The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
84
|
structure length |
84
|
Chain Sequence |
MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
PHOSPHOSERINE PHOSPHATASE RSBU
|
publication title |
Functional and Structural Characterization of Rsbu, a Stress Signaling Protein Phosphatase 2C
pubmed doi rcsb |
source organism |
Bacillus subtilis
|
total genus |
37
|
structure length |
84
|
sequence length |
84
|
ec nomenclature |
ec
3.1.3.3: Phosphoserine phosphatase. |
pdb deposition date | 2004-08-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08673 | RsbU_N | Phosphoserine phosphatase RsbU, N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | KaiA/RbsU domain |
#chains in the Genus database with same CATH superfamily 2J6Z A; 1SV1 A; 5C5E A; 1Q6A A; 2J6Y A; 1SUY A; 2J70 A; 4G86 A; 1R5Q A; 1Q6B A; 1R8J A; 1W53 A; 1V2Z A; #chains in the Genus database with same CATH topology 2J6Z A; 4HEH A; 3WHP A; 1UZ3 A; 2I2X B; 1R5Q A; 4G86 A; 1K7Y A; 3IVA A; 1QTE A; 1SV1 A; 5C8D A; 4JGI A; 2PBI A; 1K98 A; 1W53 A; 5C5E A; 4M0M A; 1BMT A; 1UTU A; 1SUY A; 2FMM E; 4HH3 C; 1SLY A; 2J6Y A; 3M1M A; 3H20 A; 1V2Z A; 3L9T A; 4X8Q A; 3BJD A; 1Q6A A; 1QSA A; 3BUL A; 3EZX A; 1Q6B A; 1R8J A; 2J70 A; 3IV9 A; #chains in the Genus database with same CATH homology 2J6Z A; 1SV1 A; 5C5E A; 1Q6A A; 2J6Y A; 1SUY A; 2J70 A; 4G86 A; 1R5Q A; 1Q6B A; 1R8J A; 1W53 A; 1V2Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...