1W60A

Native human pcna
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
255
structure length
255
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Studies of Human Proliferating Cell Nuclear Antigen Complexes Provide a Rationale for Cyclin Association and Inhibitor Design
pubmed doi rcsb
molecule keywords PROLIFERATING CELL NUCLEAR ANTIGEN
molecule tags Dna binding protein
source organism Homo sapiens
total genus 52
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 1w60A00
1PLRA 5IY4A 1IZ4A 1GE8A 3G65A 2ZVLA 2IJXA 3GGRA 5DA7A 1IZ5A 2ZVKA 3FDSD 2IO4A 1U7BA 5AUJA 2ZVMA 3AIXA 2ZVWA 3AIZC 3G65B 4L6PA 2IZOB 3HI8A 2IX2C 3GGRB 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 3TBLA 3GPMA 2IO4B 2NTIA 2Z0LA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 2HIKC 3I2MX 2NTIB 4YHRA 3P91A 1B77A 1W60A 3LX1A 3V60B 1B8HA 2IX2A 3IFVA 2HIIA 3K4XA 5DAIA 3LX2A 5IWDA 2AWAA 3A2FB 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 5A6DA 5IXAA 4CS5A 3V61B 3G65C 4L60A 1VYJA 3VKXA 3A1JA 2IX2B 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 5JNED 5E0UA 5E0TA 3WGWA 1RXZA 3GPNA 1AXCA 1U76A 4D2GA 1YYPA 3A1JB 4ZTDA 5E0VA 3P83A 5HACA 4RJFA 5B7OA 3FDSC 3F1WA 3HSLX 1DMLA 1UD9A 4TR6A
chains in the Genus database with same CATH superfamily
1PLRA 5IY4A 1IZ4A 1GE8A 3G65A 2ZVLA 2IJXA 3GGRA 5DA7A 1IZ5A 2ZVKA 3FDSD 2IO4A 1U7BA 5AUJA 2ZVMA 3AIXA 2ZVWA 3AIZC 3G65B 4L6PA 2IZOB 3HI8A 2IX2C 3GGRB 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 3TBLA 3GPMA 2IO4B 2NTIA 2Z0LA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 2HIKC 3I2MX 2NTIB 4YHRA 3P91A 1B77A 1W60A 3LX1A 3V60B 1B8HA 2IX2A 3IFVA 2HIIA 3K4XA 5DAIA 3LX2A 5IWDA 2AWAA 3A2FB 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 5A6DA 5IXAA 4CS5A 3V61B 3G65C 4L60A 1VYJA 3VKXA 3A1JA 2IX2B 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 5JNED 5E0UA 5E0TA 3WGWA 1RXZA 3GPNA 1AXCA 1U76A 4D2GA 1YYPA 3A1JB 4ZTDA 5E0VA 3P83A 5HACA 4RJFA 5B7OA 3FDSC 3F1WA 3HSLX 1DMLA 1UD9A 4TR6A
chains in the Genus database with same CATH topology
1PLRA 5IY4A 1IZ4A 1GE8A 3G65A 2ZVLA 2IJXA 3GGRA 5DA7A 1IZ5A 2ZVKA 3FDSD 2IO4A 1U7BA 5AUJA 2ZVMA 3AIXA 2ZVWA 3AIZC 3G65B 4L6PA 2IZOB 3HI8A 2IX2C 3GGRB 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 3TBLA 3GPMA 2IO4B 2NTIA 2Z0LA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 2HIKC 3I2MX 2NTIB 4YHRA 3P91A 1B77A 1W60A 3LX1A 3V60B 1B8HA 2IX2A 3IFVA 2HIIA 3K4XA 5DAIA 3LX2A 5IWDA 2AWAA 3A2FB 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 5A6DA 5IXAA 4CS5A 3V61B 3G65C 4L60A 1VYJA 3VKXA 3A1JA 2IX2B 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 5JNED 5E0UA 5E0TA 3WGWA 1RXZA 3GPNA 1AXCA 1U76A 4D2GA 1YYPA 3A1JB 4ZTDA 5E0VA 3P83A 5HACA 4RJFA 5B7OA 3FDSC 3F1WA 3HSLX 1DMLA 1UD9A 4TR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLR A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  2ZVL A;  2IJX A;  3GGR A;  5DA7 A;  1IZ5 A;  2ZVK A;  3FDS D;  2IO4 A;  1U7B A;  5AUJ A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  3G65 B;  4L6P A;  2IZO B;  3HI8 A;  2IX2 C;  3GGR B;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  3TBL A;  3GPM A;  2IO4 B;  2NTI A;  2Z0L A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  2HIK C;  3I2M X;  2NTI B;  4YHR A;  3P91 A;  1B77 A;  1W60 A;  3LX1 A;  3V60 B;  1B8H A;  2IX2 A;  3IFV A;  2HII A;  3K4X A;  5DAI A;  3LX2 A;  5IWD A;  2AWA A;  3A2F B;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  5A6D A;  5IXA A;  4CS5 A;  3V61 B;  3G65 C;  4L60 A;  1VYJ A;  3VKX A;  3A1J A;  2IX2 B;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  5JNE D;  5E0U A;  5E0T A;  3WGW A;  1RXZ A;  3GPN A;  1AXC A;  1U76 A;  4D2G A;  1YYP A;  3A1J B;  4ZTD A;  5E0V A;  3P83 A;  5HAC A;  4RJF A;  5B7O A;  3FDS C;  3F1W A;  3HSL X;  1DML A;  1UD9 A;  4TR6 A; 
#chains in the Genus database with same CATH topology
 1PLR A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  2ZVL A;  2IJX A;  3GGR A;  5DA7 A;  1IZ5 A;  2ZVK A;  3FDS D;  2IO4 A;  1U7B A;  5AUJ A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  3G65 B;  4L6P A;  2IZO B;  3HI8 A;  2IX2 C;  3GGR B;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  3TBL A;  3GPM A;  2IO4 B;  2NTI A;  2Z0L A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  2HIK C;  3I2M X;  2NTI B;  4YHR A;  3P91 A;  1B77 A;  1W60 A;  3LX1 A;  3V60 B;  1B8H A;  2IX2 A;  3IFV A;  2HII A;  3K4X A;  5DAI A;  3LX2 A;  5IWD A;  2AWA A;  3A2F B;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  5A6D A;  5IXA A;  4CS5 A;  3V61 B;  3G65 C;  4L60 A;  1VYJ A;  3VKX A;  3A1J A;  2IX2 B;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  5JNE D;  5E0U A;  5E0T A;  3WGW A;  1RXZ A;  3GPN A;  1AXC A;  1U76 A;  4D2G A;  1YYP A;  3A1J B;  4ZTD A;  5E0V A;  3P83 A;  5HAC A;  4RJF A;  5B7O A;  3FDS C;  3F1W A;  3HSL X;  1DML A;  1UD9 A;  4TR6 A; 
#chains in the Genus database with same CATH homology
 1PLR A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  2ZVL A;  2IJX A;  3GGR A;  5DA7 A;  1IZ5 A;  2ZVK A;  3FDS D;  2IO4 A;  1U7B A;  5AUJ A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  3G65 B;  4L6P A;  2IZO B;  3HI8 A;  2IX2 C;  3GGR B;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  3TBL A;  3GPM A;  2IO4 B;  2NTI A;  2Z0L A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  2HIK C;  3I2M X;  2NTI B;  4YHR A;  3P91 A;  1B77 A;  1W60 A;  3LX1 A;  3V60 B;  1B8H A;  2IX2 A;  3IFV A;  2HII A;  3K4X A;  5DAI A;  3LX2 A;  5IWD A;  2AWA A;  3A2F B;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  5A6D A;  5IXA A;  4CS5 A;  3V61 B;  3G65 C;  4L60 A;  1VYJ A;  3VKX A;  3A1J A;  2IX2 B;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  5JNE D;  5E0U A;  5E0T A;  3WGW A;  1RXZ A;  3GPN A;  1AXC A;  1U76 A;  4D2G A;  1YYP A;  3A1J B;  4ZTD A;  5E0V A;  3P83 A;  5HAC A;  4RJF A;  5B7O A;  3FDS C;  3F1W A;  3HSL X;  1DML A;  1UD9 A;  4TR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...