1W5TA

Structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
403
structure length
394
Chain Sequence
GLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSTTLFRLAPHLPADRLIEVVDNIIQAKMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Changes Induced by Nucleotide Binding in Cdc6/Orc from Aeropyrum Pernix
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Dna replication initiation
molecule keywords ORC2
total genus 140
structure length 394
sequence length 403
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09079 Cdc6_C CDC6, C terminal winged helix domain
A PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1w5tA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w5tA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w5tA02
3BJ6A 1OXSC 2UXNA 3RVBA 2RHMA 3B2EA 3V7RA 4AKEA 4CEHA 1CRPA 1XZPA 1Z0JA 2DPUA 1SQ5A 2VSOA 4C0KA 1EGAA 2VXZA 1W7PA 3U7GA 2W57A 1E96A 2ZVQX 3EZ9A 3P4YA 4HQMA 1W7AA 2DK8A 1MO4A 1MH1A 4U02A 3VX3A 3KZYA 3JAMK 4FWGA 4CIDA 1O3SA 2PX0A 1L7VC 4PO8A 3KFWX 1R0WA 2Q9BA 4H9GA 4NL4H 4PAOA 2WJIA 3WTSC 2CL7X 3PVSA 4BFYA 5L3BA 2IYRA 2WMOB 8OHMA 2XSZD 1BC8C 3CM0A 4DXAA 3QENA 2JLZA 2PCLA 4LG0A 4HF1A 2GDJA 3K9GA 4M4SA 4V0MA 4N9IA 2MA3A 3IRRA 1OXXK 1TQ2A 4MYHA 1B4AA 1WXQA 3BC1A 2GJ8A 4XIGS 5FOVA 2ZETA 4WWCA 2MMGA 3IIJA 3GMTA 4RD2A 3V4FA 1CEEA 3OV8A 1R8SA 3I8XA 4I7HA 2H18A 4OL0A 4O0MA 2OQGA 1BM9A 4I2OA 1FLIA 2B8WA 4II7A 3ZGXA 4DC9A 4B3CA 3V7CA 2BBSA 1G4AE 2KB0A 4KIGA 2ZROA 1XGSA 3G73A 1T3SA 1G17A 2RGEA 5KPDA 2JA1A 1R58A 3MWMA 5FOUA 1W36B 4GYGA 3FFAA 1E2FA 1J0RA 3KCCA 5LHIA 3GFOA 4I81A 3RYPA 1T0HB 2ZRAA 3L8YA 4G0NA 2F6RA 4HZIA 1EFCA 1KJYA 3KB1A 4HB0A 4IXNA 4RS8A 1Z7UA 4N9HA 2JASA 1XTQA 2BEOA 2O0YA 3AKDA 1IN6A 1ZNXA 3B1VA 1DBSA 4CT4B 2AXLA 5HLGA 3NEJA 3NWJA 3TAHA 4YMVA 1TF5A 4O6JA 2CJWB 2GZHA 3W6OA 5JS7A 1XGOA 3U7FB 1XD2B 1U2WA 1B0UA 1XX6A 2BIFA 2VF8A 1G5RA 3LWNA 3LVRE 3L82B 3VR5A 1G20E 5KSYA 1FYKA 2PZEA 3K0CC 1V3FA 1R7RA 1XTIA 2WAXA 3C15C 2N42A 2W2VA 3L2OB 2HFHA 1K79A 3EPJA 3AF3A 4RJLA 3NBZC 3RANA 4DLYA 1ODDA 4JYBA 3C14C 3AVWA 3I4PA 4XVQA 4A5NA 1MO3A 2H5EA 3UANA 5AUOB 1D9XA 4EAQA 2P5TB 1TTTA 3BD9A 3F8NA 3AVPA 5E8GA 4HB3A 3DKVA 3TQCA 5EXPA 2L01A 3A58B 3EPKA 4DLRA 1BI0A 4PFSA 1B59A 3G5UA 4JSTA 4ZI3A 3T5DA 3QF4B 1YFHA 4URZR 2OM2A 2FMXA 1GWNA 5K8UA 3F0TA 2V6ZM 4OU0A 1E1RD 1OW3B 4LJ5A 2EYUA 5CB8A 1R0YA 3L7WA 2KWIA 4HUQB 1T6SA 4ENMA 2HR3A 2F43B 2FJUA 3VU9A 1R1TA 5J6XA 1F60A 1VPLA 3CNOA 1A04A 1XMKA 4WXHA 1ZINA 4LHVA 4CXFA 2C78A 1SKYB 4JL6A 3VHXA 2OBLA 3I1FA 4EJSA 1HKTA 2GCOB 1VMAA 2DZOB 2C99A 3M6AA 2D2EA 2HJVA 4BAYA 2VEDA 2DT5A 5FUXA 4A0FA 2H16A 1FZPB 2NPIA 1G7TA 2ZMEB 4LGWA 1UBCA 4OQLA 2JIZA 3L00A 4R9UC 4TMVA 2WOOA 1G64A 3AAFA 4A12A 1J8MF 3TDZC 3GD7A 3MAAC 2D7DA 3JW4A 3OEHA 2E7XA 2J1LA 1L4YA 1W44A 2IK8A 4HZUA 1IHUA 5EE0A 1I1SA 4FMCF 1W0JD 3SE0A 4ZKDA 5KUTA 4OHWA 3VHLB 4Q4AA 3BWDD 1G9XA 3RRNA 3CPEA 3WXMA 1E2JA 1K8RA 3WTYC 4CHUA 1N6PA 1RKBA 3U6BA 2MBFA 1ELOA 2AL7A 5KNCA 5JSZB 3MCZA 1XPOA 1Q21A 4Q7MB 2O8BB 2O3FA 3REGA 1KKMA 4HV5A 4Q47A 1S1CA 1NP6A 2JLRA 4GZLA 5G40A 4M71A 2C9YA 4BLRA 4DLWA 2HCJB 3WGHA 4OYHA 1WCV1 1XJ0A 2GZAA 3D31A 1P4WA 4I1SA 4H0EA 5D3QA 5KDDA 4L9SA 3KQLA 4PQFA 2BOVA 3ECCA 5ILUA 4AYTA 4CW7A 2JPBA 5C18A 3AVTA 3HUGA 1MDMA 1OIVA 2AKYA 3OIUA 1PLLA 3A8TA 1VIAA 3RJPA 2N1BA 1YTYA 1VIYA 2ZMEA 3QKSB 4RCYA 1YZLA 2FH5B 4QGHA 5DN6A 2RMKA 1MJAA 4ZZDA 3WTUC 2GNOA 4B2LA 5LPNA 1LEBA 1ZIOA 4JLBA 4PHGA 3F21A 5EE5B 1JPJA 2BV6A 3HU1A 2A2ZA 1M1YE 1FQKA 1KZGB 2J7PA 4A6DA 3SQXA 4N0BA 2YKGA 1RW4A 5SZIA 1FPMA 2J5OA 2VHTA 5KYKA 4US2R 3HOTA 3KKOA 4TQ9A 4V0ME 1BOAA 4ZCIA 1UJ2A 2JRTA 3B78A 1GL6A 3AF2A 4Z51A 1Z0DA 4WX9A 1CJVC 4HDQB 2O8DB 3U2RA 2GJKA 3L09A 3KTAA 4JT2A 4PO1A 1HEIA 4NCIA 2C96A 1XZQA 4FWHA 2PEXA 2WMNB 4B8XA 3AGQA 4Z1MD 5TDHA 3UWKA 4IXAA 5L3CA 2EJRA 1P75A 1SKYE 2BHRA 5FTLA 1FY7A 1D9ZA 2DBYA 1WRJA 1HQCA 3WNCA 2QMOA 3W9YA 2DPXA 5HTKA 5KTYA 3BFXA 4D4LA 3CX8A 1O7LA 1NN0A 5JHHB 5FOSA 1A2BA 4IRHA 2G0TA 4WW0A 1AKYA 1HKQA 2J5PA 3MJRA 1TTYA 4D4MA 4EM0B 1A5TA 1DAGA 3SXYA 3QPWA 2JLSA 4L9WA 2YSRA 5J4YA 1ZU4A 4FINA 4RD3A 1ZUHA 4C0SA 2E1RA 2O5VA 1VYTA 2KIFA 4TYPA 1D2NA 1Q1BA 2EK5A 2K5UA 3CF0A 2WWIA 1OKKA 2QAJA 4Q1CA 1MJ9A 3O6BB 2QRNA 1Z08A 4S2EA 3I5YA 4JK1X 3FB4A 1E4YA 2V6IA 1P60A 3M0EA 5H6RA 4KFRA 3U9GA 3F22A 2VTKA 4LHZA 1KMQA 3RWOA 1GAJA 2P6UA 2OZUA 3I5UA 1SXJA 2W6JA 2CJWA 1IRFA 1DAKA 2RGCA 3FHZA 2Z43A 1H9GA 3JSPA 2DHRA 1D6JA 2QTFA 4DDWA 1LDDA 4URXR 3H2YA 4P31A 3KE2A 4EM2A 4JJKA 2QSZA 4LYJA 2HOEA 3OHMA 1GKIA 3GO5A 1YE8A 4CEJB 1G3TA 2ZXUA 4WF2A 1N25A 2BJWA 1F2UA 2GEUA 3HRSA 2JATA 3U3MA 1Z3IX 4JS0A 4C0HA 2COMA 1COWA 2Q8KA 2XROA 4HAYA 4R79A 1T3HA 4YDSA 2XXAB 3VTKA 1ZREA 1GRNA 2J9RA 2Q9AA 1ZAOA 2VBWA 2ZI7A 3QI2A 4FIDA 5CYOA 1E9SA 3ZDQA 3UPUA 3V4RA 2IT0A 3QKRA 1TNDA 2V3CC 4R98A 1XD9A 2CGPA 4D81A 1LDKB 4JKYA 2G88A 1J90A 4GMDA 1RUNA 1WBDA 4C7OA 1G21E 2F5CA 2PBRA 3CTAA 3K8YA 4DCTA 1D8JA 3THXA 1I27A 2AWNA 4AKHA 1SFXA 1R2QA 3D5LA 4TYWA 1HXDA 4RAYA 5JR3A 4Q48A 2QVOA 4M72A 2FPLA 2QMEA 1E0JA 1ESNA 1W7PD 1WKMA 3HHGA 1W4RA 4N3NA 4MGIR 2PLFA 1KSGA 4C0LA 3TGPA 5FBRB 4GGGA 4LLNA 5DYGA 5CYVA 2ERYA 1JI0A 3NC0C 1SXJB 2P5LC 3SU8A 4Z54A 4W9MC 5CIWA 2HYIC 4P55A 4XLPF 3AJIB 4IHTA 1FOEB 1T98A 2WOJA 2OG2A 4C0JA 4UXJA 1V4RA 2GVDC 3MWJA 2WV9A 3W3ZB 4L16A 5JS8A 1PLJA 1LY1A 5FPYA 3ZD7A 2QPTA 1XP8A 3E6DA 5D6FA 4RD0A 1ZHFA 3E1SA 2Q6TA 4RKFA 5D3MA 1PVOA 1T8UA 2JAQA 2FZ4A 4LI0A 2WKQA 4EGYA 3MAJA 3TOBA 2XNSA 1ZARA 1EXMA 2PJPA 2OAP1 5L3QB 5L3SA 1XCMA 1FYMA 1I2MA 1KI7A 3LA2A 3GLGA 2CCJA 4C0QC 4MDFA 4FCTA 2V1UA 2JJ8A 1VTKA 3TSWA 1E0AA 2MLKA 5E4FA 3WMGA 4CT5A 3ICEA 1PUEE 4PHHA 2IA2A 2E1NA 1ZMXA 1JAHA 1GTVA 2VP9A 4LMYA 2ZNZA 1CULC 5EUQB 2VO1A 3AUXA 3PEVA 2BMDA 4FWIB 3FMIA 4YLGA 3H3ZA 5C4GB 1NHAA 4PSAA 4F38A 2XKOA 2ZO4A 1I5ZA 3LW7A 2V6CA 3LFUA 3EXAA 4S04A 5DD8A 1P61B 1P9WA 5EZ5A 5KDLA 5LD2C 2VE8A 1C1YA 1FMJA 1XJQA 1U6GA 3NHBA 4NCHA 4DCUA 4MDEA 4AIIA 1T0JB 1CF7A 1CP2A 1OHHD 4JVLA 4LJ8A 1IAQA 2CW0F 1VG0B 3TSZA 2IJLA 4A8JB 3NDBB 1XMVA 3R4KA 1GL7A 1QBJA 1ONVA 1DVRA 1DS6A 2WJVA 4QG7A 1SVKA 4QGAA 5IDVA 2AS5F 1CR2A 4BFUA 1J2JA 2Z99A 2BV3A 2NTYC 4EJSC 1X1RA 3I59A 1YKSA 621PA 2WTEA 4RZ3A 5HZKA 1P6RA 1F2TB 3F8FA 1A4RA 4V02A 2WBLC 2RCNA 3KFVA 1U94A 1QF9A 4ETSA 5AONA 1MO5A 5F2EA 5FPKA 1S3JA 2QQ0A 1VCNA 1XFAA 1DDNA 1E99A 1KI6A 2W58A 1OSNA 4URUR 2R44A 4D6PA 4ITRC 3ML6A 4CYMA 4MITA 2KKOA 3QU3A 5EP4A 1EG7A 1KNQA 1GOTA 2YNMA 2J7PD 4YMUA 2WJJA 1E2LA 3KLOA 2VHJA 2Q0OA 1BMFA 1YZUA 2QORA 5GVRA 1GZSA 4KJZA 4PCQA 4WBSA 3TW4A 4IJAA 2OBMA 3J80Z 1CR4A 2C9CA 1XN7A 3RS4A 1QHHB 4DIEA 3NTUA 2GZDA 3MUFA 1NMXA 1K5GA 1N0WA 1KU2A 1G7CA 3MWKA 1EH7A 2ZYVX 2PT5A 2EFOA 1XCGB 4LV8B 2WWYA 4AURA 4RGSA 1OIWA 3CKLA 4LHYA 1VTNC 2ZE8A 2JLQA 3EC1A 5GJWC 1KIMA 2WWWA 4JLMA 2L3DA 2YR2A 3O8DA 3MG9A 4AK9A 5BYKA 1XDBA 1N3BA 2XITA 4PZLA 4F7ZA 4OQFA 4XJXA 1N5KA 5L3QA 1IRGA 1KJZA 4HW0A 1JJ7A 2KI5A 4BZPA 1GKYA 5FI0B 4BGDA 1IXCA 2GETA 3GZ6A 1EV7A 4YFKF 4BZQA 1IQPA 1X8LA 1IXSB 2NPFA 1P2FA 5AK0A 3AF0A 4BLTA 5CYPA 2Y0MA 4LWZA 4B44A 1B6AA 1ZG5A 2RGAA 2ZEJA 3K9NA 3C7KA 4NZYA 2B92A 2DYKA 4XWOA 3GFMA 4XSZF 4RGRA 1HH4A 1PJRA 3NVAA 5EE1A 4ARZA 3SC3A 1XRJA 3FVQA 1GP2A 1OH5A 3K0SA 2Q3MA 2GQQA 3FE2A 3D6TB 4OOIA 1WRBA 2IC5A 4P9UA 1HW1A 2EA2A 3BIFA 1LB2A 1NLYA 3I3SR 1KZ7B 4NU0A 4GP6A 2YC4C 5L3EA 4TTQA 1GNRA 3RABA 4W5HA 3MD0A 3T1VA 2IA5A 3WTZA 4ZO4A 5KPJA 1HE8B 4D80A 4EJUA 3T06B 2C5LA 1FX7A 3CX6A 5J8CA 2G9NA 4C3ZA 3WYGA 1JEDA 1KQ8A 4C9BA 2QUFA 2L4AA 1K78A 3BB3A 3A36A 2EFEB 1S7AA 1CKEA 3F6OA 1GITA 2PEZA 4TT3A 4PC6A 1BI1A 3JAMZ 1AGPA 1FX0B 3AH8A 3A37A 3B85A 2ZE6A 2QQBA 1II8B 2AWOA 2V7QA 5CVUA 4G6QA 4IOKA 4B6FA 2PJRA 5FLXZ 2WVJA 4K46A 1VCOA 2OUKA 1ZUNB 3FMSA 2ZAMA 4M9ZA 1L0OC 3M8EA 1LF0A 3BOSA 1KO7A 3SS8A 1WSUA 1IF1A 3ECHA 3HRTA 2BEJA 2H6CA 4KLNA 2H1LA 3T1TA 2DFKB 4UNSA 1FSHA 4EM1A 3B7GA 3AGPA 3KXIA 3QPVA 4Q1BA 3FMQA 1CBUA 5AJZA 2D06A 5FOWA 4C0AC 2NO6A 3TVDA 1USSA 3LAJA 3IQXA 4DSNA 4HQEA 2VOOA 1ANKA 2Z3YA 1Y3AA 3T15A 4NHJA 1XTJA 3FTQA 1N0UA 3AUYA 2CL0X 3V9PA 1G3YA 3U2QA 1VYUA 1KY3A 3LA3A 1KAOA 2HXYA 4TMTA 4MGKR 1YZNA 1EX6A 4L5JA 2A5GA 4BUJA 1P3JA 3T5GA 1K6MA 2ZRMA 4G5OA 3LSTA 3NDPA 5FR2A 1N6KA 3HU3A 2F5DA 2GXQA 2VC1A 1S0UA 4M9QA 4Z2YA 4LV5B 3Q8XB 4XBFA 5DUIA 2H94A 2LF8A 2OAQ1 2EYQA 4O3MA 2ZJ2A 3GW2A 4ESFA 2PG4A 1UBFA 2ZI9A 1UM8A 2VHCA 2ZS8A 3K0FB 4MRNA 1SHKA 1Z28A 1WA5A 2PMUA 1E2PA 4BRWA 5IRCD 4UJ5A 3QPHA 1ZD9A 2MH9A 2KE5A 2UKDA 3BJAA 4M21A 1SZPA 3SN6A 3K70B 2DW4A 1IJEA 1ZG3A 1X3SA 4BEBA 2XZLA 2GXGA 1NNEA 2A61A 4IRUB 1ZLJA 1LVAA 1TU3A 2RGNA 4QL3A 3EA5A 3UMRA 2QROA 3ABUA 1KU9A 4TYYA 3A4MA 3TH5A 4WXPA 1XPRA 1XDSA 4C0BA 3GJXC 2H09A 3GUDA 2GK6A 3ONWA 3AF1A 3LRPA 4LRSA 4RZUA 2FBIA 1G3RA 2LSOA 2CVFA 2GCNA 3MCAA 2SHKA 4KVAA 3F8BA 1Z0KA 3EIEA 4OQXA 4AWXA 3J81Z 4DT1B 3WGIA 2NNNA 1XEXB 1OR7A 3ZVRA 2M5WA 4HDOB 4G5QA 1XEWY 1XGNA 2I3BA 4Q03A 1R1UA 1OFTA 4HLDA 1P62B 3DZDA 1UHWA 3VKGA 4GO1A 2G7HA 5HKKA 4P0TA 5K8IA 3R0AA 1UEJA 4I1VA 4C30A 2XJ4A 1YO5C 4JSYA 3QU6A 3WGGA 2D74A 4MEXF 2VP4A 3CX7A 4TTPA 3Q9LA 4ZIRB 4BFXA 1W4CA 3AVUA 4HX8A 3AVVA 1XXHA 1KU7A 1T5LA 4EIWA 2VLIA 2VP0A 3K0AA 4DLUA 1J2XA 3GXOA 2ONKA 3RS3A 4DUGD 5BW8A 4PAMA 5A2QK 4M9XA 3VR2A 3ZMTA 5JHUA 1E1RA 3KKPA 5H68A 1RPZA 2VRWA 2FE3A 3COAC 2UZIR 3QF7A 3HTSB 3T1OA 3FXQA 3X1WA 1DPFA 2ZPTX 2DPDA 4A0HA 2FPMA 1GRRA 2ZJAA 4GSYA 3PV0A 5E7JA 1IN5A 1ZW6A 2XB2A 1NLZA 4DVGA 2HKXA 3N2IA 3QE0A 5HVQC 2NRAC 3MFYA 4P4SB 3GFJA 1G291 1RJ9A 3LY5A 2GEDA 2OCAA 2R7DA 4NPHA 4LJAA 3AVXA 3B02A 2OLKA 3JZMA 4H1VA 4AC9A 1OT3A 2WICA 5HKKD 3GEHA 1YG2A 3I72A 3VKHA 4UNRA 5SZJA 4I1OA 2BCJQ 4HI0E 4BASA 5ICEA 1IY1A 2IHYA 4L9TA 5J47A 1XPUA 2E7WA 4RKEA 5CDFA 4I0AA 1P2TA 1JNYA 1KNXA 5EP2A 2GESA 2PBIA 4GL2A 1H8ED 1C1KA 2ZRHA 1QHNA 1UEIA 2STWA 3L9FA 5AIQA 1X37A 5IT9Z 3CRVA 2BE5F 4B33A 3LDAA 1UF9A 3CR7A 2FSHA 4DB2A 1TNTA 4L9VA 1DPUA 2Y48A 2H6BA 3KP5A 3TUIC 2QWWA 4A0YA 3O8RA 3TR5A 1OB5A 3BAFA 4OHVA 1YHNA 4EJTA 1D3YA 1W4MA 1KJWA 1D5CA 3HYTA 4PHFA 5KNBA 3LA7A 3RPQA 4A6PA 4LPKA 1JEEA 2RHDA 4FCVA 1Z2CA 3TNFA 4RGXA 1P2UA 2IYZA 4XD7D 1G8FA 1ZGAA 1GSIA 3TRFA 2XAJA 4JQFA 2IYSA 3TO7A 2Z6VA 4DWJA 1TQ6A 2MMCA 4Y13A 4BE7B 5FPHA 4TZ6A 4QGGA 5K5QA 3ADKA 4RB2C 3CO7C 1E2XA 3MMPA 1G3WA 2A3SA 1EFTA 2P6TA 2XOKD 3BRWD 1W5TA 3QBVA 4POAA 2CSOA 4R2IA 3SEAA 3UIEA 4BECA 4U5XA 2HDNB 4FN5A 4TSFA 5L8VA 4NP6A 3LWFA 4S35A 3SJZA 3GZ5A 2VP2A 3EZFA 3VX4A 5DN6D 2FRHA 2HYFA 1BC7C 2XTMA 1OV4A 3GP8A 1ZM2A 3VAAA 1CRQA 1TQPA 2GZWA 2JSCA 4OBEA 2OD5A 4QHSA 5HOOA 4MYTA 1U8YA 4ASUA 1FBUA 2ZANA 2O03A 3IKVA 5L3RA 4PZYA 4GITA 4TV7A 5DE3A 2CHQA 3QP6A 4LOAA 4HLUA 4MQBA 4NCNA 1OYYA 3IKTA 4Q9JA 5B58C 4PGHA 5HS9A 4XH9B 2IS1A 3A6PC 2OILA 4Q1AA 4KFUA 3RS7A 1RC8A 2BBYA 2ZITA 1BIAA 1W1WA 1RNLA 4JYCA 4HLXA 5DUKA 5CIQA 3KQHA 1NF3A 1J70A 2RGGA 1DARA 2MSCB 4ESVA 4NYMR 1G41A 1ZNYA 5EP1A 2PFBA 1FTSA 4YFXF 1LV7A 4QWQA 2X77A 3PEUA 4X8OA 1CR1A 1TU4A 5AUNB 4U0VA 4OMYA 5E17F 2K86A 1O87A 2QM8A 4X8MA 5JLJA 4E03A 1PUJA 2OXRA 3W6PA 2OFWA 2P6NA 3BB1A 4F92B 3ZD6A 4AKGA 2DLLA 2PLYA 3B1YA 3GJ5A 3K09A 4JLPA 1DADA 4AY2A 1FL9A 1ULYA 3VB2A 3K70D 1TUEA 2F3RA 1WMSA 2G6BA 4UKDA 4G94A 5JWOA 2VODA 1WWXA 1S9DA 1ZN2A 2HF8A 3T1BA 4NCKA 3KP4A 3KB2A 4JT4A 3U6KA 2P7VB 4YDHB 4OK3A 4Q1FA 1FUKA 3I58A 3ISPA 5KSZA 4KFCA 1QBKC 1XGMA 1QRAA 4HLCA 3NXSA 2XAFA 3CH4B 4HZUB 1IN7A 1A7JA 2J0VA 3NBXX 2NO7A 2PZFA 3LX5A 4PPFA 3RNLA 4ZV4A 4EQQA 1SHZA 3ERED 3KQUA 3THXB 4PX9A 1DE0A 1E2HA 1HY3A 1TQDA 1N6IA 2O52A 4OIPF 2Z5FA 3FHTA 3RKXA 3DOEA 3RS5A 1G6NA 1TQMA 2GXSA 5A5GA 2KBEA 3DZ8A 3PEWA 3FF5A 4UUVA 1ZNZA 1NSTA 2HT1A 4EPYA 2DFNA 3IC7A 2QTHA 1WB9A 5FGMA 1P4AA 3IGFA 2D1VA 2QI9C 2VL7A 5IK2D 4FHTA 2HUPA 3C16C 4DLZA 4OK5A 1NN3A 3SDZA 2ZBKA 4MGRA 2IYYA 1E6CA 3HP1A 5L3GA 3SYLA 1OXUA 2P65A 4I09A 1NIJA 3ND9A 4JJZA 2IX3A 1ZC3A 3LBIA 3QXJA 4OQNA 4YMSA 4KAXA 721PA 2FGJA 4A6EA 3X1XA 2JLYA 3Q85A 1JQLB 1G5PA 4JLJA 3K69A 3MWYW 1U78A 1G19A 3B9QA 3HPQA 3EZ6A 2WIAA 4KSCA 4B2IA 1ZRFA 3P9KA 3WU0A 3VKWA 4M0LA 3RWMB 3V8JA 2HV8A 5IT5A 3ZJYA 2ORWA 3TW8B 2NMVA 3RSLA 2L54A 1K6OA 3C41J 3RPUA 4I4LA 2OU2A 3CF6R 5EE9A 2HEIA 4RB3C 4EMSA 3VFZA 1QO0D 3I4LA 1L2TA 4ESBA 3IQWA 4Q1EA 3REFA 1XEFA 3AM1A 4HZFA 1R5GA 2NS0A 5HE9A 1IBRA 4BLSA 2VSFA 4YMTA 1IM2A 2O0KA 1YZGA 4HUQA 3DEFA 1SD6A 2FEOA 3F3XA 4MQVA 4TLAA 2IXFA 3ZS8A 1B9NA 1U90A 3B5JA 2X0LA 1XB2A 4BQAA 4GCVA 1EFUA 3BE4A 5EZ6B 3X2SA 5D8KB 2A9KA 2HTSA 1JB1A 4A5MA 1LW7A 3HOSA 1XWIA 1QHSA 4KN7X 1G3UA 2MSEB 2ZJ8A 4TLEA 2DK5A 2PZGA 2GF9A 1P7CA 3HYIA 5C1BA 2JCSA 2NZ8A 1TADA 1BN5A 1O3QA 2VOPA 2ZU0C 5E3HA 1EFRA 1YR9A 2Z9OA 1ZD8A 2Z83A 3KKNA 3T61A 4AYWA 2J0UA 1O7FA 2VN2A 4Q7LA 3ZMSA 2EW1A 2XTZA 4B76A 3J7AO 4NYJR 1AZSC 3U3RA 2Q0HA 1GRQA 2GJSA 3SZRA 1GILA 3KKMA 3ZN0A 1QZZA 1V43A 2ZJ5A 3KJIA 1KDTA 3CUQB 5K8LA 1P5ZB 1Z6YA 2HLDD 3QPTA 1LS1A 1ZIPA 2DTRA 1CLUA 4IRIA 5HCNA 3QXCA 4OI0A 3OAAD 3CPJB 1M8PA 2YOFA 3FMRA 1E1QA 3LH5A 2FV8A 4Q19A 3H92A 2QSYA 1KY2A 1TQ4A 1Q57A 2BKEA 3RDIA 1GUAA 4HAXA 2ZXJA 1LNWA 4WXDA 5ILSA 4XD7A 2ATXA 1KQ9A 2J3EA 1DO0A 4UJ3A 3BJIC 3VEPA 3DPUA 2O8FB 3I64A 3GEIA 4UXIA 3BPVA 3V8LA 1ZJ6A 2PL3A 5TMPA 4NMMA 3Q72A 3FWEA 3TAUA 1BO6A 5H8WA 3IDQA 5KO2A 4OIRF 2QZ4A 4DJTA 4L5BA 5J4LA 3D7MA 4MKFA 4GXOA 3JSOA 4RD4A 2ZYUX 2K7LA 4TMKA 4Y17A 4DDVA 1R5HA 1TW2A 5LRRA 1QZXA 3GJ3A 4K8OA 4PZZA 3QNUA 1WF3A 2ZE7A 3E5QA 1F5TA 3AVQA 4MNUA 4PANA 2J41A 4HA8A 2OO7A 3OAAA 1H8HA 2K4JA 2FE4A 4P5OA 1BOFA 2VBXA 2O61A 4EGZA 2NAZA 4JLNA 4LDJA 3VR6A 5IT9K 4DCSA 1TBXA 3CUQA 4WK8F 1MD0A 1WDTA 2TMKA 4YQFA 3DPTA 4Y15A 3MJHA 3TUJC 3I0TA 5LEJA 1G3QA 2ZU6A 2A69F 3L0IB 4HV6A 1BIBA 4KFSA 3K1MA 4MKIA 4TL6A 3UMFA 4DBLC 2FSIA 4D2IA 5IHPA 1AA9A 4X8HA 2OFXA 5DH9A 2LWIA 2ZSDA 4Q21A 2O8XA 1WQ2A 4UNOA 1NY6A 1HE1C 1ZCAA 2ZRFA 3MWLA 4GP7A 4QBIA 3CRRA 4ZDJA 1QHYA 4WCGA 4MHGA 4U7BA 3ZP5A 6PAXA 1I4LD 2H92A 3B60A 5F9HA 2C6YA 3IBYA 2AK3A 2VSXA 4KI0A 1Q3HA 3EPHA 1P9NA 2OZEA 2YYZA 3IHLA 4LJ7A 5CVRA 2WWXA 1JE8A 2YOHA 4NONA 3GLHB 5KU1A 2ZSFA 2ZE5A 1CGPA 2IYWA 3CR8A 3DKPA 4P9FA 4MGZR 1S4QA 1E2QA 1IY0A 2ZIAA 2F2EA 3L0OA 4JBAA 1R5BA 1M2OB 4U0YA 3OEEA 2LKPA 1AGRA 2MH2A 1Z0FA 3I53A 3ABTA 1TPZA 3JZAA 3M4YA 2CNWD 1M6NA 3LLMA 4R7ZA 3GQBA 121PA 2ASEA 1ZGJA 3LXRA 4PSVA 5AJVB 4A0ZA 3IRQA 2HTJA 3P27A 2IL1A 4QJ5A 3TR0A 3M8FA 2ETHA 1G6OA 1FT9A 2FBHA 2GXBA 1I4DD 2G3YA 2QU8A 3LFKA 1IN4A 1M7GA 2QGZA 4YC7A 5C46F 2CYYA 1UDXA 3MEXA 1GKUB 1TAGA 1FPQA 3CWQA 2R3SA 2ISZA 1NI3A 3GEEA 1USTA 4F93B 4L8GA 3RLFA 5CJPA 2FMYA 5ICFA 2YWHA 2V1DA 2ZUCA 4C2TA 5HLIA 2XZPA 2E87A 2KJQA 3UXMA 4Y0VA 3BH6A 3ZMVA 4OINF 4KMFA 4ZDKA 1FP7A 5GVSA 5CK5A 2E9SA 1OXTA 3IPYA 1Z0IA 3I8SA 1HW2A 3ASZA 2VT3A 3M1IA 1W36C 2JEOA 2DFIA 3NEYA 3GLFE 5ELXA 4CGZA 1T6NA 3U5ZB 3WNDA 5CITA 4QJ4A 5CB6A 2UZ3A 2QN6A 3ZLJA 2WJHA 4CZZA 3FDIA 2M1BA 2A5YB 3NIBA 4FT8A 4Z8YA 1YVDA 3FPAA 2QBYA 2YX4A 4PPQA 3D0SA 2Z33A 2AHOA 2VE9A 1P2SA 1YZKA 3OFNA 2R9VA 1HV8A 1ETUA 2IXEA 1COWD 2LKCA 3ZH9B 1RIFA 1S3GA 1MRNA 1GL9B 2AKAB 3BS4A 3PENA 3PUVA 2RGDA 1W36D 3GYHX 1F5NA 4TLDA 1R5NA 1ZM4A 1FP1D 5CM8B 1AS2A 4H1UA 1HKSA 1NLFA 1T38A 4GMXA 2CXXA 1Z6XA 1CF4A 3EA0A 2I1VB 3CBQA 3MZYA 2YHSA 3AQ4A 2IHBA 2W6ID 3DVLA 1LVGA 3CRMA 3NBYC 3AP1A 4HB4A 5CLLA 1ZBDA 2ZRDA 3OF5A 2Z5UA 2O8CA 1LB1B 2D7CA 1NVMA 4LK1F 2BYVE 1D2EA 4QC2A 2JT1A 3T35A 5B30A 4HAVA 4QJ3A 5FI1B 4MUBA 1MOZA 4DDUA 2IXGA 4ILEA 4B71A 5AUPB 1PZNA 2D4HA 4PC2A 3V4GA 2NO9A 3MFKA 2EFHB 4M1SA 4M1MA 5C2JB 2G1KA 4DDTA 5J4HA 4LRTA 4AIHA 3SHFA 4D25A 4FX4A 1XTRA 2GF0A 4IRGA 1L3LA 3WP0A 1WE2A 2F9LA 1JJVA 1LJ9A 2WHXA 1L4UA 1TUIA 1NBMA 1C9KA 3CNLA 4YONB 4QRHA 2A5FA 1W49A 1Z07A 1G7SA 5LEKA 3SQNA 1E98A 1E69A 1UAAA 5F9FA 2C2HA 2ZRLA 1Q1HA 4PC7A 1R36A 3GLGE 2ATVA 4PTLA 3OOPA 2V1XA 3HR7A 3DKWA 1AQUA 2WWGA 4IVPA 2BBTA 2FPKA 2R6DA 1Z5ZA 4LPSA 3GVAA 5EEHA 5JJLA 1G3IA 4GYIA 1E0SA 2XAQA 3CO5A 3GPLA 1J59A 2D62A 1UCRA 1H9TA 521PA 5CJ2A 2IVMA 1W2HA 2X2EA 3B1XA 4Q4ZF 4OHXA 3P20A 2FA9A 2EA4A 3NRVA 2Y8EA 1NKTA 3K2ZA 1UPTA 3GWZA 2NYXA 2NGRA 2EFWA 5DO9A 1XCPA 1RYFA 4DLXA 3P1JA 3E2IA 3R9IA 5FUVA 4AKIA 2ONJA 3IO5A 2DWZB 3ZMZA 3ZIAD 2P4WA 2ZJYA 4HDVA 3D3QA 3THOA 4LC0A 3Q5FA 3QY0A 3W8RA 1G18A 1DAHA 3DDCA 5A0FA 2QNRA 4IHQA 4N0DA 1TX4B 4PC3A 1QG2A 5J40A 3R9WA 3KXLA 4BWYA 1X86B 4R71A 1MKMA 1Z1DA 3WG9A 1CJTC 2FFQA 4QXAA 5HE8A 4L5IA 4BYYA 4TL8A 1N6NA 3C5HA 1F4KA 3GJ7A 3I32A 1XCVA 3KEOA 1ON1A 2L4MA 2IA1A 3KP7A 1R10A 2FFBA 3KX2A 2AXNA 4A0GA 4B3FX 2JDIA 3KXKA 3R7WA 4HLUC 5E8IA 1P4XA 3BK7A 2FX3A 2QAGB 1XXHE 1ZRHA 3GFTA 1AM4D 5AJYA 3VFDA 4B73A 5E1WA 4TL7A 5BQTA 2FDCA 4KT5C 5LBIA 3K1NA 3EC2A 3NQOA 2LF7A 2H57A 2O8FA 5K5OA 1V5WA 1J75A 1TEXA 221PA 3AP3A 3CZQA 4BHCA 1FW6A 4NYMQ 3VR3A 1J7KA 4E07A 2O6GE 3E5UA 1NSFA 3CO6C 5DYMA 1E4VA 1S8FA 1T91A 1RE0A 2V7QD 3THYA 2ADUA 2NG1A 1YS6A 2W0SA 4RZ2A 1P4SA 4XLNF 4D0LB 3TE6A 5GADl 3MQ0A 1G8GA 4PZJA 5FFMA 4CEIA 3RIRA 5AWFC 4Q9IA 2CK3A 1T4GA 2ZUDA 3X1ZA 5HR5A 2QP3A 2X1VA 2YOGA 2CVHA 4PAQA 4CEHB 2W83A 5JCPA 3SQWA 3ZVNA 3R9XA 1CU1A 2IYUA 3OESA 5F1RA 2R8RA 4Q02A 3QSYA 2TDXA 3NH9A 1DELA 3EUHA 1IJFA 4JLVA 4YFNF 5FPTA 2YWFA 1Z2AA 3SHWA 2P0EA 1KDOA 4NCJA 4U7DA 1SVLA 3L43A 4GI7A 3W8NA 4B75A 3ROUA 4ACBA 2V9PA 1YW8A 2ODNA 4BLPA 1P9RA 4BFZA 1ZVQA 2R7FA 4QNMA 2QT0A 1XSXA 4US1R 3PQCA 1DTSA 1G5TA 4URYR 3ADDA 2XGXA 5BQ5A 1OHHA 4LYHA 4UNQA 3SI7A 1YS7A 2BGCA 4WAUA 1YW7A 1U98A 1O3YA 1XD8A 3MGCA 1JECA 4GOJA 1GNQA 4IDHA 4KCGA 2XTNA 2GA1A 2XUBA 5TJJA 1NIPA 5EP3A 2RC4A 1DAMA 2AR7A 2XB4A 3BROA 3AF4A 4OJKA 4MEYF 4Q18A 2MD5A 4IW3B 1BI3A 3RDPA 4ZZLA 1DEKA 2CLSA 4A82A 3L2CA 2ZJOA 4QGFA 3FMOB 1PLKA 3DOFA 4KICA 4JVMA 2HS5A 1SMYF 1RI7A 3I5XA 5FO5A 4PO9A 1Z6TA 4A3VB 3IUYA 5E1XA 5FL3A 1JR3A 1MV5A 3VR1A 3SBEA 5HDNA 2D2FA 1GHCA 3FKSD 1TF2A 1G4DA 4B6EA 1VG9B 3DL0A 4J0QA 3CH5A 4KBFA 1OF1A 4ZCLA 4A0RA 5JRJA 3TBKA 1M74A 3K53A 1EK0A 3IPXA 4FMDB 1E9RA 2KSQA 5DYIA 1VECA 3E6CC 4PXAA 1QHGA 2FMLA 1WBBA 3M7GA 3WTTC 5BPIA 1D8TA 2B7CA 2ODWA 3IIKA 1XMIA 3O8BA 1JHHA 1T2KA 1US8A 3KQNA 2ESNA 1Z83A 5KHOC 1OPXA 2ODBA 2DAOA 2QAGC 3LXXA 1YQAA 3RS2A 2QZ8A 1YLFA 1YRAA 4XSXF 3EIQA 2QM3A 4JZKA 2A68F 4DSOA 5D4SA 4LLGF 3R20A 2JJ1A 5FR1A 2CCKA 3CB4A 3ZIAA 4KYWA 4XOIA 4KN4X 3PUZA 2XZOA 5JWRA 3NBFA 5JI6A 2EFPA 2EVWX 3EDPA 4LJ4A 3FM5A 1NKSA 2DWOA 4M1YA 2ZSAA 1LS6A 1X8JA 5E7IA 3KW6A 2GA8A 4KIBA 3OIYA 3Q9SA 5HCIA 2HYDA 4PQYA 2XAGA 4B34A 4Q9KA 4E22A 1KSHA 5JWHA 3UG6A 2AX4A 1H8HD 4DQ2A 1KK2A 4RFSB 1JALA 4G9YA 1JGSA 5D6EA 4TMWA 4LBZA 5FFXA 1E2IA 1JXMA 3DV8A 4KO8A 2DZNB 1W7PB 4R8HA 4NYJQ 3J80K 1AIPA 4O25A 4AYXA 2A5DA 2J0SA 1GXPA 3HRMA 2FXAA 4EJVA 2NNYA 1VG1A 4OI1A 2A78A 5D4RA 3WYFA 2ZCWA 2JJ2D 4LYAA 3KP2A 2EFNA 5BMZA 4MRSA 4QOSA 4ASUD 3R8FA 2CQKA 2PN6A 3FHOA 4I99A 1SULA 1ZM3A 3QVVA 5JSZA 1XTKA 5DDGA 1EFRD 2V6JA 2BM0A 3F3YA 4IDNA 1E79A 4Q7KA 4CVNA 2IF2A 3CUEF 4B3DA 3NHAA 1DPRA 4RCZA 3IEVA 3C3WA 3O47A 3THWA 2EQBA 3W5JA 3HTUA 4IEEA 3Q5DA 1XBTA 2DB3A 4TZ0A 3QOPA 3I54A 2FU4A 4JLDA 3WTVC 1FQJA 3E97A 3VOEA 3BBPA 1NMYA 1QHIA 2CL6X 4O2LA 5BN4A 1OH7A 1XXHB 3ELKA 1N2CE 1DAIA 4JMPA 2QPAA 5D5XB 3DMDA 2FSWA 1X3UA 5DCFA 1KI2A 2ZKZA 4LB6B 2HDCA 1R0ZA 2XNDD 1SVSA 1SVMA 2GAOA 3W6NA 5FBVB 2WSSD 4D0GA 1UHMA 1P92A 1FOKA 3IWFA 5EE3A 5JI2E 1F2UB 4AI6A 4PR0A 3E5XA 1HT2E 2Z4RA 2A07F 1GVNB 1AS0A 5BYJA 5ILVA 3WU1B 1JXSA 3EYYA 5JMTA 2VC0A 3GLHA 4L18B 2G83A 1O3RA 1RJ9B 2K02A 3DPLC 2CG4A 1KMHA 2GKSA 2QP9X 3C5CA 3QKRB 3QXHA 4RSGA 1C4OA 2IT1A 1E9CA 2GILA 4OK6A 5CM9C 1T3LA 4A4DA 4DRZA 4CEIB 3K1PA 4C2UA 2DFTA 2ZVPX 1ODFA 3X1DA 2A6EF 5TXGA 2A30A 1Q1QA 3QQ5A 3DF8A 5AR1A 4ZH4F 3TJZA 3ZYCA 4JLOA 5JBQA 1M7HA 4MTEA 3R0JA 4OJQA 5LB2A 4BRUA 4G7HF 4EJSB 3LAPA 1QZYA 1KO8A 1YZTA 2WSSA 3TSOA 3K70C 4FW9A 3ZN1A 3OEHD 2AD1A 3CPHA 3QPUA 2IWRA 3GLGB 2OEPA 2PT7A 3A1SA 4TT3D 3BJOA 1FYLA 1FFHA 4TLCA 2FA5A 2ZJZA 4Q4HB 5JJKA 4Z8XA 1ESMA 2ZQ5A 5CJ9A 4LK0F 3BPXA 2CNWA 2QAGA 5SZHB 5HS7A 5KK1A 2BEKA 4AD9A 3E5HA 4GOXA 4KSBA 1KI9A 2F43A 5FBLB 3VU9B 1RRCA 4KDPA 3L0SA 4UVAA 4FMCB 4ERNA 3N97A 4WXRA 1OPCA 3GFIA 4D82A 821PA 1S7OA 2QYOA 5FTMA 2W0MA 1NVWQ 3OIVA 4ARZB 2XKPA 1TF7A 3A4NA 2QLZA 2O0HA 5ED4A 1F1ZA 2DI3A 5E20A 4X8LA 4HAUA 1YZQA 4EPWA 2PH1A 2GAAA 3H1TA 3K9TA 2J59A 3KJGA 4G5GA 1UADA 5BN5A 3ZVMA 3GF2A 3OIWA 2DVWB 4A8JA 3U60B 2XJ9A 1SFUA 1E3MA 4NKRA 4JLAA 1W48A 4Q1DA 3U44B 3EASA 3TGNA 3T8RA 3V8KA 2UVQA 4D4JA 2REBA 1EESA 1HT1E 3CF2A 5DEQA 5LHHA 2W2TA 3QVUA 1KU3A 3LVQE 1SAXA 3I59B 4RVCA 2CHVA 4QNRA 1TQIA 1Z8FA 2QL6A 1RYHA 2P3SA 3PJRA 4L0YB 4ZYEA 2R65A 4JBWA 5JZVA 3UKDA 1JHFA 1ZH5A 1LNZA 3X1YA 1VCIA 4EPXA 3C18A 2RKHA 2OCPA 2HZTA 1ZRCA 1ONBA 4MTDA 5FD5A 5IK2A 1XB4A 1N5IA 2A7QA 2V9VA 4V0LA 1BMFD 5GJBA 2ZYWX 2PI0A 1KQ0A 4MYUA 3S1AA 1XMJA 1RIOH 4QBHA 5A4JA 4LD5A 2W00A 2FNPA 2LCFA 2IEYA 2NZJA 4GZMA 1KGSA 4JN6A 5C4MA 3H4MA 3VQTA 1MZBA 3ULQB 4QKQA 1Q20A 2NO1A 5AIPA 2WZQA 1E9AA 2ZI5A 3U7HB 1LQ1A 1AN0A 1XEWX 4HX4A 3HJNA 5L3FA 3MRSA 4G7OF 3GFPA 4QFMA 2UWMA 4MRRA 3NH6A 4KVGA 5M04A 1QNTA 1SD5A 3SZTA 4LYFA 4P4UA 3SJAA 4JBYA 2CFXA 4KIFA 5H20A 5BOXA 3DMNA 2B21A 1AJEA 2J45A 2QRZA 5DIFA 4BHPA 1U5TC 2CE2X 2F1IA 2VQSA 3AEZA 1EWQA 1S96A 1MR3F 1ZG1A 5CK4A 3N2EA 2OESA 4GT1A 2M45A 2ZI3A 4HSEA 1IW7F 2EV0A 3F8CA 2C98A 2N46A 1Z6AA 3AKYA 4DKXA 1NBMD 2WWFA 2Q3HA 4AD8A 1QHHA 5TRDA 5FD6A 2BKUA 1NRJB 2X8AA 3RKWA 4FMBB 3BY6A 4WZBE 3DXJF 3B8HA 3RRZA 2GEVA 4DCVA 2GWHA 2FQ3A 4E5UA 1UBGA 3R8CA 1SXJC 1R8QA 4CF7A 6Q21A 5CVIA 3FZVA 2J0QA 3PUWA 2ZTSA 1H8EA 2ZS7A 3JVUA 4Q7JB 3S1AB 2EV6A 2RGBA 2Z4SA 4MKHA 1YJ5A 5DCMB 1T39A 5LBQA 4LJ6A 1SVWA 3RI4A 2G0NA 3W6KB 2H8KA 4LV6A 4BXUA 1X1SA 4JBXA 4RZXA 5E18F 4W5WA 4A8JC 2EU8A 1XD7A 3PUYA 4EJWA 1U5TA 2WKPA 4ENJA 1E2KA 3B82A 1U0HC 3NEUA 2UXXA 1Q3TA 1OB2A 1LDJA 3CLVA 2PMDA 1E2EA 2QE7D 4HLYA 5BN3A 3WHLA 4LRWA 1J8YF 1CXZA 3K0CA 2J5XA 2ACJA 3OEED 4FCWA 1VCMA 3T0YA 3GJ0A 1S9HA 4IFEA 1JR6A 1BYIA 2HT6A 1DAEA 3QXSA 4DZZA 3HSRA 1ZD1A 1F2TA 4IDPA 3FXUA 3PFIA 1CS4C 1E1QD 1B1BA 2VHQA 3REOA 1H0MA 5J8FA 1HURA 1CR0A 2F9MA 4L4UA 2J7KA 2PMKA 2FNAA 1WP9A 3AB3A 3H84A 1J9IA 4GFDA 4F7WA 1D2MA 3GLFA 2DCUA 1G8PA 1Z0AA 3TKYA 4E09A 1UBEA 4OI4A 4LBYA 4YMWA 4XSHA 2DR3A 4A36A 2C04A 1Q22A 1IXZA 4M1OA 5LGTA 2BBOA 3F8TA 3PUXA 2WTUA 3SFZA 1KK1A 1IAWA 4HDCA 5DHFA 5GJVC 1R23A 4BHBA 4B3GA 2G7UA 3GFLA 4HEJA 1KO4A 4PPNA 2FEZA 2ERXA 2ANCA 4PPGA 3P4XA 3RTRA 4P4SA 1KI8A 4ZYHA 3THWB 2M8EA 1ZAKA 2WPDD 3LNCA 2A3RA 4G01B 1II8A 4BLQA 1G4UR 2GXUA 2PEYA 3BGWA 4Q01A 3PG5A 4TYQA 2IS2A 4M6YA 2OBNA 2GHIA 4RB0A 3DO6A 3FFBA 3QG5A 1GXQA 3WMEA 3ZQ6A 5KSOA 1ZLKA 5JEDA 2CWEA 1D5VA 3LLUA 3B13B 2ZM5A 5ICCA 3H86A 3A4LA 3SNHA 1A2KC 3ZZUA 4L9JA 3P32A 3DQVC 4JL8A 3ADBA 4F4IA 3LO5A 3F8MA 1B23P 3F72A 3DM9B 4TLBA 1OMIA 2FEMA 4GPTA 2QUZA 4Q9HA 4GRAA 1KOFA 3QJYA 1KK0A 5EXSA 1Z22A 3GLFB 4IHSA 4ZDWA 2CO5A 2V4ZA 1JAIA 1PP8F 2P7CB 2FU5C 2QMHA 3CONA 4IVNA 3EWSA 3PQKA 1CJKC 2J87A 2WKRA 4QHYA 2R62A 2ZRPA 3LAWA 2ZAOA 5DISB 4LB5A 3HU2A 3WMFA 1NN1A 4JL5A 4B32A 2OSBA 5EXXA 3UMSA 5JFRA 5K8TA 2O8EB 2O8DA 4HB2A 2CE7A 3Q9VA 1OLOA 5H70A 5B64A 3CJNA 2K4BA 2CDNA 3KKQA 4XSGA 2C77A 4WOPA 2ZR9A 5EQTA 1X6VA 1N6OA 1W46A 3K0FA 4KV9A 1MKYA 4UXHA 5F3WB 2REXB 2GCPA 3BXZA 1UB9A 2HKOA 4G3XA 4DT1A 1E2NA 4URVR 2GVZC 2FOLA 1XMSA 2XV4S 2ZSEA 1QVAA 2I1QA 1Z05A 3NKVA 2PQ8A 1SD7A 2WSMA 3BH0A 3CLOA 1FWZA 4LFUA 1GDDA 1HYQA 2OE2A 1BIFA 2QBYB 2IA0A 4UNNA 2CBZA 4OHYA 1UKZA 5HDKA 2BMEA 2IYXA 1BKDR 3IILA 4BFTA 2IBMA 1G1MA 2B8TA 4B43A 4B3XA 3GEZA 2YWGA 3EZ2A 5H6QA 5K5RA 2VONA 2AD5A 3QEJA 2YU3A 3R61A 3K1JA 5CVJA 2EB7A 3R60A 5KVRA 2DWPA 3FXRA 4WZAE 1YR6A 4A92A 2W24A 4TWZA 4RD1A 3RC8A 2GJAA 2DBBA 3E3VA 2QGNA 2W6IA 2ZSBA 4TL9A 5D5WB 1FBSA 2F5EA 4CZ2A 1GFIA 4HX7A 3BFVA 5D8LB 4FI3C 3EARA 1VG8A 2XGJA 1BI2A 4V0NA 4KA4A 2OXCA 4WIAA 4ZIRA 1HSJA 1GG2A 2JLWA 1K5DA 1LF5A 4ASNA 1FP6A 4P96A 2NQ2C 1WQ1R 3OFND 5DHAA 5TV2A 1YW9A 2M87A 4DSTA 4IVQA 1G16A 4Q66C 3WTWC 5HS8A 3ND8A 4HUTA 4UQOA 2VA8A 2OLJA 4K81B 2ELHA 3HSFA 1KSJA 4QBFA 2XAHA 2HYGD 3OE7D 4EPVA 5FTKA 4LHXA 2V55B 4OI2A 421PA 2BWJA 1RUOA 2VP5A 3M9AA 4TN1A 4Q9LA 5CDFE 1W2GA 4ZYDA 5GJCA 1FP2A 3VR4A 5L3VA 2OFOA 3KP6A 1TNSA 1XU4A 2AFIE 2ORIA 1IUYA 4FXPA 4KITB 1P72A 3QF4A 1XSVA 2OQRA 1OH6A 1RRGA 1Z63A 2BBWA 4PSKA 4A15A 2EWWA 5HPYB 4UHTA 3PCRB 4FX0A 3PQJA 1KKLA 2CLDX 5ANRB 3QRFF 5DCMA 1SXJE 1SVIA 4LK2A 3L8ZA 4D26A 5F64A 4LY6A 4ZPXA 4ZKEA 3RS0A 3HSEA 2VBYA 2BVNA 5FLXK 3VLFB 2LNBA 1KTVA 4R1HA 2Q2EA 1XNJA 5AJWA 1F48A 2MC3A 4AWXB 2ESHA 4P4TA 2REOA 3ECOA 3B1WA 3TQNA 2DQRA 4O2RA 4TSFD 4EDHA 2QEQA 1W0JA 4XTCS 4WVFA 1F9NA 3E6BA 2XIGA 2IW3A 1REPC 2R2AA 3CNNA 3U3KA 4OMZA 2FBKA 1Z9CA 1DG3A 3TLXA 5FBQB 1N6RA 3U61B 1G8YA 3QG1A 2Y75A 3TDUC 1T5IA 3K09C 2QE7A 2V54A 4M74A 4A2UA 2XSZA 2IS6A 1E2MA 1EFHA 1QGPA 3I71A 4M9SA 1A82A 3ZZ0A 4Q4JA 4LCBA 4RAZA 1E0KA 1TMKA 2Z0MA 1XCBA 5J4VA 2CEAA 1AWCA 3EZ7A 3SZPA 4EFLA 1KMHB 5J5CA 1EWRA 4LJYA 1E17A 4LX0A 4Q00A 4NQWA 1BS1A 3L0PA 1UKEA 5LB4A 2XAUA 2XEXA 4UV9A 1N6LA 2B7BA 2HJGA 2JZYA 5JHGB 3MZHA 1F3OA 2LDUA 1EH8A 2ZRBA 5DV5A 3ZPLA 2DFLA 2V8OA 3V00A 2X2FA 3ASYA 5IT3A 1JR3E 2WJYA 4JIMA 4RFVA 4RB1A 3A1VA 3FWYA 4MYCA 4HAWA 4P3YA 5BPDA 2BCGY 2YX7A 1S3SA 4IKEA 1NL3A 5BXQC 3LQQA 1K78B 3F5FA 4DIDA 4XVUA 5KOYA 3K9HA 2D2WA 2M30A 2W25A 2E1CA 3DP7A 2ZR0A 2GWRA 2OV2A 3RSOA 3IHWA 3RRMA 4AIJA 2IYQA 1NBME 3VNUA 4BFSA 3GLIE 1OKRA 2OCBA 4QBGB 2C9OA 1JPNA 3GLIA 1JQJC 2BDTA 4M22A 1BJAA 2YPRA 1ZM7A 2GBLA 3QKUA 4Z1MA 4K2EA 4F91B 4TMXA 4W5JA 4C4PA 4DB4A 2ODEA 1XJCA 3G3ZA 3FKSA 5FB2A 1MABB 3HYRA 1O57A 1QDEA 4U0WA 5CVVA 4G6DA 2Q9CA 1C0WA 1KI1A 3KTAB 3NC1C 2WWHA 3KZ1E 5E95A 5FOTA 2HQRA 3MHVC 2IRFG 1Z6GA 1ZYUA 2FGKA 3Q5EA 3IEUA 4A6XA 5E1ZB 1Z91A 3BORA 4XWAA 4OIQF 4EFMA 4IDQA 4I98B 2OA4A 1TEVA 4BFVA 2P5KA 3WNBA 2OHFA 2V79A 4MQ9F 4KODA 3ZZTA 1S8NA 3U1DA 2IUTA 3ZQ7A 4AVPA 4RD6A 3EETA 2RNJA 2F55A 1FZQA 1E2GA 2WJGA 3N5CA 4V0OA 3VMFA 3FKQA 2ZRJA 1HQYE 2OAZA 2FZLA 4CYDA 5SZKB 3QIAA 3WY9A 3U44A 1QPMA 3KDSE 2UZKA 1YIOA 1II9A 1KK3A 4BPBA 2WPDA 3K9LA 1ZRDA 2OT3B 1AS3A 5FUWA 4A0XA 3LA6A 4B09A 1KAGA 3TUZC 2PX3A 3EYIA 2GBLC 4ACAA 2YVUA 3T5XA 3QP5A 2HGCA 3CWZA 3R7WB 2IS4A 2XASA 2QG6A 1UFQA 4WA7A 4TYNA 1S6LA 1N6HA 2FSFA 3W3AA 2ZRGA 4IOJA 1YRBA 1RZ4A 3KUCA 4N0EA 2QENA 1Y63A 4XWKA 5TVKA 2R6FA 1MT0A 1W47A 1ZC4A 4KXFB 4M2LA 3RAPR 2QQ9A 3IHUA 2EFCB 3EAQA 5J4KA 1R6BX 4CO8A 2DO7A 4MA4A 4NH0A 4MKGA 3CDHA 4A2QA 1SXJD 2W6JD 4U88A 4UNPA 1U99A 2VT2A 3J81k 3B1ZA 3AKCA 1NJGA 2VBCA 3BZ6A 3FHCB 3IIMA 1XD2A 5IF9A 5UKDA 4CDGA 1ZM9A 3ZS9A 1KO5A 3CRQA 1E32A 2ZRKA 5DI3A 5E7MA 5LLQA 1EH6A 1OFIA 4O5VA 5FFZA 3BH7A 3TIFA 2YC2C 4MRVA 1X8KA 3K0AB 1GM5A 2CCGA 4PC1A 1L8QA 4LSGA 2BJVA 2QY9A 4EVIA 3A1TA 3AV0B 3MSXA 4NYIR 4TTRA 4TMZA 3RYTC 2A6HF 3TK1A 1IY2A 1G3MA 2CHGA 4G8XA 4G5SA 4RFSA 1ZNWA 1T0FA 3I62A 1E79D 5EEGA 3BDDA 3BFKA 1LTQA 3QKTA 2CLCX 4FMDF 3D8BA 2L0XA 1D8KA 3WE2A 4ENNA 1XTSA 3I61A 3JTHA 2C03A 4M1KA 1CTQA 3SBDA 5ERIA 1OIXA 1FNNA 1Q12A 2QQEA 2R6GA 4IVRA 3WBKA 2AFHE 4M73A 1AZTA 1O3TA 2ANBA 1DOAA 3BERA 4WZ6A 1R4AA 1NN5A 2VF7A 2FN4A 2XVCA 3E6MA 1Z47A 4HAZA 4HYYA 4KFTA 1DP7P 2QPOA 5JI3E 2HXSA 2EWVA 1G3SA 1W4BA 3HRUA 2I4IA 3W6JB 3KJHA 5TB5A 1AKEA 5D3MB 2ZR7A 3CRW1 4HLQB 1KYZA 3RC3A 3VODA 3BP8A 3TOAA 1U5TB 3ZMDA 1HBXG 1CJMA 2WAYA 4M53A 4LLLA 1U9IC 4AG6A 5LD2B 2ZRNA 5DLQC 3HDTA 1JR3D 1MJBA 4OIOF 5L3SB 3ZVLA 3U4QB 2RDPA 3SYNA 3GJ6A 5EUMA 5F6FA 5D5VB 4MRPA 3F6VA 2IF0A 4DEYA 2QTVB 2ZI4A 3U3OA 2F1RA 1G8HA 1NVVR 1QZMA 3QEOA 4EKDA 4FD2A 1FNMA 4W7SA 1N0VC 4OHZA 2KIUA 4ABYA 4HAMA 2ISYA 3GX4X 5FUYA 3AVYA 3WRYC 1OYIA 2RH5A 3WHKA 1HSTA 4KYUA 1W0KD 2GK7A 4YXWA 2OCYC 1YU9A 4B35A 4L9NA 2KBFA 1I4TD 1KHTA 1LFDB 4HATA 4EFNA 5JEEA 1U8AA 2KJCA 1ZP6A 1IXRC 3HHHA 1OKKD 1XSDA 2FF4A 1U81A 1E9FA 1J99A 1VHLA 4CEJA 2X19A 2IYLD 4P33A 2RGXA 3EG5A 2HF9A 5L3DA 2MLGA 4LC1A 1US8B 4EPTA 2XX3A 3A1WA 1UFMA 2GIVA 2KIMA 2D45A 1AQYA 3C1DA 5G3ZA 2RVCA 1BH2A 3B6EA 2WV0A 4IF4A 3B73A 3EQLF 4BNCA 3O2PE 1KDPA 2HWVA 1IZ1A 1SD4A 4ON0A 1KI3A 1VYVA 4TQAA 4KLZA 5BS6A 4FWDA 5H1YA 2L02A 3CZPA 2J0UB 4ESJA 3HWSA 4PGGA 1FSEA 3W5IA 4I01A 4B74A 1E9DA 3LV8A 2AN9A 1H65A 1ZU5A 3ETLA 5DNYB 1HA3A 1U2RA 1FTNA 3LBNA 1OFHA 2F1HA 2H7VA 4Q4AB 1W0KA 2XHKA 3PR1A 5P21A 3SFVA 2JIZD 1ZCBA 1VDZA 1HTWA 4G7ZF 3TKLA 3RYRA 3O3KA 1YR8A 1NY5A 2BC9A 4HOBA 4BEJA 5LGNA 5EXTA 3TO9A 3F23A 3H0KA 3CUQC 1NJFA 2IW5A 3WTXC 3WYAA 4YIIA 3EW9A 2P6SA 4IJMA 2IYTA 3E70C 4AG5A 1M34E 2D3WA 3TVTA 2VIIA 1XF9A 2EFGA 5BWMA 2NOAA 1BBYA 2ZJBA 1I2DA 2QP4A 4P32A 1KYWA 3J81K 3C4JA 1KYIA 1VKJA 4ZYGA 5FTJA 1ZYRF 2IYVA 3BOQA 2QMUA 2ZYTX 4ZDIA 4UVCA 3JVVA 3EIHA 4MH0R 5DD4A 1SVOA 1T8TA 3AP2A 4A9AA 1E9BA 2VH5R 1OXVA 1S2MA 2J46A 1QVRA 5ICGA 1SMTA 2GA2A 5DSZA 4DNCA 2FWRA 4KYIB 4ENKA 4AIKA 4MUAA 2P2LA 1P2VA 4B2PA 5LDDC 2P8TA 4DHEA 2P6RA 1QG4A 3VNVA 3TMKA 1ON2A 2XRNA 4BFWA 2O8EA 1N5JA 4ESHA 2G9WA 3N70A 3HPRA 4IOMA 1U9IA 3S2WA 3FMPB 1U8RA 1FC3A 5TY0A 4EUNA 2D1HA 4GNKA 3UATA 1HW5A 5AJXA 5HLHA 3MLEA 4GDFA 2FOKA 3FMFA 2A5JA 5FPSA 2FF7A 1W5SA 2FFHA 3PITA 1F6BA 2KRKA 4S05A 2JLVA 1GIAA 3WE3A 1QQIA 2P67A 4BLOA 2AK2A 4JLKA 2BMFA 4I0BA 3HR8A 2PLRA 1G7RA 2ECKA 4LBWA 1UDWA 4UV8A 1JBKA 4A2PA 1S29A 1Z6RA 5G41A 2STTA 3LW8A 4GOKA 2JTVA 1RRPA 4XRFA 2HCBA 1Q1ZA 3AKEA 3GCGA 3FYHA 2EFQA 3N4MA 4NHOA 3SJCA 3THYB 5JVTA 3GLHE 4M1WA 4V0KA 1II0A 2JLXA 2RV8A 5CLSA 1G6HA 1R5OA 1FBQA 4NBSA 1GNPA 1WI9A 2RB4A 2YZ2A 3IO3A 2B0LA 1ZUIA 2ZNYA 3C7JA 4KUMA 3EWAA 2XXAA 1SKQA 2H17A 4B3BA 3KQKA 1W4AA 1U8ZA 1B9MA 2B6HA 4N1AA 4EQ6B 5HZHA 2DY1A 3WODF 2VPPA 3U7EB 2G1JA 2R6AA 4PDKA 3DM5A 1RVDA 2EFDB 3A1UA 2GAUA 1HUQA 1KGDA 4C7OB 3K0LA 3BB4A 4G5RA 4NTZA 4F4CA 2VHUA 5CLQA 5G53C 5FL7A 3NG1A 3QKSA 5KNDA 1TLHB 2NO0A 4Q4HA 3HIFA 2C8VA 4I02A 3Q7QA 3PEYA 1AK2A 2IEZA 2QM7A 3WBJA 3U3JA 4ZCMA 4OQMA 4BQSA 2JLUA 2H27A 1TL7C 4LBVA 1AOYA 2KJBA 4MGYR 4QM6A 2G77B 2RGVA 4Q5IA 5FOXA 5HDGA 3TQFA 1P73A 4D0PA 4KNYA 4D0NA 1LEAA 2GTPA 2JDID 3P26A 3V7SA 2JJ2A 5B2ZA 2YWEA 1UKYA 2PCJA 5JCZA 1PUIA 5B57C 1R22A 2QQAA 1CIPA 3SR0A 2W84A 4NYIQ 3CW2A 2EV5A 1NVXQ 2WC2A 3FGNA 3M1EA 2GRJA 4R2HA 1XMAA 2VP6A 4UVBA 1OH8A 2CMKA 3FM3A 3LX8A 1R7JA 1SFEA 1PP7U 4YG2F 1Q0UA 3RHFA 5K1YA 2BMJA 2F7SA 4L15A 3G82C 2IPQX 3K0EA 4LG0B 3KJEA 5FL7D 3IWZA 3LBHA 3KZZA 2KRFA 4KMUX 5DI3B 2ZRIA 3R6SA 3QXXA 4XTRA 2OBPA 2ZREA 3SJBA 3DEUA 1KA8A 2VYFA 2W85A 4LJZF 1IONA 3LQRA 4KU4A 4EV0A 1KDRA 1OYWA 2OZ6A 1K7AA 1Z06A 2C95A 1DO2A 3QBTA 4Q4JB 4V03A 5DGXA 4EPRA 2K27A 3CUOA 1PV4A 1JXOA 4NB5A 2ZRCA 2RQPA 1VHTA 3UG7A 1MRSA 2LKDA 3OZXA 2FFAA 2P5SA 4NDZA 4Y0AA 1E9EA 2Q21A 2FG5A 1YYVA 1DUXC 1Y0UA 3KETA 4JVSB 4JKIA 2DU9A 4DLSA 1NVUQ 4OKSA 5JRZA 3EPLA 1KSFX 1N5LA 3P7NA 5LRSA 1CF7B 1XEXA 4DEXA 2GCOA 4PQRA 4QLCU 4L0ZB 2F3TA 4F4JA 4LZZA 3T8TA 4HDUA 1NVVQ 2DQLA 2EWNA 2GJ9A 2MSDB 1XDUA 2RGNC 5AUQA 2HLDA 4PHTA 4A1FA 1NMZA 3GJ8A 4RGUA 4IDOA 4URWR 3U4QA 4KBGA 1I1GA 5KSPA 4ZI2A 3DHWC 3P9IA 3W34A 2WM9B 1MGTA 4Q5SF 5LHGA 3Q3JB 2YINC 3WRXC 3CIOA 1DG1G 3QOFA 3ADCA 4FWTA 3QAHA 4DLTA 1P6XA 3FX3A 1UKVY 3KEQA 4B48A 2O8BA 2IWHA 5G3YA 3IBGA 3KP3A 3T34A 1KI6B 3I73A 1Q1EA 3SOPA 3T1QA 4EJOA 5F98A 5A2QZ 2JPCA 1U0JA 4DCNA 1KO1A 2IUSA 2YJTD 4IPAA 1YQTA 4QM7A 1A1VA 2RAPA 3ZQJA 2X4HA 4RY2A 5KDOA 3EX7C 5FBWB 2HQNA 3QUSA 3W90A 4DSUA 3KFXA 5FH9A 3KLNA 2IUUA 1NG1A 4ON9A 1PDNC 2GXAA 2ORVA 2IP2A 1TW3A 1OJLA 4M1TA 1NG9A 2VBZA 1IN8A 2P5VA 4BZXA 2F1JA 2BM1A 3RKYA 2ZUBA 3B9PA 2JGNA 3AVOA 1OE0A 4LUCA 4D4KA 1QHXA 3O8CA 3G0HA 4NE2A 1RZ3A 1MDMB 3P9CA 3KUDA 4UXNA 2O0JA 3IL2A 4HF2A 4M8NE 4QHTA 3GJ4A 4HYEA 2ZS9A 5D5UB 4IXMA 2F5FA 2QT1A 4CICA 1SGWA 3C8UA 4US0R 4BH9A 3ZMUA 1J5YA 1T9HA 4IFBA 3JTGA 1MO6A 2R6CA 2YV5A 3UWOA 4KHZA 2JJ1D 1STZA 3WP1B 2WIBA 1YR7A 3GLIB 2RN7A 3DFGA 1I6XA 3GLXA 1IOZA 1BYUA 1EX7A 1U0LA 1GVJA 4XVRA 4I1UA 2Q3FA 5JECA 1DAFA 3TO6A 3PIRA 4IEIA 1MABA 1M7BA 2DWQA 2FSGA 2W2XA 2XNDA 3SYKA 4E70A 2PMHA 3IKJA 4JVNA 4Q4LA 2AXPA 1R00A 3OE7A 5TARA 4B47A 2HEOA 1OFUX 5JJIA 4LHWA 4A2WA 3T12A 4M6XA 3LD9A 5EJEA 1S1MA 4G1UC 1FUUA 1Z29A 3ICQB 3UK6A 1RFLA 1KI4A 4CRWB 4YXWD 1Q44A 4DLVA 1U3EM 2O8CB 4EQ6A 3PXGA 4YIFA 5JFGA 3BWGA 1FMLA 4U00A 4WXCA 1E2DA 1R0XA 2NIPA 2QA5A 3I92A 3KL4A 4GBMA 2XOKA 5LGUA 4HBLA 3RRYA 2ZFWA 4LJ9A 4HF0A 4DUGA 1E94E 1R1VA 1FX0A 2RKOA 2PJZA 5DI9A 3FOZA 1RRFA 3H3UA 1CJUC 5FTNA 4TQUS 4LGMA 2ZI6A 4IOLA 2CK3D 3Q7PA
chains in the Genus database with same CATH superfamily
4E7IA 2FWAA 4ENSA 5CA1F 3GEDA 2DK8A 1XKXA 1U9YA 2CY0A 4MZDA 1U2TA 4KX3A 3VX3A 4JQSA 5AVWA 1O3SA 2APJA 2XSZD 2D13A 4WNIA 2O1EA 1EBBA 1SEVA 3H2GA 1TQ2A 1WV1A 4CYCA 2XKKA 4R1OA 3D2CA 2BBSA 2ZROA 2O25A 4UUNA 1W36B 2SBTA 1G9SA 4IXNA 4AUKA 4LRYA 4EMUA 3R3ZA 2WG1A 2GCIA 1UDCA 5ALNA 2BR3A 2YMLA 5KSYA 3GG2A 3A25A 2VDNB 4XVQA 3Q2OA 2HU2A 5EXPA 4DLAA 1S3IA 4JDUA 2PYDA 4C89A 1SCJA 4URZR 4FVTA 5D2CA 2C78A 1BE6A 2X0EA 3WGZA 3CW8X 1NVDA 2XFTA 2DT5A 1XZ8A 4LJRA 3P0FA 1TRKA 2DA3A 4OSEA 4R9UC 2VPQA 2VT7A 5TRTA 4O3FA 4WLOA 1JU4A 2KHZA 4OHWA 1NQVA 1CVIA 4K6CA 1XPOA 1T1EA 4NEHB 3LIIA 1EINA 4HV5A 5G40A 3S3OA 4UZSA 4AF7A 4L9SA 4PQFA 3R0IA 3SC2B 1G6KA 1IXSA 2RCYA 1FRZA 2BKXA 2JRLA 4RVOA 2WW8A 4CKCB 3U7QA 1UJCA 5LIRA 5DM70 2YN2A 2O8DB 2AMVA 1CQJB 2ADMA 3KZVA 2YW2A 4X85A 5FUBA 4M0DA 3WIEA 5AVSA 4NQRA 1JBQA 5JE8A 1TP4A 3ZY6A 5JHHB 2HQ5A 2G0TA 1JFVA 3SXYA 4UFNA 3G79A 5IDYA 2E1RA 1Q1BA 5A7GA 3FDZA 1NW7A 3C1AA 1R5JA 1V5GA 3ABKH 5F7XA 4HQFA 1TJ3A 3ZNNA 2ZXIA 1NJSA 1GPKA 2C2BA 1G3TA 4RM3A 2GEUA 3PQ3A 4JS0A 3KOZE 3NC4A 4GYKA 3UO8B 1R9NA 4FIDA 1E9SA 4ND8A 3KJXA 3R1IA 1RUNA 4WECA 4C87A 3WDMA 3TLAA 3T3PB 2I2AA 2F3QA 4BUPA 1ZUD1 1ESNA 4IHKA 1EUDA 1GRCA 2E21A 2D5CA 3NC0C 2NXEA 3E3MA 4XLPF 5FJIA 4IGKA 3JS5A 4RAOA 3MWJA 3KQWA 2AHRA 2QPTA 1XEAA 3KOYE 4RKFA 2X7JA 3C58A 2PJPA 4N49A 1KI7A 2YZNA 2IODA 1A4IA 1SVNA 1XCOA 2ZZKA 1YCHA 4R1QA 4EGCB 1NW8A 3W6UA 4DQUA 1X1AA 4HC4A 1TR8A 1ZIYA 1N4DA 5DM1A 1JDBC 3VAYA 3IX7A 1Z5OA 1E1LA 3QVJA 5IDVA 3ABOB 1JHOA 3QZUA 621PA 4WKPA 1S8OA 1KRXA 2OV6A 4C1NA 1U94A 4QU0A 2PUCA 3NHKA 5BR8B 2H2AA 3DE0X 4MITA 4KTVE 5EP4A 4BNJA 3QEBZ 1CVLA 3U4GA 5HJ5A 4R8VA 2KRCA 3OKPA 1OIWA 3CKLA 3OZFA 4LHYA 2D3TA 1EHIA 4YP9A 5I4IA 2XE7A 3FMGA 3W2EA 3NOQA 3AUUA 1N5KA 1A9QA 1ECLA 4MQLA 2EO2A 3LCJA 2CBXA 4B44A 2ZEJA 3KSJA 2H0QA 5ALDA 1XRMA 1VLHA 2H1FA 3I3SR 3TLCA 4XX1A 3OYIA 3KSRA 3OEWA 3A4TA 3AH8A 4QLBA 1E92A 3DF7A 2XT6A 1FSHA 2NVYJ 1TCAA 4RTQA 1AV7A 2NO6A 3W04A 1JT9A 3HZZA 1I94B 3PPXA 4KVFA 3S2IA 2VL8A 4M9QA 3K8OE 1F5SA 3ESRA 2GZRA 3C8HA 1O95A 1WA5A 2VRCD 2XMQA 2P75A 4JHLA 2AV6A 1VZ0A 3U7JA 4DY6A 3RE8A 4IRUB 5MHTA 4BO1A 3E9YA 1YGPA 3H9JA 2OVBA 2ZCVA 4C3HJ 4PNHA 2NNNA 4J8PA 3HHEA 3VKGA 1DKLA 4IV8A 4QTXA 4O08A 1XTPA 3Q9LA 4BFXA 5C4JJ 2FTKE 1UCFA 4JXKA 3GGPA 3EXIB 2QM0A 3COAC 2AMFA 3QKWA 5FKLA 2FLKA 2G9UA 4MUJA 1D4ZA 3A14A 1FTWA 6GPBA 3U80A 4N40A 3FRIA 3LY5A 2OCAA 1UEXC 3HLTA 3KAPA 2IV2X 1OPRA 4HI0E 4IBFA 2AVNA 2C5HA 3HR4A 4WADA 1SQ6A 1YI1A 1X37A 1VKRA 3CR7A 2H6BA 3E53A 1P19A 4Q3EA 4DKJA 3ZIDA 4RQTA 2DYSH 3EIXA 5HHTA 2GARA 2CLKB 2RDMA 4A6PA 2RHDA 3AU8A 1SZCA 4IQGA 3TO7A 3B52X 4JJ6A 4KR3A 4O4JA 2ZSKA 3RK4A 4W7IA 3RVQA 2E5ZA 3MTDA 4TVKA 2AKEA 3GZ5A 2D59A 5DN6D 2DZLA 3KXPA 2Z1DA 3FZQA 4GITA 4G26A 2XUZA 1HSOA 1K9SA 5KI6A 5FLEX 3AEQB 1DARA 4ESVA 2DFFA 4BE1A 3V1KA 4BB6A 4PCZA 4XM1A 3VPBA 4ZRNA 1Z2DA 4QBTA 2OXRA 2IYPA 5FNVF 2AR0A 4ZZ1A 1ULYA 2Z2XA 3IR6A 1QBKC 3X1KA 4ZAYA 2J0VA 3KEYA 3RS5A 5A5GA 4HNHA 4RJTA 2HT1A 1X77A 5IWCA 3LVFO 1Y9EA 4ZREA 2IU0A 5IK2D 4CCMA 1DIOB 1Y82A 3E23A 2BHNA 3RUEA 4OQNA 4YMSA 4KAXA 4G56A 4AP5A 3VPRA 1VQKI 2HQ1A 2B9VA 3RWMB 1RSZA 2ORWA 3TINA 4ARAA 4BJ5C 3VFZA 4UTZA 2NQTA 1R5GA 2VSFA 2LVNC 3M2TA 2O0KA 5B58T 3PGXA 1DGGA 2IXFA 1UANA 3RT9A 3VH4A 2ZSHB 4KQXA 4F2GA 4BQRA 2HIAA 1OILA 1E6KA 3H2SA 1K3UB 3SHVA 3EUHC 3BYZA 3NBIA 3OOEA 2LDXA 3UHOA 2ZJ1A 2WYUA 1GLVA 3OSGA 2JVKA 4QYTA 5HF9A 2QSYA 3R9KA 1VRWA 4D3FA 4HAXA 2J3EA 4WGGA 3ABZA 3VEPA 2O8FB 4BNFA 3P8ZA 4XL9A 1GPAA 5H8WA 2QZ4A 3VDRA 3U1BA 4ED9A 1NVEA 2ZE7A 2P77A 5BVGB 2Q8NA 1H8HA 1BOFA 4DCSA 1SBNE 4WK8F 2O50A 1G3QA 2JA7J 2L9RA 1U5BB 3VR1A 3L2RA 2DJNA 3MTQA 4HPWA 4A91A 5J2UB 3V6LA 2M6LA 1SB8A 3BCHA 3QMPA 4H3SA 5JYEA 5ER6A 4BJ6C 2C4NA 4JBAA 4U0YA 3I53A 3M4YA 4RD3A 4JXJA 3PDWA 4Z4GA 4LF4M 3T7AA 3CVOA 2VSNA 1NXWA 1L2CA 4WP2A 4NRVA 4Z2AA 4CCSA 1TRHA 3BIJA 4KMFA 3ZGKA 4XVHA 3CE6A 3I8SA 2DFIA 3TL3A 1M0SA 4B7HA 1R49A 1K82A 2VE9A 4WCFB 3WFJA 2Y1FA 4YCSA 5LIPA 3HXTA 2Z5UA 1D8AA 1OVGA 1AF7A 4QC2A 1MAAA 3IMFA 4BGUA 4LECA 3M70A 3MW8A 3OCWA 1EMDA 4FX4A 1X3WB 4IRGA 5JAHA 5E9AA 1C9KA 3MJ5A 3SQNA 3RC7A 1ZOLA 4PC7A 1PG5A 2HOTA 1E0SA 3OFKA 4OFWA 3EY4A 3O7WA 3BXOA 4G97A 3NRVA 3DMFA 2EFWA 1JP7A 3IEIA 2FWJA 3EGEA 5DBIA 3R9IA 3ZMZA 3OPXA 4LTMA 2Q1WA 2GERA 1C0EA 2XB8A 1BJTA 5J40A 1QG2A 3IBTA 3LQFA 1DBIA 2AXNA 3CC7I 2QVLA 2E1OA 4RQAA 2QAGB 1AM4D 4BACA 5BQTA 1FDIA 4B3SM 3H9CA 2E5LB 4LJLA 2R4UA 3INYA 1DGHA 4JR2A 4E07A 2O6GE 4WLFA 5DYMA 1LBQA 3MWFA 2B37A 1LWNA 4XIDA 3ETDA 3UJPA 4DV0B 5JCPA 4UHBA 3P9QA 5F1RA 1UPFA 4BQFA 4EHDA 4N7MA 3IOMA 5IJ0B 2QX4A 4DR7B 2KMLA 5HOEA 1FVXA 2RC4A 2XB4A 4CL2A 3BROA 2HDHA 2NVQJ 1O9HA 1DEKA 4A82A 4GQIA 1OAOC 5JPDA 2ZIXB 4JI3B 3KQOA 4ARIA 4QSMA 4KBFA 3ZZNA 2FMLA 3WTTC 5BPIA 2OF7A 3NO4A 3AUFA 4DM4A 1DDIA 2EQAA 1MB9A 5DEOA 1DJQA 2DOEA 4B6QA 3HOZJ 4FFNA 4GKAA 3CB4A 1QOZA 3E58A 4G0QA 4B4OA 2GA8A 3OP4A 2XAGA 2QU7A 4CTJA 5DIZA 1GXSA 3FVTA 3QYPA 3I6IA 5D4RA 2JJ2D 2EFNA 3BWMA 3PX3A 1NA5A 2O3TA 3QITA 1U8CB 4G1BA 1DPRA 4DZTA 3NAUA 4HQNA 2VAMA 1Q92A 1FQJA 4YV7A 4EO4A 1NMYA 1QHIA 1HFWA 4DUYB 1SVMA 1KPGA 2JFVA 4D0GA 3HSYA 3V5NA 1F2UB 4AI6A 3MF4A 3A27A 3ZJVA 2K02A 2CG4A 4O63O 4K9QA 2QTAA 3QU4A 1M72A 5GAEJ 1RR8C 4G63A 5A4DA 3LSIA 4CGYB 2AD1A 3AR5A 1PGOA 2OXIA 1FFHA 1CWUA 1E8DA 5HS7A 4AD9A 3DBLA 1YBMA 3J7TA 4TUYB 821PA 4D82A 1X38A 1RP1A 3DJFA 5D51S 5ED4A 3AL2A 1DOZA 4HAUA 1IMOA 2R18A 1W87A 5BN5A 1Z25A 3R5KA 3MRTA 3TQHA 4E3ZA 5T67A 2J9ZB 3V1UA 3VKFA 3VO2A 3CF2A 5HKBA 2FRVA 1OQAA 3PJRA 4L0YB 2R45A 1O97C 1XNQB 1RBQA 1BD3A 5FD5A 4UU7A 4RJ2A 1GG9A 4YP0A 3NYRA 5A4JA 4QBHA 1JG1A 3ORHA 3HHYA 4L27A 3ULQB 4ZOEA 5J5VA 4IHVA 3GAAA 1AN0A 1MXFA 2UWMA 3NH6A 3Q11A 4EM6A 2OGUA 1QNTA 2HVRA 1VJCA 2NPOA 3W5BA 2ZBEA 4NSRA 4QULA 1S96A 1ZD5A 1GUYA 3HMQA 1C7YA 1IW7F 2C98A 1UELB 1Z6AA 2X8BA 5KMGA 2JH8A 4I4IA 2X4IA 5KCMA 3B51X 1H8EA 3ZHQA 5LQDA 4DA7A 2Z4SA 1YJ5A 1J25A 1E5DA 4LV6A 1SVWA 4K6HA 2EU8A 2M7AA 3H5OA 3FUXA 1BYIA 4LZAA 3Q0IA 2QEXI 4COOA 3PWSA 5IYZA 1JG6A 1UFZA 4U2CA 3RG2A 4JV5M 4B84A 3T7IA 4RHUA 3DS8A 2BEUB 3BGVA 1RAGA 1UBLS 4XE5A 1Y8ZA 4BKQA 2OZVA 2ZM5A 1WUJS 3QFRA 4NF2A 5ECDA 2C3YA 1Z75A 3NUZA 4BYMA 4QTRA 2G4VA 2R62A 4LB5A 3HU2A 2QRUA 3OKCA 2QKMB 2K4BA 1IBLB 2ACEA 2NT4A 4KV9A 2EA0A 2UXCM 4OVZB 5B6IA 1B1CA 1GDDA 1BIFA 1SU7A 4UNNA 1UP4A 4UMVA 2ZWVA 3A1NA 5H0IA 3SZOA 4NX2A 4KQMA 3CJRB 4P1WA 1KYXA 2H2GA 1L7PA 5I5EA 3MKZA 1QV6A 4YJ2F 4HEQA 3B3JA 3FWKA 1EG2A 1FP6A 3C43A 4ARVA 5DYTA 4DSTA 4PZ9A 4JNKA 3HCCA 3O4FA 1RAHA 3TP0A 2IHKA 3VR4A 3MBOA 4MRAA 4HGYA 1OH6A 3IXMA 1GU1A 4PSKA 5F4ZA 3AINA 4FB4A 1QP0A 5CA1A 1SXJE 1G20B 5BN3B 2LNBA 1VMIA 1XMOB 3QU5A 2W6QA 1LFPA 1CNEA 1VMKA 4XTCS 4AIDA 4ID9A 1P5RA 1JSRA 1VE1A 4YALA 4M74A 4A2UA 3ITEA 5IP5A 2OQIA 1AWCA 5J5CA 4PLFA 1E17A 4Q00A 3DOIA 1A5BB 4NVRA 1PYOA 5ITXA 1F3OA 1QHHD 4OOFA 5ITRA 3V7WA 1MP0A 3A1VA 2J07A 2JIDA 2W25A 5CBKA 3MTJA 4QATA 5AICA 2I6XA 3PNQA 1JJIA 4UTXA 5C7YA 1CY4A 5KOJB 3QKUA 5IAJA 3V1TC 4TV9F 2WU1A 1CSEE 5CVVA 3U16A 2Q9CA 3KTAB 5KHDA 1Z6GA 3MHVC 4B1RA 4MWZA 4B9AA 3ZZTA 3VHXB 3ZQ7A 3EETA 4AU7A 1E2GA 1WFXA 2IHJA 1R64A 2C9BA 5HQTA 4CYDA 1VF9A 3WY9A 1AB5A 3DLAA 4BPBA 4L51A 4R41A 3OLXA 1YU6A 2Y6UA 4CCKA 5HFAA 5M34A 5T7BA 4G0OA 3SKYA 4HS4A 4EY6A 2R7MA 3AC0A 3FVWA 5TVKA 1H0KA 2FK8A 1OQYA 4BX3A 4MKGA 2M1XA 1U99A 2VLBA 2FPSA 1DUIA 5UKDA 4REMA 1V45E 4MMZB 1ODJA 2PO7A 2I5PO 2EIKH 1MC5A 3C3DA 1G3MA 4YRLA 4ZD6A 2W4SA 1HEYA 4ZYAA 2P0AA 3E9RA 4MJ3A 5JC1A 3HB0A 1UFOA 5H4HA 1RJFA 1D8KA 3I61A 3RPEA 1E3OC 5IKPA 3ZNPA 3GEBA 4WZ6A 2DUNA 1ZR2A 3HP7A 2OCDA 3HB7A 1QQAA 1DB3A 4UM8B 1AKEA 1ZGBA 1KYZA 4KXMA 4OXNA 1N7IA 2H3HA 5EEAA 5LD2B 5J43A 1TM2A 3G2QA 1V7CA 2F1RA 1TJ4A 3K6RA 1BOBA 1D1BA 4N4NB 5H37D 4MUKA 2OCYC 4LQDA 1XSDA 1NK2P 2Z09A 3UJ9A 3RZOJ 3ROKA 1H88C 4MVJI 1SAUA 4EITA 2PKQP 4CCOA 3B8EA 5KQGA 3KQHA 3LJKA 2NUPB 4O4IB 4LF5B 2YN0A 3MS2A 1UK7A 5H4GA 3HM9A 5P21A 3X1XA 4BMOB 2FAXA 3TO9A 4QPOA 2NZXA 4MFEA 4O6VA 2IYTA 2B8NA 4HGPA 1I2DA 1G8AA 1SEPA 3C4JA 3V7NA 5CT6A 1KIFA 1SK9A 3C45A 1R4GA 2OV3A 2JSPA 4N65A 4YJDA 4HHEA 2XZFA 2G9WA 1QFYA 1W25A 1SOAA 4QUHA 4M0CA 4TSKA 2AK2A 2VAPA 4RL4A 4UV8A 2DWMA 1U1EA 2O9JA 1AO0A 5CURA 5AW8A 4XRFA 3SJCA 3C2HA 3UV7A 1FBQA 3CRNA 1N5RA 4CLDA 4XJSA 2CJFA 2GAUA 3PDIB 3FPLA 2VHUA 1TLHB 3NT5A 3CC4I 1WXWA 2O8VA 4EABA 4D0NA 1OA1A 4D7NA 3DAGA 2PUBA 4YJFB 1D0KA 1UODA 3T5MA 4D46A 2F7SA 4L15A 4LG0B 2ZC2A 3VZQA 4PLVA 4DILA 4OQYA 1A95A 4C6SA 1UC5B 2MU1A 3DYBA 4Q4JB 1KDRA 1LUAA 3PNTA 1VRCA 3K71B 4AQYM 1W85A 1BL0A 3KETA 4JVSB 4JKIA 1PJAA 1XEXA 4RPHA 3D4BA 4BU2A 1SG0A 4L0CA 1I0LA 2F4IA 1I14A 3GJ8A 3ZVKA 1QJCA 3GZNB 2QQ8A 1AG9A 4FWTA 4PXYA 1BDIA 3K4BA 4ZO8A 3AZQA 1NQOA 4Q24A 5IASA 3WIVA 1NG9A 1X7ZB 1IN8A 2B8JA 4WT7A 4DMHA 1XAGA 4NE2A 2VA9A 3FE3A 2CU7A 3ACDA 2OGZA 4D8TA 5IC5A 2YV5A 3UY4A 1LV8A 3L41A 3L2QA 1BYUA 4XVRA 3QNMA 1XCLA 4F4HA 4YELA 5GKNA 4NH4A 2MSKA 2F4VB 4BYGA 2O1SA 5I9TA 4EB8A 1BVRA 3FM9A 4KXVA 5L7YA 4HF0A 4I8XA 4TWJA 2WINI 3VHRA 5LNK1 2NYVA 1MH1A 1QB8A 4S1PA 1T0BA 3OPYI 1R0WA 5EN