1W5TA

Structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
403
structure length
394
Chain Sequence
GLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSTTLFRLAPHLPADRLIEVVDNIIQAKMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORC2
publication title Conformational Changes Induced by Nucleotide Binding in Cdc6/Orc from Aeropyrum Pernix
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Dna replication initiation
total genus 140
structure length 394
sequence length 403
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09079 Cdc6_C CDC6, C terminal winged helix domain
A PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1w5tA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w5tA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w5tA02
3F8NA 5KSPA 4IVQA 1G3MA 1G5TA 2QGNA 4LG0B 3QEOA 5JFGA 2Z43A 4DKXA 3REFA 3FM3A 4JLMA 3TK1A 1EWRA 2F1RA 4CVNA 1E2LA 1NLYA 1P9NA 3BXZA 3OESA 3GLIA 2IUUA 1RPZA 1ZG5A 3UG6A 3K9HA 5FUVA 2K02A 4QHTA 2Z5FA 2QUFA 1ODFA 2VE8A 2ZITA 5LHHA 2CL6X 3HSRA 3N97A 1W1WA 4KIBA 2RKHA 1YZLA 4GT1A 1KI9A 4Q01A 3ML6A 2ZETA 1COWD 4JLVA 1GNPA 1I27A 1KDTA 2PLRA 4CEJB 2HJGA 2CG4A 4HX7A 1TF7A 3C5CA 1RZ4A 1HW5A 4OOIA 4QHSA 4AIHA 4DLUA 1DG3A 2HQRA 1T8TA 4L0YB 1M7HA 1U94A 2FH5B 2ZR0A 2CJWA 4B74A 1RZ3A 3R60A 1SVWA 4C0QC 3TUZC 4I01A 3H0KA 1XCBA 4LJ7A 1KMQA 3A8TA 3H1TA 4FMDB 2OZ6A 2B92A 3X1YA 2MLGA 3ZS9A 4HDCA 4BFSA 2CEAA 1UCRA 4HDOB 1K5GA 2JJ1D 4R7ZA 3FKSA 4Q02A 4ZH4F 3RVBA 4EGZA 2Z9OA 3GWZA 3REOA 2GQQA 1NBMD 2IYRA 3AF0A 4U02A 2D45A 1G19A 2JIZA 2ODEA 1MJAA 2WOOA 2FBHA 3QKSB 4L4UA 5D6FA 5F9FA 5JECA 2XROA 4B8XA 1RW4A 2BBTA 2CBZA 4QKQA 4UV9A 1D9XA 3HDTA 5E1ZB 4G5RA 2CSOA 2IXFA 1ZINA 4IRIA 3ISPA 4G5GA 1XGNA 3Q9VA 2NZ8A 4LK0F 2IUSA 2AXPA 2DVWB 1R1TA 4QLCU 5CJ2A 4NHJA 3WU1B 2RMKA 3I71A 3AKDA 2KKOA 3CKLA 3GQBA 3OF5A 2VP2A 3W8NA 2UXNA 1PDNC 5L3QA 2XTNA 2ZUDA 1YQTA 2HYIC 1N6IA 5L3DA 3RIRA 3C14C 1L4UA 3NDBB 3QXJA 1HSJA 1G3SA 1RRPA 2J1LA 2KJBA 2OEPA 1XPOA 2OCAA 3A6PC 3B85A 5FBVB 1N25A 5F64A 3GXOA 3KQHA 2H1LA 3CB4A 1UFQA 5K5OA 1D9ZA 1E9CA 3FKQA 3UIEA 121PA 4BZPA 1Z7UA 2BGCA 2IS1A 1SXJC 4TYNA 2V6ZM 1AJEA 5TXGA 3GLHB 5FTNA 2FNPA 5SZHB 3CZQA 3K1JA 3ASYA 1R22A 3KQLA 4C0LA 3LNCA 5HCNA 2HQNA 3IBYA 5AJWA 3ZJYA 2QTFA 1LS6A 5LDDC 4RGRA 1KHTA 2GBLC 2G3YA 1N6KA 2QROA 3LQQA 1E9SA 2ZTSA 1CF7B 1Q1EA 1TQDA 2QP3A 3WTYC 3FMQA 5IT9Z 3W90A 3HRUA 1T6SA 4CO8A 1E1RA 3UMSA 4DUGA 1NI3A 1OXXK 2ANBA 1FY7A 1MABA 3KFXA 1VPLA 1RYHA 3E6DA 3CRMA 1XSXA 1G1MA 3GZ6A 1A2BA 1H8EA 3EUHA 2FRHA 3HHGA 1T0JB 2R8RA 1Z0DA 2YZ2A 3OEHD 1JQLB 1KZGB 1UHWA 3B60A 3D5LA 1XMAA 1A2KC 1JECA 1MRNA 2DYKA 5P21A 4FWHA 4UXNA 2W24A 2BJWA 1XP8A 3IRRA 4ESHA 3BWGA 3G82C 1KYZA 4A1FA 2NG1A 5AJVB 1GKIA 2CFXA 4Q7KA 2OFXA 1UAAA 1TX4B 3WMFA 1BI1A 3VX4A 2W2VA 3A4MA 4G6DA 1HSTA 4NYIQ 5JI6A 5EE9A 2MC3A 4M9SA 4HF2A 2VP9A 4BRWA 3LBHA 4KJZA 5D6EA 3U4QB 4Q4AB 1BYUA 1GP2A 4Q5SF 3PXGA 1G3QA 3ZLJA 4CEHB 2A7QA 2M45A 5J5CA 1E17A 2OT3B 4NCIA 1YZTA 3HP1A 4ZO4A 4LG0A 4EM1A 1YVDA 1NG9A 4M72A 4MRNA 2XV4S 2KE5A 2PH1A 1Q21A 5EUMA 5BQ5A 3CNLA 2OO7A 3EYYA 1XXHA 1S6LA 1C9KA 2X19A 4MKHA 4PZLA 1U3EM 2YC2C 3DDCA 1ZC4A 1NLFA 1TTTA 3N4MA 3TQFA 2K86A 3QP5A 2AR7A 2ONKA 1J0RA 5FFXA 1EG7A 1KI1A 2WJVA 4EPVA 1OLOA 1UPTA 3I1FA 2JZYA 2AXNA 2CDNA 2VSXA 2G7HA 3K69A 4FCVA 2STTA 2G9NA 4CEJA 2WWXA 1T91A 3PIRA 4TMZA 3ADCA 1NVMA 1XSDA 1OXUA 3K0CA 4O3MA 4F4CA 1ZGAA 2W57A 3KZYA 4NH0A 2XX3A 1N3BA 3MWMA 4HDVA 3A1UA 3CRQA 2YSRA 2ZNYA 5KNDA 1EX7A 1Y63A 4R98A 4TL6A 5C1BA 2Z99A 1BBYA 3TDUC 3KKNA 2FMXA 3PEUA 4B75A 3NXSA 1QBJA 4A8JC 1R1VA 5LBIA 4Q1FA 4G7HF 2QRZA 2OQGA 1HKQA 2PMKA 1EFCA 1MJBA 4HYEA 2YV5A 3QKSA 3VR2A 5EJEA 1KI3A 1N6RA 3C15C 3P1JA 4AY2A 1DE0A 1GAJA 3ZZUA 4LHZA 1WWXA 4Q9JA 1LFDB 2FFQA 4GP7A 4DLRA 1FX0B 5EE3A 2OXCA 4RAYA 5ICGA 3SYNA 2PZFA 1P4SA 4DSOA 1GL7A 2QMHA 4NP6A 2H6BA 3DZ8A 4MKGA 3ZIAD 2XZPA 4ZI3A 2R44A 2IYTA 1FX7A 4LYJA 1R5BA 1FC3A 3WHKA 1N6HA 4EJUA 2OA4A 4AVPA 1G8FA 1NMZA 4W5WA 3E97A 1ZG1A 2GXUA 3QPHA 1ZUNB 4JBXA 1DPFA 1R1UA 1WA5A 2N42A 2RV8A 2E87A 3AVQA 4M22A 4TLEA 5DCMB 1J8YF 1OPXA 3AVXA 5J4VA 5J4HA 3RI4A 1W7PB 3AVUA 4FWGA 3HIFA 4GCVA 3GLHA 2JAQA 2L3DA 3A58B 4A0RA 5EP3A 4TYPA 1QZXA 3V4RA 2ZIAA 1W44A 5ILSA 1O57A 4MTDA 2RGXA 5FI1B 4ENKA 2QPAA 2G77B 4HI0E 3K1NA 1VTNC 4NKRA 1UKEA 2R2AA 5DIFA 1TF2A 3D3QA 5JI3E 1YZNA 3DHWC 3RDIA 2PT7A 2DAOA 1HYQA 1CF7A 3O6BB 5IK2D 5D5VB 2GZAA 4LYFA 1OH7A 4PGGA 2ZREA 4URXR 1IF1A 4B47A 3ZZTA 3UMRA 3P4XA 1BKDR 1ZNZA 2FNAA 1Z0FA 2CW0F 3AQ4A 4JLBA 5KK1A 1N0UA 3JZAA 3GLFE 3THYB 4MYCA 1XU4A 3I61A 2EB7A 3EC1A 4HOBA 2ZI4A 4CT4B 2HJVA 3UKDA 2ORVA 2JPBA 2WKQA 3WYGA 1Z0KA 4GDFA 2GA1A 2WAYA 2IBMA 4TSFD 2WWWA 4HB2A 2ZYTX 3HSFA 3KETA 1KK0A 2R7DA 4HLQB 2DQLA 3M1IA 3T15A 4NYMR 1P6XA 1TQ4A 1UEJA 3GEEA 1IN5A 2MA3A 1SQ5A 4DIEA 4MRVA 3QBTA 1P4AA 1ZN2A 3L9FA 4U0VA 1LTQA 1Z22A 3HPQA 3Q9LA 4Y17A 3T5DA 3MCZA 2QP9X 2O0KA 3K0FB 2AFIE 3BGWA 4YFXF 3AAFA 3K09A 2VSFA 3H3UA 4Q4AA 1MKYA 2DFTA 3IC7A 4Q1EA 5CLSA 4CEHA 1P6RA 3ZYCA 2WWYA 2ZU0C 4IDOA 4XIGS 2J0SA 3G0HA 3R20A 2L01A 2OFWA 3A1SA 2QSYA 1EH8A 1SKQA 5JMTA 1OSNA 2NZJA 2ZS9A 1KZ7B 4RZ2A 1E79D 3VEPA 4JVLA 1A4RA 4OL0A 3B2EA 3R4KA 1W36D 2DK8A 2ZRGA 5LGTA 2H94A 2H8KA 3M0EA 1IY2A 4RJLA 1SD6A 5AONA 2L4AA 2JPCA 5BPIA 1ON1A 2AX4A 1Z6YA 4B71A 3HU2A 4FWDA 2ZVPX 3U7GA 1B6AA 3SOPA 1JR3D 2G0NA 3NWJA 4TMXA 2EQBA 4P4UA 4LC0A 4M21A 1CR1A 2XB2A 3WTXC 2IX3A 1PP7U 1O7FA 4OMZA 2RCNA 3RRYA 3QF7A 1KDRA 3CBQA 3F22A 4ITRC 2YOHA 1X8LA 5L3BA 2O8XA 3VU9B 1LDKB 1TTYA 1GG2A 1R4AA 2MSCB 4CYMA 4B44A 3VFZA 1Z6GA 5CM9C 1YO5C 1UJ2A 4PPQA 2J7PA 5KTYA 1WF3A 3WGGA 2V9PA 3EPJA 3MD0A 1K7AA 4MYUA 1CF4A 1XJQA 4PHGA 1WSUA 1SD7A 2EV6A 5HLIA 4A0YA 1LY1A 2A78A 3CF2A 4LJ6A 4UVBA 1RIOH 5ICEA 1NVUQ 1XZQA 2DFNA 2P5SA 2HEOA 4G5OA 5FL7A 5ED4A 1AK2A 2P6RA 3RC8A 3SE0A 5GVSA 2NMVA 1OB5A 3KKMA 4NCJA 1FX0A 1NVWQ 3RS7A 2O03A 5L3SA 2D1HA 2R6DA 2BJVA 2OUKA 1DO0A 3U3MA 3OE7D 2YX4A 4Y13A 5CLLA 1LDDA 5BQTA 2W83A 4Z1MA 4MGYR 4WZAE 5C18A 1P61B 2JDIA 3W6NA 3EPHA 2FJUA 4JVNA 2FWRA 2P65A 4LY6A 4M1WA 1EXMA 3QPWA 1YG2A 4BNCA 1XX6A 5FL3A 2WKRA 4DSTA 1HY3A 2HYDA 4IDNA 3DFGA 1SXJB 2Q0OA 4G3XA 3U7FB 1XPRA 2HYGD 5DCMA 4JLNA 1DAMA 5KU1A 3M8EA 3ZVRA 1S4QA 3RTRA 1W7PA 4JT2A 2RGDA 3KB1A 3ROUA 1HV8A 3EC2A 2FOKA 3L0PA 3FMOB 1OV4A 3RSOA 3HHHA 5CB6A 3HRSA 1U0HC 1ZNXA 3THOA 1E9AA 1GUAA 4PSVA 4TT3A 4LHVA 3BPVA 5LHIA 3T1BA 2BDTA 4I1VA 5FTLA 5E8GA 3LFUA 4RY2A 3PV0A 4P9FA 4E09A 2O0JA 1Z1DA 4QBGB 2FA9A 4TLAA 1TAGA 4V0OA 2NO1A 3SHFA 3FM5A 4EPYA 1G3YA 1YR8A 2A5JA 521PA 1AZSC 5BYJA 5HDNA 4L15A 1IN6A 1OIXA 1J2XA 3OFNA 1LF0A 3LA3A 3CPJB 3N2EA 2BBYA 3THYA 3DQVC 2FN4A 4D0LB 1OW3B 1XCGB 3PQCA 3K1MA 1EWQA 4UJ3A 3A37A 2R62A 4LK1F 4P4SB 3RS4A 3GLGE 2WBLC 1L7VC 1Q1BA 1IM2A 4DB2A 5CVJA 4IHTA 1FZQA 1VCMA 3CO6C 1KO5A 1E2JA 3IHLA 4PFSA 5FBWB 4F38A 3CZPA 4W9MC 3E6CC 3HYRA 4RB2C 3S1AB 1MD0A 2A30A 2CL7X 2FU4A 4LB6B 1SVMA 4WXRA 4H0EA 2YVUA 2K4JA 4US0R 2H57A 1OFIA 1Q57A 3GFJA 1RFLA 2OM2A 2CK3A 4HLUC 3KLOA 1ZM9A 5IT5A 1BO6A 2KIFA 4JZKA 2DPUA 4UXHA 5FTMA 1Y0UA 2ZI9A 5J4KA 5IRCD 3EA0A 3IILA 2IT0A 5DD8A 1FSEA 4R79A 2IS2A 5JVTA 2PJRA 4LCBA 1EV7A 1IOZA 2H92A 4TQUS 2MD5A 4MDFA 4Q4JB 4V0ME 5TY0A 3LBIA 4DDWA 2JLRA 2PZEA 4PC7A 1U81A 3GJ0A 2XGJA 4IXNA 2IYXA 2ZEJA 3TW8B 2IL1A 3DKVA 3ICQB 4Q9KA 1PVOA 2O8DB 1OB2A 4UVAA 2XUBA 5ERIA 2C04A 3WODF 3GJXC 1LS1A 5K5QA 2CNWA 1W36C 4S05A 3GUDA 4DRZA 3CM0A 1JNYA 5DDGA 1VECA 5HVQC 2P5KA 1R5HA 2IPQX 3CIOA 3JTHA 4OHYA 5A4JA 1YYVA 1P72A 4GMDA 1E0AA 1QHIA 2QTVB 1DELA 2XAHA 4MUAA 4C0JA 1QVAA 4BRUA 3HRMA 4D0PA 1IUYA 1GTVA 5KO2A 1VCOA 2Z5UA 2BKUA 2GXSA 3PVSA 1OYWA 4A8JB 3OIVA 1DO2A 1T3HA 1KK3A 3VU9A 3B02A 3P26A 4KXFB 1EFTA 2OBLA 5FB2A 2O6GE 1DOAA 5LPNA 3R9WA 2GEDA 2PX0A 2O8FB 1U9IA 2KB0A 4NZYA 2Z6VA 1T5IA 2CCKA 2Z33A 2FV8A 2VIIA 2NO9A 3I73A 3L8ZA 4XOIA 4BLQA 3LA2A 2WZQA 1G18A 5SZJA 2NPFA 2IUTA 5DE3A 1G8YA 1T3SA 1W47A 1ZYUA 3FMRA 4LI0A 3PUVA 2ZSDA 1N0WA 5EP4A 3P7NA 1R5OA 3FHOA 5JHHB 2ZJ2A 1OYYA 4PAQA 5BMZA 1E2FA 4EAQA 5HPYB 4LV8B 4ARZB 2P4WA 4OQMA 5AJZA 3IL2A 1JR6A 2J7KA 2QGZA 1RC8A 4KIFA 2XAGA 3LX5A 4HAUA 1KJWA 4ZCIA 2CWEA 2ADUA 1W7PD 4QGFA 1S1CA 3KFWX 1ZM7A 3GCGA 4XWAA 1WBDA 4R9UC 2IHBA 4HLDA 4QXAA 5FR1A 3TVTA 3MQ0A 1ZC3A 4HYYA 3L09A 1AKYA 4JVSB 4UXJA 3IKVA 1SXJA 1XEFA 1A04A 3OOPA 1TEXA 5J4LA 1K8RA 1ZD1A 2HYFA 1KI2A 3NBYC 1JHFA 3DO6A 1G3IA 2W6JD 3ZGXA 5J47A 1KMHB 3QKTA 1XEXB 1ZM2A 3FZVA 2WOJA 1ONVA 3BIFA 5KSYA 1YR6A 2OCPA 2LKCA 2PMDA 1XJ0A 1J75A 5FOUA 2XAFA 3I0TA 1DPUA 2V6CA 1G16A 3DKWA 2ECKA 4A0HA 4BHCA 3R9XA 1KO7A 1VIYA 4URVR 1UADA 4RB0A 1VHLA 2P6UA 3CUOA 1AM4D 2GA8A 2IK8A 2IYVA 3SQXA 1GVNB 1HQCA 4TL9A 3LDAA 4HDUA 3CJNA 1C0WA 2HDCA 3BY6A 4BXUA 5A2QZ 4NE2A 1XD2B 2VTKA 2ASEA 3EG5A 5J4YA 1Q3HA 1P60A 2WICA 3P32A 4D25A 4KV9A 4Y0VA 3OIYA 3T61A 1FWZA 3RDPA 3AF1A 3QG1A 5FTJA 5JS8A 2ZRKA 5B58C 1FZPB 1E0JA 4Z8YA 3A4LA 5E7IA 1N5LA 5JJLA 1S3JA 5CB8A 4DEXA 2RNJA 1JXMA 2FPMA 2A3RA 3DEFA 3MMPA 4V0KA 3ZVMA 1Z6TA 2F5EA 3MAJA 1R23A 3DM5A 4PSKA 4P4SA 1ZRFA 1T2KA 3NIBA 1WRJA 1G7RA 2OBNA 1E9BA 1HW2A 4IDQA 4OHVA 1MGTA 3R8FA 2IW3A 4HF1A 4I1UA 3B1XA 2OBPA 5D5XB 1CEEA 1YRAA 3G3ZA 3S1AA 3W9YA 3WY9A 2NAZA 2X2FA 3THWB 1IRFA 1NKSA 2TMKA 2QQ0A 5EUQB 3Q5EA 4O5VA 3JSOA 1KA8A 2D1VA 3EQLF 4YIIA 1ZUIA 4KBFA 3RRZA 2X8AA 1SMYF 1S7AA 3R0JA 4MQ9F 4Q19A 3RLFA 3ZH9B 1AS3A 1Q3TA 1H8HD 4PHFA 2LF8A 1QHGA 1F4KA 1UF9A 2F3TA 1JE8A 1E4VA 4GOJA 4BE7B 4ZDJA 3CPHA 3ZDQA 2DB3A 1ZMXA 2HXSA 5ANRB 5GVRA 1SD5A 5EP1A 3FVQA 5EXSA 1OKKD 4Q4JA 5CYVA 5HKKD 1E2KA 1G5RA 2W0MA 2EWNA 2FGKA 1GRNA 3ZMVA 4BUJA 2PMUA 2O8DA 4HSEA 1JB1A 1W4CA 5K5RA 4JMPA 3U6KA 2C96A 2L02A 3QF4B 3VMFA 4XWKA 1FNNA 4JIMA 2ZRFA 3MAAC 2QVOA 2ZMEB 4L9NA 2MH2A 1GILA 1YHNA 2J87A 3AP2A 2DFKB 1MDMB 2ZUBA 2O52A 5E95A 3WBJA 4O2LA 4QGGA 4H9GA 2KIMA 4D4JA 5JR3A 3C41J 1DAKA 2C98A 3FMPB 4PANA 1COWA 2KWIA 3CRVA 4HATA 4YMUA 1MH1A 2QLZA 1M8PA 2XEXA 5F2EA 1IJEA 4JLAA 4URWR 5BN3A 5KNBA 3C4JA 4JKYA 1CR4A 2NS0A 4A8JA 1DAHA 1FYLA 4KI0A 2IA2A 1GSIA 4P32A 1ZRDA 3GEIA 4EFLA 1Z0IA 2EFPA 3KTAB 5LRRA 3BC1A 3TUJC 2BCGY 4DT1B 1FL9A 1JGSA 2O8FA 4GZLA 3HPRA 1BYIA 1GL6A 4MRRA 4TL8A 3O3KA 2I1VB 2H7VA 4HUQB 5FD5A 1MO4A 3L0IB 4NU0A 5FOVA 2YU3A 1XFAA 4LRWA 1J2JA 4XJXA 4BAYA 1YR7A 4UXIA 3SBEA 2BBOA 1YKSA 1GKUB 1E94E 1P73A 1KAOA 3Q9SA 2VQSA 3IBGA 4HV5A 4QG7A 5BW8A 2WSSD 2W25A 3C3WA 2YINC 4IVRA 2WTEA 2H17A 4ARZA 5SZIA 5TDHA 3P4YA 3QXXA 4EIWA 5LEKA 1VCNA 1WE2A 2QSZA 4ABYA 3NBZC 2RB4A 4LGMA 2XXAB 5JWRA 2EFCB 5F98A 3HTUA 1F5NA 2DPXA 3F6OA 4ESBA 4KCGA 3SZRA 4ASUA 3E6MA 1OHHD 1L2TA 1DEKA 2UZ3A 4JLKA 4KFUA 2QT1A 2B21A 3N70A 1W46A 4QRHA 1QZMA 2CCGA 3MFYA 1KMHA 2J9RA 1XEXA 2IW5A 1A1VA 2E1NA 2OAZA 2ZI3A 2QWWA 2F43B 2OAQ1 5HTKA 3LAJA 2XZOA 1R5NA 1P4WA 3B7GA 1O7LA 3KEOA 1BS1A 3IIMA 2J59A 4G7ZF 4OIQF 2JLYA 1DAFA 1KDOA 2ZE6A 2OZEA 3SBDA 4N3NA 3LA7A 3QENA 5FUWA 3DEUA 2W58A 1SFEA 4NYJR 3X2SA 4NB5A 2QY9A 2QZ4A 3RC3A 4TZ6A 4XSGA 4B3DA 1CTQA 3VKGA 3ECOA 4AYWA 2PMHA 2Z4SA 2PN6A 3I8SA 2XNDA 4HV6A 5JHUA 3AJIB 4M71A 1Z29A 5TVKA 1G64A 3LX8A 3OEHA 3GMTA 1JJ7A 4PQFA 1KO8A 1LNWA 4KIGA 5EEHA 1YZGA 1P2TA 5HS9A 1I4DD 3LBNA 2CCJA 5J8FA 2GXBA 4JLPA 2DK5A 1NF3A 2BCJQ 4LYAA 4PC1A 1TNDA 4CXFA 3IO5A 1G4UR 3KP4A 5E3HA 3J80K 4B76A 3KP3A 4ZCLA 4DIDA 1J7KA 5BOXA 5D3QA 3AVTA 4KA4A 2R6FA 1MKMA 2FSWA 1OFHA 3GW2A 4P5OA 1P92A 1XEWX 3TVDA 4CICA 3E6BA 4L5JA 2ZRLA 2ZNZA 4HB0A 1X8KA 2ZRCA 1IXZA 1S29A 3KKOA 4IKEA 2J0QA 4AKIA 3B1WA 4N9HA 3GJ7A 2F6RA 2RKOA 1D5VA 4KDPA 1KK1A 3U2QA 3P27A 3ZP5A 3GFPA 4S2EA 1L0OC 4HW0A 4YMSA 4C0SA 5K8UA 2AD1A 4WVFA 5BPDA 4A6DA 5KVRA 3FYHA 2VRWA 3RANA 4XSXF 4DB4A 2V7QA 3U3KA 2ZE8A 3CO7C 2IF0A 4ZKEA 1W36B 2VC0A 3AB3A 1I2DA 2GJ8A 2ISYA 3QF4A 4O6JA 4ZYHA 4GPTA 3U1DA 5BXQC 4NMMA 4LJ8A 2VBXA 2ZMEA 1DAIA 1ZIOA 2BVNA 4Q1BA 4KFTA 4YXWD 1MDMA 3H92A 3AF4A 4M1YA 2EWWA 2WSMA 3SN6A 3EW9A 3E5XA 4N0EA 4JVMA 1JXSA 4KO8A 4JBAA 2W2TA 4DJTA 3THXB 1UKVY 4M6XA 1KU9A 4OJQA 4LBZA 1HUQA 1UB9A 2RDPA 4WXDA 2P0EA 2QPTA 3A4NA 2FSGA 3KTAA 4URZR 4F93B 2PBRA 2DWQA 3BAFA 5CDFA 1XD7A 4DT1A 1UKYA 3GJ4A 1AS0A 3WNBA 2EFGA 2V4ZA 3WTTC 1SVOA 1ZUHA 2C5LA 4B3FX 2P7CB 4NDZA 2BEJA 4HUQA 1ZRHA 4RGSA 3CX7A 2VA8A 1LJ9A 4I1OA 5E1XA 3PUYA 2A9KA 5IK2A 4D0GA 4ZIRB 4JJZA 3TO6A 3MLEA 2V1DA 1E32A 2P5LC 1SZPA 2WWFA 2EWVA 2KBFA 2IVMA 2O5VA 4G5QA 2NIPA 1EK0A 2ZRIA 3T5XA 4UQOA 2GXAA 1S0UA 3K53A 2ODNA 2XNSA 4X8OA 4HX8A 1ZH5A 4B33A 2FMLA 4U00A 1KYIA 2JLVA 2DZNB 1S9HA 4ZYEA 1AIPA 2D4HA 3NC0C 1E2XA 2O0YA 2ZCWA 3DZDA 3BROA 1R36A 4R2IA 4XVRA 2XXAA 1B23P 1JEDA 1TU3A 4LD5A 2MSEB 4LRSA 2WTUA 4O25A 2PJZA 4YMVA 3RRNA 4HQMA 2OG2A 2CYYA 821PA 1KI8A 1ZIPA 4MA4A 3F0TA 1KJZA 1O3QA 1C1YA 4JBWA 4RD4A 1KTVA 1QHHB 2D2WA 2GETA 2QORA 4E70A 3AEZA 5A5GA 1D2NA 4MGRA 1M1YE 3DMNA 3HTSB 1IBRA 2DCUA 3H86A 4RZUA 4NL4H 4K8OA 1LB2A 1QQIA 3BD9A 3U60B 4CEIB 5G3YA 4B34A 4RB1A 4EPXA 2OLJA 2GZDA 2WMOB 1FP6A 3ADKA 1G6HA 1Q44A 4I98B 1XD9A 3EA5A 3IKJA 1R8SA 2XNDD 4PO8A 2RGAA 5SZKB 3ZN0A 3LAWA 3MZHA 1OF1A 4IDPA 4JBYA 2UWMA 5JFRA 1YRBA 2ZXUA 2ZRMA 3KP7A 3I53A 2OU2A 2GTPA 1F60A 3QOFA 2A5FA 2ZS8A 4RSGA 1CU1A 3RS3A 1G3RA 3QPVA 3VFDA 2A5DA 3LFKA 2BMDA 2FZLA 1S7OA 1O3YA 5EP2A 1R6BX 4RD2A 1CXZA 1F5TA 3K1PA 1NBME 3QY0A 4A2PA 3TQCA 4BEBA 4TSFA 2EV5A 4ENJA 3MFKA 3E3VA 4MNUA 3BOSA 3RKWA 2P8TA 1AGRA 4P3YA 3H84A 5CIWA 3QOPA 4HLUA 5EZ5A 4XVUA 2DO7A 3DF8A 2IYSA 2NNYA 3LXRA 4L9VA 4RKFA 4A2UA 2QPOA 2QA5A 1IXSB 1FFHA 1XF9A 4OK3A 3IEVA 3I59B 1TMKA 2GJKA 2V7QD 3W6JB 4AKEA 4HAMA 3IEUA 1GIAA 4KFCA 3QAHA 2YKGA 4OHWA 1Z06A 3NHBA 3SYKA 2VLIA 1HURA 5JBQA 5FOTA 1I4TD 1YLFA 1D8TA 1MOZA 1S8FA 3VODA 2CO5A 4A12A 2GHIA 1E96A 3QXSA 3C7KA 3RAPR 3K70C 1G291 5DHFA 1Q20A 1E79A 2JCSA 4M73A 1XMVA 3T8RA 2KJQA 1STZA 1HKSA 1QDEA 1QGPA 3WNCA 3FWEA 1LEBA 3ICEA 4I4LA 2STWA 3LWFA 4RD0A 4A2WA 2Z0MA 1KYWA 2B0LA 1YJ5A 3NG1A 4FWIB 3E5QA 3MZYA 1DG1G 2FSIA 2H18A 2J5XA 2RGGA 5ELXA 4ZPXA 2D62A 1JR3A 2A5GA 5GJCA 2C6YA 5FR2A 2WHXA 3THXA 5K1YA 1JI0A 4KBGA 1R7RA 4KFSA 3TO7A 2GK6A 2PQ8A 1VYUA 1U5TC 3K0AB 4HEJA 4AG6A 5DGXA 2JLUA 1SAXA 4WXPA 4BFTA 4KAXA 2FE3A 3U7HB 1X86B 1N6NA 2HCJB 1ETUA 2KJCA 4P4TA 2LSOA 2IT1A 3HJNA 3EETA 2FEMA 3OEED 1RKBA 1TQPA 4TTQA 3UPUA 2XKPA 1PV4A 3Q7QA 1T3LA 2GWHA 1QHYA 2G6BA 4KYUA 1Z83A 1XPUA 2IS4A 4EKDA 2J0VA 3LVQE 4M1MA 4IRUB 3I4PA 1SGWA 2Q9CA 2VT2A 3BBPA 4RFVA 4ZIRA 2ZI7A 2ZXJA 1N5JA 1U90A 2VHUA 3JZMA 2CXXA 2A6HF 1KSFX 1T4GA 1X1SA 2ZFWA 2W00A 3LO5A 2AD5A 3TUIC 3SC3A 4CW7A 1Z2CA 3I4LA 2G7UA 4HBLA 4R71A 3NH9A 2WWIA 2QM7A 4YMWA 5KDLA 1WQ2A 3GLIE 1TW3A 3OE7A 2YWGA 3EWSA 2ZYUX 3MWJA 2A69F 1DPRA 1VIAA 5HS7A 1DS6A 2ZRPA 4EFMA 2WIBA 4FI3C 4JL8A 4EUNA 3PEYA 4D80A 4KVAA 3FDIA 2IYZA 2ZJYA 4DCTA 2RHMA 2R6GA 5CK4A 4KITB 4S04A 5M04A 3FF5A 2BEKA 2A5YB 4UV8A 3LAPA 1QHHA 4U5XA 4WZBE 1ZRCA 4US1R 4E22A 1G41A 4PC3A 2FXAA 1UHMA 4I0AA 1EFRD 1P3JA 2EYQA 3TKYA 1WI9A 1NP6A 2R65A 1G8GA 2NQ2C 4Q9HA 5CITA 1Z91A 2LF7A 1QHXA 4DQ2A 1GDDA 4CEIA 2PCLA 4Z51A 5H1YA 2DZOB 2FFHA 3A1VA 4LPSA 1DTSA 4NCKA 1KSJA 5AJYA 1N0VC 1CRPA 4BFVA 2IRFG 1SVKA 2QRNA 1EH6A 3KJEA 3PUWA 4LGWA 3L7WA 4EV0A 4NYIR 4TTPA 4Z54A 1KNQA 3K8YA 1YS6A 2LKDA 3SDZA 3E1SA 3I5UA 1NMYA 1VHTA 4D6PA 3B1YA 4ERNA 2ZRJA 3F5FA 4KLNA 4Q5IA 1XNJA 2H27A 2J5PA 4FHTA 5CVUA 2YWEA 3HYTA 3RABA 3ETLA 1T0HB 221PA 2GESA 4LV5B 3SQWA 1NNEA 1ZJ6A 3QKUA 5IT3A 5EXXA 3KXLA 2ATXA 4M2LA 2ZO4A 4P9UA 4RFSB 1ZAOA 3KQNA 2OXRA 5E20A 2ZM5A 4PDKA 3TOBA 5JWOA 2C9CA 1W48A 3H3ZA 3KJGA 4TLCA 1TU4A 4AKGA 2CVHA 3KP5A 1PLLA 4TQ9A 4HAYA 3F3YA 2VPPA 2DFIA 3W5JA 3NEJA 4BZXA 1B1BA 3I59A 3ZPLA 1SKYB 4QGHA 1OH8A 4GNKA 2VBCA 4F7ZA 1S2MA 4MGIR 3B1VA 3W5IA 1IW7F 2VXZA 1N6LA 3L0SA 3BE4A 1AN0A 1DADA 2XOKD 1S9DA 3FXQA 4QJ5A 3NBFA 5EE0A 1NSFA 2LKPA 1XGSA 5GJBA 1XEWY 1OXVA 4F92B 3MEXA 1NN0A 1KSGA 3AUYA 2FE4A 3HOSA 3AF3A 3CF6R 5FPSA 5HE8A 1I6XA 3HU1A 2E7WA 2YR2A 3DPLC 3HU3A 1TUEA 1TPZA 4KVGA 3WMEA 4D4LA 4QBFA 1U2RA 2HXYA 1E9FA 2VP4A 2RC4A 3BPXA 3RJPA 1M34E 2VO1A 3KQKA 3RHFA 2VL7A 1W4BA 2I3BA 2PI0A 2F55A 4EVIA 1JEEA 4E03A 5DEQA 5LGNA 3KXKA 2VH5R 4C2TA 1GL9B 2Z4RA 2ERXA 2P6TA 3B73A 4AKHA 3ZS8A 5L3FA 2QQEA 3LWNA 3VTKA 1WBBA 4MEXF 4EFNA 1XTQA 1M2OB 2KBEA 2IA0A 2AFHE 1I4LD 1XGOA 2ZJOA 2PEZA 3K0AA 3KKQA 4LWZA 5JEDA 4BLSA 4QNMA 2ZRDA 2F5CA 5L3CA 1PLKA 3LH5A 4B3BA 1ESMA 1GFIA 1JBKA 4MTEA 2ZRHA 3P9CA 2C03A 2P5TB 1SVLA 4OIRF 4IFBA 4G5SA 4HLXA 3VX3A 3AKEA 2OFOA 4B3CA 2FX3A 2H6CA 1E2DA 4N1AA 4P55A 4PPFA 1Z3IX 4M74A 5LLQA 1ZD9A 4BWYA 3TKLA 2L4MA 1XCMA 4WWCA 5EXPA 1RIFA 4TLDA 3AF2A 1YE8A 2ZJZA 4K81B 3GFIA 4Q21A 4DLXA 4IJAA 1DARA 2EVWX 2GNOA 4KYIB 2NRAC 3JW4A 2REOA 2QM3A 1HEIA 3ZMZA 1P4XA 2J0UB 1O3TA 2AKYA 1XXHE 2BM0A 4JSTA 1D8KA 3DL0A 3UATA 3WE2A 1BN5A 2BV3A 2IEYA 4FN5A 721PA 2BC9A 1ZVQA 4G6QA 2ZBKA 3VR4A 4DLSA 2O8BB 4WIAA 5DCFA 1F2TB 1QZZA 2VP6A 2VBWA 3QU6A 1BMFD 1AGPA 1N6PA 2GJSA 4OMYA 3TR0A 1VYTA 4V02A 3FXUA 2V1UA 2W6JA 1AOYA 3QEJA 3IQXA 6PAXA 1OYIA 1QZYA 1S96A 2QE7A 4PSAA 3PJRA 1F6BA 3AVYA 4KHZA 4LLNA 3BH7A 4TMTA 3UG7A 3W8RA 4XVQA 4ZKDA 3T1TA 2VT3A 1U98A 5FBQB 4BLRA 4WZ6A 3GJ6A 1KO1A 5DD4A 3DM9B 1LQ1A 3T06B 4AWXB 3Q3JB 4XSHA 4MDEA 4Q1AA 4I0BA 3CLOA 2W85A 4WA7A 1T0FA 1SD4A 3LQRA 3DXJF 4AIIA 1W0JA 3LA6A 2M1BA 2JLZA 2MSDB 4B3GA 2KIUA 4BHPA 1T39A 3ZMUA 3OIWA 1J70A 4TMKA 4YDSA 4LHXA 3RS2A 2O8EB 1S3SA 4B43A 2W84A 2OLKA 3E5UA 2YX7A 3DPUA 1PLJA 3K0FA 4RFSA 4TQAA 3NBXX 1HT1E 5C2JB 1I2MA 1TF5A 2Y48A 2XTMA 3WU0A 4A0XA 4FIDA 3ABTA 4HB3A 4CIDA 1Z6AA 1UDXA 1FP2A 4LDJA 3RYPA 5GJVC 3V00A 3I5YA 5EQTA 2GEVA 4KICA 1NLZA 2GXQA 2HLDA 4PR0A 1Z07A 3LY5A 1NY6A 2HS5A 1H8HA 4OI1A 4LZZA 3FMSA 3F21A 4AI6A 5CVRA 3GLHE 2ESNA 1II8B 2XJ4A 3K70B 2VHTA 1J9IA 1E9DA 4HZIA 4DCNA 3J81K 4A6EA 4CGZA 4OIOF 4GBMA 4OKSA 3SFVA 5E8IA 2FFBA 1Q0UA 5JZVA 3TOAA 1H9GA 1OKKA 3R8CA 4WAUA 2QP4A 5HKKA 4TTRA 1BI3A 2Q9AA 3KLNA 2E1RA 4KFRA 2GAAA 3O8RA 4I09A 2EA2A 1U8YA 1BH2A 1KNXA 4UHTA 2GVDC 1NVVQ 3ZMDA 3VQTA 2QQ9A 4JLDA 3BJAA 5FOWA 1ZLKA 4XLNF 3CDHA 3VKWA 1BIAA 3IIKA 4LYHA 2BV6A 4UNQA 1L4YA 1KAGA 1MV5A 1NMXA 4UKDA 1CBUA 1U5TB 2HWVA 2VHQA 2HT1A 1B9MA 1OFTA 2HZTA 2OILA 1ESNA 2HF9A 3F8FA 3B6EA 4H1VA 4OJKA 4A2QA 1LVAA 4B48A 4A9AA 4MQBA 2CQKA 1LV7A 1U8RA 1ZM4A 3ABUA 3D0SA 1EESA 3VHLB 1P7CA 1S3GA 2ZR9A 3I62A 1Z63A 1YU9A 5E7MA 4BEJA 1Q1QA 4G94A 2FGJA 3V7SA 3ND8A 1N6OA 3FGNA 4IRHA 1X3SA 1AKEA 3LRPA 4OHXA 1HW1A 1R0YA 3L8YA 4P0TA 3O8DA 2X4HA 2WV0A 2WVJA 3SHWA 1H0MA 2XAUA 2H5EA 4W7SA 3PENA 3SI7A 4GOKA 4AIJA 1QHSA 2OE2A 2D7CA 3UANA 4JN6A 1Z9CA 2IP2A 1FUKA 3ADDA 4KSCA 5ILUA 5GJWC 1YFHA 3TW4A 1WQ1R 4ZI2A 4X8MA 3IKTA 1E0KA 3CX6A 4ZZDA 2A07F 3TQNA 2OD5A 4OYHA 4AYXA 1IXRC 3M4YA 4D2IA 4EJOA 3V8JA 1NN1A 2J0UA 2ZAOA 2JJ2D 2WSSA 3K9GA 4OQNA 3UXMA 4LUCA 1RUOA 2V9VA 2XKOA 4A5MA 4YIFA 3AGQA 2GCNA 1P2FA 5CM8B 4XSZF 3I64A 3FB4A 5BN5A 5TB5A 5L3VA 1X6VA 4QL3A 4A92A 1CKEA 2O8BA 2DR3A 2V79A 4PZJA 1BIBA 1F2TA 2IYWA 1WKMA 4BQAA 1OT3A 3BFXA 2QE7D 2BHRA 2GBLA 1OHHA 3HR8A 2VHCA 1PP8F 2WV9A 3CONA 1W5SA 2IA5A 5DI9A 2NYXA 1HE8B 4E5UA 1A82A 3UK6A 5HS8A 3IDQA 1BM9A 2J46A 4DDTA 3V9PA 1XMKA 2RQPA 4H1UA 5JJIA 3VKHA 3REGA 1TL7C 4Q7LA 2ZYWX 5FH9A 1OKRA 5IHPA 3KJIA 4U88A 5CLQA 4N0BA 4BASA 2WWHA 5A0FA 1VG1A 2BBSA 3NDPA 1CP2A 1TQMA 1W0JD 3Q8XB 1B0UA 5AUOB 3U2RA 2GAUA 4A36A 3Q85A 4OI0A 5KPJA 3WXMA 2EFHB 4AWXA 3NVAA 3U9GA 1T6NA 3HR7A 4UJ5A 2P6SA 4ZV4A 1PZNA 2D3WA 5J6XA 2XSZD 3QI2A 4DC9A 2C78A 3NTUA 4Y15A 4IOLA 1XTIA 3M8FA 4CDGA 4DWJA 2HOEA 3COAC 5H70A 2O8EA 4M9QA 5D8LB 1WDTA 2A61A 1UBCA 4RD3A 3I58A 4Q00A 4BYYA 1G4DA 1XBTA 3SJCA 2JSCA 2HLDD 4DLWA 5B2ZA 2HTJA 1V43A 4PCQA 4UVCA 5FLXK 1GZSA 2HF8A 4OQLA 4RCZA 2REBA 4IHQA 4LSGA 4PTLA 5AUPB 1FP7A 2I1QA 3RPQA 3E70C 2RHDA 4QOSA 3O8CA 4XRFA 4IOKA 3EX7C 4FX4A 3I8XA 1F48A 1U2WA 1ZP6A 2C95A 4GZMA 4NYJQ 2WKPA 2HFHA 5HZKA 2G1JA 1P2SA 2ZVQX 3ELKA 2ZR7A 3LLUA 3AGPA 3B9QA 2IXEA 3PR1A 3K9LA 4Q03A 2X2EA 4IDHA 3AVPA 3BJIC 4M8NE 1X1RA 5TRDA 2ATVA 3UWKA 3JAMK 2EW1A 1FMJA 1OR7A 1XTSA 3I92A 1BI2A 4CHUA 3LD9A 4GI7A 5DH9A 1PUJA 1ZU5A 3D6TB 3F8BA 1R0XA 3MRSA 2RN7A 2WIAA 1MO6A 2K5UA 2P6NA 1YIOA 1BOAA 4MYTA 3W34A 4JL6A 3L2OB 4YXWA 3AUXA 1KQ0A 5D5WB 1R10A 4DXAA 2PZGA 1Z8FA 1UDWA 2C9YA 3QUSA 2XGXA 4MITA 1U5TA 1ELOA 5HE9A 2REXB 3GJ3A 1LDJA 5CVIA 3GJ5A 3TE6A 3WRYC 1GVJA 1CJUC 1RRFA 2WC2A 2EA4A 4LHWA 4KLZA 1KSHA 1D2MA 4NONA 3MG9A 3TDZC 3Q5FA 3VOEA 3PEVA 4BLTA 2OV2A 4JYCA 1FQKA 5AIQA 1B4AA 2BKEA 1KY3A 2GZHA 4MKFA 5IDVA 5B30A 4GRAA 5FFZA 1QBKC 1F9NA 3GLFB 2JLXA 1OMIA 2IS6A 1AQUA 1R0ZA 1FSHA 1VYVA 2VF7A 3QE0A 1NJFA 2RGBA 1G9XA 4PPNA 4PO1A 5JJKA 3J81k 3SZPA 4V0MA 3GZ5A 5KPDA 3KX2A 1AS2A 3Q72A 4AIKA 4FMBB 3SFZA 3CH4B 1E3MA 2GVZC 2FF7A 621PA 2ZSBA 3QXCA 1QVRA 1O3SA 4V0LA 3CR8A 4U0YA 1R8QA 4URUR 5K8TA 2UZKA 4XTCS 2UVQA 2DT5A 2DWPA 1RNLA 1CR0A 4JLOA 3TGPA 3DP7A 2H16A 2K4BA 3KP2A 5FTKA 4KUMA 4ZYDA 1JJVA 3K2ZA 3O2PE 3TH5A 5L3QB 4RGXA 1FLIA 1DUXC 2QT0A 2IWHA 3W3ZB 3I54A 1FT9A 3T1VA 5TV2A 2AKAB 4K2EA 1GM5A 2O61A 2YPRA 3GFMA 1J90A 2DBYA 2F9MA 5JRZA 5DN6A 3TNFA 1YW9A 3ULQB 4MQVA 2GXGA 1HKTA 5KOYA 3K0SA 1BC7C 1P2UA 2YOGA 2Q3HA 1BOFA 1OJLA 4Q4ZF 2KSQA 3F8MA 4LOAA 1XD2A 1XMIA 1Z08A 4X8HA 3TBKA 5FBRB 1H9TA 1JXOA 1YZQA 4KN7X 3EARA 2XJ9A 2XTZA 3LV8A 4KYWA 1CGPA 3IHWA 4TMWA 2PG4A 6Q21A 2N46A 3B8HA 4QNRA 3EYIA 1YZUA 1VG8A 2NO0A 2CL0X 3WYFA 4EGYA 3R0AA 4DCUA 4CT5A 3FTQA 5HCIA 2R3SA 4GP6A 1E1QA 1W7AA 3E5HA 2PBIA 4EPRA 2WPDA 4OBEA 2GEUA 2E1CA 5HLGA 1VKJA 3EDPA 5DV5A 3THWA 1ON2A 4FCWA 3WTSC 1IAQA 3HYIA 2QEQA 4HZUB 2BOVA 2HT6A 2WWGA 4ACBA 3V8KA 5GADl 3ZVLA 1RRCA 2W6ID 4QC2A 4L9JA 2WJGA 1MO3A 3PEWA 1SFXA 4AD9A 3G73A 2ZS7A 2EFNA 5ICFA 2D74A 1M74A 3GF2A 5FPKA 4B6FA 2V1XA 5E1WA 1GNRA 1KOFA 2MMCA 3K70D 3KL4A 3TLXA 4ESJA 2BWJA 4TYYA 3VR6A 4GSYA 3I32A 3RKYA 1SXJE 5ICCA 4IVNA 3CO5A 2J45A 3TR5A 4DCVA 1T98A 1QF9A 3NC1C 2SHKA 4A0ZA 4HLYA 4WXHA 2A2ZA 2IA1A 3R9IA 3VR3A 4KMUX 3BOQA 1GOTA 1GHCA 4G0NA 4GXOA 3WE3A 3OHMA 4EPWA 1M6NA 2VODA 4FXPA 1WMSA 2QG6A 1YR9A 1XD8A 5EE1A 4YQFA 2AS5F 1TLHB 2QAGC 2ODWA 5AJXA 1T38A 1MT0A 4BFXA 3Q7PA 3GO5A 4WW0A 4POAA 4RD1A 2HTSA 3KJHA 1JAHA 2Q3MA 4RVCA 4JLJA 2R7FA 2PL3A 2QL6A 3QBVA 1QO0D 1ZBDA 1UBEA 4QBHA 1XXHB 1JHHA 1EGAA 4OU0A 3RRMA 1LF5A 2XB4A 4NBSA 4BQSA 1XCPA 3RS5A 1G17A 2GCOB 3SS8A 3R7WB 2ZSFA 4BPBA 2ESHA 3ZQ7A 1T9HA 4B2PA 1Q12A 2Z3YA 1N5KA 1GKYA 1NSTA 2BMFA 3BK7A 3SZTA 2FMYA 3J80Z 2AN9A 4NPHA 5FOXA 2CLCX 2HV8A 2C77A 2IYUA 1CLUA 3KUCA 2GIVA 3B5JA 3RYTC 3Q5DA 3WGIA 1D6JA 4EJSC 1KU3A 1ZLJA 2E9SA 2BE5F 3AH8A 2QNRA 4PZYA 3MUFA 5J40A 1BI0A 1VG0B 4EPTA 1SMTA 5AIPA 3M9AA 2HDNB 4M9XA 1Z2AA 3X1DA 4BFUA 1LVGA 4QBIA 3FHTA 1UBFA 2IEZA 1HTWA 3OEEA 4LJ4A 4KU4A 2IYQA 2YWHA 3GLFA 1NKTA 2LDUA 5DLQC 1AZTA 1U0LA 3QPTA 4UNNA 5AUQA 5IT9K 4MKIA 1N2CE 2Q21A 1W2GA 2XHKA 3NKVA 1D8JA 5FUXA 1K5DA 4PXAA 3GLGB 3UMFA 3M1EA 2RGEA 5JI2E 1I1GA 1CJMA 3IUYA 2JLQA 3EPKA 1U9IC 3OAAA 4TL7A 3BZ6A 2PLFA 1BJAA 1E0SA 1ZD8A 1U0JA 2HGCA 1Z28A 1IQPA 2HKOA 3GFLA 3QU3A 5DN6D 4Q4HB 3CX8A 1VMAA 2FEOA 2E7XA 2BIFA 4XD7D 2ZJ5A 2IXGA 4PPGA 4CF7A 2F43A 5G40A 2W0SA 4B6EA 2RVCA 1NIPA 2LCFA 5JEEA 1XSVA 5CIQA 2DTRA 3L0OA 4LJAA 2V8OA 3WP0A 3FFAA 4US2R 3JVUA 1P5ZB 3RKXA 4LLLA 2CE2X 3A1TA 4M0LA 4JK1X 4A5NA 1FOEB 1US8B 3FHCB 2ORWA 4XBFA 1EFRA 2C2HA 4D4MA 2BMEA 3M7GA 3VB2A 2Q6TA 2CHGA 2HKXA 1E1QD 3OZXA 2GZWA 4XLPF 2D7DA 3U61B 4IPAA 2WPDD 3ERED 1I1SA 4G1UC 2ONJA 4M1KA 3L2CA 2CMKA 4QHYA 1HXDA 1YW8A 3OIUA 4BHBA 2O0HA 5K8LA 3E2IA 1YQAA 2AK3A 2QENA 3EZFA 3ZN1A 4EJWA 1T5LA 4L8GA 3K0EA 3VAAA 1B59A 1AQYA 1X3UA 3T0YA 3SJZA 2AHOA 4KN4X 1MR3F 1ZG3A 4CZZA 2FZ4A 1HBXG 2DWOA 1Q1HA 2ZE5A 3EIQA 3IIJA 1G8PA 1W49A 5DUKA 4CZ2A 8OHMA 5CJ9A 2CHQA 3P9IA 3BWDD 4JQFA 1YW7A 4HZUA 2DFLA 3VLFB 3V7RA 3HOTA 1WCV1 1WXQA 2IHYA 3B82A 4X8LA 5B57C 3KUDA 4TV7A 1XDBA 3C18A 4GYGA 2V3CC 4AK9A 1P75A 4ASNA 1SVSA 2CLSA 4TWZA 2Q8KA 1H65A 3AKCA 5FUYA 3F3XA 3WRXC 2CHVA 2LWIA 2ZRAA 2OAP1 2PEXA 1RE0A 4HAVA 1XDSA 3BB3A 1ZCAA 4DSUA 1W0KD 3U3JA 1P9WA 2OZUA 1E2PA 3IO3A 3P9KA 1HQYE 5DO9A 5H6QA 5BWMA 3QQ5A 1KJYA 4RD6A 2XAJA 3U3RA 3UWOA 4ZDWA 3FOZA 4U0WA 2M30A 4CRWB 1ZHFA 3KQUA 2EFQA 4TMVA 1FBQA 3LLMA 1FUUA 4IOMA 4N0DA 1K78B 2XOKA 4U7BA 3QVVA 1VDZA 4LMYA 2XITA 2AL7A 4M1TA 4NYMQ 2KRFA 5H6RA 3JVVA 4Q4LA 2RGNC 1KGSA 5EE5B 3QJYA 5C4GB 3SJAA 4PGHA 3U7EB 3A36A 4MUBA 1FBUA 4OINF 3PG5A 2DQRA 5KHOC 2KI5A 3DKPA 5EZ6B 3NEYA 5BN4A 4OI2A 4PC6A 5AK0A 3LW7A 3U44B 3VNUA 3FX3A 1U8ZA 3OV8A 2YC4C 3M6AA 3ECHA 5FD6A 2ZRNA 3WG9A 2GCOA 4B2IA 3R7WA 4LFUA 4OK5A 4LBWA 4IRGA 5HOOA 1KIMA 2GWRA 4IOJA 2H09A 5FPYA 1OE0A 1VCIA 1KU2A 1OIWA 3DMDA 3SYLA 1XTJA 2HEIA 4BECA 4A82A 5H68A 3EIEA 2ZPTX 4EJTA 3FKSD 4ESFA 3L00A 3TAUA 1KI4A 1O87A 1K6OA 1PJRA 2QM8A 2F5FA 4XH9B 1KY2A 2JIZD 3FPAA 4WF2A 3GPLA 4NCHA 1KDPA 3NRVA 5E18F 3T5GA 4BLOA 5KNCA 4XWOA 3OAAD 2QBYB 1Q1ZA 3KXIA 2DPDA 2ETHA 2IJLA 4A0FA 2GAOA 3U6BA 4A4DA 4MGKR 3HWSA 5HZHA 4Q1CA 3WNDA 3X1ZA 3GLGA 2JT1A 4QWQA 4HQEA 3DOEA 4TYQA 4PO9A 3RSLA 3X1WA 1WB9A 2DBBA 1VG9B 2GRJA 4M1OA 2D2EA 1Z47A 2ANCA 4PHTA 3WYAA 1NIJA 4C4PA 2XVCA 3BP8A 4RGUA 1GWNA 1SHKA 2VYFA 4GOXA 3VHXA 3QIAA 4QJ3A 5F9HA 3KCCA 1BC8C 2BBWA 3PITA 1G5PA 1T8UA 3W6KB 4D81A 4Q4HA 4C9BA 4LBYA 2YYZA 4C3ZA 4OI4A 2V55B 5L3SB 3BJ6A 1B9NA 1XN7A 2VBYA 1G7CA 5HR5A 1PUEE 1KI6B 2C8VA 4ON9A 2CVFA 4DLYA 4LK2A 5JLJA 3CUEF 1HA3A 4O0MA 4NTZA 1JPJA 1E2IA 5L8VA 4B32A 1BMFA 2VN2A 5J8CA 3WHLA 3EAQA 4GL2A 3RPUA 5CYPA 3L82B 2FBKA 2ODBA 5DNYB 1W5TA 3CH5A 1D3YA 1E4YA 1XZPA 2WJJA 4DZZA 5FOSA 1US8A 1LW7A 2VP0A 3HUGA 3FMFA 1IONA 3EZ7A 3MWLA 4JT4A 3C8UA 3MWYW 3EIHA 2IWRA 4TYWA 3DOFA 4DDUA 2ZYVX 1W2HA 4G01B 1RUNA 1GRRA 3ECCA 3D31A 2QZ8A 3T1OA 4FD2A 4D82A 4I7HA 4DUGD 3DPTA 1E1RD 5CDFE 5H8WA 2C99A 1Z05A 5D4SA 4ENMA 2F3RA 4TLBA 2OCYC 1QNTA 3BDDA 2K7LA 4G9YA 1H8ED 2AWNA 4EQQA 2G88A 4UNPA 4Y0AA 2JGNA 4ASUD 2NOAA 4NQWA 3ZQJA 1W4RA 4LRTA 1ZREA 3J7AO 2R6CA 5TARA 2MBFA 3CUQC 1NL3A 3GX4X 2EFDB 2JA1A 1TADA 3N5CA 2UKDA 3DV8A 2JJ8A 2NNNA 2DHRA 2QI9C 4HAXA 2F1IA 1TQ2A 2EYUA 2NO7A 4HAZA 1G3WA 2HCBA 3GYHX 2YJTD 4II7A 5K8IA 2VOOA 2G1KA 4R1HA 1KO4A 1GXPA 3EXAA 1G7TA 1VTKA 1XTRA 4RCYA 2GKSA 5L3RA 3GP8A 2WJIA 1Z0JA 4FMCF 5EXTA 1R0WA 3KZ1E 1JQJC 3SR0A 2GJ9A 4EMSA 4Q66C 1UBGA 3GD7A 3SXYA 2PCJA 2MH9A 4R8HA 2D06A 1ZW6A 5D3MB 2V54A 2QAGB 1IHUA 1X8JA 4OHZA 1G21E 1LB1B 1K78A 2BEOA 2IYLD 3VR5A 1NVXQ 5FBLB 2GA2A 1D5CA 1XMJA 2A68F 1A7JA 1OFUX 2FBIA 1G8HA 3ONWA 2ORIA 3BRWD 3V4FA 1E9RA 3KKPA 5F3WB 1ONBA 1OXSC 2F7SA 3F6VA 3RNLA 1LNZA 2QU8A 2NGRA 5IF9A 3U44A 3ZZ0A 1KKLA 1I5ZA 2HUPA 2QN6A 3MSXA 4NCNA 1U99A 3T1QA 3NH6A 3NQOA 4YDHB 4DHEA 1L8QA 4EJSB 2R9VA 2BMJA 2RGCA 3I5XA 5C46F 2R6AA 3QPUA 4OQXA 2GCPA 3FFBA 2EFOA 3WTZA 4A15A 4B35A 2X1VA 1V3FA 4FX0A 3IWZA 3ZD6A 4ETSA 2M5WA 1QRAA 4S35A 5F6FA 3CLVA 1JALA 3GVAA 4FT8A 1CS4C 4JJKA 2JLWA 2QBYA 4UNOA 4FINA 5DYIA 2PX3A 2VC1A 4R2HA 4FWTA 2O8CB 2ZI6A 3AV0B 1KQ8A 1IAWA 3U4QA 2G0TA 1K79A 2PLYA 1FPQA 4DNCA 4J0QA 4PQYA 4BFZA 3I72A 5JHGB 2VP5A 2XZLA 5UKDA 5KUTA 1NJGA 3CRRA 3PUZA 2Y75A 1ODDA 4ZDKA 4MRSA 4C2UA 1E9EA 5LHGA 3F8CA 1AWCA 4AD8A 1UM8A 1CJVC 4A3VB 2JJ2A 5G41A 3IHUA 3SEAA 1SULA 3MJRA 4LV6A 1NG1A 2FEZA 4WOPA 1KI6A 1CR2A 3GFOA 4Q48A 1USTA 3HSEA 4ENNA 5D8KB 2W2XA 4B3XA 2GJAA 3BB1A 3IPXA 3QVUA 4LX0A 1G6OA 2HR3A 4PHHA 3TJZA 4C0KA 2Q2EA 3QP6A 1OIVA 3AVOA 3CPEA 4GYIA 3TRFA 2LNBA 1JR3E 1KK2A 1EX6A 1CULC 2PEYA 3WTWC 2ZJAA 3IGFA 4LBVA 4NHOA 3ZVNA 2F1JA 2P67A 2MMGA 5KYKA 2GF9A 2Y8EA 3B78A 4IFEA 3SU8A 5KSZA 1UKZA 5D4RA 3HRTA 4B2LA 3MWKA 2L54A 4Z8XA 4U7DA 2UZIR 4YG2F 4ZZLA 2CLDX 2G9WA 2ZSEA 4D26A 4URYR 3DVLA 5DUIA 4EM0B 1CIPA 1P9RA 2NPIA 5LD2C 1O3RA 5KDDA 1C4OA 1E6CA 3EZ6A 1WRBA 2FA5A 2B7BA 3W3AA 4EQ6B 4P33A 3TGNA 2XSZA 3LW8A 1R7JA 4HAWA 3H4MA 1ZCBA 4CYDA 2Q9BA 2AWOA 4PAMA 3T35A 4AURA 2UXXA 4EM2A 1IY1A 1GRQA 1TEVA 1G4AE 3BJOA 4WCGA 1RYFA 2NTYC 3GLXA 5AR1A 5FPTA 4D4KA 3ZD7A 4C7OB 2N1BA 1TNSA 2DI3A 4M9ZA 4FMCB 2PFBA 3MGCA 4E07A 4DBLC 4I02A 1ZARA 2D2FA 3F72A 4QM6A 4AC9A 3V8LA 2QYOA 1GITA 1Y3AA 4IXAA 2XRNA 4YC7A 4M4SA 1WP9A 4JKIA 4OQFA 1II0A 3FXRA 5JRJA 2B8WA 1IZ1A 1Z0AA 2YNMA 2WM9B 2F9LA 4W5JA 2XASA 1EFUA 1S1MA 2Y0MA 4M6YA 2JEOA 5D3MA 2QAGA 1TQIA 3KW6A 3FHZA 1XRJA 1IXCA 2WAXA 3T34A 4HUTA 2M8EA 5EEGA 3IWFA 2ZU6A 4BLPA 3QSYA 4I81A 1W0KA 4RZ3A 4ON0A 1E98A 4QFMA 2BYVE 4IF4A 5JSZB 4WXCA 1KQ9A 1UEIA 2OCBA 4BH9A 4F4IA 2FSFA 4HX4A 1E69A 5LB2A 4GFDA 4DDVA 1ANKA 1EH7A 2ZJBA 1RI7A 4IHSA 4K46A 3ZQ6A 4C0BA 2Q0HA 2YHSA 4LC1A 5CK5A 2CGPA 1YZKA 4L5IA 4BFYA 2VE9A 1UFMA 1XJCA 1MZBA 4GGGA 4L9TA 2VONA 2ZSAA 1SFUA 3TSWA 3GFTA 4EJVA 1J99A 4Q9IA 1DP7P 4F4JA 2OBMA 4M1SA 4L16A 2DWZB 3AP1A 4EJSA 1XMSA 3BS4A 2OSBA 1V4RA 1ZYRF 4L0ZB 1SVIA 3NEUA 3N2IA 4L9SA 3CW2A 5C4MA 3K0CC 1U78A 4B73A 2ACJA 2J7PD 1E2QA 4KSBA 5LGUA 4LJ9A 2M87A 4ESVA 1Z6XA 3ZIAA 3SQNA 4HZFA 3CWZA 2J41A 5E17F 2VHJA 3L43A 4UNRA 3JSPA 2A6EF 2O8CA 5A2QK 5FL7D 3GJ8A 1RJ9B 2RH5A 3AM1A 2FPKA 1NY5A 1K6MA 4LHYA 4KODA 1IY0A 3J81Z 2VEDA 2QTHA 3A1WA 3AP3A 2QUZA 4Q7MB 1ZU4A 2DY1A 4DCSA 4AYTA 4AG5A 4BFWA 4Z1MD 2EV0A 5JS7A 2JDID 1F2UB 1FYMA 4I99A 1CRQA 1E2NA 4HLCA 5JWHA 1X37A 3S2WA 3JTGA 4L9WA 4Q18A 1R2QA 1E2EA 4I1SA 5TJJA 4Q47A 1MJ9A 5TMPA 4IVPA 5DYMA 3LSTA 1U6GA 1R00A 1CJTC 1QG2A 3I3SR 2VF8A 4RZXA 2OESA 4PC2A 1GXQA 3O47A 2IYYA 3LXXA 1JAIA 1IJFA 4IJMA 2ZROA 1PUIA 1R58A 3KE2A 1R5GA 4OIPF 4PX9A 2QQBA 5ILVA 4LJZF 4TT3D 4Q1DA 3BERA 3TMKA 2GDJA 2GK7A 4ZYGA 2YWFA 5DHAA 3K0LA 1DBSA 1XGMA 5H20A 1RVDA 2FU5C 1RRGA 5DI3B 1L3LA 3WGHA 1J59A 1KI7A 4C0HA 1G6NA 1KU7A 3QKRB 3OFND 3QRFF 1NN5A 3CR7A 1DDNA 1OH5A 1IN7A 1YS7A 3H2YA 2COMA 3CUQB 5HDKA 3ASZA 4EQ6A 3WP1B 2ZI5A 3ND9A 1G7SA 5FGMA 2EJRA 3ZMSA 2EFEB 4YMTA 2OHFA 1N5IA 2L0XA 3ADBA 5G53C 2Z83A 2J3EA 1XB4A 4V0NA 5DSZA 4I2OA 1GNQA 1FMLA 3QG5A 3BH6A 2J5OA 3ZMTA 4P31A 4C7OA 3R6SA 4YFNF 1CJKC 1DAGA 2MLKA 1IRGA 2W6IA 3KEQA 3EZ9A 1XDUA 1A5TA 2DLLA 4QGAA 2X77A 1XWIA 2P3SA 3QNUA 3RS0A 2CK3D 3C1DA 1NRJB 4UUVA 2PJPA 1P62B 1Q22A 1NVVR 2XIGA 5D5UB 1ZAKA 2GILA 3B1ZA 3MCAA 4LJ5A 1DAEA 1II8A 4MRPA 3RWMB 2ISZA 2KRKA 2QMUA 2P2LA 3TIFA 1OH6A 1XCVA 2FQ3A 3MJHA 5L3GA 2AXLA 4B09A 1HH4A 1E2GA 1QHNA 4L5BA 3C7JA 3WMGA 2F5DA 5B64A 3K09C 2JTVA 4JSYA 2TDXA 1HE1C 3W6PA 3SNHA 1TQ6A 2V6JA 3CTAA 4L18B 1D2EA 4O2RA 1F3OA 2EK5A 3V7CA 2RGNA 2ZJ8A 5CYOA 3V4GA 2ZAMA 5KSOA 1USSA 3GLIB 5AUNB 1OXTA 5JSZA 2O3FA 3BFVA 2DW4A 5F1RA 2G83A 2CNWD 1BIFA 1DVRA 3TAHA 3VR1A 1C1KA 3AVWA 1ZGJA 1J5YA 1LEAA 2C9OA 5CJPA 3D8BA 1REPC 1QG4A 5DYGA 1II9A 1Z6RA 3W6OA 4HB4A 1E99A 4ILEA 1W4AA 2FOLA 5BS6A 4WK8F 1M7GA 4MH0R 1IN8A 3PFIA 2FF4A 4G8XA 4MHGA 3WTVC 5AWFC 4MEYF 3EPLA 3FWYA 1MO5A 5LEJA 3RYRA 2BM1A 2I4IA 2FG5A 2B7CA 4HA8A 1G20E 3FMIA 3BB4A 4V03A 2ZUCA 3SJBA 2V6IA 3TSZA 4ZDIA 2CJWB 3G5UA 4F91B 2JRTA 2FDCA 2NO6A 5FFMA 4TN1A 5FLXZ 4RB3C 4A6PA 3TSOA 4A0GA 3B13B 5LB4A 2ZANA 2A3SA 2JASA 2DU9A 3KDSE 1AA9A 3T8TA 3GEHA 3CF0A 4HF0A 2B6HA 1OPCA 1Z5ZA 3D7MA 4FMDF 4N9IA 2VSOA 4KMFA 4Z2YA 1RJ9A 2ERYA 4IW3B 4JL5A 1HT2E 3MHVC 1SKYE 4PQRA 3U3OA 4ACAA 421PA 4A6XA 3P20A 2JJ1A 4QM7A 5DISB 4KT5C 4QJ4A 4LLGF 1JPNA 2EFWA 3JAMZ 1TUIA 3QXHA 3CRW1 4DLVA 1KKMA 1NBMA 2WJHA 5JCZA 4IEIA 1J8MF 1S8NA 5FO5A 1F2UA 1FOKA 3IPYA 3TO9A 5KDOA 3CWQA 1IN4A 3KP6A 5E7JA 4C30A 3VNVA 3LVRE 2P7VB 1YTYA 4HDQB 1KGDA 2CE7A 3NHAA 2JATA 3RWOA 5BYKA 1FTSA 1SXJD 4W5HA 4YFKF 3K9NA 1TW2A 1F1ZA 4XD7A 3T12A 4BZQA 3KZZA 3BH0A 2WMNB 5G3ZA 3EZ2A 3GEZA 2QAJA 4DVGA 5LRSA 1FQJA 3FE2A 4MGZR 5L3EA 4XTRA 1MRSA 2Q3FA 2ZKZA 2FPLA 3B9PA 2GF0A 3AVVA 1FP1D 4LB5A 5HLHA 2JLSA 4P96A 2F1HA 4YONB 4F7WA 3PQJA 2RGVA 1E2MA 3IQWA 3KB2A 3PCRB 2QQAA 4DLZA 2OQRA 4ZCMA 5HDGA 1TNTA 3CNNA 4PZZA 3K9TA 2ZRBA 1V5WA 3F8TA 1U8AA 5E4FA 2YOFA 5DI3A 5LBQA 3C16C 3EWAA 2VOPA 5LD2B 1TBXA 2FFAA 4RS8A 2IC5A 1FBSA 3QKRA 4OK6A 4FCTA 4EDHA 4DSNA 4C0AC 4DLTA 2X0LA 2ELHA 4RAZA 1NN3A 5CVVA 4M53A 3CUQA 1FNMA 1MABB 1XTKA 2B8TA 1ULYA 1FYKA 4UNSA 1QPMA 4D0NA 3PUXA 1FW6A 4RKEA 3WBKA 1G3UA 3C5HA 3U5ZB 2AK2A 5FI0B 1NHAA 2EU8A 2FSHA 3CNOA 3KFVA 4DEYA 4BGDA 4YLGA 4LPKA 4FW9A 1ZM3A 1FPMA 5FPHA 1P2VA 2QMEA 2WJYA 2XAQA 2PT5A 4GITA 2VBZA 3WTUC 1ZNWA 2ZQ5A 3AKYA 3O8BA 4MYHA 4WX9A 3R61A 4Q9LA 3F23A 4G7OF 1FTNA 2ZE7A 5JCPA 4TZ0A 4IXMA 4WBSA 4LJYA 1EFHA 3BORA 2F2EA 3X1XA 4GMXA 1G3TA 1E2HA 1XB2A 3EASA 1SHZA 1M7BA 4KNYA 4GO1A 3BFKA 2P5VA 2K27A 1ZNYA 2IF2A 2QMOA 4IEEA 2RAPA 4PAOA 4JS0A 3PQKA 4Q7JB 3IRQA 1W4MA 4JYBA
chains in the Genus database with same CATH superfamily
2AT1A 1Z2OX 2ST1A 4CVNA 2P5YA 4EA9A 4GI5A 1ZG5A 1UFKA 5CDUA 3IXMA 2ZITA 4FYYA 4U2DA 3PIIA 4YRIA 2Y1WA 2C92A 1A8PA 3J81S 4ES6A 1I27A 2YBDA 4UVDA 1QCZA 3C5CA 1RZ4A 4UUPA 1ZGZA 5DRTA 1DXOA 3DJFA 1RZ3A 4ZJPA 1EFKA 4A2CA 5DM70 1D4ZA 4HDOB 1XFDA 4DA0A 3COZA 4U2KA 3D2AA 3ZNQA 1YA8A 3HDTA 1AQNA 4JI5M 1RPJA 4GC9A 2NZ8A 2AXPA 2V03A 3TVYA 2DR2A 3HKZA 3W8NA 2EEZA 1EK1A 2ZUDA 1N6IA 2GD2A 1H2XA 5F64A 3CB4A 3RUAA 1NQXA 4PCAA 4I76A 5TXGA 1EH5A 1P31A 4PM4A 5HZMA 2ECPA 4BQNA 3LUPA 3CG4A 2DBRA 1U02A 1DU4A 2QP3A 4K6OA 3KFXA 2BDUA 2OHJA 1IZZA 3V3KA 1JKMA 4ON9A 4GLFA 1A2KC 3MFQA 1KEEB 2R5YB 1TYCA 3P2EA 3FNEA 2EZ8A 3BTCA 4YI3A 3G1MA 2LHCA 2TCTA 4ZOQI 3OUTA 1FJGB 1DUSA 1EIWA 2WILA 3CT6A 3HXQA 5TSDA 1U2GC 4RJIA 5BNIA 1NVMA 4NBWA 2F4OB 1JTXA 3MT7A 4XB6B 2C5HA 2FSVA 4MS1B 3ODPA 1IZ8A 1ZZEA 3QKSA 3E9DA 4TKUB 2MHCA 4LHZA 4XUEA 2TMGA 4U2BA 5CVEA 4ALKA 4NJOA 1D0MA 1M83A 1I2ZA 5DTIA 2QRPA 1UJ6A 1DPFA 3CCVI 2FSUA 3SBJA 4YRJA 2Q1YA 4BVGA 4QBTA 4LOCA 2W8BA 3KVNA 3VTFA 3K1NA 2AEEA 1POXA 5JI3E 5IK2D 4C07A 3F49S 5E79C 4YHHM 2G09A 4HQ0A 2EB7A 2AYXA 2JPBA 5ILQA 3UMVA 4C9YA 5C7IO 4WGFA 2IGTA 3Q9LA 3D54D 5L95A 1SUWA 4Y7NJ 4Q4AA 3OCZA 5KYUA 4QPCA 3ET5A 3DMGA 4FCCA 1EH8A 4OL0A 1CS0B 3RS9A 1IY2A 1BOOA 2HRCA 1ON1A 2H0QA 3QHPA 3LSJA 4B71A 3ZKWB 2QG9A 1L3BA 4LNUB 3IOYA 1X7HA 1ABFA 3VR2D 1TCBA 3ZV4A 2O8XA 1TTYA 4TTTS 3M6XA 1AHPA 4UFNA 3Q6MA 1XTPA 1IEXA 3M1AA 4D3SA 3O82A 1NVUQ 4G5OA 2P6RA 3FAKA 1S5LC 3U3MA 1E3PA 2DPHA 3F74A 3W67A 4B8YA 4DSTA 4DG9A 5FI3A 3FPHA 2FPWA 2SKEA 1DGQA 3D5QA 3THOA 4HWGA 2BDTA 5FTLA 2O0JA 2FA9A 3FM5A 4ZI5A 2NADA 3RUIA 3K10A 2NSDA 1E2JA 1ORVA 2EV9A 4JJ6A 3EGWA 4L6CA 4DV7M 1P5FA 1RFLA 2QVCA 2CK3A 2CXSA 4J76A 2WB2A 4UXHA 1OI3A 4FGWA 3HYCA 4MDFA 1TYBE 1TOAA 3W68A 4IXNA 2IYXA 2IL1A 4TYMA 3LI2A 4DC0A 1VQMI 1QLWA 5KYXA 5I9NA 4UUAA 5EKDA 1EGMB 1YYVA 1GFWA 2P2YA 1JQKA 2F8LA 4CQJA 7YASA 3CESA 3KBBA 3H1PA 4BMYA 2Y93A 2Z6VA 2D1YA 2VIIA 2NO9A 3OOHA 3SC6A 2BEWB 2AMJA 4ANJA 4K6GA 1E62A 4CG3A 1T3SA 2F4MB 4LDZA 4ZWNA 3BXOA 1Q0LA 3HCPA 4FB4A 3E9NA 2NU6B 2PSEA 3MTDA 3MSCA 3KFWX 1ZC3A 3EC7A 1XEFA 2ID8A 4RWZA 4C88A 3QHAA 3FZVA 1LDMA 2PMDA 1NRWA 2B8JA 2WG2A 4A0HA 3EZXA 3A0HC 3UKGA 1D5WA 5LSAA 2AEMA 1CZKA 2VTKA 3EG5A 4EB3A 3T61A 3NOXA 5C3MA 2ZT8A 1WDLA 1E0JA 1HKHA 2BM8A 4DV3M 2AMFA 4BL5A 2Q5IA 3NIBA 4KB5A 3NOVA 4EKIA 3R8FA 1X77A 4I36A 3WY9A 2V6FA 2GN0A 2TMKA 5IVKA 3RRZA 1VI0A 3R6DA 2AOXA 2NYAA 3R0JA 6REQB 4YJ2B 2B9VA 1AS3A 1YKGA 4YS6A 3W1EA 4MGIE 2OENG 1T9DA 4DVJA 3RIGA 3HHPA 4DDKA 3FWZA 3T0GA 2O52A 4EMBA 4HATA 1MH1A 2VPWA 2ZDQA 5K1ZA 1LX6A 4ARCA 4IEFB 2XKJE 3I12A 5LRRA 1S8OA 5CPRB 1L3CA 2RRUA 1DLJA 3O73A 4LDPA 2BBOA 2X0RA 3CP2A 3EVZA 1TD1A 3MJVA 3JRIA 5JWRA 4LRSB 3DAHA 1AUVA 4RA6A 1HEYA 1TL8A 2X0FA 1MX5A 1XRNA 1P3QQ 3LAJA 3ESRA 3LUFA 1O7LA 4WVLA 2ZYGA 3NWPA 2PZAA 1GVNA 3CZ5A 1LLCA 1YE3A 1V7CA 4H4CA 3QENA 4NBUA 1CT9A 5KZMB 3AIOA 4HV6A 5JHUA 1XOIA 1I3OA 2LCQA 3JQFA 2ZB9A 3D6UA 1P7YA 1YJAA 3AINA 3B38A 5IOYA 3GW2A 3GVIA 4XE5A 1YR1A 2JAOA 5EN4A 1Q7RA 3GJ7A 4KDPA 3DXFA 2AD1A 2OGZA 2AXQA 3ENKA 3OPQA 4BVHA 3T4PA 3U3KA 5CFOA 2QVLA 3KSAC 1QGOA 1L4BA 3K6RA 1X15A 4YRSA 4JBAA 3THXB 1KU9A 4WXDA 3KTAA 2HWKA 2PBRA 4XEHA 3PGVA 4JJ7A 4NDZA 4RSRA 2BEJA 4HUQA 4RGSA 1HLVA 3CX7A 4BKOA 3X3HA 3MLEA 1ABBA 2IVMA 1EK0A 1TK3A 5ES4B 3WGOA 3NC0C 2XXAA 1E2XA 1SMKA 4D7AA 5IC5A 4LFAM 3H5LA 4MA4A 4WNCA 3K2AA 1PK7A 3TOCA 1TIPA 1D2NA 1Z4NA 4Q39A 1HOTA 2QVBA 2BELA 3HFJA 4QICA 3UAXA 5TGDA 5C9ZA 2Z8ZA 2UWMA 2FUG2 1WZUA 3I2YX 3DEEA 2ID3A 3F96A 1KZ1A 3VFDA 4LIVA 4GI1A 2FP4B 1PP4A 3EXIB 4HLUA 1KPHA 2LBFA 2IYSA 5K2MA 1JWBB 2JLCA 2NVQJ 2GQ0A 2NVBA 4XDGA 4KFCA 2EXXA 4DOZA 4DSAA 2HHLA 1WXXA 1BDIA 2I03A 3FZGA 4QO8A 2FW0A 1DG1G 1R4ZA 2J5XA 3LYUA 2C6YA 1HZJA 2P4UA 4LEIA 5K1YA 4BNGA 1AE1A 1X86B 3T7TA 1DC6A 1IC8A 5CEFA 1F8FA 2IS4A 1DKPA 2Q9CA 3BBPA 1NU6A 1S7CA 5E6UB 3JZMA 3WC4A 4NZOA 3E35A 4FI3C 4D80A 3HCDA 3QELA 2A5YB 4ARIA 1SURA 3VAAA 5IARA 2VDBB 3U60A 3FHNA 3JAWA 5A1TA 1NQTA 1SVKA 2LKXA 3QP9A 3FYSA 4R8LA 5FNVB 3ESXA 5LYYA 4Q5IA 1XNJA 4UBJA 4EZEA 4CODB 3ULKA 2JIQA 3OYBA 4CQLB 3RGGA 3KWJA 1AHDP 2OXRA 2XT6A 2C4HA 3LC2O 1DADA 3F1KA 3E18A 1XEWY 3G0BA 2AHQA 1TUEA 4D4LA 3HU3A 1I9CA 1TPZA 4QBFA 4FFMA 1MC5A 5HQTA 2J9YB 3AR8A 1ZR2A 5TJ9A 3N9IA 4FEYA 2FJPA 4MTCA 3KSBC 4BN4A 3WGNA 4C6HA 2C03A 2P5TB 3AKEA 3AHGA 2HK8A 4EMUA 1LFAA 4M74A 5IANA 1WTAA 4TLDA 4K81B 1QE5A 2Y05A 2GNOA 2I3DA 2GVNA 3LF2A 3SFTA 1ZUNA 1MFPA 3STWA 1D8KA 4KN6A 2JZNA 4NV3A 1F2TB 1YB5A 3E8SA 4DNOA 3RPUD 5JDIA 1VYTA 2P5UA 1RC0A 4HEOA 2V1UA 3UW1A 5FWYA 6PAXA 2L7KA 1UWVA 1XWWA 1Z34A 3PFFA 4PQGA 3MN2A 2VT3A 5EHQA 3RUCA 2AR9A 1C1HA 2JFFA 4XSHA 3X2EA 2Q5EA 2UYOA 5PNTA 2QLMA 3LQYA 2O8EB 4HH0A 4LHXA 4GOLD 9GPBA 1C3VA 1TF5A 4D3FA 4FIDA 3JQQA 1Z73A 1JMYA 3RYPA 3MIZA 3I5YA 3DOIA 2GXQA 5DN9A 1N8NA 3MGKA 5LYJB 5T41A 2DQYA 8AT1A 2VHTA 3NHYA 3PQEA 4C89A 2BP7A 2HCRA 3DL4A 2ZULA 3QLVC 3OMYA 3IIKA 1MVLA 2OBYA 3WMWA 5I3ZA 3ORSA 1Q3CA 3B6EA 1EESA 1PSZA 3Q3SA 2ZQYA 3VZSA 4IRHA 3LRPA 3GLSA 5IC6A 3LY7A 2M6RA 5IVPA 5K0TA 3SI7A 1M0WA 3PRJA 4MP6A 3K32A 1BRTA 4C6SA 2A07F 3AB7A 3K30A 2WLSA 4DV2M 3NTXA 4OKIA 4G0OA 3ILSA 3O84A 1NBHA 4R1MA 5GZ6A 5DI9A 3G0OA 4BJ5A 1UC8A 1N77A 5DSXA 1G8JA 1PQWA 1J24A 2R45A 1CR6A 5KPJA 2EFHB 4XN3A 4YLEA 1T6NA 2JRCA 3NTUA 2YUIA 3PO2J 4LRXA 3M34A 1FFDA 2O1XA 4RQBA 4BO1A 1T8SA 1ES9A 4E7ZA 4FX4A 4ZT7A 1JLRA 2VDMB 1VLZA 4LRYA 4AMZA 1ZK4A 2HFHA 3LLUA 3AGPA 2IXEA 3K9LA 1BI2A 3LD9A 2N35A 2AC7A 4D96A 2L7FP 3MRSA 3AUJB 1MO6A 3W34A 2AZTA 5KYVA 1XG5A 1F36A 1DQUA 1HNXM 4TLLB 3H2KA 3MG9A 2NVWA 3TDZC 2PO7A 2C9MA 1QBKC 2HDHA 1E1CA 2WY7Q 2RGBA 3GZ5A 3UV3A 1B6RA 4U0YA 5K8TA 5JANA 3H1AA 1PZEA 4ZYDA 3IQDB 1HO3A 1Y82A 4XLZA 1FT9A 4YTEA 5D6NA 5K3FA 5D3KA 3S2EA 2QYHA 2AIRA 4MQVA 1HKTA 1FJGM 4G37A 1ZISA 3U6CA 3R0ZA 2XZUA 1NI5A 3ASUA 2WSEF 4LYYA 5BQOA 5AO9A 3G1TA 3WQHA 4BVBA 2CDAA 1IAQA 2QEQA 5IVIA 1R6AA 4JUBA 5FPKA 4MQEB 5ITXE 5T6MA 1YKFA 2J45A 2MOKA 4A0ZA 3D4BA 2QL5A 3NDIA 1QPZA 2CVZA 1A72A 2HTSA 2H1FA 4ENUA 1HA8A 2WKWA 3D7NA 2GAFA 1BH6A 1V6AA 2XNKA 2B25A 4FOSA 1HLFA 4G89A 4AAYA 4X1YB 2HV8A 2A5LA 1BFUA 4EPTA 3S3TA 4QBIA 4LJ4A 1AZTA 1MBHA 4B82A 3GUVA 4MW2A 3M1EA 2CV0A 2PLFA 5E8JA 3KVVA 3CX8A 2F43A 2DWCA 3KUXA 1IDOA 3HZZA 2VKQA 1FOEB 2CZGA 1XC7A 2Q6TA 2XWSA 1RKQA 3CCCA 1WDWB 1MORA 1XP5A 4KN9S 1STOA 3K0EA 1AQYA 3O1LA 4V39A 5AW0A 1Y8GA 2Z5VA 1Q1HA 8OHMA 3GYBA 3VSLA 2ZPAA 4JX4A 1WCV1 3B82A 1A71A 4Z3KA 4OUDA 2CYCA 2VDWA 4ASNA 1E7MA 4RMIA 3U3JA 2C61A 2VATA 2JGIA 2R86A 1JGTA 4DYHA 1D3AA 2H6EA 2EFQA 4N0DA 2IP1A 5D51S 3M3YJ 5CG1A 1OV6A 5EE5B 5C4GB 3QJYA 2X14A 2YFKA 2XOXA 2K9MA 1KH1A 2JHFA 2CNDA 2GWRA 1O94A 2DYRH 3PKZA 2HEIA 3ANYB 4CU2A 3ZU6A 1PJRA 2COEA 1NXWA 4BX2A 3ILHA 3TZEA 4DL9A 2Y69H 3GLGA 3MMYB 4WINA 3UAGA 1RYEA 3C8ZA 3QEKA 5KAMA 1TVKB 1PR4A 4C9BA 5L3SB 5BNTA 4FW8A 1PUEE 2C8VA 2QRVB 2COBA 1Y39A 1JPJA 1BMFA 4AQ7A 4O4LB 5IM5A 5F0FA 1US8A 1LW7A 2ZJ3A 1GU7A 5LZ4A 4ZJZA 2ZYVX 1FFSA 2VBIA 1RUNA 1K61A 3T1OA 3TLZA 4FD2A 2EFYA 3HXPA 2PD6A 2QQ5A 4RV5A 3C6MA 4WUVA 1F8UA 3VO1A 2WE7A 4IIJA 2JJ8A 1WB6A 2NNNA 2CXNA 3JRCA 4U87A 1EP9A 2E5ZA 2REQA 4OP2A 4JMLA 2H65A 1ETVA 2PMEA 3GP8A 3PGJA 1JQJC 5ALEA 1XA3A 4Z4QA 1UBGA 3CY6A 4I50F 1DJLA 3EN0A 3BMNB 3KQTA 4FHZA 4D99A 2BEOA 2ZC2A 1ONBA 5DXAA 5HF9A 1A9OA 1NC3A 3ROKA 1R5LA 3U6SA 3TZKA 2ZP1A 4YCCA 4CISA 5F1OA 3GUCA 3LY9A 3O83A 5A0VA 4DUYB 3IWZA 2M5WA 3EXHA 3K7EA 2IGNA 2RCYA 1XC5A 1E1MA 1UBLS 4FWTA 2O8CB 1L5QA 4KE8A 4LJSA 1K79A 4E7PA 5DGIA 3EFEA 1UBJS 1LNSA 3HU5A 4AD8A 3NTQA 3IEXA 4JX8A 5HZGA 1SULA 3W2FA 1NG1A 4WOPA 1U04A 2XRYA 2W2XA 2GJAA 1YDGA 4II2A 1WVIA 4Y9SA 1YVUA 4AZTA 3MTBA 4MQLA 2HKIA 3WTWC 4OSPA 2ECCA 1FRZA 2C4KA 4PFKA 2BFEB 3WGUA 4EM0B 5CGQB 1VFNA 1TE2A 1NX9A 2C4NA 2ZJRF 3H4MA 1PHPA 4AURA 1EE8A 3V7YA 3TR6A 3ED1A 3TEDA 3KC2A 2N0SA 4QVIA 1TNSA 4DBLC 1ZARA 2XRNA 3GDOA 5LP6A 1NI4B 1HRKA 4G4NA 1TH3A 4G6ZA 4JR0A 2G08A 1KQ9A 4BH9A 1E69A 3IQGX 1I6HJ 2BTOA 1GUDA 2W1OA 4XM0A 4L9SA 3QBJA 1U78A 3DAGA 4J0CA 2G63A 2FPKA 1KRWA 2XMQA 4AYTA 4AG5A 3ZQCA 1XVLA 4ITQA 2YVQA 2EV0A 1JTFA 3V55A 2VJ5A 5I9BA 1F2UB 5BVHA 2RBEA 4C7VA 4M3GA 4RVSA 1U6GA 3OIOA 3LHFA 3JTEA 4GZ6A 4ZOLF 1Y9ZA 1ISIA 2QSGX 3J7BA 3DFKA 1Z5AA 1LFUP 2WSFF 1VJRA 1S2DA 4UDYX 3UFXA 1OH5A 3CR7A 1IN7A 2OLEA 4QASA 3LKBA 3Q0WA 1PR3A 1U3DA 4V0NA 5DSZA 1MBEA 2GUGA 4QDUA 3ND5A 1IPEA 3ZMTA 1CJKC 5H3HA 5L4SA 2DLLA 2X77A 2BR4A 5CVCA 1NRJB 4UUVA 2XIGA 4MRPA 2E4WA 2P2LA 5IKXA 1E3SA 2FI1A 3V46A 3K9BA 4JSYA 3L46A 4L18B 5KQPA 2C8LA 1BIFA 2YWDA 3HV0A 3H9UA 4GYJA 3WTVC 2IGBA 3HYLA 2BM1A 3AC0A 4F91B 4EW3A 2N1MA 3TSOA 4AS3A 3KDSE 3OTGA 4CFSA 3WAGA 2OWEA 4EGQA 4QJ4A 1NNSA 3M5DA 1UK6A 5JCZA 4LVOA 3CWQA 2J3KA 4G2TA 2CE7A 4O08A 2IPAB 5TEVA 1TXGA 4BVJA 5G3ZA 3RS8A 3L29A 2WTXA 2GF0A 4P4GA 1NHGC 1FP1D 3EMKA 4JA2A 2VPZA 2OQRA 4EDFA 2LZ0A 2YOFA 3PHCA 3A4IA 3S2DJ 2CGEA 1W5EA 3U5ZB 1L4HA 1NHAA 1T15A 2DZDA 2R4TA 3DZGA 1ZM3A 5DZSA 3QUCA 1T0FC 4MYHA 4KW7A 3AKYA 4PGFA 3TZLA 4B31A 1LA2A 2IF2A 3WO0A 5KJEA 3S1QJ 5L4LA 2HQAA 4LG0B 1MRZA 2BEVB