1W5TA

Structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
403
structure length
394
Chain Sequence
b'GLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSTTLFRLAPHLPADRLIEVVDNIIQAKMAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORC2
publication title Conformational Changes Induced by Nucleotide Binding in Cdc6/Orc from Aeropyrum Pernix
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Dna replication initiation
total genus 140
structure length 394
sequence length 403
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09079 Cdc6_C CDC6, C terminal winged helix domain
A PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1w5tA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w5tA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w5tA02
4RAZA 4V0LA 3AVVA 4DRZA 1YLFA 3K70D 3ASYA 1S6LA 1H0MA 4IDOA 1ESMA 2VBWA 2VA8A 1DEKA 1E1RD 3GLFA 1N6OA 4FMDF 3CUEF 2M87A 4DDVA 1OB5A 2IYYA 2OXCA 2PH1A 4TZ0A 5DD4A 3ZVMA 1U9IC 1XD9A 4LLGF 2Y0MA 5KSZA 2HYIC 4L9JA 1Z05A 1N5LA 2JLRA 2IS6A 2K02A 2X4HA 2A61A 2AHOA 1DE0A 5HLIA 4RCZA 1OLOA 1B1BA 3QU6A 1P60A 4LRSA 2A6EF 1YRBA 4XWAA 2NGRA 4P0TA 2CCJA 3I53A 3V8JA 4B71A 5FPHA 1R6BX 4RCYA 2OHFA 3T1OA 2LKPA 4CO8A 1KNQA 2GEVA 2R3SA 1SMTA 1E2QA 3MMPA 4IVNA 4LB5A 1FYKA 2D74A 4KSBA 4UJ5A 5ELXA 1OMIA 5CLLA 1ZLKA 2AX4A 3BB3A 2YWHA 1GILA 1E2XA 3QKUA 1R10A 2EYQA 3OIUA 1R0XA 2D1VA 3UG7A 3K1JA 3ZGXA 5JCZA 5DDGA 4P3YA 1FC3A 1G7TA 4OHYA 3Q5FA 1FPMA 1RRGA 4JJKA 2PFBA 3M1EA 4IRIA 1COWA 2QTHA 1KI4A 3LWNA 2EQBA 4B8XA 1Z6RA 3ZVLA 2C95A 4C0QC 4E09A 4Q5SF 1FFHA 1Z5ZA 2ZS8A 1T5IA 2O8EB 1ONBA 2X77A 4HX8A 1W7PB 3LAWA 1QBJA 2BV3A 4TLEA 4TMTA 1R1UA 1GNQA 4IDNA 2WIAA 3RYTC 4IKEA 2Q6TA 1XMJA 4K46A 4R9UC 2CNWA 1ZC4A 5HE8A 2A68F 2K7LA 3RIRA 2ONKA 4JMPA 1YIOA 1E1QA 3NBXX 1MD0A 3PVSA 3MGCA 5JI2E 1NVVQ 1N0WA 4JZKA 3VR1A 2WSSA 3E6CC 3F8TA 4I4LA 1KDPA 2WPDA 4J0QA 3U6BA 3H84A 1GUAA 5CVVA 1OFUX 5DYGA 1T98A 1Z8FA 3AF3A 4LLNA 3IQWA 4A6EA 3L43A 5DGXA 2HFHA 2OQGA 1BS1A 1UDXA 3IIKA 2G1KA 1FX7A 2VHQA 5EUMA 4EJSB 2RGCA 5JVTA 2OUKA 4AKHA 1E9FA 2YYZA 4IOKA 2VHCA 3KZYA 3Q5DA 4Q9JA 3TW4A 1R4AA 4ZYEA 4RFVA 2XAHA 2QE7A 2Z4RA 1U5TA 4L5BA 1N5JA 521PA 1VHLA 3TH5A 4BRWA 1RPZA 1KK0A 2EWVA 2R62A 4XWKA 2AD1A 3EPKA 2W24A 2PL3A 4JQFA 5FR1A 3VKWA 3Q9LA 2ZFWA 1PZNA 3CWQA 3TSOA 3OV8A 4WWCA 1W0JD 2YPRA 3ZYCA 4F4JA 2TDXA 1MKYA 4NPHA 3ZIAA 2UXNA 4ZI3A 1JHHA 4BPBA 3ZLJA 2EFGA 3C4JA 3V8KA 3BBPA 3AF2A 1NLFA 3B1ZA 2VP2A 1TU4A 1U9IA 4DZZA 1P4SA 3WMGA 1XDUA 4CRWB 2FU5C 2OQRA 4OJKA 4JLAA 4EQQA 3MFKA 5C4MA 1KSHA 1P3JA 3ZZTA 5HS7A 1F2TA 4B44A 3A1VA 1BC7C 3GZ6A 2VH5R 4AIIA 4LCBA 2HYFA 4MQ9F 1LB1B 1OXVA 3FMFA 1SXJE 4LJ7A 1Z2AA 1G6OA 2RGDA 1DG3A 2WMOB 4EJWA 4BYYA 2GZWA 2HT6A 3C1DA 4LGMA 3H3UA 3DHWC 1SHKA 5DI9A 4S2EA 1HYQA 1AS3A 4EIWA 1GKUB 2QSZA 4FCWA 3QBVA 5FBRB 3W8RA 3LA6A 5FLXK 1E0AA 3J81Z 1MR3F 2L4MA 4G1UC 2GXQA 5F6FA 2ZVPX 5EXPA 2ISYA 1E9SA 1PLLA 3B13B 3NBZC 1VHTA 4KFRA 4LRWA 4MGKR 4EPVA 4KLNA 2QAGB 1IF1A 2ZRIA 1BIAA 2O03A 4KICA 1Z6YA 4GO1A 2BM1A 4MKFA 4L9WA 4O6JA 5J4VA 2FGKA 1OR7A 2A78A 5DI3B 1E2KA 4F7WA 3IPYA 5FD6A 2HKOA 2KSQA 4YQFA 2VODA 3PUVA 4WF2A 2WMNB 2CO5A 2XAQA 3I59A 2VP5A 3GUDA 3VU9A 5LD2B 1O3TA 1ZD8A 3C8UA 4BFXA 3NBFA 1PP8F 2N1BA 5FUXA 2W6IA 3CW2A 3WYGA 2CYYA 3I4LA 1CIPA 5KHOC 1FSHA 5KPDA 4ESJA 3HIFA 2BIFA 4GYIA 2OEPA 3FKQA 2P7CB 2EFNA 4YFKF 2P2LA 2VT2A 3HSRA 1R1VA 4XLPF 4V0ME 3P9KA 4KYUA 4D26A 1KOFA 1ZM2A 1ZIPA 1JJVA 3BB1A 4OQFA 3OEHA 1S8NA 1UCRA 3K69A 1LS1A 1A7JA 3HOSA 3NBYC 1ZAOA 5LEKA 1U81A 2HS5A 4M1WA 1XXHA 4O2LA 2LWIA 2ORIA 2Z33A 1N6LA 3FDIA 3I64A 4P32A 4ABYA 3E97A 1HUQA 1TNSA 1KI3A 4EPTA 2AXNA 2J0QA 2C04A 3CRQA 1R5HA 2L02A 5KK1A 1J0RA 2HWVA 3GCGA 2W83A 4DT1A 2PX3A 4ASNA 2FPLA 2ZR7A 4FWTA 2V8OA 2P6RA 5H6QA 3FX3A 4I09A 1UEJA 3QPHA 4QKQA 1E0JA 2KWIA 4Q1EA 4M1OA 4MGRA 1TQ4A 1DAHA 1R5GA 1U8YA 2XJ4A 3OHMA 1IJFA 5EE1A 2IX3A 3U3JA 1GRNA 3EQLF 4PANA 2NNYA 3PEVA 5FOXA 2F55A 1E0KA 2DPXA 1EX7A 121PA 2HF9A 3BFXA 5TARA 4AWXA 3ICQB 1F2UA 5LLQA 2Y48A 3ABUA 5E20A 4FW9A 2QZ8A 721PA 3HSEA 2ZVQX 4HYYA 4KBFA 2ODEA 3B60A 1RZ4A 4D25A 2QGZA 4RB0A 4LK2A 1G291 2NMVA 1IONA 2WM9B 3QF7A 4LWZA 3VNUA 1BI3A 4NCNA 4DB2A 1S1MA 2J5OA 4HSEA 2O8CA 2CQKA 5DO9A 3S1AB 3BY6A 4AI6A 1FMLA 2X2FA 2XV4S 1XTSA 4HUTA 3ZMUA 4P4UA 3KJEA 4OHVA 4M6XA 1VMAA 3PUXA 4G6DA 1E9EA 2AXLA 2F3TA 3GMTA 1W48A 5DEQA 4BWYA 621PA 1P2TA 4XD7D 1GL9B 2BCGY 4A2WA 4HEJA 3K9TA 3MQ0A 2PZFA 3FF5A 2Q21A 1XJ0A 1B9MA 3V4FA 1F5TA 3L2CA 3B1WA 3U3MA 1VECA 1IN6A 2RKOA 2PJZA 1KSFX 3TO7A 2P6UA 1DPFA 5D5UB 3NHAA 1I1GA 1YYVA 1W4MA 2EV6A 4LD5A 3QP6A 5HCIA 5IF9A 3GLFB 1CR1A 4HW0A 1SXJC 1TU3A 3K2ZA 4XSHA 3RSOA 4RKFA 3GLGE 4JLKA 2PBRA 1NN0A 4IJMA 3PCRB 4GSYA 3CO7C 2E1RA 4CIDA 8OHMA 1T39A 3V4GA 3BWDD 1ESNA 5BPIA 1I6XA 4B76A 1NY6A 2AFIE 4QLCU 3U4QA 1LNWA 3MWJA 5H68A 2V6JA 3IKJA 4O25A 2FEOA 1ZHFA 1D8KA 3CF0A 3WE2A 1DS6A 2EU8A 2OFWA 2P4WA 4N9HA 4XJXA 3FTQA 4TV7A 2DPUA 1M7BA 3NC1C 3U2QA 3TSZA 1E9BA 4Y17A 5KPJA 4N0BA 5L3CA 2AFHE 2IXFA 3EWAA 2OU2A 2CHVA 1X6VA 1SFUA 5DV5A 5ICFA 2RGXA 2Z3YA 1S9HA 3T5XA 2L01A 3JTGA 2HR3A 2YX4A 2FSFA 2ODBA 3QENA 4BLSA 2V54A 5EEGA 1FTNA 2R8RA 4BGDA 1OH5A 2NTYC 1KI1A 5J6XA 1S0UA 4QGFA 4QXAA 2ZMEB 1OYIA 3BPVA 3P9CA 5CVJA 1BKDR 2PN6A 5FBQB 1OXXK 2JLXA 1K78A 2AD5A 4TT3D 1GNPA 2YOGA 3TK1A 4HBLA 2RH5A 3N2IA 2RVCA 3SZTA 3LY5A 3VTKA 1ZIOA 1NMYA 1OXUA 3N97A 3SYKA 2IPQX 1F60A 4WCGA 1GFIA 3CX6A 4BASA 4OBEA 3LWFA 3B2EA 2DU9A 5EP1A 3E5XA 4NQWA 4OOIA 2F1IA 3B6EA 4GP6A 4JSTA 2GF0A 4Q7KA 3EZ6A 3T1TA 2WTEA 5JWOA 1E4YA 5ILVA 1LF0A 2GBLC 2BHRA 2VSOA 4U0VA 5ILUA 1STZA 5CJ9A 4PC2A 2WKQA 2YWGA 1YR6A 3NXSA 1JR3D 2OA4A 1U8AA 1M74A 4HX4A 1GL6A 1MABA 1U94A 2XOKD 3GJ3A 3SS8A 4UQOA 2DWOA 4UNNA 3TJZA 3L8YA 3BERA 3K09C 3GEIA 5FTNA 3KL4A 2KBEA 2P5KA 3MWMA 1G8FA 2QRZA 1VPLA 2Q3MA 1Q21A 3PV0A 1U5TB 3U3RA 4LJ9A 1X86B 2UZIR 2IUUA 4DJTA 1AOYA 3IO3A 4S05A 5AJYA 3VNVA 2H6BA 3V7CA 4DCNA 5KO2A 3IBGA 2DW4A 5HOOA 1FOEB 1FW6A 3EZ7A 3MWKA 1YW9A 2XUBA 1QZMA 1NLZA 1X8LA 3IUYA 1M1YE 3QUSA 2JASA 2OESA 1H8EA 5JCPA 2J0SA 1W4RA 1S4QA 2CLDX 3P4XA 5E4FA 1WB9A 2GXAA 1KI9A 3NRVA 1T6NA 2A2ZA 2ZR0A 4D6PA 2RN7A 1W49A 1SXJA 3DMDA 2DTRA 4DDUA 2GA1A 3P27A 3OFND 2EV5A 4ENNA 3A4MA 4LYFA 4P4SA 3KKQA 3VAAA 1FBSA 3WTZA 1UBFA 2XX3A 3CBQA 2UVQA 5DN6A 4E70A 3R9WA 3A6PC 4FT8A 1F2TB 3V7SA 1FNMA 1L4YA 1OIWA 2QPTA 2KE5A 3LW7A 4ARZA 1CF4A 2ZSDA 4HDCA 2H94A 2R6CA 4BUJA 3VHLB 5FBWB 2I1QA 4Q1BA 1L0OC 3UKDA 1G4UR 2HXYA 1AZSC 1TNDA 2Z0MA 4NCIA 1KNXA 2XJ9A 1KI6A 2C9YA 4JLBA 5JHHB 1IW7F 1ZG3A 2PZEA 4RGSA 3LX5A 3TR0A 1DG1G 1P62B 2ZSFA 5IRCD 1KAGA 3RYRA 2EFEB 1T6SA 1ZU5A 3R8CA 4DLXA 2HQNA 1XGNA 3LNCA 1AN0A 4RFSB 3E6MA 1BC8C 4QNMA 4GITA 3J80Z 2ZJYA 3WNCA 3PQCA 2RKHA 1FL9A 1OFIA 1DADA 2BEKA 4FCVA 1GG2A 3AVYA 3D31A 1II0A 1YS7A 1XSVA 3IHUA 5JHUA 4NKRA 4UNSA 1XEWX 2IA0A 4M9ZA 4MYUA 4Y0VA 3GLHB 2RDPA 1QO0D 4EJUA 2YZ2A 2RCNA 1Q57A 3I59B 3VU9B 3AF0A 2F1HA 5D3MA 5J4YA 5DD8A 3WGHA 2MLGA 2TMKA 3K0FB 4YMVA 5DHFA 2DR3A 4LC0A 3FM3A 4KXFB 4RD1A 4Z51A 3B1VA 3L09A 2O3FA 5CYVA 1HE8B 2GBLA 4AG5A 1DAMA 2KKOA 4Q48A 2IRFG 3EYIA 1A04A 1RE0A 4PO9A 1W36D 1JXOA 2P65A 1RYFA 1XDSA 2WVJA 4R79A 5ICCA 4GBMA 2XKOA 4FWHA 4DSNA 5DNYB 1Z9CA 2FSGA 5FFMA 1JE8A 1MO4A 3ND9A 4C9BA 1WBDA 1XMAA 1H9GA 3EPLA 3K09A 3RPUA 5JRJA 1LVGA 1WWXA 3B73A 1VTNC 4X8OA 4QJ3A 2ZSAA 2QP9X 1R0ZA 4G5SA 4PR0A 3CX7A 1XXHB 2HEOA 4KHZA 1WCV1 1AS2A 3SJCA 1ZM4A 2W6JA 3CIOA 4ON9A 5FL7A 1RRCA 3QEJA 1GXPA 2DY1A 1N2CE 1S3SA 2IHBA 1E2JA 2ZRHA 4ZCMA 5FB2A 5DISB 1NBMD 3I61A 5G3YA 4L5IA 3WTXC 1C9KA 1Q1EA 4JBXA 4HI0E 2DWPA 1ZYUA 2VP0A 3QEOA 3BXZA 5L3VA 4BLRA 4RJLA 1XPUA 5LPNA 3EETA 1W7PA 2X8AA 4M6YA 1G3IA 2DK8A 3EDPA 1IRGA 4NCKA 3WNBA 3PJRA 2GAOA 4R7ZA 2JRTA 2F5CA 3FMRA 1IY1A 2R65A 1XN7A 2J45A 2A7QA 3SZRA 1XPRA 1GVNB 3VEPA 4AWXB 4FX0A 4PX9A 1YZLA 4DC9A 2GZAA 1F2UB 5CVIA 2ZYUX 5DYMA 3C14C 2DZOB 3KXLA 3I58A 2R9VA 3LH5A 5ICEA 1P6RA 2ATXA 5LHGA 2QUZA 3OIYA 4MGIR 1QG4A 5SZIA 5FOWA 4DCVA 2CW0F 1AIPA 1CTQA 1R0YA 3AVPA 1ZGJA 1G3WA 1NI3A 5CB6A 2Z83A 2D45A 3AVQA 4B3CA 3VLFB 2O8CB 1ON1A 1RZ3A 1SVWA 1NVVR 3HU1A 1G3SA 2DBBA 2VQSA 2JLZA 1TEVA 1YQAA 2G6BA 3EYYA 2D2EA 2CEAA 2AL7A 3RAPR 5LHIA 1C1YA 4WW0A 3GLGA 2NO0A 3WTTC 4DKXA 5KVRA 2GRJA 5BPDA 2CL7X 3AP3A 4G9YA 4MKIA 2GXSA 1TQIA 3WBJA 3CLOA 1EFTA 4QL3A 1KU9A 1K79A 5HZKA 4JK1X 1VYVA 2HYGD 3X2SA 1ANKA 4AURA 2PLFA 1KO8A 4AYTA 1XCVA 4QGHA 5F98A 2R2AA 3Q7QA 4NHOA 4RSGA 4YXWD 4TL9A 3NKVA 1UJ2A 4N1AA 3IRQA 1K5GA 2WWFA 3TAHA 5JEEA 5JLJA 3EG5A 2R7DA 2OXRA 1QHSA 1XJQA 1COWD 5DCFA 4YIIA 2GCOB 1FX0B 1W0KA 2VE8A 1L3LA 1ETUA 2QMEA 5B57C 2BYVE 3DPUA 4UXIA 4GXOA 3L82B 2JJ1A 1DP7P 4YG2F 4LHYA 4LPSA 3GJ4A 2GXGA 4MYHA 4Q03A 3VR2A 1G3YA 1O87A 2CNWD 2KJQA 3MAJA 2HCBA 2ZI5A 4TMWA 1ZAKA 4MITA 2F5EA 2ORWA 1BH2A 4NTZA 3R20A 3VKGA 4L9SA 2ANBA 4YDSA 4GP7A 3EPJA 4ESFA 3GFJA 2PLRA 4FCTA 2MSEB 2WSSD 3WU1B 1KK2A 2WWHA 2CE7A 1G6HA 2D2FA 4LPKA 5CJPA 5BQ5A 3W34A 5JSZB 4EFMA 4FWGA 2WPDD 4BFSA 4MDEA 2EFPA 5CM8B 2SHKA 1Q1ZA 2V1XA 4KAXA 1YO5C 1JBKA 1SVOA 3KUCA 4URWR 4DLSA 4F91B 4ENMA 2QAGA 1UDWA 5FUVA 2XZLA 2OCAA 3DDCA 1OHHA 2VF8A 2FNAA 4KNYA 2F2EA 4MRSA 1G8HA 1K78B 3SQWA 3IILA 4B73A 3VODA 3LD9A 3UMSA 2ZYVX 5FTKA 4OI2A 2FWRA 2QE7D 4F92B 2F43A 1SD4A 2XNDA 5K5OA 5D8KB 1RC8A 2BBWA 2O0YA 2HDNB 1FP1D 2ZANA 2B21A 4TLCA 2PEXA 3ZMVA 4K81B 3G0HA 1HA3A 3O8CA 3EIEA 1CGPA 4Y15A 3D8BA 2DLLA 2GJAA 2HEIA 2I4IA 2HYDA 3ZIAD 2COMA 2B8TA 4FWDA 1KJWA 3RPQA 2IYRA 2ZSBA 3QKSB 1E9DA 4M72A 3VQTA 3GJ6A 4JL6A 2ZREA 1LQ1A 2BOVA 3FHZA 1MABB 1QG2A 2FMXA 3RLFA 3L0SA 6PAXA 1HSTA 2BM0A 5KOYA 4W5HA 2V4ZA 3AB3A 2GHIA 3IPXA 4C0KA 1KQ8A 4PO8A 2WWGA 3HHGA 1VCOA 2IJLA 3HSFA 4HLCA 4MQBA 3THYA 1HV8A 1GKYA 1OE0A 1XFAA 4IFEA 3K0CC 3K1PA 1NIPA 4F38A 1KTVA 3THXB 3GFTA 4M0LA 1HBXG 3TLXA 2QUFA 2A07F 3W3AA 4O2RA 3ZS9A 3EA0A 1AM4D 4BLQA 4DSOA 4WIAA 1KO1A 1RUOA 1A4RA 2ZJOA 3W8NA 4I99A 2IS2A 4QNRA 1SXJB 2PT5A 4N9IA 4DDTA 1LVAA 3HU3A 3BE4A 4BEBA 3AH8A 2FSIA 3T1VA 2V1UA 2ZRPA 3TGNA 1TQDA 2J1LA 2KB0A 2P3SA 2QTFA 1G17A 4QBGB 2GTPA 2IW3A 4HZUA 5KSPA 5LHHA 1F9NA 1G7RA 4HB2A 1Z08A 4EVIA 4CVNA 3MSXA 2O0HA 1KYWA 3RDIA 2P5LC 4ARZB 5CDFA 4A6XA 5E1WA 3P32A 3FM5A 4GCVA 2YWFA 4YIFA 1CJUC 4KA4A 3NVAA 4A1FA 1B9NA 1N6IA 2GK7A 1T9HA 5FGMA 2YHSA 4HAZA 2VBZA 5BOXA 2VC0A 2ISZA 1TF5A 1G4AE 2F6RA 1A2KC 2W6ID 4DLZA 2DO7A 1KI6B 2BVNA 4M1MA 2VL7A 2ZBKA 2OLKA 3T06B 1JI0A 4HF0A 3FMPB 1KKLA 2CDNA 1OPXA 4LOAA 4US0R 2BV6A 2G1JA 4N3NA 4RY2A 1J2XA 2VHTA 4G5RA 1XU4A 2YOFA 4A82A 5AR1A 5AUPB 4LYHA 3D3QA 3DFGA 4AIKA 4E22A 3EARA 2WV9A 4RZ3A 1E79D 3OEHD 2B0LA 2A5YB 3GYHX 1E2FA 1NVUQ 3OZXA 2IF2A 3F6OA 3TNFA 4Y13A 1T2KA 3ELKA 1O7LA 3RC8A 1D8TA 3HR7A 4NP6A 4OIQF 2JA1A 2IYTA 5K8IA 1L2TA 2J7PA 4M22A 4LJ8A 4LJ6A 3DEUA 4ESBA 2B92A 5D3MB 5FL3A 2FPKA 4MKGA 3ZJYA 5C2JB 3OEEA 1GWNA 1XTRA 2OT3B 1O3YA 1ZUNB 1AKEA 4L8GA 5HZHA 4MDFA 2XKPA 2A5DA 2GAAA 4BZXA 3T35A 3SYNA 3CPJB 2XB4A 1Z06A 3B1XA 3I4PA 1TAGA 1NVMA 1ZNYA 3DEFA 3EIQA 1R00A 4Q9LA 1P2VA 4HZIA 3FE2A 3HRSA 4IW3B 2F1JA 4JLNA 3CO6C 4LC1A 3SU8A 4KVAA 2GEUA 1HY3A 4NU0A 2ZS9A 4Q4LA 4WZ6A 5GADl 5TJJA 1DAGA 4CDGA 3VKHA 4DHEA 1V5WA 2E87A 5BN4A 2FOLA 4HQEA 2CK3A 3K0CA 1GKIA 2Q9BA 4DQ2A 4UNQA 3K1MA 1E2IA 4XBFA 1FUKA 3KZ1E 4W5JA 3K0AA 4LJ4A 3VHXA 5AJXA 4Z1MA 3OAAA 2PEZA 3ZD7A 5B64A 5A0FA 3ZQ7A 3W6NA 5FPKA 1ZD9A 2WTUA 3D7MA 4KFCA 2N46A 1KQ0A 2ERYA 2IEZA 3KKOA 5EXXA 3QP5A 2DFLA 5A2QK 3ZP5A 2YSRA 3HUGA 4B3GA 4QHYA 4HF1A 3FMQA 1UKYA 1ZU4A 2EFCB 4DCTA 4RD6A 3K8YA 2ZMEA 4L9NA 1NJGA 1RIOH 1IAQA 3L8ZA 4G5OA 1VIYA 1WBBA 4UVCA 4EJTA 1GIAA 1NG1A 1OXTA 1ON2A 2O52A 4GOKA 4DUGA 1XTIA 1J8MF 3IO5A 4GDFA 4BQSA 3WTWC 1IN4A 1Z28A 4KU4A 4HAMA 4A5MA 2FMYA 1W4AA 1DAKA 2VO1A 4Q19A 1WRJA 5E17F 3SFVA 4AYXA 3O2PE 4A0XA 3NH9A 5KDDA 1FBUA 4DWJA 2OBNA 2VT3A 3W3ZB 1KYIA 3MJHA 5FLXZ 2UWMA 1AKYA 5J4KA 3LA7A 1I4DD 3I71A 5LGNA 1KHTA 3B1YA 3EWSA 3HJNA 3U7EB 1PUIA 3IDQA 1OPCA 5CM9C 3GJ7A 3IIJA 3UPUA 4ASUA 2QPOA 3H3ZA 4RB3C 3MWLA 3C5CA 5GVSA 1R2QA 2REBA 3TVDA 4EDHA 1EG7A 5K5RA 1P5ZB 3EXAA 4EMSA 4B32A 2VN2A 3N4MA 2VE9A 4B2LA 2JDIA 3RS3A 5DCMA 5J8CA 1YZTA 2NO6A 4B48A 4IPAA 1KO7A 1XWIA 1U2WA 1SD7A 4UVAA 5CVRA 2WKPA 3GLGB 2WZQA 3QPVA 3THOA 2GWRA 2NZJA 3T1BA 3C41J 1FP2A 1TF7A 2HOEA 2NO1A 3MJRA 2STTA 1NSTA 3IHWA 2ZRKA 1SFXA 1CF7A 4MRVA 5E3HA 3B9PA 3K9LA 1F5NA 3H86A 5HTKA 1XDBA 5DUKA 1G3RA 3AVWA 1MZBA 3ROUA 3HHHA 1ZRHA 2BMDA 3A4LA 2ZNZA 4LYJA 4Q5IA 1XTQA 1MO6A 4EGZA 3QXXA 1BYUA 1KI7A 4JLOA 4PGHA 2W84A 1VTKA 2VRWA 2WJGA 1FNNA 1WI9A 4EJVA 3NH6A 1BI0A 4M1SA 2PLYA 2DVWB 1SZPA 2N42A 1D9XA 3GFPA 2E1NA 1HKTA 4G01B 4PAOA 3WP0A 2ZRBA 2Q2EA 1YJ5A 2VTKA 3CTAA 4HV6A 3AP2A 4TSFA 3J81k 3E6BA 4AIJA 1XD8A 2UZKA 3ULQB 5J40A 5D4RA 4A9AA 5F3WB 1O3QA 1EWQA 4A8JC 5L3RA 4LK1F 1QDEA 1IUYA 3AEZA 1G8GA 2ZUCA 5HVQC 1J8YF 2JEOA 2G0NA 4M9SA 4LJAA 5C18A 1JALA 2PT7A 1R22A 4HDUA 2QEQA 1YTYA 4JKIA 3U7HB 1KDRA 4HYEA 2PMUA 3GFMA 1ZVQA 4BRUA 3KP7A 2ZXUA 2ZRNA 4I01A 3LO5A 2W2XA 2X0LA 1SD6A 2GESA 3WNDA 5D6EA 2GEDA 3MRSA 2IYVA 4TL6A 1N6PA 3RI4A 5E95A 1O3RA 1DO2A 5LD2C 2HKXA 4M73A 2Z9OA 1XPOA 3X1DA 3ZD6A 3P9IA 1XMKA 4OU0A 2D4HA 2GVZC 3OIWA 4YONB 3SXYA 3T8TA 2ZJAA 3ZPLA 1P9WA 2FE3A 3P20A 5GJCA 3ZVNA 1G1MA 3TGPA 2GDJA 1MRNA 3GLHA 4GFDA 4DNCA 2QZ4A 3RNLA 1S3GA 2LNBA 2F43B 2H17A 4UHTA 2V9PA 3AUYA 1XJCA 1RI7A 3TR5A 5AIQA 4BXUA 2GVDC 2IWHA 1WP9A 4D4JA 3K0FA 3U44A 2OCYC 4PAQA 1Z0IA 1IY0A 1G20E 2OBLA 5JS8A 1KYZA 4II7A 3AUXA 3THYB 4CEHB 4HLUC 1GSIA 4KMUX 1RNLA 2FEMA 2XB2A 1ZM7A 3TBKA 3GFOA 2WJJA 1W5SA 2VBXA 4B43A 1UADA 4U7BA 1UBEA 4I0BA 3GJXC 4A12A 3A58B 4JBWA 4B2IA 1XNJA 3KTAA 2JZYA 1E9RA 1BOFA 4IRUB 4Y0AA 1REPC 4LBWA 3KEOA 5JR3A 1AK2A 2HXSA 3FMOB 3SEAA 2BMFA 5LGTA 1TF2A 2FBHA 2FSWA 2FN4A 1OIXA 4H9GA 4G7HF 5EE9A 4HAXA 5DN6D 3QXSA 2ESNA 3F5FA 5C1BA 1DELA 3V7RA 1UKEA 2XEXA 3WTSC 3CUQC 1LV7A 2HLDA 3E1SA 3NDPA 2HZTA 2CCGA 4AYWA 1ZC3A 1UEIA 1CEEA 4EPWA 5KUTA 4BLOA 3H0KA 3KFVA 1E94E 4I0AA 4U88A 1QHHA 5FFXA 1P9RA 1WMSA 2ORVA 3KKNA 3GPLA 2O8XA 3K9NA 5E7MA 4DDWA 5KNBA 2ZXJA 1VG0B 1Z63A 3THWA 4ZYHA 3HOTA 3WODF 3ZMDA 2IP2A 3SBDA 4CF7A 5D6FA 3T12A 2DB3A 2AN9A 1C0WA 4FI3C 4GPTA 1VG9B 5EJEA 4W9MC 1IXCA 2ZRLA 3RVBA 1MOZA 4Q1FA 1X8JA 1XX6A 2QMUA 5FOSA 3PFIA 3Q85A 2QQ9A 4AY2A 4WXCA 4ACBA 3DOFA 4HZUB 1YKSA 5SZHB 2GZDA 1NF3A 1RYHA 3REGA 1XMSA 2QORA 4KFTA 3MAAC 1Q12A 2FV8A 4OMYA 4KLZA 4QM6A 5EXTA 1E1RA 2RGNC 4FN5A 5ED4A 3VB2A 2ZM5A 4ZPXA 2FOKA 1K6OA 4A2PA 1KZ7B 4JLDA 4EAQA 3FKSA 4TYQA 2OZ6A 4A8JA 4LB6B 4A36A 3GFLA 5KDLA 5TMPA 2YKGA 3P26A 4JLJA 2EFWA 4JJZA 1XSDA 4IHSA 4EPXA 2WHXA 3FB4A 4JVNA 2MA3A 1IXRC 1G19A 3MWYW 4HATA 4TYNA 1NSFA 1G3UA 3GLIE 4L18B 4WOPA 2JJ8A 4N0EA 4RZUA 2CWEA 4LSGA 2BJVA 1SVLA 5CYOA 1I2MA 2QMOA 2MBFA 2J5PA 1OJLA 1TW2A 3MLEA 4PC1A 5GVRA 1U8RA 4I2OA 1HE1C 2VBYA 3FXUA 5EUQB 2RGGA 1R5OA 2W6JD 1J70A 2FH5B 2ODNA 3C7KA 3GD7A 2IYZA 4JVMA 4TL7A 5FL7D 2WJHA 4Q7LA 1TLHB 3X1YA 2QLZA 5IK2A 4AKEA 3AJIB 3QG5A 4HLUA 2VPPA 1OB2A 4DCUA 4BE7B 5JFGA 4IFBA 4US1R 1WXQA 2GJ8A 2WBLC 4IXMA 4PFSA 2V6ZM 4RVCA 1CR2A 4V03A 2GCOA 1WKMA 1FX0A 3H92A 4NONA 5IHPA 2H09A 3NEUA 3TVTA 3ETLA 1W7PD 1KJYA 3BH7A 1J9IA 2F9MA 4G6QA 3AF1A 4OYHA 1ZBDA 2GZHA 2HCJB 4G7OF 1ZH5A 3LA2A 1CR0A 4OJQA 4PTLA 4TTRA 1TX4B 2ZEJA 4Q9KA 1NG9A 4PCQA 3AKCA 4OIRF 5FPSA 4UKDA 2DWZB 2W57A 5ERIA 1JPNA 2WJYA 5CIWA 4BFUA 3I62A 3QSYA 2MSDB 2C5LA 2V9VA 1YR9A 4PHGA 3K0AB 4IDQA 1KMHA 2J3EA 3HPRA 2P5SA 4C30A 5JSZA 3LRPA 4TQ9A 1SVIA 3N70A 3R0AA 2BWJA 3KP5A 3FXQA 2GNOA 3SN6A 4B3FX 3WHLA 4YMTA 1Q1HA 3GJ8A 2XVCA 2ATVA 4LHWA 1RIFA 2IA2A 3GLXA 1JQLB 2ZYTX 1VYUA 1W2GA 2H5EA 1HURA 4GOJA 2Q0HA 4LHXA 1XZQA 1P2UA 5HDGA 3MZHA 2KIMA 2WOJA 2ZJZA 3K9GA 3PG5A 1NHAA 4YMSA 4A2QA 1IRFA 3WY9A 1ZGAA 2P7VB 1JR3E 2QQBA 2GXUA 1P92A 4GT1A 3KZZA 2RGVA 1AGPA 4UV9A 1X1SA 1E2MA 2AKAB 1FZPB 1IZ1A 3CZPA 3RKWA 3NQOA 3WG9A 3IL2A 2Z6VA 3C16C 4M21A 4JVLA 3LLUA 2YC2C 1LW7A 1CJMA 3DV8A 1HEIA 2NNNA 1G7SA 1Z83A 2MH2A 2FBIA 3ABTA 1I1SA 1KSJA 1NP6A 1SVSA 1IAWA 3AKEA 3L0IB 3LLMA 3ZQJA 1EH6A 2FEZA 4XRFA 3F6VA 4F7ZA 1KJZA 5FPYA 3HYIA 4BFVA 5L3QB 3QKSA 2QT1A 4PPNA 1VYTA 4E07A 1GOTA 1ONVA 3T0YA 1KAOA 1ZNWA 3MEXA 3ML6A 1N0UA 2ZE6A 3SYLA 1RJ9A 1N6NA 4G5QA 1JEEA 5AIPA 2M5WA 1UFMA 5E7IA 4CEIB 3LQQA 1G8YA 1EK0A 1KO5A 5DCMB 1DAFA 2MMGA 2P67A 1W0KD 2PEYA 3CNLA 4HB3A 5JZVA 2MH9A 4XSXF 3FWEA 3LV8A 2JJ1D 2B8WA 1ODDA 1G41A 3QPUA 1YVDA 4IHQA 5BQTA 4OQNA 3W90A 2DFIA 5K5QA 1QHXA 1XZPA 3RWMB 1Z1DA 3THXA 4ZKEA 1CF7B 3IHLA 5B58C 4C0BA 2RMKA 4ENKA 1M6NA 4BZPA 4GMDA 4ERNA 2H57A 3TQFA 2QBYB 2MSCB 1OSNA 4KDPA 3KW6A 2XAUA 1I5ZA 4NCHA 4PC3A 3W6OA 4JN6A 2BBOA 4N0DA 5AUNB 5LBIA 2QROA 3TO6A 1G7CA 1X8KA 2WJIA 2O5VA 1MV5A 1Z07A 4P33A 2GJ9A 2E7WA 2XNSA 4CICA 2K27A 4QBIA 5FI0B 1E4VA 3I54A 3R0JA 4BH9A 1IHUA 1QVAA 2O8FA 1FPQA 1LS6A 5ILSA 1XD2A 3M8EA 1YZQA 1EFHA 2DYKA 2ZSEA 3JVUA 1SD5A 1OHHD 5IDVA 1WRBA 4WXDA 1HQYE 4C7OA 2IYWA 1M7HA 2G83A 2AR7A 2NPFA 3SJBA 5C4GB 2VYFA 1TQMA 2IL1A 4U02A 2OBPA 1NKSA 2J0VA 1MT0A 5AJVB 1KDOA 2JT1A 1S1CA 1V43A 4AD9A 3BJAA 2F7SA 2XNDD 3AQ4A 3KQLA 1V3FA 1WE2A 1Z6XA 2ESHA 2IUTA 2QTVB 5JBQA 5JRZA 3KDSE 4A5NA 2IYXA 3OESA 5H8WA 4JLVA 2A5FA 1Q1BA 2MC3A 1OKKA 5K8TA 5UKDA 4JS0A 2PG4A 2DK5A 2KJBA 4CGZA 1YZNA 4M74A 2EFQA 3RRYA 4A0GA 3T61A 1CBUA 3R7WB 1SKQA 2OM2A 3QPWA 2CJWA 5CK5A 2WWYA 4Z8YA 5H20A 3RRNA 4PDKA 1B4AA 3PIRA 4Q00A 1PP7U 2FZLA 3QBTA 3HYRA 5AUOB 3I3SR 4XLNF 3LX8A 5KU1A 3M7GA 2LF7A 2UXXA 2XTNA 1SVMA 4V0MA 4M1TA 2O8DB 4BNCA 2F5FA 3FVQA 4JL8A 4Q47A 2CLCX 4WBSA 4KN4X 4HA8A 4K8OA 1R8SA 2Z5FA 4Q9HA 3U44B 3ADBA 4DXAA 2M45A 3FFAA 4Q66C 1KI2A 4P96A 4EM2A 3A1TA 3IEUA 4NYIR 4FD2A 3ASZA 4WXRA 2XZOA 5F9HA 1U6GA 2ELHA 5D5WB 4A92A 3J7AO 2IYSA 2A3RA 3B02A 1R36A 4P9UA 1E2PA 4URZR 4W7SA 1DVRA 3KTAB 3BOQA 3CNNA 1FP7A 3W9YA 3U60B 2WWIA 3SC3A 3O6BB 1Q20A 2GCPA 3ADKA 3AVTA 1ZNZA 4Q01A 3BWGA 4PQRA 4M9XA 1YHNA 3GF2A 2C8VA 3A37A 4QC2A 1Q22A 1L8QA 1EV7A 1O57A 1DBSA 4OQXA 1B0UA 1YU9A 3ND8A 3B82A 5D5VB 1J59A 4YLGA 5HLHA 1QHHB 1PLKA 4JBAA 5FD5A 1G18A 2W85A 1RRFA 5AJWA 5HE9A 1DTSA 3THWB 1YFHA 3ZZ0A 2BBYA 2C9CA 1SHZA 1QPMA 1OYWA 1XEWY 3BD9A 1I4TD 2FF4A 3LBHA 4PHHA 1BN5A 3U1DA 2A9KA 1CR4A 1U0HC 3IEVA 1E2LA 2ZAOA 1ZARA 2ADUA 3IKVA 2QSYA 1XF9A 1Z0KA 2B6HA 4B2PA 1ZG5A 2XSZA 4M4SA 3ZQ6A 5HKKA 4JYCA 4W5WA 3F8CA 2WWWA 3PUZA 1ZCBA 5FH9A 3A36A 3DL0A 1FQKA 2M30A 2H8KA 2H18A 3RHFA 3RSLA 5FOUA 5J8FA 3RS2A 5G3ZA 1F4KA 4CEJB 3TUIC 3F8BA 3WP1B 1T0JB 3IRRA 3P7NA 2J7PD 1JAIA 2VSFA 3I32A 1G5PA 1GITA 5IT9K 4IVPA 4A8JB 3C18A 1AGRA 4DEYA 1F3OA 3EA5A 1VCMA 1X3SA 3F72A 3GQBA 3OEED 1FYMA 2PJPA 4V0NA 4URUR 1MKMA 1S29A 1YS6A 4UJ3A 2FQ3A 5HDNA 3NHBA 5DIFA 5H6RA 2J9RA 4RGRA 3OOPA 3TKLA 4MKHA 3J80K 1Z6AA 2I1VB 3ONWA 2XZPA 4MGYR 5FUWA 4XVUA 3EIHA 1FQJA 5JMTA 3DKVA 3U61B 4ESHA 4XOIA 2ZRFA 1BMFA 1LDJA 3T1QA 2KI5A 5DSZA 5A5GA 1Z22A 4C0JA 5HR5A 2RGBA 4ZV4A 3FGNA 1HH4A 2VEDA 4DVGA 4TYYA 1FTSA 3R4KA 1HW2A 1N25A 1NKTA 4UXNA 2O61A 1T3LA 3BIFA 4A3VB 2HUPA 2CK3D 3MZYA 1AQYA 4BZQA 1XGSA 3QXCA 2O6GE 1OV4A 2EA2A 4GMXA 2W0SA 2IA1A 2RNJA 3OAAD 4BFZA 4DLRA 4UVBA 3GJ5A 1NJFA 4Z1MD 4UNOA 5EEHA 1R1TA 1WA5A 2DBYA 2IYLD 2VF7A 1JAHA 2K4JA 4GGGA 821PA 2PX0A 5JEDA 1M2OB 3QQ5A 4UUVA 3AGQA 1LJ9A 3KX2A 4HB0A 4MUBA 4TT3A 2EK5A 2D7CA 1PLJA 2P6SA 3SOPA 3DOEA 4U0YA 3EC1A 1D8JA 3FHTA 1NN3A 4L9TA 5DLQC 6Q21A 1R58A 4MGZR 4CW7A 1B59A 3A1WA 4DUGD 1OW3B 3RS5A 1IQPA 4EUNA 1E1QD 1LTQA 1S2MA 3CO5A 1CRPA 5KNCA 3CUQB 3H1TA 1KA8A 3DPTA 3GJ0A 4M2LA 4L16A 5JI3E 3RDPA 4TTPA 5L3SA 1W36C 3JAMZ 1JR3A 3GXOA 1J75A 1GRRA 4LG0B 1Z7UA 1KY3A 4PAMA 1KMHB 4QJ5A 4JKYA 4OI4A 4RGXA 2XOKA 1C1KA 4LGWA 3GW2A 2UZ3A 4G7ZF 3HWSA 5SZKB 4ASUD 4D4MA 1W5TA 4TTQA 4R8HA 3F23A 2REOA 4MEYF 2W0MA 2WSMA 4ZDKA 2VHJA 3AVXA 1FWZA 2A3SA 4TMZA 3BZ6A 4O3MA 2JDID 3K1NA 3B78A 3PEYA 2B7CA 4FIDA 4ZH4F 2DT5A 1BBYA 2GF9A 4LBYA 2WJVA 4C0SA 3UXMA 3EPHA 4PPFA 4KI0A 2PMDA 1CRQA 1T3SA 1UHWA 1TW3A 1S7OA 5CLSA 4AIHA 1OXSC 2ZITA 5EP2A 3QKTA 5LB4A 1YQTA 3UANA 1H8HA 4FXPA 4M1KA 5F9FA 4IOJA 2QGNA 1U0LA 3L9FA 3QVVA 4PC6A 5KSYA 3F22A 3F3XA 2VIIA 4CEHA 1E69A 4UNPA 1I27A 5EE5B 1EESA 4WA7A 3ZMTA 4C0AC 1KY2A 1JXSA 2OE2A 4KN7X 3HR8A 3HRUA 3OF5A 4KSCA 4TYPA 3TO9A 2EYUA 5E7JA 2G7HA 1HKSA 2P5VA 2G9WA 4ZZLA 3O8RA 2YR2A 3TDZC 4LZZA 5LRSA 1FP6A 1RJ9B 3TMKA 4A0ZA 2IT0A 3AVUA 3WE3A 4B3XA 1KK1A 5CB8A 4D80A 3BROA 2J7KA 2DCUA 1WQ2A 5LRRA 1IOZA 4IOLA 1J90A 2OZEA 3BPXA 3CLVA 2V6IA 2QYOA 3ISPA 1BIBA 4ETSA 4TSFD 3LFUA 4L0YB 1XMIA 3HDTA 4RB2C 5JHGB 5K1YA 2DFKB 3HU2A 3O8BA 3S2WA 4MRPA 3JZAA 3NG1A 4OK5A 3OE7A 4D4LA 4OIOF 1NMXA 1L7VC 3GVAA 3P4YA 3CZQA 5TDHA 4TQUS 4Q02A 3F8MA 4B74A 3DKPA 2IYQA 4IXNA 3TW8B 1EFUA 3AVOA 1S3JA 1IBRA 2W58A 4D0GA 2FSHA 2OV2A 5DE3A 2O8FB 1QZXA 1XD2B 1H65A 3BP8A 4RFSA 2M8EA 3R8FA 3A1SA 2W2VA 3GFIA 4IJAA 2NG1A 5HS9A 1XGMA 2QL6A 3RANA 5L8VA 4C7OB 2Z4SA 1Z6TA 2OILA 4LJZF 2ASEA 2C77A 1J5YA 2P8TA 3RS4A 2JLQA 4XTRA 3GO5A 4CT5A 4DLWA 2FXAA 3SJZA 4H1UA 4BFWA 1TQ6A 3BORA 2HGCA 5GJVC 4PQFA 2M1BA 5FBVB 4UNRA 3TOAA 4NHJA 1G9XA 2IVMA 1XXHE 2QQAA 3U9GA 3NTUA 4Q7MB 3KETA 5CITA 4ZZDA 1EFRA 3W6JB 4OQMA 1T8TA 1TL7C 3U7GA 3ICEA 2YC4C 3REFA 1IY2A 4D81A 2FFBA 1R5NA 4I7HA 4LYAA 1ZW6A 4C4PA 4ZIRA 5CYPA 2DZNB 4ZKDA 2CJWB 3CDHA 4MYCA 3Q8XB 3L0PA 2OZUA 4A0YA 2JCSA 1KGSA 3NWJA 4NYIQ 2WC2A 4PSKA 1D3YA 4GL2A 3QE0A 5LBQA 1F1ZA 1J99A 2ACJA 2KRFA 4M71A 2ZJBA 4FWIB 4NYMR 4US2R 2BKUA 4HLXA 4OMZA 3UG6A 3BH0A 3QU3A 2HLDD 5BW8A 3H4MA 4QHSA 4M9QA 2Y8EA 2ZE8A 3WMFA 3ERED 1J7KA 2ZI9A 3EUHA 1KU3A 1YW7A 1T5LA 2W00A 5A4JA 1UAAA 4LFUA 1WF3A 1U99A 2W2TA 4WZAE 1OH6A 1XBTA 4ZYGA 3BH6A 3RRZA 2FZ4A 1UM8A 4KO8A 1Y3AA 2XASA 1UBCA 2QP3A 1CULC 3E3VA 3HRMA 1EGAA 3I8SA 4FMBB 4RD0A 2A5GA 3ZMSA 5BYKA 2CVFA 5FI1B 4KIFA 2BBTA 2EVWX 1I4LD 1SQ5A 4PPGA 1QVRA 3AKDA 4H0EA 4KBGA 1HT1E 1US8A 3V8LA 1O3SA 2XAJA 4LJ5A 4ZYDA 3F3YA 3M4YA 3KXIA 2C9OA 5AK0A 3NC0C 3TAUA 5JFRA 4V0OA 4CXFA 4D0NA 3VR6A 2YNMA 1GVJA 1IN8A 3CX8A 4UXJA 3CONA 4JVSB 4POAA 3QRFF 1YE8A 3VFDA 1LF5A 2FX3A 5ICGA 1T3HA 1Q44A 3CKLA 1NN5A 3FKSD 2V7QA 2ZETA 3LSTA 5DYIA 3LDAA 1FBQA 2WICA 3GEEA 4OKSA 1OT3A 1CLUA 1QF9A 2ZO4A 1ZUHA 2FPMA 3FWYA 4YDHB 3Q7PA 4L0ZB 4I81A 1OKRA 1GP2A 4QGAA 1SAXA 1OH7A 2ZTSA 3KXKA 2WKRA 4U00A 1P2FA 3O8DA 1JQJC 2HDCA 2MMCA 4HDOB 2XGJA 4RAYA 4JT2A 2EW1A 2BJWA 2GETA 4NYJQ 1QBKC 4P5OA 1S7AA 2EFDB 4LK0F 2DAOA 3GLIB 2NS0A 1V4RA 4Q1CA 5LB2A 4YXWA 2XAGA 5CJ2A 1CP2A 2QM3A 1KGDA 1PUJA 4ZDIA 3A1UA 2V79A 1NMZA 1T0FA 2GXBA 1DAIA 2ZU6A 4OQLA 4D4KA 4DSUA 4TYWA 3R60A 3IKTA 1LEBA 5L3QA 3K53A 1G3QA 3JW4A 4A0RA 5IK2D 4X8MA 3KP4A 2ZRMA 3RTRA 3CRW1 1MO5A 2QM7A 3MFYA 4YFNF 4UXHA 1T4GA 4KODA 4F4CA 2OFXA 2VHUA 2AWNA 4C0HA 2EA4A 2FGJA 1W4CA 3UK6A 4CEIA 1LDKB 1RFLA 3TUZC 1UB9A 4DIDA 4DLTA 2JSCA 3PITA 4DSTA 2G88A 4JIMA 2CBZA 2C2HA 2Q3FA 4PHTA 4R98A 3WMEA 1M7GA 4EGYA 4OIPF 1P4WA 3KLNA 3O3KA 4EV0A 1XEFA 2C03A 2D3WA 2ZRJA 1CXZA 3CR7A 3E5QA 5CIQA 2G9NA 1WDTA 4ITRC 4OL0A 5J5CA 3JSPA 1ZP6A 4U0WA 1YR7A 5JI6A 3BDDA 5FBLB 2QBYA 1N6KA 3KJHA 4OHZA 2CFXA 2WAYA 4YFXF 5JS7A 4HDVA 2ZAMA 3U5ZB 3ADCA 3LBIA 4LV6A 1JHFA 1ZM3A 2J87A 2YWEA 2ANCA 2O8BA 1R8QA 2C99A 4XSZF 4C3ZA 2VP6A 2YU3A 2IS4A 1U78A 1EXMA 2H7VA 3UWKA 4K2EA 1U3EM 3H2YA 4R2HA 3DO6A 5TRDA 4D2IA 2LKCA 4AK9A 4LRTA 3JTHA 4OHWA 5J4HA 4X8LA 5C46F 3K70C 4MEXF 3GZ5A 3M0EA 4LBVA 5CLQA 4LV8B 5KNDA 1GDDA 1N5IA 4IDPA 1KI8A 2BDTA 4PSAA 3KB1A 2L3DA 2C6YA 1E2EA 2G7UA 3VFZA 4URYR 4ZCIA 3WYAA 1Z3IX 5L3SB 3LXRA 2D1HA 1PVOA 1JECA 1XP8A 4CZZA 2GAUA 4FX4A 4QBFA 5TY0A 3AGPA 4BFYA 3WTUC 2ZROA 4OK3A 2K5UA 2BMJA 2JIZA 3CPHA 1QZYA 3IQXA 3P1JA 2G77B 3WGIA 2VOPA 4ZO4A 4L9VA 3MG9A 2ZUBA 4EPYA 2DFTA 1D5CA 3ZMZA 3R7WA 2JJ2A 5KTYA 2ZRDA 4ON0A 2X1VA 2JLYA 4KFUA 2R7FA 4L5JA 1ZCAA 4LV5B 4TMVA 3U7FB 4WZBE 1GM5A 4F4IA 1LEAA 1XB4A 4LHZA 2ZE5A 1JNYA 3FZVA 4PC7A 4C2UA 1Z2CA 3PENA 2IW5A 2CVHA 2D06A 4NMMA 1K6MA 2AXPA 4OINF 4NBSA 2O8DA 4PPQA 1PV4A 3I72A 3RWOA 2ZCWA 4FMCF 5BS6A 2LF8A 5L3DA 1E9CA 1NIJA 1AQUA 1DOAA 1E99A 2PCJA 3KUDA 5FTLA 3QF4A 3TRFA 1RVDA 3CF2A 1VCNA 1H8ED 4BHPA 4URXR 2FF7A 2FG5A 1IN7A 3BJIC 4QG7A 2GCNA 4HAYA 2RHDA 4WK8F 1C4OA 5EZ5A 2HV8A 1NNEA 2FNPA 1SXJD 2P5TB 5ANRB 3E2IA 2VP4A 4JT4A 4LLLA 4PZZA 1F48A 1KU7A 2HF8A 3FXRA 4XVQA 2FDCA 4IDHA 1LFDB 4X8HA 2OCPA 1Y0UA 2XXAA 4CYMA 1E2NA 4C0LA 1DAEA 2G3YA 4WXPA 4TMXA 3BRWD 2VBCA 3QXHA 4GZLA 4URVR 2H92A 1DPRA 3BGWA 1QHIA 3KJGA 3BS4A 5IT3A 4Q1AA 1BI2A 3RS7A 1SKYE 3ECOA 1XTJA 3EAQA 3F0TA 4EFLA 4ZDJA 2PJRA 2J5XA 1MO3A 5L3GA 1E96A 3Q9VA 2DPDA 1IJEA 1Z0JA 5LEJA 4P31A 4TQAA 4AKIA 2PZGA 1OKKD 2O0KA 1Z0DA 4NDZA 3K0SA 3KJIA 4BQAA 3T5GA 1E79A 3L7WA 3WXMA 1NL3A 1W1WA 4ESVA 1W2HA 1KDTA 2NAZA 2D62A 3RKXA 2Q0OA 3LVRE 3ZDQA 1VDZA 4BHCA 3VR3A 4G3XA 3VMFA 2RQPA 1MRSA 1N3BA 1E6CA 1ZRFA 2B7BA 1U8ZA 4EKDA 2V1DA 3I5UA 4RS8A 2ZI3A 4A2UA 2EWNA 3B85A 2IXEA 4Q4AB 5FOTA 2WAXA 1XEXA 3QAHA 2JAQA 4IVQA 2YINC 3DMNA 2D7DA 4FHTA 1AJEA 1X3UA 1R5BA 4CEJA 1Z0FA 4XH9B 3KQHA 1P7CA 4ACAA 2XAFA 1CJKC 4KCGA 2R6DA 2X2EA 4ZDWA 4QWQA 2WWXA 3CM0A 1A1VA 1W36B 2NOAA 1SVKA 2ZPTX 1GHCA 4L15A 1DUXC 2ZU0C 1CU1A 1TUEA 1E2DA 5FFZA 5B30A 2X19A 1DDNA 4MH0R 4NYMQ 1WSUA 2ZIAA 4B75A 3J81K 1QRAA 2BGCA 4NH0A 4LY6A 2Y75A 3DXJF 2NQ2C 4LI0A 1EH8A 3ECHA 1II8B 3IWZA 1YR8A 2P6TA 4ZIRB 2NPIA 3ZVRA 3R9XA 5FOVA 1D2EA 4LDJA 2CE2X 4WX9A 1PDNC 2JLSA 2XTMA 4P4TA 4PXAA 2GK6A 1FY7A 4NB5A 4B09A 1RRPA 4HX7A 2VONA 1BI1A 4RD2A 5JWHA 5BN3A 3LFKA 2JGNA 3UMFA 2DQLA 3KP3A 2ZJ2A 3KP2A 2IF0A 5AJZA 3ZH9B 3U3KA 3AV0B 2RGAA 4HUQA 3BFVA 3D0SA 5D3QA 4PZJA 4LHVA 2JTVA 2A6HF 1G21E 3Q3JB 3VX4A 2MD5A 3W5IA 3EZ2A 2ZQ5A 3QY0A 2QVOA 1KU2A 2NRAC 1CS4C 1CJTC 4I1OA 4O5VA 4O0MA 4DLVA 3BFKA 3FHCB 3FOZA 4A6PA 4P55A 3QG1A 2VP9A 3HP1A 4QHTA 1MGTA 3Q9SA 2H27A 1D6JA 2EJRA 2C96A 2A69F 1N6RA 3RS0A 5JECA 3BJ6A 3SDZA 2XSZD 2IA5A 5HKKD 3RC3A 4G94A 1US8B 3CF6R 3C3WA 2FRHA 2E1CA 2BC9A 1TBXA 3Q72A 1Q0UA 1OF1A 4Q7JB 1HW1A 3CUQA 1B6AA 1G3TA 2QMHA 5HDKA 4L4UA 1YZKA 2XITA 2QN6A 5EZ6B 1NVWQ 2NYXA 2ZR9A 4LG0A 2ZI7A 3DVLA 4IRGA 1OIVA 1XD7A 2ZKZA 1A82A 3HTUA 4EQ6A 5BYJA 3FHOA 3W6PA 1R7JA 3SHFA 5FPTA 3T15A 2XTZA 2BEJA 4RKEA 2HQRA 1QHNA 3T34A 4AKGA 1XCMA 1K7AA 5F2EA 5L3BA 4HLYA 1EX6A 4EM1A 3QI2A 3ECCA 4F93B 2HTSA 1CJVC 2F5DA 1CKEA 1Q3HA 4I1SA 3X1WA 4BHBA 4EPRA 4IF4A 2V55B 3MHVC 3DF8A 3F8FA 4AVPA 2IWRA 1R7RA 4EFNA 1BMFD 1W0JA 3SZPA 1SGWA 1Z0AA 2QY9A 1JXMA 2QQ0A 1DARA 2RGNA 5P21A 3X1ZA 1GTVA 4DBLC 2REXB 1EWRA 2Z5UA 3QNUA 3T5DA 1BOAA 1R23A 2EB7A 2GJSA 5JJKA 3SE0A 2IS1A 1IXSB 1XMVA 3CRRA 2CXXA 4LX0A 2W25A 3DM9B 2CL0X 2J59A 1JPJA 2GKSA 3QOFA 1XTKA 1USTA 3NIBA 2WIBA 2BCJQ 3SQXA 2R6FA 3K0EA 3TUJC 2V6CA 4Q4JA 2ERXA 5BN5A 3TQNA 2E7XA 3LXXA 3ZS8A 4OI1A 2DFNA 4GRAA 1TNTA 1KMQA 3G82C 4NZYA 1AZTA 5E18F 2YJTD 2Q9CA 5AUQA 3F8NA 3QJYA 3I5YA 3FFBA 4DEXA 2LCFA 3IBYA 2WOOA 4XTCS 2QU8A 4U7DA 4C2TA 3AF4A 4IEEA 2FA5A 2QT0A 4Z54A 3QPTA 2ZJ8A 1HSJA 3IWFA 2DI3A 4TMKA 3BAFA 2IT1A 1A5TA 4Q4HA 2O8BB 3PEUA 2OAZA 2STWA 1YRAA 4CZ2A 4B3DA 3QOPA 2R6GA 4JLPA 3KEQA 2OAQ1 3CH4B 3KFXA 3L2OB 4KJZA 3M1IA 2P6NA 2CHQA 1KKMA 1ZUIA 4PGGA 2C78A 1BJAA 2A30A 5TB5A 1HW5A 2QNRA 2NIPA 4R71A 1P75A 3RABA 4NL4H 4D82A 2RV8A 1S9DA 3UMRA 4QOSA 2XHKA 2KRKA 2PCLA 4LUCA 3BOSA 1N0VC 2FE4A 221PA 2KBFA 2QG6A 4TZ6A 2BMEA 4LMYA 1L4UA 4ILEA 4DCSA 1T0HB 3I5XA 2QI9C 3KP6A 1BYIA 1H8HD 4B6FA 5HPYB 1U0JA 2AK3A 2O0JA 5F64A 2ZI4A 2KIUA 4GI7A 1E9AA 4R2IA 4D0PA 2LSOA 1F6BA 1Z6GA 1ZLJA 1PJRA 3MCZA 1KSGA 4IXAA 2CMKA 5EXSA 3MCAA 3E6DA 3N5CA 5BWMA 3G73A 3LW8A 3K0LA 2CLSA 3W6KB 4MUAA 5JWRA 1RKBA 4HLQB 2R6AA 3GWZA 4NCJA 4LBZA 1QZZA 3CB4A 3G5UA 4BAYA 4D0LB 2CGPA 4MTEA 1UKVY 2YOHA 3WTVC 1P73A 1ZRCA 5FO5A 1I2DA 1OYYA 2J0UA 3G3ZA 4HZFA 1HKQA 4RGUA 3LAPA 1P2SA 4OHXA 4RZXA 2PMKA 1RUNA 5EP3A 1A2BA 1MDMA 3C5HA 3JZMA 5G40A 3F21A 3QKRA 1II9A 5IT9Z 5KSOA 3M9AA 5H1YA 2KJCA 1KQ9A 1GRQA 1VCIA 2AK2A 3FMIA 3KCCA 3QF4B 4G5GA 4Z2YA 1LDDA 1G5TA 1NLYA 2FFAA 2CHGA 4HAUA 5CDFE 5HLGA 3OE7D 2ZYWX 4EJSC 1E2GA 2CG4A 3EC2A 3KQNA 2ZNYA 1JR6A 3GP8A 4KUMA 5AONA 1TTTA 1ZREA 1UKZA 3CH5A 3SNHA 3VR4A 1QHYA 1FT9A 3WBKA 1NBME 3NEJA 2XGXA 4MHGA 2XIGA 1ELOA 2FMLA 4AD8A 2JLVA 1NY5A 3AM1A 3NEYA 3UWOA 2AWOA 4P9FA 3EX7C 1P9NA 1GZSA 5BXQC 2L4AA 4U5XA 3SJAA 2XXAB 2QA5A 2BEOA 4JLMA 4Q21A 1YZUA 4QBHA 4BEJA 1XRJA 1TUIA 4PZYA 1JEDA 3L0OA 2EFOA 5L3EA 1E17A 4DLYA 1P6XA 3NDBB 3TKYA 5FR2A 1G64A 3CUOA 2PBIA 1N6HA 421PA 1KZGB 3PQJA 2QM8A 1EFCA 4XWOA 3REOA 1G6NA 5HCNA 5H70A 2ONJA 5AWFC 5SZJA 4A6DA 4E5UA 1EFRD 1U98A 2GILA 3KKPA 2YX7A 1NRJB 2J46A 4XD7A 4XSGA 3TSWA 2ZRGA 4BECA 4BLTA 1ZJ6A 1D2NA 3RJPA 1D5VA 1J2JA 3GLFE 3R6SA 1XSXA 2FU4A 2Q9AA 2PI0A 2IC5A 5JJLA 3K70B 4GZMA 4S35A 3PUWA 2ETHA 3U2RA 3WU0A 1GL7A 4RB1A 4G0NA 2C98A 3GLIA 2WV0A 4A0HA 1SFEA 1FOKA 3C15C 1FMJA 1XEXB 2AKYA 2FBKA 3CR8A 3MD0A 2VXZA 2EWWA 5IT5A 4DT1B 2RAPA 4GNKA 3EW9A 5TVKA 3RYPA 1SMYF 2IEYA 5DHAA 1TQ2A 2VSXA 3JSOA 1FYLA 3WRXC 1ZYRF 4B33A 2L54A 4MRNA 3GEZA 2GQQA 3FYHA 3GEHA 3HPQA 5JJIA 1WQ1R 1TPZA 5K8LA 4YMUA 3C7JA 1W44A 2QAGC 2FA9A 1QGPA 5LGUA 2EFHB 5FTJA 2ZE7A 3DZ8A 4NYJR 4IEIA 1TTYA 4MYTA 3CRMA 1T91A 5KYKA 3DM5A 4TLAA 3V9PA 4MRRA 4JYBA 3PUYA 2RGEA 2F3RA 2YV5A 3DQVC 2ZS7A 2H1LA 3PR1A 1G16A 1TADA 4FMDB 3TQCA 4MQVA 4Q4ZF 1XB2A 2F1RA 1W47A 4R1HA 2QAJA 4HF2A 3BC1A 2MLKA 1ZM9A 3TDUC 4NE2A 4QRHA 4OK6A 2OAP1 5B2ZA 4A0FA 1E3MA 4QGGA 3RKYA 1UFQA 3SI7A 1E0SA 3HYTA 3LBNA 3TIFA 1Z29A 2P0EA 2RB4A 5M04A 3QXJA 1P4XA 2UKDA 1G8PA 3QIAA 5EE0A 5D4SA 3WTYC 3N2EA 2Z99A 2JPBA 2FJUA 4KYWA 4CHUA 5J47A 4HV5A 1XCGB 1YW8A 3DKWA 4HUQB 1PUEE 4EJSA 4HQMA 4HDQB 2V7QD 5FUYA 4KT5C 5HS8A 3B8HA 4IVRA 2NO9A 3L00A 5EP4A 5D5XB 3I1FA 2G0TA 3KKMA 1AS0A 4V0KA 1MJ9A 1YZGA 1OH8A 2LKDA 2HT1A 2Q3HA 3SQNA 1D9ZA 3MUFA 1GAJA 3ZN1A 4M53A 1OFTA 2JLUA 2DQRA 3KFWX 5D8LB 1JGSA 1Q1QA 3SFZA 5CVUA 2IYUA 2D2WA 4HB4A 3D5LA 1BO6A 3D6TB 1FZQA 3X1XA 1UHMA 3A8TA 2EV0A 1TEXA 5LDDC 1N5KA 4YC7A 2ZJ5A 4JL5A 5EE3A 3SR0A 1T38A 1FLIA 4DLUA 2FFHA 4TN1A 3A4NA 2IUSA 1HQCA 4TWZA 4EJOA 5L3FA 1YG2A 1IN5A 5FTMA 1BM9A 4EQ6B 2F9LA 2GIVA 2JLWA 1SULA 2R44A 3WYFA 3EZFA 3R61A 1KK3A 1BIFA 4LJYA 4AC9A 1E32A 3LA3A 4BFTA 3BJOA 2BKEA 4KV9A 3U4QB 3K9HA 3E5UA 3I73A 2YVUA 1ZRDA 3QVUA 5EQTA 1XCBA 4KIBA 5E8GA 1JJ7A 2GJKA 1LNZA 1ZMXA 3UATA 4CT4B 1IM2A 2HTJA 3AP1A 4I1UA 4RD4A 1FSEA 2XRNA 1DPUA 1VIAA 3LVQE 2VLIA 2JATA 4TLBA 4XIGS 2JPCA 2IK8A 3WRYC 1LB2A 1P72A 1HT2E 2OCBA 4Q9IA 1HXDA 5E1XA 2OSBA 3T8RA 1R0WA 2GWHA 2HJVA 3CNOA 2K86A 2QPAA 3KE2A 4UV8A 5F1RA 1JB1A 3OFNA 4RD3A 4DIEA 5K8UA 1IXZA 4Z8XA 1NN1A 1W4BA 3V00A 3ADDA 4OI0A 1U2RA 5BMZA 3E70C 3RRMA 2H6CA 1ZN2A 3GX4X 4MA4A 5GJBA 1E2HA 4DB4A 4G8XA 2OFOA 4Q4JB 2DHRA 4TL8A 1UBGA 2ZRCA 1O7FA 2NO7A 5DI3A 4A4DA 2PMHA 5J4LA 1AA9A 4ZCLA 2V3CC 2PQ8A 3AAFA 4B47A 4RZ2A 4GYGA 4MTDA 2BE5F 1EH7A 4KYIB 2QQEA 2DWQA 3U3OA 1E98A 1B23P 5CK4A 3I92A 3VX3A 2IHYA 4HAWA 1MH1A 3U6KA 3CRVA 1LY1A 2IXGA 4HLDA 2NZ8A 1QQIA 1OFHA 4H1VA 4B6EA 4IRHA 1Q3TA 2CCKA 4XVRA 3WHKA 2XROA 1VKJA 3DZDA 2ZUDA 1UPTA 1ODFA 1Y63A 3UIEA 3TE6A 2GA2A 4JBYA 4QM7A 1X37A 1USSA 3B5JA 3SHWA 4A15A 4Q4HB 4WVFA 3BB4A 2IBMA 4MNUA 3GLHE 3BK7A 5TXGA 2JIZD 4QJ4A 3HTSB 1W7AA 4KMFA 4HAVA 2Z43A 3LAJA 4Q1DA 3DPLC 4ENJA 2CL6X 4I1VA 5DH9A 2KIFA 1Z47A 2GA8A 2L0XA 3KB2A 1GXQA 4PHFA 4AG6A 2O8EA 1ZNXA 3TOBA 3I8XA 4KFSA 5G53C 2AS5F 2CSOA 1NVXQ 2E9SA 2ECKA 4YMWA 2Q8KA 2JJ2D 5GJWC 4FMCB 3O47A 3B7GA 4PO1A 3ZZUA 4WAUA 4M8NE 4V02A 1M8PA 1P61B 3IC7A 4B34A 4Q4AA 1MJBA 4S04A 5DUIA 3PEWA 2OO7A 4WXHA 1ZINA 3PXGA 5E8IA 2RHMA 3IIMA 3SBEA 2ODWA 4CYDA 1S96A 1S8FA 5A2QZ 1M34E 1HTWA 4TLDA 2HJGA 3JAMK 2QP4A 3W5JA 3KQKA 3VOEA 1TQPA 3KLOA 4EM0B 1ZG1A 3VR5A 3PQKA 3FPAA 4B3BA 1KO4A 2QENA 4IHTA 2QRNA 4I98B 4P4SB 2VOOA 1U90A 3IGFA 4FINA 1II8A 3E5HA 1VG8A 4ZI2A 3WGGA 1ULYA 3R9IA 5E1ZB 4HOBA 1Z91A 1DO0A 2I3BA 1P4AA 1G4DA 1FUUA 1ZD1A 2J0UB 4IOMA 4JSYA 4PSVA 1VG1A 2LDUA 3Q5EA 1UF9A 3DP7A 2VC1A 3OIVA 5G41A 1MDMB 3EASA 4E03A 4KIGA 1NBMA 2OBMA 2ZRAA 3QKRB 4B35A 5TV2A 3COAC 1D2MA 4M1YA 1XGOA 4Q18A 2QWWA 4I02A 3LQRA 1G5RA 1GNRA 3AKYA 3M8FA 3CPEA 3EZ9A 3JVVA 1AWCA 1MJAA 4PZLA 3FMSA 2BBSA 3I0TA 1K8RA 3S1AA 2RC4A 2OG2A 1KIMA 2OLJA 1XCPA 2H16A 2K4BA 1QHGA 1W46A 2J41A 3B9QA 2FFQA 4PQYA 4BLPA 3M6AA 5KDOA 2OD5A 1G3MA 1H9TA 2A5JA 3CWZA 3HRTA 4KITB 3KQUA 4GOXA 4QFMA 3ZN0A 1SKYB 1T8UA 1K5DA 1U5TC 1TMKA 4KVGA 3CJNA 2ZI6A 1QNTA 3V4RA 1X1RA 1RW4A
chains in the Genus database with same CATH superfamily
4OKIA 5GV8A 2ZUTA 4IDOA 4N3CA 4MHSA 1OY1A 5E6RA 3K10A 2ADOA 2JLRA 1W75A 4QPQA 4HGOA 3DCYA 4J4TA 4ARUA 4CO8A 2R3SA 1FYKA 3LRTA 1EEXB 5FQOA 1R10A 4Q4CA 3NU1A 4D9BA 4E6PA 2JCBA 3UAZA 5DLDA 1FEXA 4RLFA 4AJLA 2R5ZA 3SKVA 2VI6A 3KJXA 4K46A 2A68F 1KBQA 5BMVA 4Y2TA 1IOLA 3DEEA 2C83A 3IQGX 3INGA 4MICA 3AF3A 1U8FO 5CW2A 5DGXA 3E5NA 1V55H 3WBBA 4ZOLF 1OAOA 3GAZA 4JQFA 3FPLA 2HB6A 4ZI3A 3C24A 2P68A 3DMRA 3L05A 5KNLA 1WTAA 2ZB9A 1KY4A 3B1ZA 3FROA 1AUVA 1M2HA 1SUAA 1QIMA 1I33A 2I3AA 4LAFA 4AIIA 1YF3A 4ZEWA 2RGDA 4KUEA 3WGMA 5BR1A 1MR3F 4G1UC 2C58A 2ISYA 3EIOA 1UXJA 5J4VA 1VI2A 3WYEA 1EDEA 1OI2A 3UXEA 2CO5A 1PP8F 3FPBA 3B9RA 4X7BA 1FSHA 2I6QA 3HIFA 1PG5A 2BIFA 4CR7A 2Y9YA 4KYUA 3BT7A 1KOFA 1ZM2A 1DC8A 4OQFA 3D3EA 3G0DA 1N6LA 4IJQA 7ABPA 1HUQA 2R5WA 3HXPA 2OWDA 2JPDA 1WMDA 4F3RA 5DSTA 4RKRA 2N47A 2QW1A 2Q8PA 4BNDB 4IBFA 2R86A 2JEYA 4TUYB 4B7UA 121PA 4EEFG 1CUFA 3FNGA 3CG4A 2EJWA 5PGMA 1YE9A 1IONA 5EZGA 3TJRA 4D8VA 1XKXA 1BMTA 4LGCA 4E2YA 5D84A 4BWYA 4IH1A 4YEDA 2I9PA 4X1YB 1F5TA 4ILKA 4DNFA 4W99A 4IBKA 1W4MA 3QP6A 1KPGA 4HW0A 1SXJC 4XSHA 3P2IA 3ONNA 4J9UE 1MU0A 4CIDA 2PRZA 4KR7A 4N5MA 3U4QA 4QPNA 3WO1A 1GG8A 2PSSA 4BRSA 3WE2A 2EU8A 2IGOA 4XJXA 3FTQA 1M7BA 4MVWA 1SU8A 3TCKA 1S9HA 1WDMA 4Q9DA 2HR3A 2Z6AA 1BJTA 3AHFA 2RH5A 1OXUA 2EKQA 1H4TA 1M2EA 3DQQA 2D1FA 2JKVA 4AICA 2LY1A 2BFCA 2BZ0A 2R1TA 1BFDA 3C0KA 3KXEC 1TGUA 5F1PA 5U4QA 3IBGA 3AIKA 4BE1A 2O57A 5AW4A 1CQZA 4X85A 4MQEB 1R6VA 2KE5A 2ZSDA 3PNBA 1C4KA 1C1DB 2G82A 3ONFA 3QPDA 2C9YA 4J90A 4EYKA 4O0LA 2HAKA 2Y69H 5FRNA 3H5VA 3FCUB 1BU5A 1A69A 1T8YA 4BV2A 4FCVA 4NKRA 5JHUA 3HP4A 1WFXA 5AHRA 3AF0A 1MX1A 2ATCA 2LHGA 2P65A 2WVJA 3UQZA 4KMOA 5IREB 1CYDA 2WDZA 3ZGOA 3IVCA 1PO7A 4MH0E 1D4FA 2Y1DA 3HEFA 5E6SB 3UAWA 2YDXA 2VRCA 3WLKX 4UTOA 2UUAB 4U2KA 1KFJB 4NQRA 3OJFA 4YDRA 1NOIA 3Q0IA 3ZYZA 5BPHA 1N0IA 2C07A 4BB0A 1IY1A 1TZ2A 1XN7A 2JL1A 7YASA 3F47A 3IH3A 1AKNA 2QTWB 1PNRA 1IIRA 1O96A 2X8JB 2AJCA 1NI3A 1KP2A 1OQAA 2WKSA 3NATA 4X64M 3RAPR 4C2AA 3CVYA 1CUDA 3HCRA 3WBJA 2P79A 3V6MA 2O54A 3RT1A 1NJ2A 5DK4A 2SECE 3Q7QA 1ZUD1 4D9NA 2CLLB 2P9BA 1XJQA 1EFDN 2AN1A 3IUJA 5C4XJ 4OFBA 1DJQA 5F4BA 4NTZA 3GFJA 2BM8A 2MSEB 1G6HA 3NOQA 5REQB 4LK3A 1SVOA 4EY8A 1NQVA 3EXHB 5H3HA 2HQOA 3R8XA 3CSSA 3OMXA 3LD9A 5KSWB 3C6ZA 4KHPM 5D8KB 3KXPA 1FP1D 5EY5B 4YREA 1DQYA 3QTTA 2R96A 4FWDA 4RDCA 2AZXA 1MVNA 3D8NA 4IKOA 1HT0A 2BOVA 3T1HM 2JA6J 2V6EA 5K20A 2CWBA 3KR9A 3G13A 2A07F 2VBFA 4DSOA 1WJEA 2PT5A 2QIPA 1A31A 4H4CA 1GGKA 4H3KB 4CVNA 1DQUA 4DVJA 5AVRA 3K32A 5E1WA 3GJYA 3GROA 5C0OE 1BW5A 2YWFA 3L5OA 1NXTA 2YBDA 1W1WE 3A26A 2W6ID 2BEVA 2AGVA 4IHYA 2DQZA 2PUEA 3ESRA 1FMCA 1DXYA 4PNZA 5AR1A 5CKTA 3SYMA 2CXNA 3OZXA 3P97A 4Y13A 4Q3DA 2IYTA 5ALLA 3OL4A 4NXMB 1J5EB 1O3YA 1AKEA 3IQDB 3EULA 1Z06A 4Q9LA 1NVMA 2OV7A 1OOEA 2R18A 2GEUA 4W1RA 2C2OA 1O4XA 4MVJD 3K0AA 5AJXA 5A0FA 1RXCA 2YJGA 2GQFA 2WK1A 1KQ0A 4BKQA 2B99A 3KKOA 3EEIA 3FMQA 1TFRA 2MSLA 3IO5A 2GN0A 3KSAC 2FMYA 3U6SA 2W43A 3D7RA 2VXBA 2G17A 2OBNA 1FFAA 3MJHA 4KE6A 5G1PA 3C5CA 1P5ZB 2VDUE 1J0BA 4FR0A 1AE1A 4RZHA 4WFIA 4RVOA 2OORA 3MJRA 2CXOA 2VP3A 1SFXA 3B9PA 4DV4M 1K0UA 5FJJA 3A4LA 1NX9A 4E7LA 4PGHA 3IYLW 2CF6A 1WI9A 2AFHB 5JQGA 5M5YJ 1JTFA 2Z3XA 1K8QA 1EXWA 2WTNA 1RSZA 3Q41A 1M1NB 4CQMD 1UBRS 3PE3A 2AHQA 1N5OX 4EG6A 3JD0A 1J8YF 2M6LA 4M9SA 2BEWA 2ZXUA 2GM4A 2PD4A 3NRCA 5E95A 3MVEA 3P9PA 3GPYA 3PKJA 2WM8A 2WI8A 1OPRA 1M2VB 3HOZJ 1ZM7A 5TJHA 2W7NA 1EFPA 5AJUA 5A9TA 1UC4B 4LBWA 2K5CA 2Y6UA 3SEAA 1B14A 5ALNA 2BTOA 5F0FA 2H4XA 2IP2A 4YP1A 2RSLA 2FW8A 3FKJA 3CURA 4GPTA 2Q5EA 4EABA 4BVBA 4J7CA 1EA7A 3H4JA 1NF3A 4KLZA 5GADJ 3TOSA 1WM1A 1W0TA 4HRYA 1TWFJ 1KZ7B 4A36A 1YI1A 1WJCA 1KQOA 4YJ2A 3MWYW 3T7JA 1NSFA 4N0EA 1W59A 1VRCA 1AMNA 2FH5B 3EZNA 4I4TB 5IK2A 2VPPA 1YACA 2OVFA 4W8HA 1C3XA 2GCOA 4HJRA 5IHPA 3OWHA 4G7OF 5KO3A 4MWZA 4AMZA 1AF7A 1GXSB 3OQ6A 3WV5A 3ZN2A 1O0BA 4AJ2A 4NV1A 1QIHA 3WHLA 2H3HA 4X6AJ 4LY0A 2E18A 2XVCA 1C41A 5ILOA 2VSYA 3MZHA 2E2JJ 1OX4A 1E5QA 4L95C 1GEGA 4GT1A 3JASA 4QOJA 1X1SA 3FJYA 2YXPX 5IN5A 2MH2A 4ZMRA 1X7YB 5DTMA 2P9FA 3ZWYA 1N0UA 3LQQA 1LQ2A 2F8TA 1DRWA 3B7ZA 4XSXF 2YL2A 4I2VA 1R0BA 1Z7WA 2TMYA 2A0WA 1H9CA 5I4BA 3G6KA 4HH1A 2FJ0A 1R9MA 1Z07A 1YBAA 5LMNB 4ZT2A 5ILSA 3BMOA 1OX6A 3BRWA 2NPFA 4HQLA 5C4GB 3O8GA 2IL1A 1U31A 1V8ZA 2YTZA 5TE9A 4ZOQI 5E0OA 4Q34A 2QCOA 2IYXA 3OSZA 3JALA 3OESA 3OCVA 1B0AA 3VM6A 2ZZKA 4CGZA 4JA2A 4Y7CA 1N1MA 3LHIA 3T61A 2OM2A 3RRNA 1B4AA 3EVFA 3U4MA 5KKNB 3E8SA 2XLBA 5JTUA 1JHDA 2BGLA 1AKTA 1Y6QA 2P75A 3A6LA 3J7AO 3WMRA 3ROXA 1EIZA 1NQXA 2G5GX 2O8KA 1W5EA 4O4IB 1DIOB 2I3ZA 4R3NA 5DNCA 3O9VA 1UZCA 4MIOA 2XCQA 3TQOA 2Y9MB 4YAIA 5A9RA 3TO5A 3BD9A 4YRZA 3MCTA 1FQKA 1B72A 3IDOA 1NI4B 4WD3A 2HJ9A 1FTZA 1YNOA 5LKRA 2R7NA 1L5HB 3OEED 1Z68A 1V0JA 2R8OA 4G4RA 1Q0QA 4MVYA 2ZBQA 4UXNA 1DB3A 3BIFA 5BOSA 5JVDA 3DH0A 2W0SA 4YI5A 1NJFA 1FRZA 4IICA 2OK7A 1GN9A 2DHQA 4HB0A 5LC1A 5HJ5A 3EC1A 2QHXA 5DOVA 1PS9A 2W2PA 2FI1A 2Z2XA 5AXBA 5MDHA 4DUGD 4FGWA 3BCUA 3CO5A 2D5VA 4PDIA 3A2KA 3ZLVA 4CYCA 2NVWA 5E4JA 1C1KA 4IKFA 4MWTA 2ZYHA 3BFJA 4TTQA 1ZN8A 4PLHA 3Q2KA 5IHXA 3H2IA 1L7RA 3B8EA 3IAEA 1B8PA 4FIDA 2WJVA 5KYXA 3LECA 1SZCA 4X7PA 4D3FA 3L6EA 3JW8A 1PT6A 5HKBA 1R2ZA 2G7HA 3JD3A 4DR1M 3DG9A 3BROA 1C8LA 3GOQA 4TSFD 1BIBA 5JHGB 3S1QJ 3HU2A 2P9QA 3JZAA 4OK5A 4D4LA 3COYA 2I7VA 8ADHA 1T08B 1XD2B 2W2VA 2ET6A 4C7OB 1TAUA 5HS9A 2GKOA 4IZ6A 2Z4SA 4P80A 2C77A 3CMMA 4AM3A 2JLQA 3DKKA 3SJZA 4QLBA 1F36A 4PQFA 4UC0A 1GJTA 4KPUB 5AVOA 4D81A 4JIGA 4LYAA 3MFQA 3GT4A 3N0TA 3O4HA 1F1ZA 1WQ4A 3QU3A 2RJ3A 3CCCA 4JOBA 1QIJA 1QHHD 1DWPA 4DIOA 5AW9A 1XBTA 1ML4A 3FMVA 4IJ6A 2WB1A 3E3VA 5GONF 2C4WA 1D0YA 1W581 2XAJA 3TAUA 3VPCA 1GVJA 2FPRA 2UUBM 3WXBA 4HDQB 4JI4B 2WICA 3FWYA 1ZUHA 5B2EA 4YDHB 1CNFA 1WETA 4YP6A 3IT0A 1EXNA 1JFFB 3OE5A 1J0CA 4PJNA 3ZUPA 1O6FA 5NLLA 3PB3A 4E7SA 1IXSA 1DAIA 4PQEA 2M6KA 4ERNA 4ITQA 4I8IA 4CGYB 4JIMA 1MAUA 3VA7A 1JRLA 5CXSA 3CVXA 4YFXF 3V48A 3FTFA 3L7IA 2PM8A 2LC2A 2J87A 3ZDFA 3VISA 1CEQA 2FFJA 1U78A 1EXMA 4J16A 4EECA 4Z4GA 4OHWA 4XLZA 5AOAA 4DBZA 1ETKA 1E62A 1EUYA 5H80A 3I4CA 1JKFA 2HL6A 1JECA 2CXTA 2ZT8A 4JYZA 3VBCA 2K0BX 2RGWA 4LV5B 1ZCAA 3U7FB 3JPYA 3ONDA 3K15A 2D5AA 1SUIA 2VQGA 1E9CA 3TRFA 3N8HA 1FDUA 2WIGA 1H8ED 5M7EA 4M3EA 1EGMB 3ZHCA 5ANRB 1D7OA 4HQNA 3W06A 4F6RB 3LGAA 5A4IS 2FDRA 3I01M 3ME5A 3OTWA 1U2EA 2PWZA 1QLHA 4CISA 1Z73A 1WW3A 3NYQA 3FDXA 2LGJA 1DBIA 3I5AA 1HC7A 4R8LA 2C4KA 3NTQA 1VDZA 5F4ZA 3F6EX 3OPVA 5DHSA 3R75A 2F5QA 1ZN7A 2V1DA 3BXFA 4KQEA 1H5NA 2DA6A 2X2EA 3PE4A 4XKCA 5AVTA 3OD1A 3CUUA 1DUIA 2FOWA 2RHBA 5GZ1A 4EW3A 2NQ2C 1AUAA 1UELB 4BAZA 3ANNA 1O6CA 1TU0A 2EILH 4B3HA 1RRPA 1Z4PX 1I0IA 5BVHB 3AHGA 4TV8A 2DQLA 1SBQA 1C9YA 1WHCA 1V1MA 4JOSA 4MW5A 4PZJA 1QR6A 2JTVA 3KSMA 1E4EB 3MS4A 2MD5A 1IJWC 1VMKA 4I1RA 2PO5A 3H6HA 3DPSA 3P9SA 4L8WB 4JP2A 1N2CB 2A69F 3IP1A 1N92A 2BC9A 3Q72A 1Q0UA 1OF1A 2HO5A 3ZHVA 2PNFA 3GO4A 1HMYA 3GEMA 1V4NA 4RWEA 2HQRA 1XTVA 1K7AA 5EMMA 1XI2A 3T7TA 3LSJA 3BREA 1SM4A 4IF4A 2J30A 2H4JA 3C3PA 2GARA 4REMA 2EG9A 2XRZA 5P21A 4WY8A 1G0NA 2IS1A 3TSCA 3FWNA 4A3KJ 4GMFA 2R1VB 4ZAXA 1CR6A 3AFHA 2R6FA 3DVAB 4DUYB 3JD4A 3TQNA 1HG0A 1KMQA 4NCBA 2YJTD 1RCUA 3EY9A 5DCWA 1EE2A 2ZJ8A 1C9MA 3WA6A 4RLQA 3BAFA 2IT1A 2R47A 3SEFA 4B3DA 4DLAA 3PC8C 1WUTA 4GC9A 1P5RA 1ZUIA 3GDHA 5TB5A 4A5SA 2L9SA 3OZTA 3A3YA 1OVMA 3ZHXA 2BFMA 3HRHA 2L18A 3OR1C 1X0XA 4CG0A 2WSIA 1F6BA 2BCEA 1NZDA 2L82A 3RKSA 1UZUA 1L5VA 5GPBA 4LBZA 3G5UA 1N7JA 1Z5GA 3OPQA 4WXMA 3LAPA 2QRKA 3GRZA 5C1PA 3UUWA 3QKRA 1W93A 5H1YA 4R69A 2KJCA 3DE3X 1YX5A 5ER9A 4EJSC 1E2GA 3EC2A 1JR6A 1SQ0A 3C7AA 1TVKB 3TLZA 3ILKA 3AM1A 2B0CA 4K9OA 1FBNA 3L1UA 4JLMA 2FZVA 2O48X 4OYRA 1YONA 1QFXA 4TUYF 5EGSA 5B2FA 1EA5A 3WLSA 5F33A 1ZI9A 2WIKA 5HCNA 3H11B 4GQIA 3BTVA 1EMDA 3QITA 3OLYA 3KVWA 2V8BA 5HKAA 5EC8A 4DT1B 1XQWA 2PUDA 1AMOA 3GYBA 4XOTA 2NUTB 1A0OA 3EXEB 4TLAA 2RGEA 2Q3EA 1FVHA 1AUQA 4MQVA 2OAP1 3GBVA 3HYTA 2HLHA 2RB4A 1P4XA 5C51B 1T6ZA 3BULA 2QRVA 2OD9A 3PJDA 4HRIA 4HOYA 2D0DA 2KNVA 4WN9A 3PD7A 2ONYA 1U4SA 1H9BA 1JKMA 3A8TA 4ZVQA 3ZHBA 3JRBA 2QJTA 3GJSA 3RZOJ 2JLWA 1E32A 4YAUA 3OTOB 4ZO6A 1LNZA 2HTJA 3DYIA 2UUAM 4DCCA 1KZHA 5C8YA 3KVNA 3D7KA 5BMZA 3F98A 4ZOLB 3EVTA 2CQXA 4C7BA 4IJWA 2NVXJ 5CK4A 4COKA 3ZOKA 4OHRA 3OZDA 4WCFC 1TD1A 1VCHA 5DGHA 3V4SA 4WECA 1PFVA 4RK7A 4KMFA 2UZ0A 4Q1DA 5FLXS 4FDUA 2JGDA 2WFLB 3EGOA 5AM4A 2GPSA 4PFJA 3ZZUA 1M8PA 3RYHA 2FOXA 1FSGA 3O5AA 1ZINA 1UK8A 4P58A 4QQKA 2ODQA 4B31A 4EM0B 1U8CB 3GWGA 3WV4A 4HOBA 1G4DA 1E7RA 1BW9B 4MB0A 2LDUA 3IDSA 4UREA 1QF7A 2OBMA 1BSVA 2KNAA 3COAC 1XGOA 3W5BA 1Z5WA 3FPEA 4MUKA 3EZ9A 2BBSA 1K8RA 4OAZA 3UGKA 2JMWA 4RHTA 1H9TA 3CWZA 4KITB 1KYVA 3NWOA 5HBRA 1P7VA 3E9RA 1MJ5A 1YLFA 3K70D 4HT3B 3IV5A 2IEIA 3GLFA 1DAPA 1HEUA 2E5NA 2F59A 1J0DA 4CXMA 1YRBA 4HDRA 1ZIXA 5IG2A 1JSXA 1MX3A 1FC3A 4XORA 2O8EB 1ONBA 3LAWA 1ACIA 4M76B 2AC7A 2PKXA 1MD0A 3H87A 4CLDA 2VKDA 5CVVA 3CCFA 4LLNA 4W6ZA 3WL7A 2OQGA 1H22A 4IHAA 5I47A 4NXMM 4CUKA 1J5EM 1HE5A 4FDLA