1W5TA

Structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
403
structure length
394
Chain Sequence
GLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSTTLFRLAPHLPADRLIEVVDNIIQAKMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Changes Induced by Nucleotide Binding in Cdc6/Orc from Aeropyrum Pernix
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Dna replication initiation
molecule keywords ORC2
total genus 140
structure length 394
sequence length 403
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09079 Cdc6_C CDC6, C terminal winged helix domain
A PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1w5tA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w5tA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w5tA02
4UHTA 1CKEA 5H20A 3A1WA 1G7RA 2YOFA 4HLYA 2QZ4A 1KSGA 2RGEA 2G6BA 1BN5A 1ON2A 2DFKB 1S6LA 2DVWB 2VT2A 2Z99A 3NRVA 3WODF 1TF2A 2O3FA 1Z6YA 3R8FA 3EC1A 1ZUNB 4NCJA 1Z08A 2OG2A 1U8ZA 2J7KA 4TL8A 1E2DA 3V7CA 2HF8A 4RB1A 1SD5A 1ZLJA 2GIVA 2ZRLA 1LY1A 2AFIE 3MJRA 2E9SA 1YG2A 1RJ9B 3SJAA 1GWNA 4DIEA 1ZIPA 3SQWA 3RDPA 3CNNA 2HYDA 4Q9JA 1TTTA 5FR1A 3H92A 4OI1A 2AXNA 3KFXA 4H1UA 3RS4A 2V9VA 1P3JA 4NYMR 4KSCA 2O8FB 1J8MF 2N1BA 5CM9C 1JR6A 5E8GA 1E4VA 5CVUA 3CO7C 1XGSA 1E9AA 3F3XA 3G82C 2VH5R 3Q8XB 2I1QA 4EQ6A 5H8WA 4KIFA 3THWA 5BOXA 2BMFA 3BZ6A 2Q2EA 2H6CA 4F4IA 2H6BA 2IYWA 4KIGA 4BXUA 3H3ZA 2RMKA 2XAUA 4RZ2A 3LA3A 1E2NA 4F92B 4QNRA 5AWFC 3VNVA 1FNMA 2W00A 4YONB 1PP8F 1T0HB 3NHBA 3TMKA 5LRSA 3RSLA 3ZVRA 5CLLA 2BYVE 4KHZA 4MYHA 3NIBA 2EYUA 2XXAA 2FMXA 2RCNA 3U3OA 2ZJ8A 1MJBA 4Q9LA 2PLFA 4QFMA 3ZIAD 1QZYA 1BOAA 3QKUA 1S8FA 2P7CB 1LNZA 4JJKA 4QC2A 1B23P 3MWLA 3H1TA 4HAZA 4RFSA 2J5PA 1UM8A 2ZFWA 5LHHA 4G1UC 1JXMA 5EP2A 4CYMA 4R79A 4B3CA 3THXB 4QGFA 4C4PA 2O8DA 2QQAA 4DB2A 4PC6A 3DO6A 1Q1QA 4OQLA 4BLTA 1YIOA 1SGWA 4XLPF 3JVUA 1J7KA 2MLGA 3FXUA 4HDOB 3U3RA 4YFNF 4Q7LA 1R4AA 1OXSC 4RD2A 5ICEA 1EFCA 3PXGA 1WDTA 2BMDA 3AKDA 3KJIA 1RYHA 1I4DD 4C0BA 4FI3C 3BFKA 1BS1A 3H86A 2KBEA 4IRGA 1T0FA 2QUFA 1Z3IX 5D5VB 1ZM7A 4ABYA 4A4DA 1AS2A 4J0QA 4TWZA 1S3GA 4PO8A 4AIKA 1FOKA 1RJ9A 4Q21A 2JPBA 1GDDA 4DLUA 4ESHA 1ZNWA 3O8CA 2ZETA 4FWHA 4DCVA 2A61A 3TOAA 4TMWA 4I1OA 2O8BA 1S8NA 4KI0A 5BPDA 2D2WA 2D4HA 5E4FA 3I32A 3S1AB 3ADDA 1SXJD 4Q1DA 1JNYA 4Q7JB 5SZJA 4M1MA 4H9GA 4C30A 2ATVA 2B7CA 3U7EB 4A6XA 2EFPA 4P96A 3V8KA 1JEDA 1R00A 1NVVR 4BLOA 2WAXA 2L0XA 4GYIA 4NQWA 2BMJA 4OI2A 2WOJA 4JLKA 2YZ2A 4PAOA 2PT7A 4KU4A 4I0AA 3WTWC 2BBSA 2IEYA 3LXXA 4P33A 5G53C 5UKDA 2JLXA 3TSWA 1K5GA 1G5TA 2HV8A 2RGAA 4L5BA 1HKTA 4YMSA 5FD5A 4TYPA 1KGDA 1E98A 4B2PA 3KQNA 1TW2A 5J8FA 1TPZA 4P4SA 4HUTA 1FP2A 4O2RA 4D4MA 2XXAB 1BI1A 3GPLA 2NNYA 1QGPA 3PUVA 1MDMB 4KYWA 1Y63A 3GJ7A 5D8KB 3QPWA 5HDNA 2XIGA 2O0YA 4B3BA 4M9SA 2HDNB 4D4LA 4NYJQ 5TARA 1G5PA 1Z0JA 1X1RA 2NPIA 5ANRB 4BUJA 1CRPA 5FUVA 2DR3A 2AKYA 3UIEA 4WZAE 4EKDA 4GXOA 1BIBA 4WW0A 3EPJA 2C98A 1FY7A 3T1BA 2WV0A 2FGJA 2WJYA 4Z8XA 1Q3HA 2JLWA 2J0QA 2AHOA 4MYTA 4O5VA 1G8GA 4ESVA 4ZYGA 4BECA 4UXNA 2Z3YA 5F6FA 3SZTA 2PEYA 2DCUA 2BBYA 4YFKF 2P6UA 1QHXA 5FBWB 2NZ8A 5JECA 4ILEA 3CUOA 5D8LB 1Z0IA 2LWIA 1VG1A 2IUTA 2REXB 1K78B 2IYTA 4G8XA 3TO6A 1R10A 5EE9A 4BFVA 3OAAA 2ZRBA 1DS6A 2PN6A 1U2WA 2Y8EA 5TB5A 4BFUA 3K1MA 3B9QA 4D25A 1BC8C 1C4OA 2QE7D 2O8EA 3DV8A 2GA2A 4S05A 3P4YA 2FEZA 1ZYRF 3BC1A 2J0SA 1RE0A 3DKWA 1UDWA 3GEZA 2FMYA 4LZZA 1E2HA 3GFLA 3Q72A 1WSUA 4Q5SF 1X3SA 3AAFA 2EU8A 3CIOA 2ORIA 5DCMA 2PJPA 2BCGY 2YWFA 1SKYE 3QF4B 1D9ZA 1MKYA 3M1IA 4QM6A 1WF3A 5CIWA 5FUXA 3SR0A 4Q9IA 4R8HA 3JTGA 4QOSA 2EB7A 4MKHA 1IONA 2I3BA 3OV8A 3QRFF 4P4SB 3E6DA 1GFIA 4MKFA 4MGZR 3KFWX 3A36A 5D6EA 4QKQA 1ANKA 2ERXA 2PLRA 3TO7A 2R6CA 1SVLA 3V8LA 4G0NA 3OF5A 1FUUA 1AQUA 3BB4A 1LTQA 1A04A 3WE3A 1XEFA 2OHFA 2D7DA 3C41J 5LDDC 2CLSA 4A0YA 5LLQA 2BHRA 3L2CA 1KK3A 1BJAA 1DPFA 3ZN1A 3Q5FA 4OHYA 1M6NA 2EW1A 4DEYA 2FGKA 4HAUA 4M21A 2ZYVX 2M45A 3TR0A 1W7AA 4NB5A 1VKJA 5DDGA 1SAXA 4IEIA 1ZG5A 1FPQA 4JLJA 4TYQA 3FKSA 1S7OA 4KO8A 4A6DA 4KNYA 5EUMA 1G41A 2NAZA 1B1BA 4Q7MB 4AIIA 4LPKA 2GJSA 3U5ZB 2OA4A 4B47A 1HW2A 2VHQA 2FRHA 2O8EB 1E2MA 4G3XA 3ELKA 4B75A 2J7PA 5JS8A 4G94A 2Q8KA 1FX0A 1XJQA 5DN6A 2GILA 1KQ9A 2OXRA 2OT3B 1ODDA 5KDOA 1G3IA 3B02A 2QP9X 2WPDA 5CM8B 4DKXA 4B2IA 5DCMB 2XJ4A 3ECHA 1L4YA 4V0KA 1CLUA 3C7KA 1LEBA 4ZCLA 5E1WA 2AKAB 2QMOA 2UZIR 4TT3A 4ZPXA 2PBIA 5TMPA 2G7UA 4OJQA 3TW8B 3T12A 4NCHA 4A0GA 2EA2A 4HBLA 1HW1A 3WTSC 1EFHA 2WWWA 3SS8A 3CUQA 2RGDA 4YIIA 1NVWQ 2NQ2C 2UKDA 3PV0A 5D5WB 1XX6A 4AYWA 4URZR 1VTNC 2X2FA 4JVNA 3C14C 3X1WA 2WOOA 2IYUA 2DWPA 5LD2C 4A6EA 1AIPA 3A58B 3LSTA 3SQXA 3U4QB 4OKSA 3SJCA 1HH4A 3AF0A 5KU1A 3T0YA 4ZYHA 1E2GA 4F38A 2ZSBA 1RRFA 4KITB 4LHZA 4UKDA 3JTHA 3FHOA 1R5BA 6PAXA 4KBFA 5EE3A 3EETA 4XOIA 4OIPF 4XWOA 1E0SA 1W36C 2IYRA 3DHWC 3KQKA 4DWJA 3VR4A 3T5XA 2RC4A 5FFZA 5J8CA 1Z9CA 1QHSA 4LLGF 4XRFA 2C2HA 2YJTD 4CZZA 5JHUA 1JALA 3QY0A 2J5XA 1Z28A 2OAQ1 5FL3A 4YQFA 1BM9A 1KO4A 4JN6A 3IWZA 3DXJF 4MTEA 4G7OF 1IXRC 1JHFA 2GVZC 4MITA 4HAMA 1LW7A 2OSBA 4NHOA 5CJPA 3RS2A 4WBSA 3T34A 3R7WA 2A30A 2NG1A 1F6BA 1T8UA 4EJSC 4PANA 4PHGA 3UWOA 5E95A 1YR8A 2HLDD 3CPHA 1UHMA 1QVRA 3LO5A 4LHXA 4PAQA 4L8GA 4TN1A 3VR2A 4IF4A 3MZHA 1OYIA 1BIFA 1RIFA 2PL3A 3N2IA 5D3QA 2R65A 2YSRA 3MWJA 1XD2B 1Z06A 1GZSA 2GCNA 1N6LA 3I54A 3LA6A 3AKEA 1GL7A 4BFXA 2YV5A 2XTZA 2ZR0A 3VTKA 1SFEA 1Z91A 2FZ4A 4NTZA 3AVQA 1ZLKA 3TKYA 3NVAA 1NNEA 5LB4A 3GJ0A 4FWTA 1NY6A 2V6IA 4OK5A 4B48A 1ZNXA 2MH2A 4BLSA 4E09A 4MQBA 1LB1B 1N6PA 5DV5A 3SZRA 2QWWA 1FNNA 2Y48A 3DL0A 2DYKA 3WMFA 4AYTA 2ZUCA 4NHJA 1XDBA 4TMXA 3AVYA 5BS6A 4P9UA 3KLOA 3OE7A 2P8TA 2QTHA 3QSYA 2FMLA 5HS9A 1JAHA 2ZYTX 3HSRA 5HOOA 3LW7A 1YZNA 3DM5A 4V0ME 1TF7A 1EFRD 3ZIAA 1GG2A 5HCIA 1BI3A 4GSYA 2XZPA 3RSOA 2IUUA 2L01A 1YR9A 3FMFA 4DQ2A 1UBGA 1JQJC 1SVSA 2IA2A 3C3WA 4X8HA 2ZR9A 1G8HA 5JWOA 4XSZF 1ZMXA 2REOA 3GLIE 3ULQB 5FLXZ 2F9MA 2IBMA 2QP4A 2ZM5A 4LJ5A 2KRFA 4YG2F 4GMDA 1ZCAA 2GVDC 3UKDA 2W25A 3FMPB 4C7OB 2K02A 3ISPA 4LDJA 4L15A 1JJ7A 2QQBA 4MGKR 1FP6A 4ZDKA 1JI0A 4BZXA 5B30A 2HEIA 2VF8A 1Z6TA 1FOEB 2AXLA 2FEOA 5TDHA 4LJZF 1XCMA 5DI3A 3PUXA 4QJ4A 5FUYA 5CVIA 5CVJA 2KKOA 1OB5A 1F1ZA 1OH7A 4CZ2A 4I01A 4PCQA 1N6NA 4QXAA 2QVOA 4WXCA 4GL2A 1R8QA 1W44A 2QMHA 2VRWA 1OR7A 5DE3A 2L4AA 1E2FA 2F7SA 1F2TB 2JJ2D 1R0YA 1UKVY 5EXXA 3K1PA 3BWDD 4OL0A 2RN7A 4Q03A 2EV5A 4IVNA 2REBA 2ZVPX 2HT6A 4LBWA 2W58A 1U98A 4I02A 2LF7A 2QROA 4I81A 3NQOA 2WKRA 4HEJA 3E6MA 4HLCA 3SN6A 2D2EA 3T15A 2PMKA 2FBHA 2W6ID 1W7PD 1P7CA 4YFXF 4G5GA 1N5KA 1U9IC 2VSFA 1FX7A 2DK8A 4G01B 2ONKA 4LD5A 2FF4A 1J0RA 4ASNA 4ZIRA 2IS2A 2F5FA 2M5WA 1N6IA 1NVXQ 3D3QA 3PITA 4MRNA 2GXQA 3WMGA 2CG4A 3THYB 3EIHA 2ZI4A 4BWYA 1BIAA 3RWMB 4JBWA 3GZ6A 1IBRA 4RAZA 1G3YA 1MJ9A 1T39A 2MSEB 3K0EA 1XMVA 3ZPLA 2EV6A 1MGTA 5FOUA 3ETLA 3QG1A 4RAYA 1IRFA 4ZZDA 2VA8A 4WAUA 5EZ5A 1ON1A 3L82B 4JT4A 4GGGA 2ZJ2A 5TJJA 2F1HA 4IJMA 2N42A 4NONA 4UJ5A 3U60B 3GF2A 4IDOA 4PSAA 1O87A 5GADl 1CJVC 1KY2A 3AF3A 3BRWD 5FD6A 3CR8A 5KSYA 1WI9A 1II9A 4Q7KA 2LKPA 3NXSA 5L3QA 2J0UB 5KNDA 5IT5A 2R62A 5FLXK 3L0SA 2WWHA 4LJ6A 2P65A 4NDZA 3N4MA 2OBNA 3QU3A 2PQ8A 1U0HC 1W0JA 3LY5A 4Y0VA 4KV9A 4URUR 8OHMA 4W7SA 1EX7A 1K5DA 1G19A 1YO5C 1GHCA 1F2TA 3IPXA 5KHOC 5D5UB 1OF1A 4KBGA 3KW6A 5LEJA 1IUYA 1G3MA 1GRRA 1MRNA 3QIAA 4PQRA 5G3YA 3U3MA 3ZDQA 5FBLB 5KPDA 1PVOA 1CU1A 3ADCA 2GWHA 4G5RA 4ZDJA 3BJ6A 1MABA 4X8MA 1ZARA 2XITA 1S96A 3QXCA 5TV2A 2XVCA 1OYYA 3CNLA 3VODA 1ZD1A 2KBFA 1FBSA 4JKYA 1UEJA 2P5TB 2RKHA 5LHIA 4OINF 1FZQA 1H9GA 3VB2A 2IXFA 5ERIA 4QJ3A 4M6YA 5HLIA 2ZSAA 3FPAA 1WQ1R 2XNSA 4UNRA 4ZIRB 5J5CA 2ZJBA 4N0EA 4TQAA 4C2TA 4LX0A 1NKTA 5A5GA 5KOYA 2ZI9A 1DE0A 2DPXA 2HGCA 3EA5A 5G3ZA 2VT3A 1XSVA 2BVNA 1P4AA 2JEOA 2ZR7A 4C0LA 1LB2A 4PSVA 4DBLC 2PT5A 4KSBA 5HS7A 5JWRA 4AKEA 4OBEA 4EJSB 3MG9A 1T6SA 2VQSA 1MV5A 3OEHA 3TGPA 3M9AA 1E2QA 2NNNA 4Z51A 2RGGA 3QU6A 5J4KA 1TQ4A 4B6EA 3TO9A 3LFKA 5HVQC 3LAPA 4BLPA 1NMYA 5FPSA 1LV7A 3FVQA 4HF2A 4P9FA 4R9UC 4BFZA 2VHCA 4FMBB 1DAMA 4LB5A 1AKEA 1P92A 2DQRA 1DPRA 4L4UA 3HU3A 1QZZA 2K4BA 2UXXA 4U88A 3BOSA 1G4UR 3AP2A 3TBKA 3CWQA 2GF9A 5L8VA 2BM1A 3GP8A 1W36D 1YW7A 2GJAA 2DWOA 3E5UA 4RCYA 3VFZA 3Q3JB 2O52A 1SHKA 4PC2A 1IN4A 3WU0A 5E1ZB 4EJTA 1MJAA 2KJQA 2PCLA 3EZ9A 3WP1B 1R1VA 4O25A 3EIQA 2IXEA 3VKWA 3LVRE 3F8CA 2EVWX 5B58C 3GFMA 1MOZA 1TQDA 5CYVA 2ZAOA 2VO1A 3QQ5A 4XJXA 3R9IA 5JCPA 3U9GA 1XSXA 4G7HF 3F8NA 3FFBA 5F98A 2VHTA 1J9IA 3TH5A 4F4JA 4JMPA 4WXHA 4CHUA 2QQ9A 1QG2A 3HIFA 1MABB 2GAAA 1UF9A 3C8UA 3PENA 1HTWA 1XZPA 4FX4A 2DB3A 1NN1A 2J87A 4B44A 2GJ8A 4KT5C 3GEIA 4KYUA 4NCIA 5JS7A 4CEJB 5BMZA 2BM0A 2UVQA 2V9PA 1E1QD 4IEEA 2DTRA 4IFBA 1YJ5A 2J3EA 2GEUA 3MMPA 5JEDA 5KNBA 3CF0A 3RRZA 2UXNA 3WTZA 1N6RA 1AZSC 1T9HA 3CX8A 3THXA 5F3WB 2Q3FA 2Z0MA 2F3TA 4RGXA 2XAGA 1J2XA 1YW9A 5BPIA 5HKKA 1N3BA 4B43A 2EYQA 4B74A 5JI6A 1G6HA 1USSA 2JATA 4B34A 3F21A 3IHUA 1Z0AA 5KDLA 1ZN2A 2VYFA 4TL9A 1V3FA 2MSDB 1TU4A 2CWEA 2WC2A 2ZRKA 3EUHA 2GEDA 2ZSDA 4G7ZF 1FLIA 2NGRA 5KO2A 4KUMA 2FPMA 2WHXA 1RUOA 1E9RA 4R1HA 2V7QD 3OEEA 3PEUA 3E3VA 4GP7A 5AJYA 4DCSA 4DDTA 1FC3A 2D2FA 3TQCA 2O8BB 1TQ2A 2CQKA 1BOFA 1CR1A 5F2EA 1XTRA 1IAQA 3A1UA 4BNCA 1PJRA 4K46A 4EPVA 2CO5A 2FJUA 3QENA 3AVVA 1COWA 2FWRA 2OXCA 2RGXA 4TLAA 2R6GA 4EFNA 4I7HA 2DW4A 4GZLA 3GEHA 4U7BA 2OV2A 4M8NE 2GCOA 4QGHA 1NVMA 3GO5A 5FB2A 1G6OA 3IILA 3MQ0A 4KODA 3L9FA 2IYSA 821PA 2HZTA 2RAPA 4CT4B 2JLVA 3KZYA 4LI0A 1ZRCA 4C0QC 2ERYA 2F5CA 3FOZA 5JMTA 3BPVA 1OKKD 1SQ5A 3K53A 2QORA 3N97A 4LJ7A 1MDMA 4UNNA 5AONA 3GLHB 4EQQA 2FSFA 5D3MB 1E9EA 1I5ZA 2IW5A 2I1VB 4P0TA 3DP7A 2FSWA 1XMJA 2ZSEA 1PP7U 3JSPA 4EM0B 3I71A 4IRIA 4CEJA 4Q18A 4HSEA 3BXZA 2PI0A 4L9SA 5FPHA 1KI1A 1H8ED 2FSGA 3ZMDA 1ZNZA 3QNUA 2ZE8A 3TQNA 1LFDB 4FMCF 2ZQ5A 4LV6A 5D4SA 2WWGA 1DAEA 4BRUA 3EYYA 4TQUS 4L0YB 1GSIA 2QT0A 1R8SA 4EV0A 3RS3A 3CZPA 1YR7A 2XAJA 4U0YA 4YMTA 3AP3A 4KFTA 3FXRA 4WZ6A 1HSJA 3DOFA 3GFTA 1A2KC 1F2UB 1ONBA 3I72A 4Q4ZF 1ZGJA 2ZANA 2RGNA 3ERED 1G7CA 1K78A 2CNWD 4U02A 4TT3D 2Q21A 4EPWA 3GJ6A 5K8LA 2YC4C 1W46A 3BS4A 4M1KA 1J5YA 2K5UA 4W5HA 1JJVA 3VX4A 1D8TA 2WPDD 3MAAC 4CEHB 4HLDA 4OJKA 2FF7A 2XOKA 2HJGA 1WA5A 2N46A 3OE7D 5EXPA 2VN2A 3T1OA 4AI6A 4TTRA 2FXAA 2G88A 1XCBA 1G7TA 2B7BA 3HP1A 3WBJA 4ASUA 4A82A 4U00A 2KIMA 3GJ4A 1B6AA 4Q48A 2XOKD 3TAUA 5E8IA 2JLSA 2XNDA 3IWFA 1T5IA 1U94A 2ODEA 5GJVC 3R0JA 2GCOB 4LJ4A 4A0ZA 1ODFA 2WKQA 4B33A 1T5LA 2IS1A 5CJ2A 4FX0A 5EP3A 3MHVC 4ZCMA 1RYFA 4EVIA 2QBYA 4GZMA 3QG5A 4A5MA 4IXNA 5HCNA 2BBTA 1R5NA 3F8TA 2STTA 5HE9A 3PQCA 4JYBA 5AUPB 3U3KA 2KE5A 2JA1A 3KTAA 2W83A 1FYKA 1BO6A 4JVLA 5D3MA 5GJWC 3ICEA 3SBDA 4P4UA 4FT8A 2COMA 2PJZA 2CYYA 3SZPA 2GAUA 2A68F 4HDUA 4LG0A 1EX6A 1GL9B 1OH6A 4BFWA 2JLRA 2ZS7A 3QEJA 4O0MA 4RZUA 1CEEA 2L54A 1YVDA 3PQKA 1YZLA 2Q6TA 2JT1A 1KSHA 1VCMA 4JL5A 3ZS8A 3RIRA 4Z1MD 3KE2A 5JRJA 5FO5A 4RB3C 2AR7A 2W6IA 1ZIOA 1RFLA 5E1XA 1YRBA 2CVHA 721PA 3EZ2A 3V4RA 5CLSA 2ISZA 1TAGA 2RH5A 1XBTA 2W0MA 5C2JB 2ZI7A 1M2OB 2CFXA 2PX3A 1YS6A 3LVQE 3RPQA 3FGNA 5JR3A 4I09A 3SDZA 1IAWA 1QRAA 2VHJA 2QPAA 3VR6A 3E2IA 1KA8A 4R7ZA 4ZI2A 4M53A 2VIIA 3PG5A 3CJNA 1DAKA 4Y17A 2CVFA 3RJPA 5CDFE 4CEHA 4GI7A 3IEVA 3ND8A 2VE8A 2ZU0C 1LQ1A 2ZRCA 1NVVQ 3ZMTA 4UQOA 4LRTA 3ZS9A 4ETSA 5AR1A 1YZUA 2O5VA 4US2R 2IA5A 2VTKA 4IKEA 1OB2A 4CEIA 1IM2A 1LDDA 2QSZA 4HX7A 3RTRA 1F9NA 1II0A 3BROA 3B7GA 2FFHA 2VBZA 2OQGA 1YZTA 3LAJA 1OLOA 3J80Z 3EZFA 3FDIA 4AYXA 2IYYA 3IL2A 1B4AA 3BJOA 2QBYB 2F1RA 4LHWA 4A15A 2HF9A 2R6AA 1CJUC 1JQLB 2I4IA 4MKGA 4DSUA 4P5OA 5E7IA 3DMDA 1GIAA 3SU8A 1JAIA 5AUOB 4L9NA 1UHWA 1P9RA 4XSXF 1BYUA 3KTAB 3TVTA 1FTSA 1TUIA 2VODA 5L3RA 5FL7A 2CE2X 1EH8A 1P61B 3O8DA 1R0ZA 2OBPA 3ZQ7A 1WMSA 3NWJA 4N3NA 4L9TA 4LG0B 1II8A 4TMKA 5HE8A 3M6AA 1Z6AA 3AF1A 3U4QA 4JSYA 2KB0A 2CGPA 4ZYEA 1J75A 5J4YA 1FQJA 4Q5IA 2W0SA 3B1WA 2VP5A 3QXHA 3LQQA 3WP0A 5BN3A 3F3YA 1V43A 1W5TA 4JL6A 2FBIA 1CRQA 3MRSA 1R0WA 4FMCB 1CR0A 2ZBKA 1DEKA 3O8BA 2Z9OA 5HR5A 1OHHA 1Q1EA 4YMVA 1U8RA 5CB8A 2DFLA 1SHZA 3A37A 2DU9A 1YKSA 3JVVA 1E6CA 5K5QA 2PFBA 2FE4A 1N25A 4A2WA 3MWYW 5ELXA 3JZMA 1E4YA 4FCVA 4I4LA 1NMXA 2QM8A 3DDCA 4E03A 5L3VA 3TW4A 2LF8A 3RS5A 1YTYA 1U99A 3DVLA 4FCTA 3HPRA 1S29A 2MMCA 4YMUA 1QF9A 1O7LA 5CVVA 2CL6X 4C2UA 1G64A 4GYGA 3TAHA 4D0NA 4US1R 4YDHB 3ZVMA 4W5WA 5LB2A 1VG8A 3R61A 5KVRA 1ZRHA 4TQ9A 2RKOA 1QO0D 1SVIA 3F8MA 3SOPA 1FW6A 2GZDA 3W3AA 1KZGB 4XWKA 3K69A 3A6PC 2HQNA 1ZP6A 2YWHA 1E9FA 3QOPA 3KP5A 1H8EA 1XD2A 3QBTA 1ZINA 2CL0X 4LOAA 1W4RA 4LHVA 3LWNA 2KJBA 2RNJA 3U2QA 1G291 2ZCWA 4DSOA 2PCJA 3N70A 1N6HA 1Q20A 2Q0OA 1DARA 2AFHE 2D3WA 2WWFA 3VQTA 2GETA 3EPLA 1FSEA 5IK2A 4EPRA 1W4BA 1DG1G 2ORVA 3BDDA 5H6QA 3GQBA 1G6NA 4PTLA 2D06A 3IDQA 3PQJA 1P6XA 1XTSA 1OMIA 2IEZA 3CKLA 4NH0A 5DH9A 4PQFA 3UMFA 2ZI6A 1II8B 3HR8A 3S2WA 2IWHA 6Q21A 5AJZA 4E22A 1HYQA 2XRNA 3KKQA 5BQ5A 5JFGA 4K81B 2OZ6A 3HRUA 4EGZA 2P6TA 1N6KA 1VDZA 4LK1F 3T5DA 4F7ZA 1QHHA 4EJUA 4V0NA 2X77A 5F1RA 4GFDA 1KI7A 1UBEA 2ORWA 3P9IA 4P3YA 4NU0A 4HAVA 4TTQA 5JZVA 5LPNA 3G0HA 2DFNA 2WAYA 3X1XA 2NO6A 1TBXA 3CF6R 3FZVA 4M6XA 1M7BA 2DWQA 2ZNZA 1IOZA 3GMTA 5HDKA 2OQRA 1XEXB 1KAGA 1Z83A 2P6SA 2CJWB 2WSMA 5GJBA 4Q01A 2H1LA 4R2IA 2IYQA 1W0JD 4TZ6A 1IXSB 1H0MA 1D6JA 5J4VA 1YQTA 1AKYA 2GXSA 1CTQA 2Z83A 3EASA 1HUQA 2FA9A 1NJFA 1KQ0A 3MCZA 3JAMZ 2JCSA 3CRW1 5DI3B 1G18A 4ACAA 3KQLA 4WIAA 2GESA 3SFZA 3P26A 4DLTA 3H0KA 2GK7A 3K9LA 4IVQA 5CK4A 3ADBA 4BHPA 3DEFA 3K2ZA 3W3ZB 1YZGA 2FFAA 4WA7A 3G73A 5LBIA 1GNPA 2A5GA 1XSDA 3GLGE 3M8FA 521PA 2HCJB 5K5RA 4XVRA 1IN7A 4KAXA 1G3RA 1RPZA 2GTPA 3ZP5A 1XMKA 1R7RA 1O3TA 3UPUA 2XSZA 2EJRA 2ZREA 4DUGD 4M1WA 2E7WA 1TUEA 1D2MA 3HRMA 2CSOA 2W24A 1SXJA 2RHMA 3C5CA 1Z1DA 5AUQA 2IP2A 4MQVA 2O61A 1N5JA 1NKSA 1W47A 3FHCB 3KKOA 3RYPA 4G5QA 4XH9B 4ENMA 2X1VA 1SMYF 2Y0MA 4B09A 4TV7A 2R3SA 1QHHB 4OHWA 1W4MA 3UWKA 2Q9BA 2IF2A 1ZW6A 2G83A 4BHCA 1O3QA 3L8ZA 1TF5A 3SXYA 4DVGA 1H65A 1D9XA 1R2QA 4FXPA 5DHFA 2HDCA 1SVMA 3I1FA 4MH0R 1OKRA 3HYIA 1VCIA 5EE0A 3FTQA 5IDVA 4JLMA 5IF9A 1AK2A 4B6FA 4DIDA 4URYR 1JGSA 2IT1A 4RGSA 4HQMA 2P67A 4DLYA 2F5DA 2O0KA 3K0CA 4B3DA 1X1SA 2XGXA 1KDTA 2CCJA 1ZGAA 1JXOA 3LX5A 5K5OA 1J90A 1ZD9A 4ON9A 3X1YA 1IZ1A 2X4HA 2VONA 2ZRAA 2QPTA 5L3QB 2J0UA 2IC5A 3UK6A 2YINC 1OFHA 3BFVA 4KJZA 3MCAA 2HR3A 3IQWA 4LV5B 3TNFA 3ZJYA 4MRSA 3ZVLA 3RKWA 3ZZUA 2KIFA 1U81A 2NO1A 4QWQA 1KJZA 3MZYA 2BEJA 2EFEB 2ZAMA 3A1VA 1KO5A 3J81k 4DC9A 1CF4A 3MWMA 2XX3A 2FU4A 3OIWA 3QVVA 5FPKA 4MRPA 2EQBA 2Q9AA 3F8BA 3I5YA 4II7A 1IY0A 1RNLA 2ZJOA 4HZFA 4IRUB 2VP4A 2CK3A 1XTJA 3IBGA 3FE2A 4Q1EA 4BYYA 1GUAA 1PZNA 3FMRA 3KLNA 2A5FA 2B21A 2ZITA 3T5GA 3TKLA 5DD4A 4DXAA 1EK0A 4LLLA 1JE8A 1O57A 2E1CA 5EE5B 5LGTA 2GBLC 3HHGA 2VSXA 1AGPA 2Y75A 2ZMEB 4N9IA 1N5LA 4GBMA 4HAYA 4JT2A 3TE6A 5L3SB 2DI3A 1ZG1A 2VF7A 3ECCA 1AM4D 2ZXUA 3A4MA 1W48A 1Z0KA 4ZCIA 1IHUA 3EWSA 1UBFA 3PFIA 3FWYA 4Q1CA 4WX9A 2OFOA 2XEXA 1AN0A 1MO3A 5IK2D 2ATXA 2FPLA 3AVTA 3TJZA 1K8RA 5SZIA 3LA2A 4EJSA 4CF7A 4AIJA 1ZAKA 3K9NA 3ECOA 2BJVA 2JRTA 3UG6A 4F4CA 3GD7A 3LBIA 3AM1A 3CPEA 1TEXA 4KCGA 3UATA 3GJ3A 4CXFA 4MRRA 3R9XA 3C5HA 2YX7A 3J7AO 4EPXA 3RKYA 2CK3D 2ETHA 4BFTA 2MSCB 1FSHA 5JRZA 2VC1A 2DWZB 4IRHA 1ZREA 1ZC3A 3ZQJA 4DDWA 3QF7A 3TRFA 1FBQA 4NE2A 5BXQC 4MTDA 3BE4A 3L09A 4LYHA 4JL8A 2G1KA 2YVUA 4I1UA 2GEVA 1NRJB 4Y0AA 2OAP1 1K6OA 1FUKA 3I62A 2YX4A 1FL9A 3IGFA 3QKSB 4N9HA 1WQ2A 1U9IA 4IFEA 4RB0A 3W6KB 1UPTA 4DDUA 4JK1X 3L2OB 1Q57A 4FW9A 4HX4A 4OHXA 2HEOA 3BH7A 1FPMA 1GTVA 5KUTA 3KXLA 5EE1A 4LFUA 4UVCA 2D1VA 1KK2A 2E87A 3GJXC 4BFYA 4OQXA 3WRXC 1CJMA 3R20A 4DCTA 1KDOA 4X8LA 1TNSA 2ZMEA 4Q1FA 2GNOA 2YOGA 5FOWA 3UANA 3VR5A 4A0FA 1NN3A 2NYXA 2JJ2A 4AKHA 4LBZA 1O3YA 4MUAA 1IW7F 3GXOA 2J5OA 3KKNA 2PMDA 2ZO4A 4P4TA 4PQYA 4LJ9A 4AWXB 3EYIA 1B9MA 1HE1C 4HB3A 4CO8A 1E9CA 1FMJA 2J0VA 4NBSA 5BWMA 3HUGA 3AEZA 2XUBA 4L18B 1SVKA 5IRCD 2IPQX 1A7JA 1KI8A 2MBFA 2G1JA 5H70A 2DPUA 2PMHA 5SZKB 1V4RA 4ACBA 1HT1E 4LCBA 2B6HA 1D8JA 3FF5A 1R23A 1ZVQA 1TQMA 2ANBA 2ONJA 1S4QA 3I0TA 4ITRC 1AQYA 1PLKA 3EIEA 1VIYA 2R6FA 3ADKA 2IK8A 2QSYA 2ZJ5A 2EFOA 3B78A 4YLGA 1JPNA 2J1LA 3WG9A 2Q9CA 2ZRJA 3LXRA 2O8XA 4UJ3A 4HLUA 3X1DA 2B92A 1I1SA 1ZD8A 4A8JA 5KTYA 2A69F 4UNPA 4TLCA 2A78A 2OFXA 4MRVA 2D74A 4HZUB 1EH6A 2LSOA 5FFXA 1R7JA 4OMZA 1TL7C 2WIAA 1M34E 2AD1A 2J45A 3E5HA 1ZUIA 4JYCA 3WBKA 5DI9A 1GOTA 3GFIA 1MKMA 2BMEA 1UKEA 3CH4B 3MGCA 4XVUA 1P60A 2WTEA 2XROA 1MO5A 4JLOA 3WGGA 4S35A 1ZYUA 3GLHA 5TXGA 3WTUC 1E0KA 3CONA 4IOLA 1LS1A 3TGNA 5BN5A 3RNLA 3U6KA 5EXTA 2V1DA 4LJAA 1LF5A 1KU2A 1JR3D 2V6ZM 4N0BA 1GVNB 4JLAA 4JLNA 3ZMSA 4JIMA 5CB6A 2ZKZA 4A6PA 2R9VA 4WOPA 4LJ8A 4L9WA 5HDGA 3SHFA 1OFUX 3P20A 4M0LA 3K0LA 3K09C 2STWA 4DUGA 2QL6A 3HU2A 2BIFA 3PCRB 5JI3E 1XTQA 2GXUA 4IVRA 4AWXA 4NPHA 2DLLA 5AUNB 1F2UA 3NBYC 4JLBA 2ZYWX 3CM0A 1OPXA 3U6BA 1IJEA 1G16A 1NP6A 2HUPA 2Z33A 3U3JA 4A3VB 3T1VA 4O6JA 4Q00A 4L9JA 1OKKA 3BD9A 1EH7A 2CBZA 2H94A 3Q5DA 1BI2A 1KNXA 1P5ZB 4GPTA 4DSNA 1G8PA 2OCYC 5K8IA 3M8EA 1KI9A 5JHGB 2GKSA 2J41A 5KSZA 2XGJA 4I1SA 2BGCA 2E7XA 2UWMA 2HKOA 4Z2YA 2JGNA 2QP3A 4M72A 3LD9A 4IW3B 3V8JA 2R7DA 2FOLA 3KKPA 3T35A 4Q4AB 3WNCA 4OQFA 4QL3A 4C3ZA 1XTKA 1ZU5A 4G5SA 2H27A 1HE8B 3GUDA 4AK9A 1K6MA 1S3JA 1S7AA 1ZHFA 2WJGA 3QE0A 1N0UA 3T1TA 5BYJA 1AZTA 1FT9A 4DLSA 2Z6VA 1E94E 4FD2A 1S9DA 1ZJ6A 1FP1D 3OIVA 4XD7A 2ESHA 2JPCA 2B0LA 2A5YB 4KMFA 221PA 3I3SR 5FGMA 2C77A 3ASYA 1S2MA 2J9RA 1VMAA 5A2QZ 1OFTA 3AUXA 1DOAA 3ND9A 2DY1A 2G9NA 1J59A 5CJ9A 2R6DA 1KU9A 2NO0A 2GZWA 4ZI3A 3BH0A 2DBYA 4L9VA 3B8HA 3U2RA 1KZ7B 3I59A 3CLVA 4I0BA 4RFVA 4Z54A 4TTPA 1WE2A 1NJGA 3UMSA 1C0WA 1NLYA 2QMEA 5BN4A 1OSNA 1N6OA 5GVSA 4POAA 1ONVA 2QZ8A 5ILSA 3HTUA 4QLCU 1YFHA 1JECA 1T91A 4C0SA 3NTUA 2XAFA 2HXSA 4A5NA 2GXAA 1TQIA 4OOIA 2Z4SA 3AF4A 1S3SA 1W49A 1NHAA 1W5SA 3K0SA 1ZAOA 3K8YA 1E2EA 2H18A 4RY2A 1M7GA 5FL7D 4DLZA 3J81Z 2VSOA 3DKPA 3ZLJA 2IYXA 3QP6A 1QBJA 4K8OA 4AIHA 3QP5A 1NIPA 5TY0A 4MHGA 4OI0A 3PIRA 3K70B 2FZLA 4IHQA 5EEHA 3W5JA 3ZGXA 3QPHA 1HKQA 1US8B 4LYFA 5JI2E 4MEYF 2WVJA 3L0OA 4CEIB 1T8TA 5FTKA 2GWRA 3VMFA 4BPBA 2CHQA 4Q4AA 1IQPA 3M1EA 3KP7A 4EM2A 3AUYA 3I4LA 1WBDA 5DSZA 4QBIA 4XWAA 2WICA 2NZJA 3SC3A 3CF2A 3SI7A 3LA7A 1P75A 4A0RA 1G5RA 3HWSA 1YW8A 1IXZA 3BOQA 3GX4X 1GL6A 1NBMD 3DFGA 3P7NA 1W4CA 3HJNA 3TLXA 2VXZA 1KSJA 3KZZA 5CK5A 4D6PA 3IO5A 4LC1A 1ESNA 3IRRA 3B1ZA 2V4ZA 2PH1A 2FV8A 2QNRA 3QUSA 2CEAA 3LV8A 4FMDB 3KQHA 1CJKC 4B3XA 3VKHA 4JLVA 1XTIA 4Q47A 4HB2A 4M1OA 3C4JA 2H5EA 4IDHA 3WGHA 3Q9LA 3ZZ0A 3AVUA 3W6JB 3CW2A 4U7DA 2ZUBA 3LAWA 3I59B 3M7GA 2DT5A 5HLGA 4ENNA 1ZCBA 2EFWA 3KDSE 1YHNA 4XTRA 3R8CA 4MUBA 3A1TA 5KYKA 4KFRA 2VP6A 2Q0HA 4HI0E 2FE3A 5FTMA 4HLXA 2A9KA 4ZDIA 2QAJA 1SVWA 3WTTC 5A2QK 2Q3MA 3BIFA 1E2LA 1WWXA 3G3ZA 2QT1A 4ERNA 5FFMA 1P6RA 4G6DA 3KXKA 1XD9A 1Z8FA 1JHHA 4RB2C 3CO6C 1R0XA 2PZEA 3OAAD 5FOVA 3KP2A 621PA 1NY5A 1GXQA 3L0PA 2IHBA 4JLPA 3BWGA 5FTLA 3GYHX 1MH1A 2QEQA 3REFA 4HB4A 4X8OA 3RRYA 5DYGA 3OOPA 4N0DA 2HKXA 4V03A 4D80A 4WXRA 4QBHA 1RI7A 1XN7A 2FNAA 4OK3A 3W8NA 4D2IA 1WRJA 5JWHA 4LRWA 4IVPA 5FOTA 1OIWA 3J81K 1OXVA 2YNMA 1XP8A 3NH6A 4LJYA 4UVAA 1SMTA 1BMFD 1XMIA 4BE7B 2IL1A 5EXSA 3R4KA 1NBMA 2TMKA 4CT5A 3SNHA 2XZLA 1D2NA 2FU5C 1Z07A 3FMQA 2M8EA 5G40A 5E18F 2M87A 1KMHA 5CITA 4MYCA 1FTNA 3REOA 1P2UA 4PHFA 3CRRA 5K8UA 3E6CC 2BJWA 1T2KA 3AQ4A 3LDAA 3GLHE 2VP2A 1IRGA 3F8FA 4I2OA 2C04A 3I5UA 2OFWA 2QUZA 3F5FA 3MD0A 4B2LA 3U44A 3I73A 1K79A 1JEEA 1HBXG 5BW8A 3FKQA 2XTMA 1E9DA 4LGWA 4ZV4A 2FG5A 3GJ8A 1CBUA 4OIOF 3SQNA 1LF0A 1HT2E 1ETUA 2JJ1A 3FX3A 4P31A 3RHFA 1CGPA 1L4UA 1GRNA 2WTUA 2HFHA 4HW0A 1QHYA 1Z6XA 1RC8A 3K70C 4JVMA 3EDPA 1Z2AA 3SFVA 3VEPA 2W6JA 4I1VA 2ZIAA 5P21A 3IHLA 1D5VA 421PA 3QXXA 1XCVA 3P1JA 4TMVA 3TR5A 4EQ6B 2A6HF 1UBCA 3EPKA 1NF3A 1XEWY 1XEXA 2CJWA 2GF0A 4AKGA 1L2TA 4L16A 5E17F 2V54A 2HQRA 3K1NA 3KETA 3QPTA 4DSTA 3NEJA 3IC7A 4QG7A 3EA0A 3R0AA 4A92A 2Z5FA 4PC1A 1T0JB 2PEXA 5J4HA 4HQEA 5D4RA 3V9PA 2VHUA 1YZQA 2OM2A 2AL7A 2NPFA 1NN5A 3IO3A 1EWQA 3Q5EA 3U1DA 4G9YA 3K9GA 3P4XA 2YKGA 1GKUB 1OXUA 1M74A 1ZM4A 5DYMA 2NRAC 1GNRA 2JDID 4M1SA 1I2DA 4XSHA 3KP3A 5C4MA 1K7AA 2ZXJA 3GLFE 5JHHB 3BORA 4DCNA 4XD7D 5DEQA 1U5TC 2F9LA 1XDUA 3AGPA 3K1JA 3NG1A 4V02A 1I27A 4UV8A 1KOFA 1N0VC 1VCNA 2J59A 1JPJA 2QA5A 1XF9A 4LWZA 3CO5A 1KMHB 4EPYA 3OIYA 4UXHA 3KQUA 1D2EA 4ESJA 2VC0A 2JLUA 3FFAA 4CDGA 4KICA 1CXZA 3TIFA 3JW4A 1BKDR 2D1HA 1C1YA 1QHNA 2W2TA 3A4NA 4RD1A 5FPTA 3EPHA 2XB4A 4ARZA 4GT1A 1SXJB 1OHHD 3B73A 3C18A 5LEKA 3AVPA 3F22A 5ICCA 5HZHA 1GM5A 3N5CA 1F5TA 3K70D 4HUQB 4CIDA 5LGUA 4LRSA 3VLFB 2F2EA 4L5JA 1TQPA 3G5UA 1MR3F 4O2LA 1AJEA 4LC0A 1I4LD 2YYZA 2ZJAA 1NLFA 5DD8A 1OFIA 2CXXA 5DUIA 4I99A 5JLJA 3ZD7A 1ESMA 2W2VA 2C99A 1E1QA 3WYGA 1Z6RA 2IF0A 1P2TA 1GNQA 4A0HA 2GZHA 1WCV1 3K0FB 3RAPR 3VU9A 5JBQA 2H17A 4HA8A 3WTXC 1E99A 1XXHA 1G8FA 3BB1A 2CNWA 1COWD 1OH5A 1TADA 2RV8A 4M1YA 4D82A 2DQLA 2CW0F 1RVDA 3LWFA 1CULC 2ZTSA 5CYOA 2HYGD 1KU7A 2OO7A 1A82A 2XAHA 2W57A 2Z4RA 3HRTA 3T8RA 1DTSA 2L02A 2V7QA 1X8JA 3EXAA 1XJCA 2ZYUX 1KY3A 4TMTA 3IEUA 3KP6A 1SVOA 4OHZA 3CZQA 4CGZA 5KPJA 5DIFA 2G0NA 2RGBA 4Q9KA 2EK5A 4D26A 3QVUA 5CYPA 3WMEA 4PC7A 1EWRA 3IKTA 2R2AA 4PFSA 3IIJA 2HXYA 4Q4HA 1E2KA 2RQPA 3AVXA 3PEYA 4W5JA 1OJLA 4LV8B 1KHTA 1T6NA 4GDFA 4FHTA 5DISB 1XPUA 2VBWA 2BV3A 3NC0C 1Q44A 2FX3A 2FSIA 3QKRA 4MNUA 1O3RA 5D6FA 3OEHD 5LD2B 5L3SA 1G4DA 4Q1BA 4ASUD 1XGMA 1U2RA 3KX2A 2CMKA 2QGZA 2MC3A 2TDXA 3CUQC 4I98B 2OBMA 1USTA 1RZ4A 1LEAA 2WM9B 2P5KA 1KQ8A 3KZ1E 3Q7PA 1BMFA 1ZUHA 1PDNC 3FM5A 2GJ9A 2WJIA 2CCKA 3PVSA 4RD4A 4DLWA 2UZKA 3WY9A 3UXMA 3I53A 4RGUA 1VHTA 1BC7C 4KFUA 3NBZC 2GHIA 2BBOA 1SD4A 2F43B 1UB9A 1ZRFA 2SHKA 4URXR 2C78A 5KDDA 3N2EA 1ZH5A 4BQAA 3K0FA 4XSGA 1G3UA 4U0VA 1KI6B 2B8WA 3RS7A 3VAAA 1XWIA 2E1RA 2IW3A 5E7MA 5ICFA 1E3MA 4KDPA 4TZ0A 1R5HA 3RS0A 1LDJA 1E0AA 2IWRA 1U6GA 4S04A 1AOYA 2ZUDA 4DZZA 1OW3B 2WJJA 1KI4A 4RS8A 1E79D 1T3SA 1Q1HA 2MD5A 3W9YA 4XIGS 2H16A 5AIPA 2F5EA 2JDIA 5DUKA 2C95A 3BY6A 4HX8A 3BP8A 3QKSA 4PO1A 2JLZA 1SXJC 3V00A 3HYRA 2EFCB 5BQTA 2JLYA 4MA4A 3SJBA 4DLXA 1H9TA 2ZRGA 3CPJB 3PEVA 3SBEA 1XD8A 4H0EA 1E1RA 3QXJA 2OU2A 4ENJA 2QRZA 3TQFA 4Q4HB 1OPCA 2VOOA 1D8KA 2IRFG 1A5TA 1UFQA 3BB3A 5LHGA 3SYLA 3MUFA 2ZE7A 3CWZA 1G20E 4PPNA 3L00A 2EFHB 4HLQB 4KN4X 2DK5A 3E5XA 5H68A 1DPUA 3SE0A 1DAGA 4GCVA 1DADA 1QHIA 2GCPA 2IUSA 1KIMA 4LPSA 1NSFA 2JTVA 2G9WA 5HLHA 4IHSA 3A4LA 3FMIA 4C0HA 3RPUA 1OYWA 4BGDA 4U5XA 1Z47A 2P5SA 4EIWA 3F72A 3KB2A 3NC1C 1U5TA 3KUDA 1W7PB 5JEEA 2P4WA 1DG3A 1AS0A 2OLJA 1CP2A 3L7WA 4NYIQ 1DUXC 3B82A 3EARA 4OYHA 3W6PA 3X2SA 1F5NA 2OCBA 1XRJA 2WSSA 3H2YA 3HDTA 2X19A 4WCGA 1T38A 2ZSFA 1U90A 2AN9A 5AJXA 5DHAA 2VEDA 3KKMA 1EV7A 3CTAA 1U8YA 3E1SA 4PZYA 4B3FX 2P5VA 2OZUA 3IIMA 4CRWB 4C0JA 2IA1A 2HJVA 4U0WA 2P7VB 3NEYA 2XV4S 2NO9A 1G3SA 1R6BX 4LB6B 1SFUA 2PMUA 1KI6A 3FXQA 3NKVA 3C7JA 3MEXA 1QVAA 1KDRA 4WK8F 2MMGA 2XHKA 5TRDA 3B1XA 4GOKA 3E70C 5JJIA 3C16C 4LHYA 5JFRA 1W1WA 3RLFA 3CRMA 2DHRA 1XB2A 2YPRA 3MLEA 2PJRA 2VPPA 1LDKB 2C96A 2H57A 4RCZA 5H1YA 5F64A 3RWOA 2XTNA 3NDPA 5J4LA 4HV6A 4A8JB 5FR2A 1HURA 4BFSA 3CLOA 2ECKA 1C1KA 2D45A 1KTVA 3KXIA 4HZUA 4Q4JB 4EJVA 3X1ZA 1F3OA 1GVJA 4KIBA 2WWYA 4MGYR 5A4JA 3DQVC 2OBLA 3BK7A 3RKXA 1IY2A 1UDXA 4FIDA 4LYJA 2WV9A 3LQRA 5F9FA 5DNYB 1GXPA 2IA0A 1Z0DA 3MFKA 2OCAA 2ELHA 4OMYA 1FWZA 3CX6A 4HDCA 4QHTA 1UKYA 1OXTA 1KGSA 1YS7A 4A2UA 4RD0A 4MQ9F 1NSTA 3VNUA 3NDBB 2ACJA 1UJ2A 1EFUA 5J40A 1U5TB 3B6EA 1E69A 4B73A 3F6OA 4M74A 2DPDA 3IUYA 5C4GB 4ENKA 3I58A 3RI4A 3CBQA 3QBVA 2QLZA 3KEOA 1V5WA 4DLVA 5HS8A 1AS3A 5AIQA 1QZXA 1Z7UA 1N5IA 1NI3A 3AV0B 4RVCA 3LNCA 1SFXA 3UMRA 4BLQA 2DZOB 2VLIA 3I64A 5L3BA 1H8HD 1Z29A 4MGIR 2XASA 1XZQA 2NOAA 1MD0A 2C03A 3B2EA 1PV4A 3B9PA 5ILVA 5EEGA 3FHZA 3NBXX 4R2HA 4BAYA 4EFMA 1CF7A 3O2PE 2JZYA 1YR6A 1VYTA 1P9WA 3PJRA 2G3YA 2NS0A 1KKLA 2B8TA 2X8AA 5EQTA 2AS5F 1SXJE 5EP1A 1Y0UA 2V1XA 2GXBA 4GO1A 3A1SA 4M9QA 4NP6A 3BAFA 2DFTA 5EJEA 1IF1A 4Q4JA 3ABTA 1GKIA 3BJIC 1B0UA 3AVOA 3B5JA 4WVFA 2VBCA 3KFVA 2QAGB 1JR3A 1HEIA 1UEIA 5JSZB 2WWXA 1X8LA 4DHEA 2MA3A 3CX7A 3DZ8A 4M9XA 4RSGA 1MT0A 1QG4A 4LK0F 2GBLA 2ZRPA 4V0LA 3M0EA 3IQXA 4AG5A 3J80K 4ZKDA 2C9CA 3T8TA 2P0EA 1F60A 3P9CA 4HZIA 2RGCA 4PO9A 2D7CA 2GK6A 1TW3A 2JJ8A 3AH8A 4PPQA 2QM7A 2HTJA 3ZMZA 2XKPA 2IYZA 4US0R 3TSZA 4P32A 1X6VA 4BHBA 2YC2C 4LY6A 5DGXA 4IOMA 2HWVA 4EPTA 2V8OA 3QPUA 2FPKA 3BERA 4P55A 1J70A 4HYEA 2VE9A 1W2GA 1HA3A 2GDJA 2RB4A 3OFND 1G7SA 5ED4A 1Y3AA 5E7JA 4A2PA 4JSTA 5C18A 2EV0A 2ZRNA 4EGYA 4A12A 1W0KA 4HLUC 2XJ9A 5GVRA 5CDFA 1LNWA 2AX4A 4NYJR 4A8JC 2IT0A 1EESA 3I4PA 4AD8A 4PZZA 1Z0FA 1W4AA 1GKYA 1NVUQ 1UADA 4D81A 4QGAA 2YR2A 3EQLF 3EZ7A 2F1JA 3K9HA 2W2XA 2FBKA 4KLNA 5C1BA 1ZU4A 2OZEA 1TTYA 3Q9SA 4WXDA 1G9XA 4JLDA 1EXMA 4LMYA 1NLZA 3RDIA 1E2PA 3TVDA 4EMSA 1P4XA 1F48A 1US8A 3FWEA 1WP9A 4NYMQ 1DDNA 2F55A 4LYAA 3RC8A 1AA9A 4PGGA 1VYVA 2F3RA 3FMSA 2Z5UA 4NCKA 4Z8YA 5BYKA 5DN6D 1XMSA 3KJEA 2CLCX 2IS4A 1BI0A 5DCFA 3WHKA 4KFCA 2AWOA 4FINA 3QPVA 5JJLA 3FM3A 1NBME 2QENA 3V4GA 1KDPA 1KYWA 2BV6A 2L3DA 2IYVA 2EFQA 2BBWA 2A07F 1Z63A 4M71A 1CS4C 4RD6A 3WXMA 4E5UA 1ZC4A 1G3WA 3EX7C 4JBXA 1OT3A 3ZMUA 3QOFA 1RZ3A 3I92A 2QQEA 4Z1MA 3VKGA 1BYIA 2ZJYA 3LLMA 1M1YE 4DEXA 4QJ5A 5L3FA 3F0TA 3VR3A 1G21E 2FSHA 3KUCA 2ZJZA 4FN5A 1DAIA 4EJOA 3E5QA 3DOEA 1E9SA 1TQ6A 1UKZA 2WSSD 3EWAA 2P2LA 4KVAA 3AVWA 2VOPA 1TMKA 5FI1B 4CYDA 3KP4A 3KCCA 1REPC 2BKEA 4IHTA 2OE2A 2HLDA 3BPXA 1HQCA 4MGRA 2WBLC 3W6OA 1XPOA 2K7LA 4NZYA 1U0LA 2XKOA 1W0KD 5B64A 4UUVA 4C0AC 1KAOA 2GJKA 1KU3A 3D8BA 2P5LC 1QBKC 4IPAA 3BJAA 2QPOA 2Q3HA 4IOJA 3OFNA 5KSPA 1VIAA 5LRRA 2KSQA 2CE7A 4A0XA 3ZYCA 1I1GA 2WKPA 1GAJA 3ABUA 4L0ZB 3NBFA 1XNJA 2ZRHA 2V1UA 1R22A 2AK2A 3P32A 2GRJA 2A2ZA 3ZVNA 1WXQA 2PZFA 3L8YA 1Z05A 3B85A 1NN0A 3UG7A 3FMOB 3DF8A 4OIRF 4XTCS 5K8TA 2FQ3A 4ZZLA 1J8YF 2P3SA 1UFMA 1RUNA 4D4JA 4G6QA 4ON0A 1Q21A 2Z43A 1A4RA 1ELOA 1Q1ZA 3THWB 2FOKA 1DELA 2F1IA 4DCUA 3GLFA 2C5LA 3AKYA 4HF0A 4DT1B 1FMLA 1XMAA 2VBXA 1JXSA 4YC7A 4RGRA 2IS6A 3R60A 2C9OA 3GLIB 2OD5A 3JAMK 1IN6A 4RKEA 4BLRA 3HSFA 3TDUC 1OE0A 4PHTA 3K09A 2FH5B 3VFDA 2JASA 3D6TB 4FWIB 2QN6A 4PHHA 4B35A 3PR1A 1KSFX 3IHWA 1OV4A 2O0HA 3RRMA 2QM3A 3THOA 4Q02A 2CLDX 3CH5A 3LH5A 4IOKA 1E96A 4MDFA 1DAFA 3NH9A 4EFLA 5FBVB 1TNTA 1DO0A 2EWVA 3DM9B 1KO8A 3U44B 3A8TA 3KEQA 1ZBDA 4MDEA 1GP2A 4RFSB 4B71A 4PDKA 4YMWA 1U78A 4OQMA 2JIZD 5CIQA 4QNMA 3VOEA 2O8DB 4Y13A 1NL3A 1X3UA 3AB3A 4JVSB 3DPUA 5ILUA 1JBKA 1CR2A 4AURA 4CW7A 1M8PA 2QMUA 3IBYA 3FYHA 1H8HA 3D7MA 1E1RD 3QJYA 1XEWX 1U3EM 3SEAA 4LBYA 4LSGA 1PLJA 5KNCA 2XB2A 4HAXA 2PG4A 2V3CC 4XVQA 4JKIA 2ZU6A 1KI2A 4BH9A 3KJGA 4GP6A 2BWJA 2GXGA 3EW9A 3TUIC 1A1VA 2BEOA 1HY3A 1XXHE 4IDQA 2G0TA 4PX9A 5FI0B 2HOEA 1G1MA 1MO4A 4HAWA 4A9AA 2RDPA 4QHYA 1VTKA 3U7FB 3CRVA 4GNKA 3S1AA 5IT9K 3H3UA 3DMNA 3R6SA 2W6JD 1Z6GA 2KIUA 4E70A 1PUEE 2BEKA 2LNBA 2CHVA 4OIQF 2QTFA 2ZVQX 1T4GA 3HOSA 5E20A 3GZ5A 2O6GE 1PUIA 2BE5F 1OIXA 1YU9A 2PZGA 5B2ZA 4BRWA 3GLFB 4EUNA 2JJ1D 1VPLA 3AJIB 3CB4A 1Q22A 2PLYA 1P4SA 2A6EF 2JIZA 3TSOA 4DT1A 2ANCA 4PSKA 2HCBA 2BOVA 3RVBA 3GLIA 1XGOA 2OAZA 1PLLA 2BC9A 3DEUA 3WYFA 4QGGA 1HKSA 1EG7A 4CICA 3PUZA 4PGHA 2ZRFA 2V6CA 3IPYA 5KSOA 1VECA 1Z5ZA 2AK3A 2A5DA 1GILA 4M1TA 4Q1AA 1SD7A 3M4YA 2XZOA 4G5OA 5L3DA 4OQNA 4UNOA 2JSCA 4ARZB 2J7PD 3DPLC 3WYAA 3RABA 1E32A 4MYUA 2GQQA 4HUQA 1ZM9A 2O8CA 3LFUA 3H4MA 1T98A 4PR0A 5IT3A 4OK6A 3COAC 4RD3A 3ICQB 3U61B 1XPRA 2QAGC 2ZE6A 2EWNA 1IJFA 4YDSA 3RRNA 4Q66C 5A0FA 1G4AE 2EA4A 1ZM2A 3NEUA 1NIJA 4V0OA 2OCPA 4RJLA 5KK1A 2OEPA 2A3SA 3TK1A 3FHTA 2F6RA 3SYNA 2OLKA 1L8QA 4EJWA 1W2HA 3DKVA 4QRHA 4FWGA 1YRAA 1HV8A 2A5JA 4M4SA 1R36A 3VU9B 1Q12A 5DYIA 5AJVB 4E07A 3E97A 1XXHB 1M7HA 3GLXA 1G3QA 1S9HA 2CCGA 5EP4A 3HOTA 3AGQA 4EDHA 1UAAA 4PXAA 5HTKA 1F4KA 4KVGA 2ZI3A 2ZPTX 1LVAA 4K2EA 4D4KA 4JBAA 3F23A 4AY2A 1QQIA 1KO7A 1VYUA 4UXJA 4ZYDA 2GAOA 3O47A 5JCZA 2D62A 4C0KA 3QF4A 3IRQA 3HTSB 3K0AB 4BZPA 1WBBA 2FA5A 1KMQA 4Q19A 1FZPB 1NMZA 5IT9Z 2IHYA 1X37A 2P6RA 5D5XB 1RW4A 2ISYA 1EFTA 2DAOA 1XJ0A 4LGMA 4DB4A 3GW2A 1SD6A 1E2IA 4QBFA 1JB1A 1DP7P 4WZBE 3T61A 1N2CE 4F91B 1QDEA 3RYRA 1WRBA 3MAJA 2WIBA 4RZXA 3BBPA 3PUWA 4Q9HA 3ZZTA 4AD9A 1OXXK 3B1VA 5HZKA 3LBNA 3QKRB 2X0LA 4TSFD 5EZ6B 4JBYA 1EGAA 3GFOA 3HPQA 2PBRA 3LRPA 1FQKA 5F9HA 5CVRA 4Y15A 4MKIA 2QE7A 1YYVA 2HTSA 1L7VC 2ZRDA 4Q4LA 5HPYB 2W85A 4LK2A 1B9NA 2O8CB 2M30A 1SKYB 1DVRA 2VP9A 3OEED 4HDVA 2G7HA 4D0PA 1R5GA 4B3GA 1JR3E 2H7VA 4GOXA 4TLEA 1R58A 2OILA 3R9WA 2AWNA 1VG0B 1WKMA 1RRPA 2F43A 2CL7X 1FFHA 2O03A 3ML6A 3W34A 3V4FA 1EFRA 3QEOA 1LS6A 3L0IB 3B13B 4PPGA 2PX0A 1P9NA 4D0GA 4URVR 2V79A 4A1FA 4B32A 1SULA 2GZAA 4AVPA 4D0LB 4PPFA 1DBSA 1J2JA 3LBHA 3K0CC 4EM1A 1SZPA 3VHXA 2HS5A 2QGNA 2G77B 3WNDA 5IHPA 1IXCA 121PA 4GITA 1FX0B 5B57C 5M04A 1AWCA 2ASEA 5FOXA 2YOHA 2WZQA 2EFDB 1OIVA 4NKRA 2ZRIA 1AGRA 5HKKD 3TOBA 4ESBA 2ZS8A 2K86A 2ODWA 3QAHA 1E17A 3K0AA 4OI4A 1FBUA 3GFJA 1XU4A 1RRGA 1KJWA 1TX4B 5FBRB 2GA8A 1XGNA 4M9ZA 1S1MA 3ZH9B 3OHMA 3LLUA 1TNDA 1QNTA 1QHGA 3OESA 4NMMA 3ZN0A 3CUQB 2BCJQ 4CVNA 3JZAA 2ZE5A 2W84A 3K9TA 2BDTA 2IYLD 3IIKA 3W90A 2VP0A 4PZJA 3W8RA 4IDNA 5FBQB 3QXSA 2MLKA 2R44A 3ZMVA 1P4WA 4LUCA 2LKCA 5L3CA 1ZG3A 5FPYA 3RC3A 4BEJA 4EAQA 3MSXA 4HATA 4M2LA 4HV5A 4BZQA 4TLBA 1I4TD 1HW5A 2ZS9A 1P2VA 4ZH4F 1IN8A 1W7PA 2ODNA 2WJHA 2WMNB 1GITA 1IN5A 3C15C 3CNOA 5FUWA 1RIOH 1XFAA 2O0JA 1MRSA 4H1VA 1YQAA 5C46F 4FCWA 1KYIA 4HOBA 2ADUA 2GA1A 5SZHB 4TYYA 1J99A 4TSFA 1QZMA 3TUZC 4JZKA 3SYKA 2VBYA 3D31A 5G41A 3BH6A 1X86B 3W6NA 4XBFA 4KYIB 1BH2A 5GJCA 1B59A 1QPMA 3AP1A 1KK0A 2MH9A 1DAHA 1E0JA 1GRQA 2AXPA 2OESA 5AK0A 3ZQ6A 4TYWA 2RVCA 3DPTA 2R8RA 3BGWA 3R7WB 2RHDA 1XD7A 3U7GA 2WMOB 5EUQB 4DDVA 1NG1A 4B76A 3C1DA 3NHAA 5AJWA 2P6NA 3O6BB 1FP7A 3WRYC 1CIPA 1D3YA 3OZXA 3RYTC 3WTVC 3V7SA 1P72A 5CLQA 4ZO4A 2C6YA 2L4MA 3H84A 2YWGA 1W36B 1HQYE 2LCFA 3EG5A 4BEBA 4YIFA 3GLGB 4GOJA 2BKUA 2ZRMA 4HYYA 2H92A 3CUEF 3FB4A 4JS0A 3WNBA 5H6RA 2H09A 1O3SA 2QI9C 3E6BA 3LW8A 1KYZA 4ESFA 1N0WA 1X8KA 4DLRA 3AF2A 2AD5A 2EWWA 3PUYA 4ZDWA 1YE8A 1G3TA 3HYTA 3PEWA 1T3LA 4FWDA 1MZBA 1VCOA 4GRAA 1O7FA 1ZRDA 3I5XA 5FOSA 1G8YA 4WXPA 4RKFA 3WU1B 2NIPA 2QYOA 1S1CA 2J46A 3SJZA 4AG6A 4AC9A 2YU3A 1FYLA 4KFSA 3CRQA 2C8VA 2DBBA 4S2EA 4ZKEA 3VX3A 3EC2A 4QBGB 1RKBA 4URWR 2UZ3A 1E2JA 2KWIA 3D0SA 2XNDD 2ZEJA 4NCNA 1LVGA 4OU0A 2EFGA 1ULYA 4OHVA 1D5CA 2KRKA 1XB4A 3O3KA 3MWKA 3Q85A 3I61A 3FKSD 3IKVA 1STZA 4M22A 2IXGA 2HYIC 2QU8A 4HF1A 1KKMA 4N1AA 1R5OA 4BQSA 4C9BA 3B60A 3Q7QA 2PEZA 4MEXF 3P27A 4YXWA 2HT1A 3B1YA 4QM7A 3DZDA 2K27A 2LDUA 5J6XA 1KNQA 4C7OA 3HSEA 3TDZC 2DFIA 3VR1A 4A2QA 3EAQA 1HXDA 2A3RA 1CF7B 4TL7A 4JQFA 1TLHB 3T06B 2H8KA 2FFBA 3P9KA 2YHSA 3W5IA 2ODBA 1P2FA 4IXMA 3V7RA 2KJCA 4KLZA 4IXAA 4UNQA 1E2XA 5FTJA 3EZ6A 2ZNYA 3GJ5A 3SHWA 3CDHA 2FN4A 1L0OC 1FYMA 5DO9A 3HRSA 3D5LA 1KO1A 1XCPA 2XSZD 3KL4A 2K4JA 3OIUA 1I6XA 2R7FA 5ICGA 1R1TA 2QAGA 1KJYA 4UV9A 5JSZA 3WE2A 1ZM3A 1OH8A 3GLGA 3I8XA 1YZKA 5JVTA 2IJLA 2DZNB 3TUJC 3IKJA 1BBYA 4HB0A 1TEVA 2NTYC 5K1YA 1CJTC 2QTVB 4KMUX 2WWIA 1E79A 1P73A 3WHLA 2ZROA 4TYNA 4DRZA 4L5IA 4O3MA 4R98A 4PAMA 3ZD6A 1I2MA 2NMVA 1SKQA 3VHLB 1WB9A 2KI5A 3AKCA 3REGA 3HU1A 1MO6A 5LGNA 3Q9VA 1XCGB 2FDCA 2XAQA 2FFQA 1IY1A 2V55B 3THYA 4UVBA 2V6JA 4V0MA 3KJHA 2C9YA 2QY9A 4R71A 1G17A 4WF2A 4WWCA 4LLNA 2QRNA 4W9MC 5JJKA 4KA4A 1CR4A 3ONWA 1U8AA 4TL6A 4TLDA 1Q1BA 3KB1A 4TMZA 4UXIA 2VL7A 4QHSA 1UCRA 4FMDF 4PZLA 1ZNYA 4DJTA 2FEMA 3O8RA 2JLQA 3LX8A 1VG9B 2HYFA 5J47A 1XDSA 1Q3TA 2RGNC 4KXFB 4F93B 1NG9A 3RANA 2ESNA 4IDPA 4F7WA 3HR7A 5FTNA 3L43A 4B8XA 2X2EA 2YWEA 5E3HA 2LKDA 3QKTA 4HDQB 3T1QA 1Z2CA 4YXWD 4NL4H 1RRCA 1KK1A 2IX3A 1Z22A 4KN7X 1P62B 1L3LA 1U0JA 3GVAA 1E9BA 5FH9A 4DNCA 5LBQA 3ASZA 3GEEA 3I8SA 4LBVA 4RZ3A 1YLFA 3WGIA 5L3GA 2JAQA 3MFYA 3F6VA 3MJHA 1Q0UA 3U7HB 4A36A 1VHLA 2WJVA 3ROUA 2DO7A 4IJAA 5TVKA 2O8FA 2QQ0A 1C9KA 2CDNA 3WTYC 4UNSA 4BASA 1T3HA 2EFNA 2NO7A 3GWZA 4NYIR 4GMXA 4M73A 2CHGA 3GCGA 4JJZA 2M1BA 1DO2A 5DLQC 1R1UA 2FNPA 5L3EA 3GFPA 1TU3A 4PC3A 2QG6A 3CR7A 3QI2A 1HSTA 2OUKA 1P2SA 1PUJA 1LJ9A 4AKIA 2RGVA 2IVMA 1KI3A 4XLNF 3BFXA 2E1NA 1S0UA 1A2BA 2A7QA 3HHHA 3JSOA 2ZI5A
chains in the Genus database with same CATH superfamily
2E2JJ 2CKDA 5H20A 2G6BA 3HYSA 2Z99A 4A69C 2OV3A 4FX2A 1EXNA 4NCJA 2IOFK 4Z3KA 3ZCBB 1E2DA 1QHEA 4UE2A 1YG2A 4A0QA 4KXXA 4OI1A 3OE5A 5CM9C 3L0YA 1X7YB 1EFPB 2H2GA 4BNUA 4Q7QA 1JIJA 4H1WA 4EQ6A 4TXJA 5JQGA 4YONB 4QARA 1NATA 1U8XX 1FLAA 2EYUA 3HJHA 3IB3A 4QUJA 3QBEA 4FFPA 4EEXA 3G6KA 5JNUA 2UUPA 3CMCO 4EH1A 3SX0A 2ZXEA 4PC6A 1JDTA 4HDOB 1R4AA 2I6FA 3PXGA 2NT3A 4DDKA 5HOQA 3BFKA 1L7MA 1WHTB 1T0FA 4JI4M 1OU0A 5GIOE 3ZQCA 3ADDA 1KFCB 4H9GA 4M9CA 1H1LB 2VJLA 5CG2A 2BMJA 4JLKA 4P33A 3QTTA 1EB8A 1ZCFA 3VO1A 4HUTA 3SQOA 4MKXA 4AN4A 2NNYA 4RMJA 4CIYA 4M9SA 3F9KA 1QX4A 4EKDA 4DBVO 2FGJA 3QX3A 4MS4A 4ESVA 1T33A 2R0QC 1GVDA 3QMWA 3DHVA 1F8YA 4BFVA 2DZDA 3KPHA 3ZHBA 1WP4A 1QP0A 1C4OA 1K4KA 4O4LB 4HQOA 3PGKA 2IY8A 2F00A 3CEJA 3SHQA 2Z5GA 1V16B 1VZ3A 2OFPA 3K9PA 4NU8X 1I6HJ 2UU9B 2R1ZA 4RADA 1AQUA 4JGBA 4M60A 3GAMA 1RJEA 3HR4A 2HVRA 1DUVG 2FGKA 2BFWA 4QAQA 1VKJA 5HGJA 4L5EA 3SASA 1G41A 4AIIA 3KB8A 3RCBA 4MV9A 3ESBA 4XD2A 1RDFA 2OT3B 4H1HA 2WI8A 2PBIA 1V6SA 3TTXA 4OJQA 1N5RA 3WJ7A 3SR4A 5E6SB 3CUQA 1WDWB 3L29A 1OBOA 5KKNB 3BR5A 2BVMA 3DVAB 3UYLA 1VTNC 4YJ2F 1VA4A 1GGJA 5LD2C 1HTBA 4OKSA 3SJCA 1GTL1 1UK6A 4ZYHA 4ZT5A 1BD4A 3ORSA 3C2GA 2ZAGA 3ZCQA 3K8ZA 3ESQA 3HCRA 5B5SA 1PWHA 4CZZA 2YZGA 2G17A 2J5XA 1Z28A 1KO4A 4BX2A 2HA0A 1F5SA 1KJNA 5E95A 4LZJA 4ENQA 1T9KA 5BSTA 5KPZA 4WNIA 4BXOA 3AVQA 3NVAA 3JARA 4J2TA 4OK5A 4FOLA 1U9JA 4HJRA 3E0QA 2HK6A 1N9KA 1NQ5A 1THMA 2PUVA 2NZXA 2DZLA 2GJ4A 3GGSA 3V2IA 4YAKA 2CYCA 4G1BA 3RC1A 1QAQA 4F2GA 2L01A 2YFHA 2RH9B 3GLIE 3DOCA 3K1ZA 1UPCA 4JR2A 1VQ1A 1UG2A 2FEOA 4LJZF 1OR7A 3NPMA 3Q40A 4WGGA 2F7SA 1QK3A 4OL0A 2CUTA 1U98A 1F8GA 1FX7A 1M5TA 3ZXUB 1E3TA 5FWXA 1PT7A 2GXQA 4DOZA 1T6XA 4V0RA 4JBWA 2WYHA 3A1DA 3ZPLA 1MGTA 1U5BA 4W1UA 4IJMA 4FFMA 1PTJA 1XVVA 5KSYA 1J24A 1SXIA 2OD7A 4BYGA 5E0KB 5KYNA 1AKQA 4ETWA 2DMRA 1IUYA 4PQRA 4ZOBA 3WOVA 5TV2A 2XITA 3U3ZA 1UWCA 3MELA 1H9GA 1IDOA 2KXEA 2DPXA 3EA5A 2WKSA 4PE5B 5KTPA 3VPDA 2PIDA 1IG0A 2EFYA 4OBEA 2P1DA 5COAA 1QYCA 1TQ4A 2IUYA 1QM5A 1ZQ1A 2VCEA 3TZKA 4JBIA 4MV0A 1KERA 2GF9A 1EFPA 3LGXA 2NM0A 4M89A 3EZ9A 4U0KA 1YBAA 5BMVF 3ZK7A 5JQGB 1MOZA 5DTIA 2ZAOA 3QQ5A 2Q29A 2RH8A 1I3AA 3HIFA 3IAS2 1HTWA 4FX4A 1TMYA 2WLTA 3JASA 2X51A 4ME6A 1R6AA 1BQ3A 4G89A 5F3WB 3A98B 1WNFA 4L3OA 4ARUA 4EB8A 1TU4A 4KUMA 1FC3A 1JR2A 3WRYA 1G4HA 3GH1A 2RGXA 2R4QA 5JFTA 3ILXA 1BG6A 4K6HA 2I78A 4CT4B 4EZEA 1ZRCA 3FR7A 4YP7A 4YT4A 1XQVA 1E9EA 2QRUA 2DGDA 1BKYA 4CEJA 4M49A 5CFZA 2V4MA 1V2HE 2ECFA 2WWGA 3PE3A 4XYBA 5JYCA 1F2UB 1M2OA 3PD0A 1TLLA 4TT3D 2BHYA 3THRA 4WACA 4ZCTA 1NPYA 2FOIC 3OTGA 2FF7A 1ZK2A 3RKUA 3ZDXB 2VN2A 4O1HA 4U00A 1EUZA 1KETA 2XNDA 1SU7A 1RPTA 2AZMA 2XH8A 1RP1A 4ETMA 5CJ2A 4EVIA 3KTAA 2PJZA 3SDGA 1ZLYA 2XNJA 4JL5A 1T29A 1KSHA 1BFUA 2XOXA 2CVHA 1WCWA 3QY9A 4NOLA 1DAKA 3RJPA 3RC2A 5CXQA 4TXMA 5K4GA 1FEZA 3U31A 1YZUA 5AW7A 1ZIDA 1IM2A 2GRUA 1F9NA 1BR2A 2OQGA 1OLOA 4HDSB 3IL2A 5JISA 4A15A 4E1BA 1NW9B 3DE7X 1RWXA 4N40A 2X0KA 4P5OA 1PUFA 3O8DA 4M6WB 3HOZJ 1DRJA 2JFZA 1Z6AA 3AF1A 1P18A 2G1PA 1J75A 4D0RA 1R0WA 2NU8B 3O8BA 4FHEA 3B6MA 3PC8A 3RFUA 1PYDA 3AC0A 2GPJA 4P92A 4UHKA 3D2BA 3EAGA 1MB0A 3JALA 4D0NA 5T64A 1JFRA 4RESA 3W3AA 3A6PC 1E9FA 3QOPA 3GCWA 2X4AA 1JDVA 4IGKA 1WR8A 3S27A 5HFNA 1ZMTA 3AIOA 1MPTA 4GP9A 2RAVA 4JA0A 3OQMA 4NU0A 4HAVA 1TYDE 2RG7A 1X38A 1MNAA 3M9LA 4DMFA 1S89A 2R4TA 2IEGA 1IXSB 1PGNA 4BV2A 4NZMA 1KQ0A 4RENA 3ZU3A 1VQ6I 3G73A 2PL9A 4X24A 1M10A 1DC5A 2XSJC 2XSZA 2UUAB 1DV1A 1SXJA 4Y9SA 4XGQA 4B09A 4MUGA 4J03A 3C7AA 3RIYA 5FTWA 2Q9UA 4IM7A 1U5BB 4NXMB 1QCCA 1TQHA 1BXRB 2WMYA 2P67A 2XGXA 3NRCA 3R09A 2Q6IA 1C8VB 5EVCA 1OFHA 2J3DA 4BO4A 3FGZA 4DYCA 2P41A 1Q15A 1HMPA 1IQ0A 2TMGA 2B21A 2C84A 5DLPA 5H83A 4DAOA 2AV6A 3X1KA 4JT2A 4HEHA 1ZX1A 4Q1CA 4WX9A 4JP8A 4OLHA 1TT5B 2ATXA 1K9SA 3SEZA 4HH1A 2CB0A 1T3ZA 4GEKA 4RDHA 3CPEA 3AZOA 1L5NA 4OXIA 3J7AO 4W9NA 1FSHA 4XL9A 3ZQJA 3GUHA 4DDWA 1GV2A 4LXUA 4G4QA 5BXQC 1O95A 5COBA 3RE1A 4FWBA 2YWJA 3KQPA 3IGFA 1FL9A 4RA6B 1NC3A 1GUDA 2WE7A 4CG1A 4ZO9A 1XGKA 4LFUA 3EIFA 3DZHA 5CB8A 4Q1FA 5JS1A 4NAVA 3BQYA 4GSLA 2RD2A 3KKNA 2NSLA 3FCEA 1RJGA 1HE1C 5E9QA 2VXBA 3G9XA 7MHTA 1IC8A 2F4OB 2H31A 3OLWA 2OBXA 4G5FA 3ABOB 3DUWA 4AQYM 3R3YA 1SQSA 3PJEA 2GHQA 2FDCA 1EH6A 3CJRA 3P8ZA 4OMZA 4D57A 2JFHA 3K6SA 3UA3A 2ID3A 4XVUA 3VO2A 5HFAA 3WGGA 1CR6A 5ALQA 5FXMA 1OCZH 4DGQA 1GVNB 1JR3D 5C1DA 5HDGA 1L3CA 4WNAB 3SHFA 3FKEA 3PD1A 2LWXA 4HRXA 3PCRB 1ORYB 3FYUC 4Y8VA 3LBFA 3JQ8B 5JQGF 2HK9A 3U6BA 4I5DA 2XRYA 2NAFA 1Z4QA 4JELA 3TSCA 4MGIE 5B3JC 3WYNA 1P5ZB 1QF7A 1SG0A 3HKBB 1JFVA 2QQ5A 4R1LA 3FPHA 3WNCA 5BVHA 5IS2A 1ZU5A 3M6XA 1E1CA 5HF5A 4BP1A 1OH5A 1FT9A 3P0FA 4J7AA 3ZN2A 1JUPA 3AG6A 1YCGA 2ZIWB 1UQRA 3BH0A 1MG0A 1ORRA 1CC1S 5BN4A 2P27A 4POAA 2J32A 3F7MA 4YGXB 2GXAA 3IH2A 4A5NA 2PTHA 3R7BA 4PV7A 1DQNA 4D97A 3FFWA 1HF0A 1B0AA 1NM5A 2O4CA 3ZGXA 3OMWA 2WP0A 4WH0A 1NVGA 2ZIVB 1M8GA 2FG6C 3SI7A 1OTHA 3ESYA 4NNJA 3HWSA 3D3KA 4JNCA 1M5RA 1ESNA 4CR8A 2CEAA 4DIFA 4YPVA 2G28A 3VSKA 3JQBC 3UY4A 2H5EA 3ZWPA 4BO5A 4U7DA 3M7GA 2PVCA 4KFRA 2Q3MA 3BIFA 2QT1A 4IIWA 3KP2A 1NY5A 1GXQA 3B6IA 1CERA 1GQOA 1U0RA 1WZIA 2JHAA 3UMVA 1WDMA 1GQSA 1J5EM 4YQZA 2OGZA 4I9NA 4UAVA 4BQIA 3HFRA 2XPCA 3GLHE 3H36A 5ARCA 3F8FA 3I5UA 2OG1A 1BHO1 5AKXA 1YKGA 1ETUA 4QPPA 3I01A 4HWOA 1VQ4I 3X43A 4JVMA 5JALA 2HLHA 3IRVA 4GE3A 2GBCA 2OCEA 1OYOA 3HACA 3WYEA 3UJAA 1YA6A 1PR0A 1ISRA 4UU0A 4FLFA 1Z7WA 2F9LA 1JTYA 2J59A 3DQZA 1XF9A 3D4LA 1Q02A 3DMYA 2UV1A 1DQUA 1IOWA 3TIFA 2Y21A 2H48A 4HMPA 1SXJB 1OHHD 2J9GA 2YTZA 2F2EA 1I51A 4I76A 2ZJAA 2DWUA 1B0PA 2FDXA 1UODA 3EMBA 2GN2A 1E99A 1XDGA 5KCMA 2HNBA 4D82A 1Z4PX 3TOSA 3LWFA 4LY3A 1FS6A 2OFFA 4IILA 5CQGA 4KGXA 1IRIA 4CGZA 2A9RA 1I3KA 3TQIA 4PC7A 3BG9A 2Z8ZA 3GLQA 1MFZA 4KDFA 1U3FA 1U2EA 1C50A 5LOVB 1PDNC 3FM5A 3IP1A 2AZTA 3DQQA 1C4XA 2Z8XA 3U49A 1BC7C 1X7GA 2F59A 1V3UA 2P2NA 4IDEA 5DTRA 2XEDA 2GZ1A 4ZXPA 1GYQA 5ICFA 3K1AB 2WJJA 2Q0SA 2F5EA 3DMGA 1SFKA 5E79C 4LXYA 4RA6A 1VL0A 1DBPA 2EFCB 1QUSA 4MDHA 5CA0F 1MPXA 3QXJA 3TQFA 1YK1A 4GM0A 4WXEA 1HG0A 1SU6A 2EGUA 2XHZA 3L00A 2LMDA 3NDIA 2GCPA 4AMVA 3WBBA 2G9WA 1K3WA 4EIWA 3F72A 2ZBDA 3H18A 3D6JA 4WCGA 4JBLA 3NEYA 3CRNA 2YJGA 4XJSA 2H0QA 4Z6KA 1T8IA 1QGOA 5JJIA 1EAYA 3CUKA 3MLEA 2YPRA 1QE5A 1RPAA 3QQPA 4Q12A 4A8JB 3KZMA 3TAXA 4BFSA 1C9NA 4KIBA 3K2QA 2Q3DA 2JUGA 3BK7A 3RKXA 2KYRA 3X2EA 2GBFA 4MQ9F 2BTEA 3NDBB 4WNAA 3HEAA 4W97A 1QQ5A 3DSRA 4ENKA 1FNDA 3I58A 1FFCA 4KR3A 4ZALA 1B26A 3NTXA 3LRXA 4GX0A 2H0RA 4R2HA 5B6JA 3AHJA 5CD1A 2OENG 2DFTA 5EJEA 2I67A 5BVHB 2B2NA 5JDCC 1B0UA 2VDJA 4WVFA 3H97A 1E1CB 5T67A 3WAGA 2D5CA 2EJCA 3M6WA 4I19A 4AX4A 3ZNOA 4V0LA 4ZKDA 5DEIA 5TPWB 5E3NA 3AH8A 4ZVPA 4UUAA 3LUCA 3HXOA 2GIZA 1J70A 2DUWA 1Y0NA 4A8JC 1ETKA 2PX8A 3GC6A 1F4PA 4O59O 3L2VA 2CMFA 3CW8X 3H0CA 3DEZA 2O2EA 2DYRH 2B1RA 1YITI 4P17A 4MQMA 2WU0A 1HRDA 1B2RA 2VDMB 4CUKA 3I92A 4Z9FA 4O1IA 1S3FA 1DAIA 4EJOA 1UKZA 4LQDA 2FVXA 4RIIA 3AVWA 3RJ9A 1REPC 1ZI9A 3BE8A 2K7LA 1O89A 3E7PA 4YJHB 4DCCA 4HDAA 3G1TA 3KT8A 5LRRA 1ZGZA 2HZ7A 2QRVB 3K9WA 4UVIA 4CKEB 2V1UA 5JS2A 4QUGA 4GWGA 5K01A 5F76A 1Q1ZA 1M83A 3Q1LA 4EYKA 3EY9A 1U8TA 2QVZX 4YRQA 4BLRA 1OWLA 1WG8A 1EU1A 3I37X 4H7HA 2EGGA 4EAAA 4Z7OB 4GKAA 3KK0A 5ITQA 1HMYA 5EKDA 4PDKA 4XOTA 1U78A 3C70A 4TKVB 3G1MA 2K9QA 5EQDA 3DPUA 3ZWAA 4AURA 3OPNA 3GO4A 2ORED 4DIOA 5DBIA 1Q1AA 4OSEA 4L57A 4IDQA 2NX2A 4UHDA 3B89A 1PUXA 2HU2A 3H3UA 5E6JA 1TMOA 1T9DA 1VE7A 3ZTWA 3VK8A 3AHHA 3TSOA 2PLYA 3D7RA 2R66A 3OTOM 4CICA 2BFFA 2P2ZA 3DVQX 4XLHA 3P0JA 3E35A 1H3EA 1U7OA 3I0ZA 2DOAA 2HM7A 3U61B 4U9UA 2VXYA 2XB5A 4U7GA 1CYEA 2BFEB 1B6TA 1L7EA 1L8QA 3DKVA 1LXCA 2FWPA 4OHMA 3RAJA 4IEFB 4NS1A 3FCYA 2R5YA 2C8LA 5JHFA 2YCLA 4W63A 5AM5A 2BHZA 3P9PA 3JRIA 3DFUA 1QQIA 2GAOA 1XQWA 1PEDA 2E21A 4JHXA 4PRYA 5IT9Z 4KOAA 4POOA 4W6QA 1WHSB 4DCJA 4V38A 3D4PA 2P6OA 2W85A 4KLAA 1DIRA 2QMQA 2VP9A 4HDVA 1G5QA 1JR3E 1P4GA 5FFFA 3ZE7A 2NVXJ 4MA0A 1KQGA 1TTPB 1FFHA 3AG4H 4PPGA 2Z1NA 2IXTA 2GZAA 5M5WJ 4FGJA 3GN1A 3TOBA 4BOYA 2ZS8A 2LFBA 2EATA 1P1RA 2I6TA 5F51A 5AXDA 4LI3X 3F5DA 5FLVA 4FGSA 1XGNA 4YJ3A 4BGEA 1MBFA 3ZE0B 1WFXA 1GARA 1ZJWA 4KDEA 3QVMA 1TCCA 2LKCA 5J58A 3FNIA 3UHFA 1ORKA 3OPMA 4KB5A 1XL1A 1UDBA 2QX4A 3Q3CA 1R0SA 4IGEA 1V37A 1UKCA 4MW1A 4COOA 4GXTA 4IY1A 4A5OA 1STOA 1BRMA 2BXYA 3KTFA 1V9CA 4QDZA 2HHHB 5HM8A 3O6BB 2HD4A 3OZXA 3VNRA 1Q0QA 3A4CA 1FC0A 4XQGA 1DKPA 1N0WA 4DY4A 4FWDA 3F4LA 3O1LA 3RASA 3FXAA 3KZCA 3VI3B 3CUUA 3PGVA 3PNOA 2OC6A 2Z04A 3LQ1A 1HLDA 4Q93A 4KO1S 3L6RA 2ZEJA 2M7BA 3UWDA 1D09A 2LR0A 2BEUB 1V95A 1SC1A 2HYIC 3N6RA 3RRFA 5A2QS 2E5LM 3FCXA 2PEZA 3G8DA 4KQCA 1E8NA 1JDNA 2LDUA 3HSEA 2H4HA 4H16A 1TB4A 3AI7A 4IXMA 4JLSA 4KLZA 2ZNYA 3HEFA 2GF2A 2ZLBA 1KO1A 3BTUA 1HQKA 1U2GA 1K27A 1AKRA 2R7FA 4UV9A 3RJZA 2JK1A 1HDDC 4KL8S 1PYVA 2H1IA 3VHLB 2KI5A 2J3KA 2XAQA 1FNSA 3KJHA 4HRIA 5AJUA 4NX2A 4DJTA 4W82A 3DL7A 3WWZA 5IC6A 3B1FA 4PLZA 3R7SA 2FX2A 4JI0B 2CH0A 1KBZA 4A36A 13PKA 5JNTA 4B7HA 1PFWA 1RAAA 4MR7A 4UNSA 2IGTA 3LNQA 4BJTA 4M7