1W5TA

Structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
403
structure length
394
Chain Sequence
b'GLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTILEQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSEDLVRKAVSENASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASLTMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSTTLFRLAPHLPADRLIEVVDNIIQAKMAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORC2
molecule tags Dna replication initiation
source organism Aeropyrum pernix
publication title Conformational Changes Induced by Nucleotide Binding in Cdc6/Orc from Aeropyrum Pernix
pubmed doi rcsb
total genus 140
structure length 394
sequence length 403
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09079 Cdc6_C CDC6, C terminal winged helix domain
A PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1w5tA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w5tA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w5tA02
1S7AA 3FKSD 1WWXA 4LB5A 2CEAA 1TAGA 2REXB 3QNUA 3MEXA 4Q4AB 1P2TA 3REOA 2NYXA 1K79A 1CRQA 2ZJ2A 5HLHA 3SZRA 5L3VA 3S2WA 2C8VA 2X1VA 2W2TA 4E22A 4DDWA 4V0LA 1GSIA 1Z0DA 2ZI9A 1S1CA 2IVMA 4FX4A 5EP2A 2DFIA 1E2NA 5D3MA 2VHCA 1DUXC 1AIPA 3JSPA 1CJKC 4AWXA 3SDZA 1YS7A 2XX3A 1SKQA 4LJ9A 4HDCA 3UXMA 3KXIA 2CWEA 3H2YA 4A0ZA 3QEOA 4YMWA 1UB9A 2GK6A 2HKXA 1DAFA 3BB1A 1FBSA 4BFZA 4MYTA 2RCNA 4A6PA 3K0CC 3W6OA 1E0JA 1GL6A 5JBQA 4U0VA 3EA5A 1A1VA 4U0YA 1FQKA 2DO7A 1DE0A 1OF1A 1ZCBA 5DISB 4A8JC 3IGFA 4IVRA 5KNDA 2H5EA 2F5EA 3FHCB 1GXPA 3THOA 1S0UA 3QXXA 3THXA 3I72A 2C96A 2ZU6A 4ZDIA 2HDNB 1G8GA 2GDJA 4TMTA 1VDZA 4M9ZA 1U2WA 1Q57A 4KXFB 4D6PA 3NBYC 3L43A 2Q9BA 2W58A 3GJ8A 3DOEA 3SFZA 2V6JA 2JEOA 4MRPA 4CT4B 2HYGD 1KI7A 3W34A 5L3FA 1QDEA 2OZEA 4U88A 1ZC3A 2QMOA 5H68A 4B2IA 2VXZA 5CLSA 5D5XB 5E20A 1XD7A 2W84A 4OIOF 4RCZA 3TGPA 1Q1EA 2DY1A 1N3BA 3IKVA 4OI0A 4ESHA 2Z33A 4DLRA 1KZ7B 2OXRA 3CW2A 3KFXA 3ZZUA 4XSZF 4B76A 4RD2A 1O3RA 1XGOA 4KSCA 1VKJA 2PJPA 1Q44A 1DTSA 1OB5A 3WU1B 3JAMK 5DN6D 2J0UA 4W5JA 4OK5A 2QT0A 4U0WA 3MJHA 3NHAA 5H6QA 3WXMA 4CEIA 4I01A 3TRFA 2J59A 2JDID 5F1RA 3E5XA 1PUIA 2FZLA 2IYLD 3LLUA 2KBEA 1OFIA 2RN7A 4ZCMA 2CDNA 1MJAA 1S3SA 2VHQA 4IVQA 3MCZA 2QPOA 2ZJ8A 4QGGA 2EQBA 3NRVA 1YZNA 1BM9A 1LQ1A 2VA8A 4OIQF 4DIEA 5C4MA 2FZ4A 2YNMA 4POAA 1F2TA 4U5XA 4IHSA 5FOUA 3LA6A 5HS7A 3RRMA 4PXAA 4LY6A 3N2EA 3K9GA 1VYTA 2XNSA 3JAMZ 1E79A 3NDPA 3KJEA 4D25A 4MHGA 1ZG3A 1IJEA 1M34E 2CCGA 2GWHA 2BCGY 3QPUA 3GW2A 4LHWA 1J5YA 1N5IA 3D31A 3RANA 4NCKA 4KSBA 3C14C 1MJBA 3OIUA 1E4VA 4QGHA 3LV8A 5KSOA 4QXAA 3RS3A 3T1BA 821PA 4WOPA 4RY2A 3HUGA 2JLZA 1G3YA 1R00A 4MEYF 2BM1A 5LGTA 3GFTA 4O0MA 1YZGA 1G3RA 4EJSB 2D3WA 2RAPA 2R3SA 2A30A 2QENA 1NSFA 1ZD1A 3HR7A 3FXQA 2WJGA 1EFTA 2O8BB 5A5GA 2HF9A 1N6KA 5FPSA 2MH9A 1T8UA 2ODNA 2VC0A 1K7AA 2HJGA 2Q3HA 2G7UA 4PPFA 2VPPA 5LGNA 1MABA 2GBLC 3QE0A 1B23P 3LO5A 2CSOA 5EP4A 4JIMA 2CHQA 4RGRA 1U94A 4TTPA 3X1DA 5HLGA 4Q19A 1W7PD 2NZ8A 2QQAA 2XZLA 2VO1A 2WWIA 3L9FA 1OKKA 1U90A 3RYPA 1J0RA 5DYIA 1NVVQ 2ATVA 1A5TA 3DMDA 4JSTA 3C3WA 1XJQA 2NOAA 1E2DA 1NY5A 1R8QA 1VTKA 1Y63A 3KLOA 1ZBDA 3A1WA 3NEYA 4I1OA 1HYQA 4IEEA 2CGPA 4NCJA 5GADl 3VFDA 5IHPA 1ON2A 3I1FA 3U6KA 4HV5A 1KGDA 2FEMA 3ECCA 2D1VA 2W0SA 3D0SA 3I64A 1UPTA 3F5FA 4BFSA 4XSHA 4BEJA 2HOEA 3EETA 3I32A 2ZXJA 1OXXK 4M74A 2FXAA 4EJOA 2GA2A 1YKSA 2L0XA 2VEDA 3K9LA 4JKYA 2GXUA 4GZMA 2OFOA 1WQ2A 2PMDA 1R0ZA 5BMZA 3N70A 4PAOA 4QBGB 5DYMA 4XJXA 3BWGA 2CO5A 2D45A 1Z29A 4DLTA 3MG9A 3V8LA 1UKEA 4UVCA 2IHYA 1JR3D 2RGGA 1Z0KA 5CVVA 1YLFA 1J59A 4WXPA 3FKQA 4M4SA 2DZOB 4XBFA 4AD8A 2P3SA 5IK2A 4LK1F 4DJTA 3OV8A 1E9DA 5F6FA 1NBMD 1ZM7A 4Q9JA 4TL9A 4WBSA 5B58C 4P32A 3SYKA 1X1RA 4B6FA 1MGTA 3KETA 3MSXA 4PC6A 2C95A 1CRPA 2RGEA 3LAWA 1J7KA 2NS0A 3E6MA 1X3UA 4DT1A 2OV2A 2P5TB 5J4KA 2FBIA 5DLQC 3RNLA 1JPNA 4RFSB 5B30A 3P9IA 1F3OA 1R0YA 4GL2A 3K69A 3W3AA 2FA9A 3K1NA 4QJ3A 1NBMA 3QKSA 2ZAOA 2FX3A 1TW3A 3CUQC 2A5GA 2YJTD 3B9PA 4A6EA 1OFHA 2V7QD 1AS0A 1KMHA 2ZVPX 1PP7U 4ZDWA 5FFXA 3SBEA 4BEBA 3ZD6A 4ZI3A 2GXGA 3BIFA 4GT1A 1UFQA 5D8KB 2V54A 1P6XA 5KNBA 4DDTA 3W6NA 3CR8A 3QUSA 3LAPA 3RVBA 1N6OA 1OMIA 5IT5A 4GPTA 5BOXA 3ZN0A 1GOTA 2AD1A 2WIBA 3IPYA 3Q9LA 3TSWA 3HU3A 5BS6A 3G0HA 3SXYA 3KJIA 2STWA 3E6DA 4ASUA 4RB3C 3QP5A 1XEWX 3ZN1A 3M1IA 4ZCLA 1II8B 5FL3A 4KAXA 2F43A 3L0SA 4A9AA 4MUBA 5FBRB 2IYRA 4TQUS 1E3MA 4XWAA 1YVDA 4M1YA 1TUEA 2RVCA 2MD5A 4LK0F 1AS3A 2J7PA 621PA 1TEVA 2V1DA 4JLPA 4RD1A 2VBYA 3AKEA 2QTVB 3AH8A 2XB2A 1FBUA 5LHHA 1W4CA 1IOZA 2ZITA 4YIFA 1E0AA 2LKCA 3PENA 5E1XA 1EGAA 2J0VA 2XAUA 3OF5A 1WRJA 4WF2A 1E2QA 4LJ4A 2I4IA 2MC3A 2PG4A 2XASA 4PAMA 3IBGA 3R20A 1IM2A 4LD5A 4RZ2A 1YS6A 5CYPA 3QXHA 3RYTC 3Q72A 2CMKA 2H1LA 4M6YA 4Q7MB 4DVGA 1TQPA 1XTSA 3W8RA 5C2JB 1F9NA 2D2EA 3I8SA 4Q00A 2YINC 1NJGA 4WXCA 3BE4A 2KIFA 4ZZDA 2IYQA 2QE7D 3BB4A 2QSZA 2M1BA 3H92A 3IHLA 4LHVA 4NYIQ 3TUIC 2GXBA 4B75A 1UAAA 4TZ6A 1ZAOA 1AJEA 1E1QA 1Z5ZA 3TO6A 3X1ZA 2GJKA 1QVRA 2ZIAA 4NONA 3AGPA 4RKEA 5CVJA 3FWYA 2V79A 5L3RA 5FOVA 4Y17A 3OZXA 3O8CA 1FW6A 3QXSA 2ZMEA 4RD0A 3TSZA 1D8KA 4M2LA 4UJ3A 4B8XA 1XXHA 1FX0B 4PSAA 1DG3A 2XNDD 3GJ6A 2WJIA 3OE7A 3VNUA 5D5UB 3C7JA 3LBHA 2R7DA 1R5GA 1L2TA 1ZU5A 5CJPA 4A0GA 4AD9A 1J9IA 2HYDA 5J4YA 2IYUA 4H1UA 2RH5A 3SHFA 3WG9A 5JWHA 1G5PA 2BBYA 3N5CA 3UIEA 3C16C 1UHWA 4DB2A 1Z2AA 1R5HA 3VNVA 4DRZA 3KDSE 1ZP6A 1J2JA 4MQVA 3W8NA 4ON0A 2IRFG 3F8NA 2VN2A 4BYYA 1X1SA 3LLMA 1KAGA 1ZARA 3COAC 4K8OA 2JPCA 2XGXA 1N6PA 3ABUA 4NYMQ 4AY2A 2OEPA 3VKWA 2DK8A 4P5OA 3WHLA 1FOKA 2MSCB 2IPQX 4JBWA 5GJCA 1YZQA 4A2UA 4IHQA 3GFPA 1F2UA 3GEHA 5FO5A 3B78A 3EZ7A 2BEJA 4I81A 1Z47A 1AZTA 2CNWA 2WWGA 3BPXA 1G7TA 1BBYA 4LG0B 1XU4A 2G1JA 5DO9A 2P0EA 1I1SA 4C0AC 1X37A 1QGPA 4G1UC 1GL7A 2ZYVX 2VE8A 3WTXC 1COWD 2M87A 3LRPA 1IZ1A 4UXHA 3ZMZA 5FPTA 3VU9B 3WP0A 5SZHB 1EG7A 2AXLA 1KI6B 1ZRHA 4DXAA 4KDPA 1SVMA 3AF0A 3ZJYA 2PEXA 4PHHA 3GP8A 2ZJOA 1W4AA 1W47A 4G6QA 4EMSA 3KP7A 2D4HA 2A2ZA 3B13B 3GJXC 3K0AA 1AS2A 2JPBA 1E9AA 2GCPA 4PFSA 3BOSA 2F9LA 1DG1G 2ZPTX 3PR1A 3QXCA 4BZXA 1H8ED 2PMKA 3I5XA 4Z1MA 2QP3A 2EFGA 2NPIA 1QF9A 4Z51A 1H9TA 1CBUA 3GPLA 2CBZA 3KL4A 4NP6A 1SVKA 4FMDF 3SQWA 4UVAA 3BERA 3REGA 2L4AA 4MH0R 3ZPLA 1RJ9A 3W3ZB 1KU9A 5BYJA 1R58A 1XSXA 2OUKA 3RS2A 5JEDA 5LBQA 2JLVA 3I4PA 4NCIA 1Z05A 2NAZA 3B1WA 1L0OC 1LDKB 3B7GA 3RDPA 1U6GA 2Z4RA 3AVUA 3B1ZA 2F55A 4TYWA 2HCBA 3E6CC 4G7OF 5EXPA 2EWNA 1KJYA 4LWZA 3SHWA 4AI6A 4JLVA 1SZPA 4CF7A 3K70C 3KW6A 4QC2A 2XSZA 2ZR7A 5EP3A 3WBKA 1T0JB 5E18F 4LLNA 4OQFA 2XHKA 3ZS9A 2OO7A 3KZZA 1W2HA 1NMZA 5KSPA 3VR2A 1HW2A 2GVDC 4EQ6A 2QUZA 3LQQA 4IDQA 1RZ3A 3PQJA 1S9DA 5IK2D 3KX2A 2OA4A 4TMKA 5G41A 4A2WA 4WX9A 4PGGA 1XP8A 1OH7A 2QP9X 1K78B 1T8TA 2XB4A 2ZS9A 4HEJA 1L4UA 3B1VA 5G3ZA 3VR4A 3PEVA 4C9BA 2ZE8A 4LJAA 3MWMA 2K5UA 1QHIA 1ZD8A 1Z6AA 2D62A 2G3YA 3LX5A 1RRFA 3OEED 4Q48A 2ZRKA 4LK2A 3AVVA 4LFUA 5LDDC 1OPCA 4PANA 4XVRA 5HCNA 4M9QA 2L01A 1T38A 2WWHA 2XOKD 3L09A 5KDLA 4JSYA 5LLQA 2PZEA 3B9QA 1PZNA 4GYIA 4TZ0A 1OLOA 3K0FB 3L0IB 4CEHA 4HB0A 4Q1BA 4F7WA 3FOZA 2FU4A 1NN1A 2JCSA 5FI0B 1I4TD 4AIKA 5FPYA 1VCOA 2ZRJA 4S35A 5IT9Z 3CNNA 1P4XA 4IRIA 2PT7A 4R98A 5L8VA 2VLIA 1WBBA 4JL6A 1WB9A 4AKEA 3EZ9A 2P65A 1IAQA 3TLXA 3ZGXA 4D4JA 3Q7QA 2K4BA 5FGMA 3A6PC 4FCVA 2O0HA 2VSOA 2YOFA 3K1JA 4A4DA 2XAQA 2FPMA 1A04A 4N0BA 1EWQA 2Y75A 3ONWA 5JI3E 1CF7A 2ATXA 5ERIA 5AJVB 3J81k 4JN6A 3BJOA 4DUGD 4PQYA 1FT9A 3SYNA 2FWRA 1U8AA 4RAZA 4G0NA 3FXUA 2I1VB 3PUXA 4F93B 1OB2A 1IN5A 2KIMA 4IVNA 2DLLA 1P9RA 5D6EA 3CNOA 3MGCA 4OYHA 1KSJA 2BMDA 4OIPF 1Q20A 2STTA 1U8RA 2H57A 2QY9A 2IEYA 1JQLB 4Q1EA 2ZRNA 1CXZA 4N1AA 1GRRA 3A36A 2G9NA 3CUEF 5L3SB 1GUAA 1FTNA 2IK8A 5HDNA 2DHRA 1XGSA 3ROUA 1E98A 1Z0AA 4KI0A 4XTCS 4B09A 2V9VA 4KMFA 2GTPA 3OFNA 4YG2F 1P7CA 2F3RA 4L5BA 5CYOA 3W5JA 1N0WA 1GKUB 4Q21A 3X1WA 4EFLA 4AG6A 2OZUA 1Z6TA 4IPAA 4JK1X 4LRSA 4N9HA 1FNNA 1E1RD 2JIZD 5JI2E 1NIPA 3F0TA 1XGMA 3MRSA 4N0DA 3RKWA 2FOLA 4OK3A 3SBDA 5K5QA 3ZP5A 1EFHA 3SZPA 1FMJA 1ZMXA 1E2XA 1LS6A 4F4IA 3RPQA 1EXMA 1VG0B 2Q9CA 2ZANA 1E2IA 1W2GA 3HYRA 1GDDA 3WMFA 2EK5A 5EE3A 4CZ2A 5ANRB 3U44A 2IT1A 4BPBA 1S3JA 2WVJA 1SHKA 2EFEB 1KJWA 2XXAA 4GO1A 4TMWA 1W4BA 1GKIA 3DM9B 1KYWA 1XBTA 2R2AA 1ZREA 3KB2A 3GWZA 2QGZA 4GNKA 2G6BA 5DCMA 4I02A 3NBZC 3THWA 3CUOA 4MYCA 4A8JB 2Z9OA 2J41A 5L3EA 4WXRA 1REPC 1ZJ6A 2J46A 4OQXA 3Q5EA 1I27A 4W5HA 3GVAA 2ZYTX 5JS7A 4KYWA 2VOOA 4DSOA 2G9WA 3R61A 3TDZC 1K8RA 3QIAA 1COWA 1Z91A 2RDPA 5DH9A 2EB7A 4BHPA 4BWYA 2XGJA 1JEEA 1GILA 1YU9A 3F3YA 1P4SA 1MKYA 1JR3E 3EA0A 5E4FA 4YXWD 3GQBA 4BZQA 4P9UA 2QT1A 3WP1B 1T6NA 5TV2A 5TRDA 3B60A 2ZI5A 4RB2C 1SFXA 4Q66C 1IXZA 2YR2A 4R1HA 2VSXA 2HYIC 3ZVMA 2K4JA 4CEJB 4LBVA 2GRJA 4BQSA 1PP8F 4Q7JB 1NMXA 4MNUA 4G3XA 4YXWA 3TMKA 1OXTA 4KBFA 1R1VA 1CEEA 3R60A 3U3OA 1H65A 2GVZC 3VOEA 1QHXA 5JZVA 1N5KA 4E5UA 1P4WA 1UEIA 5CLQA 4B35A 3IQWA 4IVPA 4MGYR 3K0EA 3CF2A 4EFMA 2CL7X 2QM3A 4G94A 1TEXA 1TBXA 3RABA 4QNMA 1P75A 5E95A 5TVKA 4EPYA 3SJZA 2GXSA 4WXHA 3U1DA 3Q5FA 1IJFA 3F6VA 2CJWA 3I59B 2A5FA 5K8IA 4Q9IA 1G8HA 2I1QA 1P73A 2N46A 5FTLA 3KQHA 5AUQA 2ESNA 4L15A 2R7FA 4M9XA 1GVNB 2PCLA 4UUVA 1W0KA 2BBTA 4RZUA 5F9FA 2QBYA 3Q85A 4L9JA 4HBLA 2AXPA 1YIOA 2GEUA 3KP6A 3THYB 2ONJA 1IF1A 2OE2A 3LBIA 3RKXA 1Q3TA 4IOLA 1MD0A 1XTRA 2GAOA 4BRUA 1IY0A 3EG5A 1J70A 5L3QB 2HTSA 3V8JA 4ZZLA 2ERYA 2VP0A 4BQAA 5AIQA 3G5UA 1M8PA 4FWIB 2P5VA 1I6XA 4HB4A 3LWNA 2O8FB 4QHSA 3Q9VA 1HXDA 3I54A 2AS5F 2OD5A 4A12A 2UWMA 2VRWA 2C9OA 3HRSA 2FBKA 4KIGA 4M1WA 3GFMA 1GXQA 5FUYA 5LD2C 4UNQA 2J0SA 1KGSA 1II9A 1KQ8A 2M45A 2BC9A 3JVUA 4B34A 4R71A 5KUTA 4H1VA 4TYQA 1UADA 2ZM5A 5HDGA 2XOKA 2ZO4A 4BXUA 4KA4A 1XZQA 4BHBA 3EW9A 4CW7A 4D4KA 4D4LA 3SJAA 2F1HA 3TOAA 3EUHA 4Y13A 1E6CA 4E09A 3LFUA 5C46F 5JWOA 4DBLC 1KK2A 2IS1A 2WJYA 3G3ZA 4JLAA 4MRRA 1LJ9A 2RHDA 1KKLA 2PCJA 3RS7A 3IC7A 1BC7C 1G3QA 2GNOA 5DYGA 4EGZA 4LGMA 1FBQA 1MO6A 2QE7A 1RZ4A 2PN6A 2MLGA 2YHSA 4D26A 2HT6A 3VEPA 1XEXA 1RKBA 2HCJB 4JBAA 1D8JA 1EH8A 1P4AA 2QYOA 2OSBA 3A1SA 5C4GB 3I0TA 3DO6A 1GFIA 5J8CA 1AA9A 2FSFA 2OG2A 1RPZA 5KK1A 1JJVA 2O8DA 3GLIA 5H1YA 1O57A 4A3VB 1F48A 2J9RA 4PO1A 4D0LB 1ZRFA 4RB1A 4L16A 3QOFA 3U3KA 4Q4AA 1AN0A 3TO7A 2ZTSA 4LJ8A 4DZZA 1WRBA 2PMUA 3ASYA 4MQ9F 1F60A 1HURA 1LDDA 2KKOA 2G77B 2RNJA 3DV8A 3E3VA 2ZUBA 2AKAB 4D2IA 4RS8A 1ZLJA 4KMUX 4NCHA 1SULA 3FMSA 2X2EA 4HATA 4BLTA 4XSXF 3ZQ7A 1DDNA 1GHCA 3PVSA 2G7HA 2YWFA 4OU0A 4HI0E 4JBYA 4TSFD 5J40A 1XPUA 1RIFA 3LVQE 5JHUA 2WV0A 4W9MC 1TU4A 2FH5B 2G83A 2IXGA 1QBJA 2IWRA 3I5YA 1Z1DA 3CPJB 4CHUA 3GEIA 2P7VB 3WTYC 2CHVA 4G9YA 4IDNA 4YDSA 3U5ZB 3LY5A 2D7DA 1U0JA 1YO5C 3L00A 5SZJA 2L3DA 1G7CA 3EIQA 4G5RA 1FZPB 1VTNC 2K86A 1I5ZA 4KBGA 3W6PA 2P5SA 2BHRA 1T6SA 4HLCA 3GJ5A 3QF7A 3ZQJA 4WZAE 4QWQA 1FSHA 1KI2A 3K9TA 2HV8A 3GFJA 4Z54A 1L7VC 4Q1FA 4F4JA 2A5DA 2C9CA 1B1BA 1DPUA 5E7MA 4C2UA 3AQ4A 2EFPA 3O8BA 3MZHA 4NB5A 2OCAA 1VHTA 4I7HA 3JTHA 5DEQA 1HE8B 1G21E 1QHHB 1S9HA 4HB3A 2YPRA 4Y15A 2DBYA 3AEZA 2D1HA 3WGIA 3U3JA 4F4CA 5H8WA 3L0PA 2YSRA 3T34A 1E32A 4EM0B 2J45A 4V02A 1OHHA 1CF4A 3PUWA 3GD7A 5A4JA 1AOYA 6PAXA 2RGBA 4L9NA 4O3MA 1STZA 2W83A 4QJ4A 5E3HA 4D81A 3VTKA 2YX4A 1FQJA 2MMCA 3RAPR 2J0UB 3UG7A 3K09A 2ZVQX 2ZJYA 3IUYA 2VBWA 4WCGA 4QBHA 1WA5A 1XMJA 1KAOA 1K6MA 1UKYA 2UZ3A 3CWQA 4V0KA 5ICCA 2OBMA 5JCZA 4HUTA 4XOIA 4Z8XA 4G7HF 4PQRA 1RC8A 3MAAC 5M04A 1BN5A 2HKOA 2UKDA 4HAUA 4R2IA 1KU3A 3T5XA 1N6RA 2H7VA 2OBNA 2VF8A 4HUQA 3K9HA 1UBCA 4M22A 3QF4B 4NH0A 5FBVB 3SJCA 4G7ZF 4KN7X 2WJVA 2F3TA 2FNPA 4URXR 2ZI3A 2IW3A 3T1TA 3CUQA 3DKWA 2QRZA 4QGAA 4XWKA 2TMKA 4EPTA 2JLRA 3P4XA 3PEUA 1MJ9A 4EPWA 1JB1A 2B6HA 1S4QA 4GFDA 4KV9A 1ZNWA 2H8KA 4I98B 1R22A 1WSUA 2I3BA 4M72A 2QPTA 2UVQA 2ZETA 3B1XA 4OHXA 1RI7A 4QGFA 1ZNXA 3FHZA 1TQ4A 4NMMA 3R7WA 1I4LD 4JJKA 2ASEA 3OEEA 1R6BX 1OHHD 3RWOA 2RGAA 4NYMR 2GBLA 1KI3A 1T3SA 2ISYA 5DD8A 2DWQA 4KITB 3ZD7A 3TK1A 3IWFA 1Z7UA 1XD2B 5KDOA 4M71A 5ILSA 2D2WA 1JALA 1NKTA 2B7CA 1XJCA 4OMZA 4RSGA 3TH5A 3X2SA 4ZKDA 3FYHA 4PZLA 3JVVA 1FL9A 2O8EB 2F2EA 3BRWD 5LB2A 3KTAB 3BC1A 1MRSA 3JZAA 3T0YA 1OH5A 1G7SA 4IEIA 4QM7A 3UKDA 1W4MA 3J80K 4O2LA 3QPWA 1USTA 4AYXA 4CZZA 4TLBA 2E87A 1SGWA 4US2R 5K8UA 1Z0FA 4Q02A 1IXRC 3QRFF 1DAGA 4AG5A 3W90A 4QHYA 1ZLKA 1TTYA 3F8BA 4BFVA 1OYYA 1SVSA 2RGDA 4ZIRA 3EPKA 2HT1A 2B21A 1SFEA 5JWRA 1FX7A 3VFZA 5DUKA 1TPZA 3CM0A 2V6CA 1I2DA 3BB3A 2IUSA 3CX7A 1OIWA 1Z6RA 4UV8A 3TQNA 3V8KA 2NTYC 4GMXA 1JXSA 3NQOA 3QKTA 5FBQB 4GYGA 3DPUA 1R5BA 4LLLA 1TW2A 2KB0A 4LRWA 2L02A 2FE3A 1D5CA 4UXJA 1NVWQ 1CR1A 1TF5A 3KUCA 1A2BA 1ZG1A 3DZDA 4I1VA 2J5PA 4K46A 4RZXA 5E8IA 1ZIOA 3AVQA 3AGQA 3E5HA 2W85A 3G82C 3ADCA 3QOPA 1FYKA 1IUYA 2QQBA 4MKGA 2D2FA 1VCNA 4KFRA 4C0KA 2ZXUA 3DPTA 2DZNB 1WQ1R 2JJ1A 3CF6R 1US8A 2OLJA 2GJ9A 1P72A 3GLGB 1NVXQ 2P6NA 5FLXZ 1QHNA 1R1TA 2ANBA 2DFNA 3TGNA 2IBMA 4TTQA 5JEEA 3ZQ6A 3P20A 1KMQA 1NP6A 1WP9A 2P2LA 4IRGA 1DARA 2NIPA 4DT1B 3H86A 3U60B 3G73A 4RFSA 2FFAA 2IS4A 1BS1A 3D7MA 2IXFA 4B3XA 4ENJA 3HSEA 1EX7A 1XPRA 2BEKA 3VQTA 3GFLA 1L4YA 4PPQA 2HJVA 3RKYA 1W1WA 5JFGA 1N6NA 2VH5R 4BFUA 1TNTA 4IJAA 1U3EM 3TE6A 3EZ6A 4DSTA 1ZYUA 4F38A 4N3NA 5CVRA 4LOAA 1PUEE 3NHBA 1DAKA 1N0UA 2O8CA 2RV8A 1C0WA 2Y8EA 1OE0A 2BEOA 1BMFA 3FFAA 4KCGA 4G5QA 1KI4A 4G8XA 1CLUA 4QRHA 1AKEA 3RRYA 2A68F 2W6JA 4OQLA 2EFQA 1KSGA 2CFXA 4GCVA 5E17F 3VR5A 1QVAA 1VIAA 1BI1A 3P27A 3L2CA 2FV8A 3QKRA 3BK7A 2ORVA 5K5RA 3IEVA 4ETSA 3QBVA 2BV3A 1OH8A 3AVXA 3C5CA 4U7DA 2AWOA 2REBA 1TF7A 2VHTA 4OK6A 1L8QA 3FF5A 5LHGA 2P6TA 2O8XA 5HVQC 4AIIA 4OJKA 4URUR 2MSEB 1LF0A 3NDBB 4B33A 421PA 1HY3A 3SR0A 4QM6A 2D7CA 2RC4A 5AUPB 2M30A 2H09A 5C18A 3ZMTA 1M7HA 2FJUA 5ICEA 2IA5A 2WKQA 4LYAA 4V0NA 3TAHA 4CXFA 3KB1A 4GOXA 3WTSC 1XSVA 3DEUA 4FI3C 3FB4A 5BYKA 5HZKA 5LPNA 2CHGA 3F22A 5K8LA 1TU3A 2RGCA 2PJRA 5JJKA 2FE4A 3C8UA 4PC2A 1HEIA 3RC3A 4MKIA 3FM3A 3GZ5A 2YZ2A 4OBEA 1GKYA 3RYRA 1BYUA 1N6LA 1N5LA 2FFQA 2GZDA 1X8KA 3I58A 1O3YA 3ETLA 5D4RA 1J90A 2XTNA 3A4MA 1R0XA 2CW0F 4KIBA 3MWLA 2C03A 1RRPA 3K1PA 2AK3A 3BH6A 3NKVA 1JEDA 1AM4D 3LW7A 5CB8A 1HSTA 3V7RA 1KQ9A 2VL7A 1LVAA 1ZW6A 2Z83A 3RSOA 4XWOA 4LYFA 4ZKEA 1XRJA 3SQXA 4PGHA 4UNPA 1FNMA 3ZLJA 3D5LA 1DAIA 1ODDA 3LAJA 5EXSA 3ZZ0A 3I61A 1KSFX 2EFHB 4HB2A 1G3UA 5DIFA 1FY7A 3I4LA 2VYFA 1UM8A 1SFUA 3P32A 4YMTA 4C7OA 2IHBA 4MTEA 2AFHE 1MDMB 3NTUA 1VYVA 1KK3A 4IXNA 4HAMA 2QMHA 2GIVA 4FXPA 8OHMA 3PQKA 5JRJA 2DWZB 5HE9A 4Q03A 5B2ZA 5CITA 2WSMA 2PLYA 2BMEA 1NY6A 3NG1A 1S6LA 4A0HA 3H84A 2FF4A 3B82A 4DHEA 4KICA 2FN4A 5EUMA 5G40A 3X1XA 4GSYA 5HZHA 3KQNA 1G6HA 5JFRA 1MZBA 2DBBA 5FTMA 1ZM3A 3P1JA 1UDXA 4KLNA 4HF0A 1X3SA 2PBIA 2JATA 4HYYA 4DCNA 1SXJB 1G18A 5K8TA 1EH7A 3U4QB 4US1R 3M0EA 4OHVA 5CM9C 2VODA 4Z8YA 1ZINA 3CBQA 1HKSA 2WZQA 5GJBA 4EPXA 1S8NA 1ZUNB 3WRXC 3OEHA 3PUYA 4CYDA 1U9IA 1ZIPA 2ZRLA 1QZYA 1VCMA 2IXEA 4OI1A 5IF9A 2VTKA 2HDCA 4MYHA 2FMXA 5F9HA 4KO8A 2J7PD 4MKFA 4EQQA 1H8HD 1XDSA 2DW4A 1G20E 3LA7A 1JXMA 3LVRE 2DI3A 4Q1DA 4ZDKA 1KO5A 1MH1A 5TMPA 4EJVA 1AGPA 4NPHA 5FTNA 3MZYA 1NKSA 2GEVA 2BMFA 4JLJA 4BLPA 2IS6A 5FTKA 4AWXB 2R6GA 2R9VA 4V0MA 2AFIE 4P3YA 3MJRA 2O8FA 1IHUA 4UXNA 3DF8A 3K0AB 4WZBE 3NH9A 1B4AA 3P4YA 3SFVA 2AWNA 4C3ZA 3KQUA 3UPUA 5F98A 3IHWA 2FMYA 2MBFA 4BFXA 2AHOA 2HS5A 3E5UA 3ZMVA 3VB2A 2ZUDA 3QI2A 1W4RA 2O6GE 1JBKA 2JGNA 2P6UA 5DI3A 3V9PA 3RS5A 3ZIAD 1G16A 5HS9A 5J4HA 2QVOA 3MUFA 5EXXA 1P9NA 1Z6XA 3CO6C 1KDTA 2J3EA 5JI6A 1YG2A 1ZYRF 1WF3A 2L54A 2FF7A 3CB4A 4P0TA 3K70B 3ZH9B 4LB6B 2DWPA 1NLFA 1OR7A 1LTQA 4LZZA 4KVGA 3BORA 4IRHA 3LW8A 3PV0A 1B9MA 2GXAA 4GOJA 2CNWD 3GLHB 3FTQA 4HOBA 3ZIAA 1A4RA 2YWGA 5TJJA 1SMTA 1XCMA 1YZTA 2FNAA 1G3WA 5E1ZB 4IJMA 3X1YA 2HWVA 2M5WA 2GJAA 1JR3A 2KBFA 4QJ5A 4MGKR 5EJEA 5UKDA 4A36A 3HSFA 2BBOA 2DAOA 1C1YA 1KY3A 2H92A 2QEQA 3SZTA 1W7PA 2MSDB 4JLKA 3K2ZA 1CIPA 2LKPA 3QG5A 2O3FA 4FMCB 2XTZA 2MLKA 4A6DA 4ZYGA 1T0HB 3KJGA 4EQ6B 1VG1A 2F1RA 3V7SA 3QQ5A 5JRZA 3U7FB 2OBLA 1D5VA 3QU3A 4MQBA 4EJWA 2EFNA 1ZRDA 1N5JA 2ZRIA 4N0EA 4Q1AA 1GITA 3VODA 4FCTA 4ACBA 5ED4A 4AYTA 1CJUC 4U00A 4CEIB 2HQRA 3FDIA 4M1TA 2WWYA 5FUVA 4TYPA 1XGNA 2OCBA 2ZRFA 1IXCA 3OOPA 1U8YA 3KKMA 2JZYA 3F8FA 4Y0VA 2A6HF 3WY9A 3FXRA 1NN5A 4RD6A 5AWFC 4ZDJA 2HEIA 1U9IC 3FVQA 4ON9A 5JECA 2BMJA 3QPTA 5FPHA 1RUNA 1M1YE 2H6BA 3SI7A 2GJSA 5FOXA 1R0WA 3K0SA 3QVUA 3KZ1E 4MRNA 3FFBA 4RB0A 3C4JA 3T5DA 2OBPA 4DCTA 1P5ZB 3V7CA 1YW7A 4CRWB 4HV6A 3KCCA 1EFRA 2RHMA 3HU2A 1SD4A 1JE8A 121PA 4UHTA 1SXJD 1TUIA 1Z6GA 3GLHE 1NN3A 2ZI4A 4EV0A 1FYLA 5BPIA 2L4MA 1I4DD 521PA 1Z22A 2X0LA 1EWRA 4WIAA 1ZH5A 4MITA 3E1SA 1XMAA 4Q9LA 1XTQA 3GZ6A 1IRGA 4DWJA 5KPJA 4A1FA 4ASUD 1BI3A 1M2OB 3A1TA 3CRQA 3HR8A 4US0R 3O2PE 4NU0A 2R62A 4P4SB 2D74A 4BAYA 3RJPA 2J5OA 4UNSA 1JPJA 1CF7B 4LHXA 4LJYA 2Q6TA 4ZYDA 3MWKA 2IF2A 5FB2A 2VF7A 4PO8A 4TL6A 2M8EA 3TKYA 3EASA 3TR0A 3I62A 1HSJA 4IDOA 2GCNA 3CZQA 2BJVA 1XTKA 2V4ZA 4Z2YA 2FDCA 2EFWA 1Q1QA 2G0TA 3LH5A 1BIFA 1MABB 4QBIA 3HHGA 5LEKA 2DPDA 3ASZA 2BKEA 4TV7A 4BLSA 1E9CA 1XXHE 4HZUA 2OCYC 2EJRA 4HAXA 5LB4A 4LSGA 2YWEA 5TDHA 4BZPA 5L3SA 4FWTA 2WJHA 2PQ8A 2A9KA 3PFIA 2CVHA 3DKPA 3DM5A 3GJ7A 2PT5A 3QXJA 4DEYA 2Z4SA 5FOWA 4B3GA 4Q7LA 1UDWA 2BKUA 1R5OA 3WHKA 5KSYA 1XCBA 2W2XA 3B6EA 4RD4A 3ND8A 2J5XA 3KJHA 5EUQB 3TBKA 3QVVA 4ARZA 3AAFA 4B6EA 4M53A 3DPLC 2ORIA 1H0MA 5SZIA 1O3QA 1GNQA 4LC0A 4OHWA 2A5JA 2JDIA 1VECA 1LVGA 4H9GA 1T3LA 2RGNA 4R9UC 4ZV4A 4XD7D 1G5RA 1MKMA 4HX7A 3MD0A 1UKVY 3BDDA 3HPQA 1TLHB 4MGZR 1Q21A 2QMEA 2ZS7A 4LLGF 5JHHB 4KODA 2JJ2A 5JR3A 1ZAKA 1E0KA 2VHUA 4LBZA 1DOAA 2OAP1 3AP3A 1NI3A 1CR4A 2H18A 1CR0A 5GJWC 1XD8A 5DCMB 4KNYA 2HR3A 4F7ZA 1IXSB 3BOQA 4LPKA 2IUUA 2K7LA 1TX4B 4CGZA 1SD6A 4L18B 3WMEA 4P96A 1XFAA 1CP2A 1SVWA 3R0JA 3TUJC 1Z8FA 2QAGC 1VCIA 2KRKA 2F1IA 4V0OA 1TL7C 3S1AB 2WKPA 1SD7A 2H94A 1AZSC 5DN6A 2ZROA 4Q9HA 4B74A 3KEQA 3SE0A 3H1TA 1X8LA 2REOA 2JJ1D 3FHOA 1OXSC 2DQRA 2ZSEA 4O6JA 4B2PA 4L8GA 1NVVR 3EXAA 4TWZA 1YR7A 4IW3B 3IRQA 1TQ6A 2FEOA 4B73A 4FX0A 1N2CE 3QSYA 3AF3A 2W57A 4EJUA 4LRTA 1D3YA 1A2KC 2VP6A 1Q1ZA 2ZSBA 5L3BA 2FG5A 2ZJAA 5IT3A 3OEHD 4MGRA 4OI4A 3ZVNA 1JHFA 3GX4X 3CO7C 1N6IA 1ZU4A 1BKDR 2CQKA 1M6NA 2CLCX 5JVTA 2IYVA 4XTRA 5D3MB 5DI9A 1AKYA 2XZPA 2Y48A 3WGHA 1W36B 2MH2A 5KDDA 5D8LB 3KKQA 1R8SA 2A7QA 2LSOA 4A15A 3TW4A 2GF9A 4GDFA 3AJIB 3MHVC 2F1JA 4MDEA 3PEWA 1WKMA 3EX7C 4DLVA 3CONA 1VG9B 3HJNA 4JS0A 4KFUA 1U0LA 2JLXA 1II8A 3IDQA 4BLQA 4DB4A 4PQFA 2LDUA 3LDAA 4ERNA 3W9YA 2ZYUX 2IX3A 1UF9A 4PX9A 4QG7A 4DDVA 4R8HA 2IA2A 2UZKA 1YR8A 1KO8A 3TUZC 4KJZA 3FKSA 3DXJF 1R7JA 2AD5A 3O3KA 2ANCA 2HFHA 2QAJA 4QFMA 3VMFA 1E4YA 1T91A 3F8TA 2GK7A 4LX0A 3WYAA 2C9YA 3OAAD 5AR1A 1KSHA 3KZYA 1UBEA 2X19A 3FMPB 4PSVA 1ZM2A 4XH9B 2OAZA 1IY2A 1NSTA 1VMAA 2ZJ5A 5FLXK 3QG1A 4HDVA 1QPMA 3SQNA 1FP6A 5CJ9A 1Q3HA 2FSGA 2Z5FA 3O47A 3B8HA 2HYFA 2XUBA 3R9IA 3AVWA 3WYFA 1E94E 1G8FA 1E0SA 3WE3A 3FMRA 3GO5A 1BO6A 2ECKA 2OFWA 3B1YA 1XD9A 4UNRA 2WAXA 5HPYB 3KQKA 2P6RA 3SNHA 2GA1A 5CYVA 3J81Z 2QU8A 3KXKA 2BGCA 3WNDA 1EK0A 2BJWA 5H70A 4AKHA 2ZAMA 1W5TA 3NC0C 3KKPA 3T1QA 2UXXA 3W6KB 1SAXA 2W00A 3HYTA 3VR1A 2FGKA 5FOSA 3FGNA 1CGPA 1E17A 2ADUA 1MV5A 1NG1A 1LEBA 1NMYA 1E96A 3O8DA 2QP4A 2ESHA 3HIFA 3RRNA 2CE2X 4G6DA 2E7WA 5DDGA 1EFCA 1N25A 2C2HA 1E2LA 1KO4A 1YYVA 2LNBA 4TMZA 1U5TA 2IWHA 5CB6A 1NF3A 1FUUA 2Q3MA 2DPUA 3IPXA 2GZWA 4CYMA 4ITRC 2CCKA 1WBDA 4NBSA 1E2JA 5KNCA 1XEXB 3HRMA 1YFHA 5TXGA 4WZ6A 4EIWA 1VG8A 1GNPA 2WV9A 2HXYA 2BYVE 3UK6A 1KJZA 1S29A 3JW4A 1O87A 3RTRA 3PUZA 2FBHA 3GLFA 5GVSA 2ZR9A 3SU8A 3LNCA 2XKPA 2KI5A 4P4TA 4TLDA 2QROA 2XSZD 4OI2A 4LV5B 1OXUA 1RUOA 4URWR 3UANA 4LMYA 3AVPA 1PVOA 4DKXA 2NNNA 1VPLA 4UNNA 4XVUA 2AN9A 2ZRCA 1IN7A 2GJ8A 1P92A 5B57C 1Z28A 3R8CA 4CT5A 2PLFA 4QKQA 3LA3A 3IL2A 3BPVA 4RAYA 1TF2A 2ODEA 3B85A 4EJSA 3GLGE 1FZQA 1T5IA 2OHFA 3QEJA 4Q4JA 5AK0A 5JSZA 1RYHA 2KSQA 4RGSA 3ISPA 1XEFA 4P4UA 1P61B 4HF2A 2F5DA 2O8BA 1E2PA 4HLYA 4NYIR 2F7SA 4LJ6A 4ENNA 2XROA 3VU9A 4XVQA 1LNZA 4PSKA 3KLNA 4GMDA 4TLCA 3ECHA 4F92B 2A78A 2N1BA 5KOYA 1NHAA 1XNJA 2F5CA 2ERXA 3BFVA 3DKVA 4B71A 5BN5A 4FWDA 3IKJA 4DUGA 3WGGA 2E9SA 3GMTA 3OHMA 4ILEA 4S04A 2XTMA 4OIRF 1J8MF 1T5LA 2C77A 3GFOA 1HBXG 1Q0UA 4GZLA 4Q7KA 3U7HB 1A7JA 3C18A 2DFTA 4KLZA 5AJWA 3ULQB 2EYUA 2O0JA 2OILA 3ZMUA 3SJBA 3SN6A 3HOTA 3HSRA 4MDFA 1IY1A 1V5WA 1HT2E 4IDHA 1UFMA 1BOAA 4KN4X 3TIFA 4PTLA 2KJCA 3CZPA 1KK1A 3LD9A 2JASA 1RJ9B 2Y0MA 2RGXA 4HX8A 1ZM9A 1DP7P 3K8YA 1IQPA 1OIXA 3VX4A 2OM2A 2ZQ5A 4LHYA 4PZZA 3EC1A 4PC3A 5DHFA 2PEYA 3NBFA 2QL6A 1MO3A 3KFVA 1F6BA 1CTQA 3LSTA 3T8TA 2OESA 2Q0OA 1U5TC 2X8AA 4LJZF 3EYIA 4B32A 2JAQA 4P31A 4XRFA 1XEWY 1GVJA 3ML6A 1VIYA 4HZIA 3TKLA 1IN8A 3C41J 1XB2A 3EQLF 2ZI6A 2J7KA 5K5OA 4IHTA 3ELKA 4A92A 4Q5SF 3NWJA 4Q01A 3H4MA 1XMIA 1FP2A 3CIOA 3VKHA 3OFND 3KEOA 1BJAA 5DD4A 1QBKC 4R79A 1XJ0A 2ORWA 5FBLB 1GRNA 4Z1MD 4L5IA 2NO9A 3IBYA 2GEDA 3QKUA 1WDTA 1TTTA 2J0QA 1ZVQA 1LS1A 3BP8A 1ESNA 2FPLA 4ABYA 4A2QA 3QKSB 1XPOA 3IQXA 3QF4A 4HLDA 3EPLA 3KE2A 3B73A 4JVNA 1ULYA 1JNYA 1KMHB 2PZFA 1JQJC 4CVNA 1CKEA 1I1GA 1DAHA 1P62B 2EU8A 4YDHB 4BUJA 5JHGB 2VT3A 1Q1HA 3BH7A 1JJ7A 5JMTA 1RFLA 2HTJA 5HOOA 3BY6A 4WK8F 1E79D 3QY0A 3IHUA 2NPFA 4A2PA 1HTWA 1J2XA 3HRUA 3N4MA 3CWZA 3D6TB 3JZMA 5AUOB 3BAFA 4AYWA 4HLUC 3L7WA 4FT8A 1P3JA 2CK3A 3KQLA 2ZRPA 3VHLB 3M8FA 2IUTA 3PCRB 2P4WA 1KZGB 4MGIR 2Q21A 4DCVA 4EPVA 4R7ZA 6Q21A 5DNYB 3L0OA 1HT1E 2YOHA 3GLXA 3CPEA 1K5DA 5HLIA 3I5UA 1CJVC 2A6EF 1G291 1RVDA 1XD2A 3UMFA 4L4UA 2MA3A 2QAGA 2WJJA 3HHHA 4EJTA 3GJ4A 2ZRBA 4GP6A 4JLDA 2F43B 3I73A 3TVTA 3U7GA 2O8EA 5JJLA 4DCSA 1DS6A 2QA5A 4ZH4F 4KUMA 1AGRA 3CRVA 1IN6A 2A07F 4BNCA 3HRTA 1XSDA 1XN7A 2ELHA 3U61B 4F91B 1T4GA 2WAYA 3F21A 1QHGA 3MFYA 1EESA 4CDGA 4E03A 1X86B 2V55B 4HAVA 5F3WB 4RZ3A 2KJQA 2NRAC 3L8YA 5EE5B 2DWOA 3T06B 3ZMSA 2B8WA 3B02A 1XF9A 4LJ5A 3EIEA 1W0KD 2E1RA 3ND9A 1JI0A 4PPGA 1X6VA 4ESBA 3SYLA 1KIMA 4P33A 5EP1A 1ZC4A 1O3SA 2FOKA 1PLKA 4XIGS 1P2VA 4ZIRB 1T2KA 4HAWA 4UJ5A 3SC3A 2COMA 5JCPA 2WTUA 3WYGA 2Q9AA 2ZR0A 2PH1A 5JS8A 1DO0A 3Q7PA 3RC8A 2BCJQ 3C7KA 2AR7A 3P9CA 1FTSA 4Q4HB 3FMOB 4WA7A 4EDHA 1J75A 4YMVA 1CJTC 5KYKA 4YC7A 4DEXA 2XZOA 2GCOB 1YE8A 4HDQB 4Q4ZF 4QL3A 1N0VC 1Z08A 2CVFA 1EFUA 4LGWA 2W25A 3BJIC 4L0YB 3DDCA 5CJ2A 3WU0A 1HV8A 2V6IA 1QG2A 4M0LA 4FN5A 2PI0A 3DHWC 3KUDA 3WTTC 4LJ7A 4C0JA 4AIHA 1K6OA 1US8B 2ZREA 2HLDD 4TQAA 4JL5A 4A0RA 1S2MA 2NQ2C 2O0KA 3IRRA 1XXHB 4ENMA 1FX0A 4YFKF 1UJ2A 2JA1A 3FZVA 2A3SA 1YZLA 3TOBA 2KWIA 3BS4A 2RQPA 4JVLA 1OFTA 2WPDA 3LXRA 3E6BA 4I1SA 4DLZA 5L3CA 5BPDA 2QGNA 5HR5A 4NZYA 4LYHA 4TMXA 1ZUHA 2W6IA 3CLOA 1S7OA 1H8EA 3GJ0A 2JLWA 1G8YA 1D2EA 4BGDA 5E1WA 2ZKZA 4YIIA 2BE5F 3N97A 2ZS8A 1ZN2A 4AK9A 4UV9A 2W24A 5EEGA 1O7LA 2EFDB 3N2IA 4G5SA 5TY0A 5HCIA 4B3FX 4ESJA 1DVRA 2IYTA 1RIOH 1Z2CA 1H8HA 2YOGA 4MA4A 2QWWA 2ZI7A 5G53C 3UWOA 1HW1A 3CH4B 5IDVA 1KDRA 3AP1A 1E2MA 1F2UB 3AUXA 1KI8A 4AVPA 1SXJC 4UKDA 1SD5A 221PA 1E2KA 3P9KA 5E7JA 1KHTA 3PEYA 2JIZA 2XEXA 4LBYA 4LG0A 3V4RA 3MWYW 4L9TA 2Z5UA 3WTVC 2PEZA 4I99A 4TSFA 3UATA 2EA2A 5IT9K 1Z3IX 4S2EA 3FMIA 1RW4A 1S1MA 3QENA 3J81K 4DLXA 1BH2A 4I09A 2EFCB 2EVWX 4LUCA 4TL8A 5ICGA 2ZFWA 3AB3A 2NO7A 1KI6A 1FSEA 2QUFA 1V43A 5AJXA 4B3DA 2IC5A 3CF0A 4XD7A 1XMVA 2OAQ1 2ZE5A 4HDOB 3Q8XB 1MT0A 3E97A 3ZMDA 1ODFA 4JVMA 2KRFA 5EQTA 2IYWA 2PJZA 2WPDD 4HQEA 1G17A 1P2UA 3GEEA 3F72A 4JYBA 2IJLA 4FMBB 4D0GA 2XKOA 3T1VA 4RJLA 2XAGA 2B0LA 1B6AA 2QMUA 4H0EA 1XDBA 3NEJA 1GRQA 2DK5A 4HLXA 3M6AA 1FYMA 4Q47A 1E2HA 3IO5A 4KYIB 4B3BA 2IP2A 3R0AA 1GWNA 1MRNA 3EAQA 4CIDA 2IYZA 1TQMA 3VR3A 1BI2A 3THXB 1XMSA 2IA0A 1M7GA 4DSNA 4S05A 2CE7A 3L8ZA 4OMYA 4EKDA 2QBYB 2Z3YA 3NVAA 1XWIA 2FSWA 5ILUA 3AKYA 3IIKA 4B2LA 2K27A 1GAJA 2BDTA 4A0YA 1G4UR 4TT3D 4GRAA 1E9BA 1IBRA 3CR7A 2IA1A 4JLMA 2G0NA 5BXQC 3F3XA 5FPKA 1BI0A 3F8MA 1E2EA 4NKRA 2NGRA 4M8NE 1ONVA 2XV4S 4D0PA 2RGNC 4TQ9A 2ZU0C 2ZJZA 1KQ0A 2OQGA 1I2MA 2QORA 4FMCF 4KVAA 4NQWA 5FUWA 5D4SA 1RRCA 2XAHA 5IRCD 2WBLC 3EWAA 2NNYA 1II0A 4OHYA 2LWIA 1Z0JA 2DTRA 1KOFA 2DQLA 1OW3B 1KI9A 3O6BB 1ELOA 3U3RA 5A2QK 3ECOA 5HKKD 3CH5A 1RYFA 5C1BA 3U2RA 2UXNA 3TAUA 2A5YB 3VR6A 1U98A 4U02A 3TSOA 2AL7A 5KO2A 2DU9A 3HYIA 1W44A 2CL0X 1E2GA 4A82A 5JLJA 1K78A 5FFZA 1E1RA 1PDNC 4LV6A 4C2TA 3A8TA 4O5VA 2OXCA 4X8LA 3OIVA 1YTYA 1TMKA 1KA8A 2WSSD 1C4OA 2GAUA 4K2EA 4JKIA 4I4LA 1KDOA 3NH6A 2IF0A 3VX3A 2RMKA 4BFWA 1OJLA 5EEHA 4NTZA 4YLGA 2C04A 2GF0A 4C4PA 1G3MA 1EFRD 5EXTA 5HKKA 4URVR 5D5WB 4II7A 1RNLA 5D3QA 3U4QA 4YFNF 2WC2A 4G5GA 1Y0UA 3BROA 2YC4C 2O8DB 3FMFA 4JT4A 1F2TB 3GLIB 2SHKA 4G5OA 5J6XA 2XRNA 4BLOA 4CEHB 2QQ9A 1HH4A 2P5KA 2F5FA 2VC1A 4EM2A 3WTUC 4JJZA 4V03A 3U7EB 4BECA 1FFHA 4LHZA 3KKNA 4A5NA 2QM8A 4KFCA 4OKSA 4XSGA 2ZNYA 1DBSA 5L3DA 4KIFA 5LHIA 4PDKA 2C5LA 2Q8KA 1CR2A 1LNWA 3WTWC 2OFXA 1D9ZA 3T5GA 3QBTA 4KU4A 4DC9A 3JTGA 4PC1A 3BZ6A 3LFKA 2JJ8A 1SHZA 4LYJA 4FWHA 1G8PA 1KYZA 2LF8A 2KE5A 1M7BA 3OIWA 3EPJA 4JVSB 2ZSFA 1HQCA 2JSCA 1G4DA 4Q9KA 4E07A 2H16A 3RPUA 1IW7F 4B3CA 4I2OA 3ZVRA 1YJ5A 4MEXF 1G19A 4IFBA 2HUPA 1NL3A 4Y0AA 1NIJA 3H0KA 1Z9CA 4LV8B 1NLZA 2LCFA 2VOPA 1R2QA 2ZRGA 4K81B 4YMSA 4IXAA 4TMVA 1GIAA 5FR2A 4DNCA 2BVNA 4JLNA 3QPVA 1K5GA 2WWXA 1C9KA 1KYIA 1TNSA 5FD5A 3RIRA 1MO5A 4O25A 2JT1A 3U2QA 2FA5A 1U81A 4AURA 3CRRA 2AK2A 4EPRA 4OHZA 5TARA 1LFDB 5FL7A 1ZHFA 3REFA 1MR3F 4ESFA 5AUNB 1QHHA 3ZVLA 2BV6A 4DQ2A 1ZD9A 1GL9B 1HQYE 4WW0A 4BH9A 3LA2A 5LEJA 4PHFA 2VP5A 5CDFE 3ICEA 4D80A 3R4KA 3K0LA 2R6FA 2VP2A 1KDPA 5HDKA 4Q18A 4RVCA 4LCBA 4M73A 4HW0A 5GVRA 3ICQB 2CG4A 4IOJA 3U44B 3DMNA 1E99A 4P9FA 1KI1A 2WIAA 5BQ5A 2IW5A 3UG6A 3W6JB 1NVMA 2XXAB 4IRUB 1USSA 4WWCA 2HLDA 4CO8A 1FWZA 4RGXA 3HU1A 4ZPXA 5H6RA 1CJMA 3EC2A 3THWB 4A8JA 1PLJA 4DLSA 1FOEB 2W0MA 1FMLA 3CX8A 4KYUA 2Q0HA 3U3MA 1E9SA 2FU5C 2IEZA 3DL0A 1PV4A 1T3HA 3ADKA 3GCGA 1CULC 4LI0A 2VE9A 1GM5A 2P5LC 1R36A 1TNDA 5FOTA 2NZJA 3AV0B 1GTVA 2X77A 1BC8C 3I8XA 1G3SA 2PX3A 5GJVC 4URYR 1KNQA 3LQRA 2BM0A 3A37A 4HUQB 1KKMA 2NO1A 4MUAA 2TDXA 5J5CA 3QAHA 2VHJA 3A4LA 1GP2A 5AJYA 2EW1A 4OQNA 4EJSC 3C5HA 1SVOA 1XTJA 4M21A 1YR9A 3AVTA 1P2SA 3V00A 2R6AA 2YVUA 5ELXA 4M6XA 2WMOB 4JBXA 1HKQA 5FTJA 1W48A 2WHXA 4KHZA 2C78A 4XLNF 2DR3A 4NYJR 1F1ZA 5E7IA 2WWWA 2WSSA 4HLQB 1XTIA 5BWMA 2DB3A 3KKOA 1GG2A 1NBME 4C0HA 3I3SR 2FFHA 4IOMA 4GBMA 2G88A 4IXMA 1HA3A 4BFYA 3EWSA 1IN4A 3RS0A 2Q2EA 4I0AA 2P6SA 3TW8B 2C6YA 2XAFA 3CJNA 2FMLA 3H3UA 3I59A 1WI9A 4PZJA 4XLPF 1P9WA 3MFKA 2VP9A 1HW5A 2FQ3A 1LB2A 3KTAA 1YRAA 2HZTA 4HX4A 3IIJA 1V4RA 2GWRA 1AWCA 2CCJA 1KTVA 1XCGB 5G3YA 4D82A 3WNBA 3T61A 3RRZA 1KY2A 2UZIR 2DT5A 3KFWX 2ZRAA 1UCRA 1OSNA 2H17A 4QOSA 3PXGA 1PLLA 5CK5A 3THYA 1J99A 4UVBA 3FHTA 2EWVA 4HZFA 1PUJA 3BH0A 3BFKA 1G41A 1SVIA 4TLEA 4URZR 5HTKA 1UHMA 1V3FA 3VKGA 3KP4A 4ARZB 4OOIA 1S96A 2AKYA 3HWSA 2RB4A 3EYYA 4X8OA 3B5JA 2GILA 3NBXX 2XJ4A 4ZO4A 5EZ6B 1E9EA 3I71A 1XCVA 1Z06A 4ZCIA 3OAAA 2O5VA 1G4AE 4UQOA 5EE0A 2BOVA 2NO6A 1T39A 1Q22A 2E7XA 2OLKA 4ACAA 1KO7A 4W5WA 1DEKA 4A6XA 4DLWA 1W36D 2ZSAA 3AKCA 2RGVA 2YU3A 4NHOA 4JQFA 1XX6A 1YRBA 3CO5A 4JLBA 2P7CB 2PL3A 2GETA 1DPFA 1G6OA 4L0ZB 1IRFA 3CRMA 3HPRA 1JHHA 1QHYA 2OCPA 5HE8A 3AF1A 2QZ8A 2QM7A 3PQCA 1B0UA 5TB5A 2V8OA 1ZNYA 2QLZA 2H6CA 1KNXA 2WKRA 2HGCA 2W2VA 4HSEA 5BN3A 2VT2A 2HQNA 3A4NA 1G6NA 2ZMEB 4NE2A 5F2EA 3TVDA 5DCFA 1E69A 2ZNZA 1VHLA 3M9AA 5FI1B 1M74A 1XCPA 5DHAA 1UBGA 1Q1BA 3L82B 3S1AA 4WXDA 1NVUQ 4L9WA 5FL7D 3MWJA 3AF2A 4GI7A 4BLRA 2JLUA 4HAYA 4DLYA 2OZ6A 5LRRA 3BWDD 2WOOA 3RDIA 1JAIA 2QQ0A 1OXVA 2V3CC 2GKSA 3CTAA 5J4VA 3RHFA 5KVRA 3F8CA 4C0SA 1OKRA 5ILVA 3EARA 2X4HA 5AONA 2IYYA 1W7AA 2ZJBA 3RS4A 2YWHA 3AKDA 3BJ6A 3A1UA 5KPDA 2EV6A 2E1CA 4TN1A 4I0BA 2RKHA 5FD6A 2DCUA 1NNEA 5DV5A 3M4YA 2ZSDA 3MCAA 3RI4A 3IO3A 3O8RA 5FH9A 1WXQA 4QHTA 2JJ2D 2WM9B 4M1OA 2ZE6A 3BXZA 4W7SA 1O7FA 5AJZA 4BHCA 2DYKA 1G3IA 4MRVA 3VHXA 2EWWA 1HE1C 1F5TA 1BIBA 2CXXA 3ADDA 3P7NA 1U78A 3QKRB 4RFVA 5H20A 3KP5A 5HS8A 2ETHA 1D6JA 2ONKA 4PR0A 1YHNA 3ADBA 4OJQA 5FR1A 3VLFB 4NYJQ 1TQIA 2FRHA 2GXQA 4PHTA 4ZI2A 1FP1D 3HP1A 4E70A 2ZRHA 4Q1CA 1SMYF 1ANKA 3J80Z 3WMGA 1QZZA 1G7RA 2XAJA 4YMUA 2JLQA 2O0YA 5FUXA 4OINF 4LC1A 3RLFA 4RKFA 3AF4A 3H3ZA 1J8YF 3GEZA 4GOKA 3QP6A 2N42A 5KTYA 5FBWB 1B59A 1D2MA 5LBIA 3MMPA 4GP7A 4OL0A 2G1KA 1BOFA 1ZCAA 1Y3AA 1T0FA 1ZUIA 3ABTA 4HDUA 4U7BA 4HYEA 2JTVA 3M1EA 5K1YA 2XVCA 1QG4A 3I92A 3K0CA 4C30A 1SKYB 1NJFA 1DPRA 3MLEA 4JL8A 2IYXA 1P60A 3QU6A 2O52A 2PFBA 1W36C 4HLUA 5CVUA 3WRYC 1FUKA 4DSUA 3EZFA 5CK4A 3WBJA 5SZKB 2PMHA 3CKLA 2LF7A 4KFTA 3R6SA 1DAMA 4DIDA 5J4LA 1VYUA 3E2IA 4QLCU 2FPKA 3CDHA 2XNDA 3IILA 3OE7D 4M1KA 4FCWA 3HTUA 4ENKA 2VIIA 4EVIA 4HF1A 1GZSA 3FE2A 4R2HA 3DEFA 1AK2A 4X8HA 1T9HA 2KJBA 3GYHX 3R9XA 2MMGA 1U5TB 1CS4C 3PJRA 2FFBA 5D6FA 4CICA 3CPHA 1MDMA 4IFEA 3LWFA 3DVLA 5P21A 2QTHA 2NO0A 4PO9A 2P8TA 2EFOA 2R6DA 2YC2C 3D3QA 2H27A 2V6ZM 2A69F 3NIBA 3TNFA 2P67A 1R23A 1BYIA 1G3TA 1YZUA 1TQDA 3GLFB 1XB4A 4N9IA 2IS2A 1KU2A 4JYCA 4JT2A 3IKTA 2VQSA 3C1DA 1QZXA 5CIWA 5DGXA 2R8RA 2A61A 2OQRA 4MTDA 3CNLA 4AKGA 2FSHA 2XJ9A 3E70C 3EDPA 2C98A 3D8BA 3CUQB 1SXJA 2ACJA 1CU1A 2CLDX 1QHSA 3BFXA 5F64A 3UMRA 1D2NA 2E1NA 3M8EA 1W0JD 2YV5A 5CIQA 3ZDQA 1E9FA 2ODBA 2ZE7A 4PC7A 5BW8A 3GF2A 5JJIA 4EGYA 3HOSA 2ZBKA 1YZKA 3DOFA 1D8TA 3PUVA 1SKYE 4OQMA 2ISZA 3K0FA 1YW8A 2QG6A 3R7WB 4B43A 4Q4JB 5JSZB 1F5NA 3AVOA 3T15A 1U2RA 2QZ4A 4M1MA 3R8FA 1FPMA 3RSLA 3SOPA 2QNRA 4TTRA 2JLSA 2Z43A 1W0JA 4BASA 2V1UA 5DUIA 2ODWA 2VBCA 2CK3D 1Z07A 2WOJA 1LV7A 1GNRA 3K53A 3KXLA 4BRWA 3K1MA 1OPXA 4G01B 5B64A 4DLUA 1TQ2A 3J7AO 1OYIA 4KFSA 2BBSA 5LRSA 2V9PA 1DO2A 5ICFA 4NHJA 1DELA 1XZPA 4A0XA 4GGGA 1JECA 4FIDA 4IDPA 4MRSA 3MQ0A 4HQMA 1Z83A 4J0QA 4RD3A 3UMSA 1D9XA 5AIPA 1P6RA 2NMVA 5FFMA 1BIAA 1AQYA 1H9GA 2V7QA 4WVFA 4UNOA 4M9SA 3HDTA 5DI3B 1YW9A 1MO4A 3DFGA 4EFNA 1Z63A 3WTZA 4V0ME 5J8FA 5A2QZ 3A1VA 1YQAA 1R4AA 1UKZA 4Q5IA 4YONB 3ZYCA 5J47A 5KHOC 1OIVA 3LBNA 4L9SA 1U99A 1YR6A 2Z99A 2NG1A 2PZGA 1XDUA 3TR5A 4BFTA 5KSZA 5CVIA 1EX6A 2AXNA 5EZ5A 2IT0A 1LF5A 1W5SA 3FX3A 3T8RA 3TO9A 1S3GA 2QSYA 3NC1C 3TQFA 4LDJA 1W46A 4PCQA 4B48A 4LBWA 2KIUA 3GXOA 2K02A 4ESVA 3GLHA 1B9NA 4KT5C 1R7RA 1BMFD 2V1XA 4A0FA 4B44A 3LXXA 1QQIA 3GLIE 1NRJB 1OH6A 1ZNZA 1FC3A 1UBFA 3BJAA 2D06A 2QRNA 4TL7A 4TLAA 4C0BA 2EV5A 3SEAA 2ZRMA 3EZ2A 4NL4H 2B7BA 1DAEA 1E2FA 2GESA 1W7PB 2Z0MA 2Z6VA 5L3GA 3CX6A 4Q4LA 1KO1A 3AM1A 1PJRA 4EM1A 3GLGA 3HTSB 1SVLA 2IL1A 4RGUA 2YX7A 4YFXF 2EA4A 2W6ID 3A58B 5EE1A 3W5IA 1OFUX 2X2FA 3Q5DA 4QBFA 4RCYA 3U6BA 1R10A 3UWKA 4DDUA 1LDJA 1LEAA 3FPAA 5DE3A 1HUQA 1W49A 2PLRA 3TQCA 3ZZTA 2WMNB 2J1LA 3T1OA 2VONA 2EV0A 1Q12A 2GA8A 4C0LA 1ZGAA 1KU7A 3C15C 5CLLA 3V4FA 3CRW1 4IKEA 3DZ8A 1ETUA 2DPXA 3IEUA 5A0FA 1DADA 1OV4A 3E5QA 2OT3B 1WMSA 2DFLA 2BBWA 1TADA 1QRAA 2AX4A 4M1SA 2VBZA 1LB1B 4UXIA 4C7OB 2OU2A 1OYWA 1G64A 3T35A 3Q9SA 2F6RA 3TDUC 2F9MA 721PA 1T98A 2O8CB 2CYYA 2QN6A 2YYZA 4GITA 1EH6A 1Z0IA 2A3RA 2ZUCA 3AP2A 5BQTA 3P26A 3GJ3A 1U0HC 4D0NA 2JRTA 1E1QD 1FP7A 1N6HA 2LKDA 1SXJE 4AIJA 2HEOA 3BD9A 3IIMA 5CDFA 2VBXA 3T12A 4FWGA 1RE0A 2RKOA 4CEJA 3JSOA 4WAUA 3RWMB 1U8ZA 2O61A 4PHGA 1NG9A 1RRGA 2CLSA 1FLIA 3R9WA 4HA8A 1O3TA 2QAGB 1QZMA 5BN4A 2WTEA 4ASNA 1IONA 3OESA 4X8MA 2GQQA 1G9XA 2R44A 4TYYA 1JR6A 1ZM4A 4NDZA 1ZGJA 4AKIA 3GLFE 1NN0A 4P4SA 2QTFA 1ON1A 4NCNA 1C1KA 2FEZA 2DVWB 4FHTA 1LY1A 5DSZA 3AVYA 1P2FA 3QPHA 3OIYA 1A82A 5KU1A 4FD2A 4HAZA 2BWJA 4I1UA 4JLOA 3MAJA 3B2EA 1L3LA 1OKKD 3I53A 2CJWB 2ZYWX 4L9VA 1ZG5A 3U9GA 2VSFA 4HZUB 2BIFA 1S8FA 2R65A 2GZAA 3NEUA 3V4GA 3LX8A 3Q3JB 1FPQA 3ERED 4DCUA 3DQVC 3IWZA 1G5TA 2GHIA 2R6CA 4Q4HA 2ZEJA 4C0QC 3EIHA 1KK0A 1QNTA 2FSIA 4ZYEA 1YQTA 4LPSA 4GXOA 1E9RA 2VP4A 2GCOA 3TJZA 4YQFA 3DP7A 1XMKA 2ZRDA 4D4MA 1OT3A 3K9NA 2O03A 5L3QA 3ZS8A 1Z6YA 4EUNA 1JAHA 2J87A 2Q3FA 1WE2A 2ZCWA 2HXSA 1NLYA 4BE7B 2PX0A 4TT3A 2QPAA 4MKHA 2C99A 3F6OA 2QI9C 4FINA 1EV7A 3EPHA 4L5JA 4P55A 3CLVA 1R1UA 3KP3A 3BGWA 4QNRA 3NXSA 3BBPA 5D5VB 2WWFA 4MYUA 4ZYHA 5LGUA 4O2RA 2PBRA 5EE9A 2GZHA 1ZRCA 3K09C 3WNCA 3GUDA 1UEJA 2CL6X 2XITA 1WCV1 2IYSA 3GFIA 1G1MA 4PZYA 3PG5A 4AC9A 3FM5A 4FW9A 1QO0D 3AUYA 1LW7A 5LD2B 1AQUA 3QJYA 2QQEA 2B92A 4EAQA 1IAWA 4IF4A 3PIRA 4IOKA 3SS8A 2W6JD 3VAAA 1JXOA 1SQ5A 5CM8B 2YKGA 4FMDB 3WE2A 1ESMA 3F23A 2GAAA 1MOZA 5E8GA 2XIGA 2JLYA 1JGSA 1ONBA 1X8JA 4PAQA 3K70D 2WICA 3PITA 4JZKA 4PPNA 4JMPA 2EYQA 4B47A 3L2OB 2B8TA 4TYNA 1R5NA 3FMQA 2HF8A 4A5MA 2FGJA 3M7GA 2DFKB 1F4KA 3WODF 1HKTA 3KP2A 3FWEA
chains in the Genus database with same CATH superfamily
1H2WA 4M0CA 4LWQA 2VQCA 4NSRA 3O8OA 3OX3A 3ZZUA 1XKQA 1AIPA 4GZ3A 5L51A 2CMGA 1ZI9A 2HKXA 4JC4A 3KB8A 4HWTA 5HIJA 3KSBC 1M1UA 4A8JC 3B3FA 2UUAB 1S0UA 3DZJA 2CVZA 1OLXA 3RGSA 1E3WA 3L8EA 2WVGA 4D6PA 3SFZA 2XUJA 1O1YA 2OZEA 3CC7I 5EL0A 4H59A 1Z2DA 4CM8B 1ONSA 3CQ9A 1Q3KA 3F98A 3E9QA 3Q2IA 3ZI0A 3E5XA 2ZJ6A 5IYZB 2OQ4A 3NRVA 2RQQA 5K3DA 4LE2A 4M86A 3V80A 5AW2A 3N2EA 4UCWA 2X4DA 3NDPA 1IJEA 3RF7A 3WWYA 1AQIA 2X9NA 1I1NA 1OT5A 3JQ6A 2A30A 1NSFA 3HR7A 2E5LB 4K9LA 3C7TA 1XVUA 2LTPA 4MINA 5DGTA 1B23P 3WWDA 4EEKA 3KPVA 3SHVA 2VSNA 3NDIA 4B5KA 5C7LO 5A2QS 1W7PD 4DSAA 4RQTA 3L9FA 1JLMA 3BMCB 3KP1A 1VTKA 3PXEA 5I9LA 3QYJA 1MXFA 3QA3E 4HTFB 2FXAA 5F7XA 1IRXA 4GZMA 3N70A 5BMZA 4PAOA 3KRTA 2BSXA 2OAGA 4OP2A 2RGGA 3LCCA 4M4SA 2C42A 4CL8A 4AD8A 2PKWA 3JX9A 3KYLA 4L22A 1NULA 2I2DA 3ZW9A 1Q1AA 3HKPA 4QJ3A 4N7RA 2YS7A 1OFHA 2NXNB 4CTMA 2AHQA 3CRNA 5FFXA 2A1TR 4QUKA 1QC5A 3BWEA 1G38A 1AMOA 3W6NA 2X8BA 5B1HA 2OOAA 2BE9A 4GPTA 3MTIA 2VKHA 4FQ8A 2F4VM 1Q92A 1FMFA 4ARCA 4A9AA 3DC7A 4DQLA 1DMRA 3KAKA 1C7QA 1EMDA 4C2AA 3AH8A 4CLOB 1NR1A 4M46A 4X64B 1SIUA 1VIVA 1AURA 2H1LA 3UK1A 1UAAA 1V9SA 3ZHTA 4Z5XA 4EY6A 3H2SA 3WGYA 4UJ3A 1OCOH 2GF2A 3OQBA 5CJPA 2HSJA 3FAZA 1G5PA 2R7RA 4J76A 3HA7A 2PQ2A 2L18A 3KL2A 4OA5A 1N6PA 3H9CA 3UUEA 4WKOA 1LVHA 3NXKA 5KO3A 5IVIA 3R3ZA 2KPOA 4RK4A 4AY5A 4DWOA 1SURA 2COUA 2OYRA 1YAHA 1JEOA 5SZHB 4Q3BA 5CCDA 4G6QA 1WJAA 2D4HA 2AE1A 1DGHA 4XIDA 5EIBC 4YALA 2QP3A 3O21A 5C1IA 2VB6A 2CB0A 3ZCVA 4RMJA 2Q49A 4TTTS 2IXBA 3REGA 4BC0A 3RS2A 3UTCA 1FDRA 3B1WA 2F55A 4XLAA 1ZUD1 1THZA 1NP3A 3K2EA 4HL4A 4PG7A 3JAKB 3HGQA 2O8VA 5BQFA 2I5UA 1X9HA 1UP6A 5LXTB 3DEKA 1Y9AA 3B1VA 3ZCSA 1DV1A 2I2BA 4YJDA 1RMQA 4LK2A 4B7ZA 1JKXA 3OPYA 4GX5A 1J00A 3H1EA 4JSRA 4FC6A 4CEHA 3TM4A 3K4HA 5PGMA 2K4BA 4BE4A 1U3FA 2WU1A 1PBTA 4L73A 2G40A 3ZX4A 1FT9A 1U8AA 4CCKA 1XVIA 4L8WB 2VJOA 5DLPA 3KT0A 2CXQA 1MMFB 5CLGA 6GPBA 3QE2A 2XT6A 5LP6F 1D1SA 2F59A 4E5SA 1SEVA 3E23A 3AM3A 4JK1X 2UXBM 2I65A 1VOTA 2XMQA 1T36B 4J91A 2UUAM 5ANRB 4LYDA 4JXJA 3SP1A 2HNHA 2WVJA 4QXQA 1MIOA 1SHKA 2Y6VA 4M3EA 3PD7A 1OJ7A 4TMWA 3T4PA 2ZTCA 4A8JB 1FVFA 5L3EA 1I27A 2ZYTX 1OU4A 4ZO6A 3S3MA 2QB5A 4RSRA 5EXDA 4G8JA 2PO5A 2V98A 4JBGA 1KH1A 3D0RA 1V96A 1BE8A 4UTRA 3RTDA 4BQSA 3GF4A 1MAWA 2WT9A 3HHEA 3HB4X 4YUAA 1XZNA 2ZVDA 1X1AA 4QNMA 5AJHA 5TVKA 3ZC7B 4WXHA 2Q2EB 5AXBA 3R0IA 3F6VA 2KHZA 1AUAA 1L5QA 4YUYA 5HNFA 4M8LA 2YWDA 3AG2H 1Q3TA 1E89A 4X93A 3V8JA 3P9ZA 1YSYA 1PGNA 3P2KA 3OT1B 1XWFA 4DWWA 3QYEA 4WL0A 2PUVA 2E6KA 2ZO4A 5JAIA 2VH1A 2B35A 4G84A 3WZ2A 1BC7C 2YHSA 2QE7A 1QKKA 4ZYAA 4JBAA 3HVJA 5J8CA 1AA9A 2OG2A 5T3UA 4MS3B 4IDBA 5IAEA 3H5WA 4CMJA 2PMUA 2R7VA 1U1GA 4RS8A 5GONA 4Q7QA 3ITKA 2REQA 4BAZA 2X2EA 4YT2A 1GHCA 4HVAA 4TSFD 4JBYA 4W9MC 5JJ5A 1M2VA 3ESBA 2CHVA 3PDHA 4YDSA 4TVKA 1Z36A 4RSHA 3GLSA 4XK4A 3PNLA 4ZHQA 4P3OA 4F4JA 3NTOA 3LOQA 1H8AC 4IIJB 2P5UA 1S9HA 2YPRA 3K9FC 3WGIA 1QU3A 3NRJA 3LZDA 4IKOA 4V02A 2LR0A 1L1RA 1K08A 4J7AA 4IX9A 4AZFA 4Y52J 1BW9A 5E3HA 4MX8A 3VTKA 3C8ZA 5LA6B 4HGOA 1KAOA 5ICCA 1VFNA 3DDHA 4XKWA 1TKCA 1NW5A 3ZV5A 4YREA 2X9GA 5FBVB 2Z8YA 2CFOA 4ZP1A 4UMDA 4EGJA 1MJ9A 1ZESA 4EPWA 2CFSA 1J5EM 3UJBA 2OQIA 3FHZA 2ASEA 3E27A 3N2GB 3MCWA 3TK1A 4JYKA 2ACWA 5D5QA 3PF8A 4LC9A 4NARA 4C7JA 3CMCO 3OF2A 5EIHA 1U9YA 2CVQA 2HCRA 2OR3A 1DI0A 3W90A 4QHYA 2RGDA 3EPKA 1Z4PX 2DR2A 4LVOA 3HGIA 3C0KA 2IZOA 5FLKA 3H5RA 1A77A 1VB5A 4LRWA 3VVLA 2H4ZA 1RKUA 10MHA 4L6AA 1TJ4A 3ADCA 3BA1A 3K9BA 4TROA 2AOVA 2DZNB 3KKLA 3UKGA 4P1WA 4B3MB 2IBMA 5LOVB 3FKEA 5C8DA 4YCJA 3B1JA 4DUZM 5B7PA 2PWZA 1R0SA 3CZ4A 1C4WA 4GS5A 4QUHA 3DBLB 3WDKA 3I12A 3L6EA 3T5CA 3ZR8X 4BO4A 2CZGA 1ZDMA 3MYYA 5H83A 2JFPA 2W6JA 4ZTZB 1V5FA 4IIEA 3RVPA 1VI0A 2REBA 5F52A 4ZT5A 3HLYA 1Q1VA 3BC8A 3BGIA 4MW7A 3B5EA 5DNAA 4NJOA 3GIWA 2CHGA 1Q7GA 3C8UA 4PC2A 4M76B 3RC3A 4DQKA 3GZ5A 2GZDA 4CCJA 1F06A 4YI5A 3A4MA 4W5RA 3P96A 3BULA 3V7RA 5G0VA 3ZBPA 1DRKA 2IU4A 5HNKA 4RABA 1Z5VA 4JCOA 5JNUA 1SFUA 4LTDA 3ZR4B 1K3XA 4LFBB 3LS2A 1KK3A 4AIDA 5KWSA 1D1QA 4FFNA 5BY2A 3OWOA 4B31A 3LE8A 1H0RA 5IYCJ 4CI9A 1GEEA 1XKXA 2BFBB 3QVLA 4IIFA 3C8MA 4AICA 5EYPB 4JLJA 4FZRA 2XZUA 3IP8A 1GAWA 2HXIA 1NHWC 4OO3A 3IHWA 1WGLA 4BFXA 1P7WA 4GBGA 1YOBA 1A9XB 3K10A 5I8PA 3COSA 4UHJA 2QVOA 4R9RA 1CD5A 3I01A 2J3EA 5IKMA 4P0TA 3HJ8A 1ZCJA 2GXAA 1N0IA 2NS7A 3BG3A 1J0BA 4XDGA 3RAGA 2GPWA 2Q46A 1TCUA 5UKDA 1KP2A 2NYUA 3IEPA 5LP6C 3PVZA 1VG1A 4F85A 5JRZA 3RJMA 1N5JA 4C6TB 5I7UA 4FCTA 2V1CA 1UXHA 3I9V6 2ZB3A 1U3DA 3PX3A 4BGEA 2K2WA 4Y8VA 4DL9A 2Y1XA 4O0LA 3GTKJ 1ICIA 4RB0A 3C4JA 1P5ZB 1EFRA 1QIEA 121PA 3A1FA 5FJ8J 3JWHA 3E7DA 5C81A 1XMAA 2MW8A 1WD5A 2J5OA 3Q0TA 2V6MA 2DWNA 5C1PA 1V11A 1QO0A 4IKPA 4JR1A 1Q1QA 6YASA 4QSHA 2AFIA 1V41E 3HR4A 4N03A 2BRUA 4S3MA 3NASA 1JDUA 1DU0A 2OCYC 5LB4A 2BZTA 4M1EA 5C35A 5IKOA 4Q7LA 5B1BH 5A9RA 1XCBA 4BVHA 1FDTA 1KVRA 4ZCTA 3DBVO 3KKZA 3SZOA 1T3LA 3HVHA 5B1IA 1Q5PA 2QMEA 3RS9A 3AP3A 4A8HA 1Y3HA 2GFIA 1CP2A 4KXNA 1SH7A 3TUJC 4ZQHA 1AZSC 2ZROA 4Q9HA 2HRCA 1YA8A 4B2PA 3F2VA 1OX5A 4EPYA 3K9WA 4JX5A 2DLNA 1YGYA 2CW5A 1LE8B 3IVRA 4GNRA 2IHNA 3L04A 3KKQA 3VO9A 2GF9A 4GDFA 3KALA 3R3WA 1EE2A 1OASA 2I91A 2J4FA 5JNSA 4X97A 1OBVA 1QU2A 1UF9A 4R8HA 5JVGF 4ZTFA 4BO3A 4LDQA 4LX0A 1ZA1A 2DZLA 1B16A 2ZJ5A 2YVAA 1NQOA 1AKWA 4PDIA 4B4UA 3AVWA 3RJZA 1E94E 3K20A 3KQKA 3G2IA 1E92A 2FGKA 3V2UA 3FBGA 2RIRA 3IPXA 5C8ZA 1YFHA 3HFRA 4Y2HA 1OCZH 3JW4A 3CVUA 1Y7PA 2OCCH 4G3OA 2WT4A 2ZXWH 2QSJA 1V4VA 2XUZA 3U9TA 5J2UB 3A4CA 2I2CA 3LK7A 3AR3A 5B53A 2ADOA 4EJSA 1CUIA 1T5IA 1TKBA 5HCUA 2CQNA 3WLLA 3ZE9A 2R46A 2B0CA 3DA1A 1HDRA 1IBKM 3JVEA 5G0SA 5BN5A 3DKVA 1HGXA 1DGHB 3OHMA 1NRWA 2LGJA 1T5LA 1T9AA 1Q0UA 4MDFA 4FDTA 3V33A 1E6KA 4G1FA 3CNHA 1HC7A 2L9VA 1U28A 3K8YA 1DP7P 3VX4A 2H0QA 3H2KA 2HHHB 4CR6A 1U5TC 3RFTA 1H88C 3NWJA 4DNPA 2Q9UA 2RAUA 4F55A 3KEOA 1F5SA 3P71T 2ORWA 1RBZA 3HZZA 3IBYA 3QKUA 3BP8A 1JXAA 4KVFA 1G71A 4AJEA 4XX1A 5EJ5A 3T7TA 5FYQA 3BY6A 1L0BA 1V6CA 1S2IA 1XJ5A 3VHLB 2IPOA 1KORA 3G2KA 1CWUA 4NZ9A 2WFZA 3SHTA 3TL3A 5A3RA 1XN7A 1T4GA 4HNAA 4IJFA 4ANFA 2C7QA 4BNYA 3KU1A 2BZ1A 4HAWA 4UJ5A 1ECPA 4GD3Q 1R6UA 4O5OA 3PRJA 4YC7A 3ZVKA 5JSYA 3AC0A 3OBBA 2C59A 4IIUA 2PTGA 3D0KA 4ENMA 4ZDKA 3FZVA 2V0NA 1AXGA 1U2ZA 3DWIA 4QVGA 2Y1FA 4CIAA 4KPGA 2BE5F 2DA5A 4AK9A 1X8XA 2YHIA 4YCMA 4YY3B 5TS2A 3QJ5A 1GRCA 4TXLA 221PA 5CT4A 4MWTA 3MWYW 1KAEA 5FQOA 1F17A 1YQEA 2EA2A 3WVNA 2QY6A 4ZRNA 1KI6A 2QUFA 4IDGA 4HGNA 2DOAA 4E7OA 1ODFA 2IJLA 3QITA 1Z4LA 2LRHA 4HLXA 1XNRB 1MRNA 2GFQA 4KXUA 3WMRA 1QAMA 4B2LA 4F11A 5TT0A 2G0NA 1Z2PX 2Q2VA 2ZU0C 4NQWA 1RRCA 3GCZA 2HAEA 2HKIA 4J03A 2GARA 1W0CA 2GPAA 2GCIA 4U02A 2AL7A 4P16A 1E2GA 1HQDA 5IAKA 2AT1A 5ALWA 2WSSD 4D9EA 3B52X 4P7FA 4BFWA 4C4PA 4RJKA 1RWQA 4YFNF 4LQCA 2PNJA 2QXYA 5FDFA 2J9XB 3FM9A 4TS1A 4BECA 1LKZA 2JI4A 2HL6A 2OFXA 3WTWC 3ON5A 1D9ZA 2GOYA 2VEOA 1SHZA 1G8PA 3GMEA 2JSCA 1MW8X 1MORA 2RRUA 1FFGA 1YJNI 3EUAA 3BZCA 4DV0B 2BRUC 2FA5A 4MW1A 3FZNA 2L82A 2DJNA 3REFA 2F3UA 3R5JA 4N3BA 3DAHA 3LBYA 3HI6A 4LRSB 3UJCA 2E89A 2CF6A 4EO7A 5CDFE 5JXGA 3R4KA 3BEDA 1KDPA 1BROA 2G7MC 3QW2A 3D7NA 4DLSA 5LA6A 4X3PA 2CHEA 1FMLA 2FU5C 2GH1A 4OGGA 1XMXA 2Q5OA 3GRCA 5GJVC 1ENPA 1RXIA 4CMHA 5J5CA 1URPA 3JSAA 3RUDA 1JKPC 3C5HA 4CE6A 1IQUA 5H0IA 4TYMA 5DNUA 2WMOB 4JBXA 1DGRM 5M5WJ 2WHXA 4KQGA 4BU1A 2JP7A 3HDVA 3OZTA 4C0HA 1RDFA 1TDZA 1T8RA 3F47A 5DOVA 1RWKA 3WWZA 1R6AA 3QK7A 3BK2A 2DT5A 3TTYA 4BLVA 1TYDE 2HKJA 2H17A 3PXGA 5CK5A 3THYA 3FHTA 2IEBA 5ALRA 3HWSA 1Z38A 3MVEA 3EWIA 1Q22A 4ACAA 3QVSA 3BG7A 3EYAA 3CN9A 3CO5A 2WMYA 1G6OA 2ZB2A 4HS4A 4ZTJA 2OCPA 5HE8A 3PQCA 2XA1A 4WMLA 2ZMEB 1T9BA 2G76A 3LFTA 1XCPA 4FLMA 4IBKA 4GI7A 4BLRA 4EJ0A 2QQ0A 3DBLA 3FNQA 4BEHA 3MN2A 5K03A 2JUJA 1Y6JA 4XZ3A 1W7AA 3AKDA 4F0JA 1P6QA 3GT3A 2EX0A 1W581 1QCDA 2XGDA 1KWKA 3HKZN 5ENVA 2BLNA 2Z3WA 4NV0A 1HE1C 4B6JA 2CXXA 3PK0A 1NYRA 4MI9A 4RFVA 3L02A 4OX9M 3HP1A 1SMYF 1TRKA 2EQAA 2LXNA 4AW4A 4MKXA 3G7NA 3DFKA 1M76A 1YSCA 3C3EA 3VO1A 1E58A 1F43A 1HSOA 4HDUA 4ZV9A 4A3FJ 4C30A 2XQIA 1ZLYA 3MLEA 3QU6A 2BP7B 4DSUA 2FPKA 1Z56C 2HJRA 4LE0A 2CWWA 4IICA 3HFJA 5D6FA 3ANLA 1ZOLA 5BWNA 3Q87B 5P21A 3IIIA 1T5TA 3LHSA 2P8TA 3L5OA 4JV5M 1QA6A 2P67A 3RYCB 2V0CA 4BO6A 1XB4A 3HJHA 5HVNA 1IE3A 3RGGA 1Y3DE 1QZXA 1U2PA 1PNOA 1LRKA 2FSHA 3EDPA 1W0JD 1RM4A 4X6YA 1W96A 3FE3A 2XNJA 4FTWA 3LECA 1MHTA 3LL4A 2OORC 3BL8A 3GDWA 3Q0IA 4AWAA 3DMGA 1JECA 1OU0A 1KH2A 5E3OA 1LNSA 5E0KB 4M9SA 3WTZA 5J8FA 4L9SA 2J4DA 1XR3A 1FXWF 5CG2A 3M6WA 3TCXB 3T1YM 1PX0A 1GHTA 5F77A 4QGSA 1SHTX 1ZNZA 2ECCA 2V9ZA 1NI4B 1T36A 1KO1A 4LSMA 2IL1A 1M5RA 2JFYA 2V59A 5DE3A 3ZIUA 1W49A 4TS4A 3RFXA 5ALTA 2OL4A 1ZGAA 4IKEA 3WX0A 1AB5A 1YH3A 1JUSA 3ZWDA 1TTQB 4G24A 2YYZA 4HPJB 1DRVA 3DEHA 4HA8A 1HG0A 2QAGB 3V3KA 5LZ9A 2WTEA 4I8XA 6ABPA 4FHTA 5GPCA 2QVBA 3OIYA 1NR5A 1EA3A 1S3FA 5KS2A 2K3FA 4QOZC 3USCS 2OV3A 3CJQB 2J5BA 5FKOA 3SWWA 2WNSA 1EUDB 2GHIA 2R6CA 4QPDA 4KR6A 1RMTA 1M6YA 2ZBRA 4PLFA 4C5BA 4GXOA 2XCIA 5T57A 4W8GA 3FXMA 1JAHA 3W5UA 4FCYA 1Z5WA