1W61A

Proline racemase in complex with 2 molecules of pyrrole-2-carboxylic acid (holo form)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
353
structure length
353
Chain Sequence
FKKSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFLFDPIEEGADLGIVFMDTGGYLNMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLDTPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVVLPKPYGEVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGFNTMLFDPTDPFKNGFTLKQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure,Catalytic Mechanism and Mitogenic Properties of Trypanosoma Cruzi Proline Racemase
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Racemase
molecule keywords B-CELL MITOGEN
total genus 95
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 5.1.1.4: Proline racemase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w61A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w61A01
1W62A 2GKEA 1BWZA 1YM5A 3EKMA 2AZPA 1TM0A 3FVEA 1U0KA 4IJZA 2Q9JA 4Q60A 5M47A 1S7JA 1GQZA 2H9FA 1QY9A 2Q9HA 3EJXA 1XUBA 2PW0A 4JBDA 4JCIA 4DUNA 4LB0A 5H2GA 5HA4A 4J9XA 3EDNA 4JUUA 4JD7A 4Q2HA 5H2YA 4K7XA 1W61A 4K7GB 2GKJA 1XUAA 2OTNA 1QYAA 3G7KA 1U1VA 1U1XA 1U1WA 4J9WA 2PVZA 4K8LA 4IK0A 1SDJA 5IWEA 1T6KA
chains in the Genus database with same CATH superfamily
1YM5A 3PVHA 3FVEA 1U0KA 4IJZA 1GQZA 2QB7A 4DUNA 4LB0A 2KW7A 3G98A 3WQZA 4JD7A 3IGHX 4OA3A 1U1WA 3DEVA 4J9WA 4IK0A 1W62A 3EKMA 1TM0A 2QB8A 5ANPA 4Q60A 2ENXA 5M47A 1WPPA 2PW0A 2ZXOA 3PTJA 5HA4A 1I74A 4K7GB 1U1XA 4K8LA 5IWEA 1WPMA 2GKEA 1BWZA 1S7JA 2H9FA 1QY9A 3EJXA 2EB0A 4JBDA 1K20A 2HAWA 4JUUA 3W5WA 4K7XA 4GL6A 2GKJA 1XUAA 2ZXRA 1U1VA 2ZVFA 2PVZA 2LT2A 2IW4A 3ICJA 2AZPA 2Q9JA 2MPBA 1K23A 2YMAA 2Q9HA 1IR6A 2QB6A 4LG3A 1XUBA 4JCIA 2ZXPA 4PY9A 5H2GA 4J9XA 4LS9A 3EDNA 4RPAA 4Q2HA 5H2YA 3PW9A 1W61A 2KPTA 2OTNA 1QYAA 3G7KA 1SDJA 1T6KA
chains in the Genus database with same CATH topology
1YM5A 3PVHA 3FVEA 1U0KA 4IJZA 1GQZA 2QB7A 4DUNA 4LB0A 2KW7A 3G98A 3WQZA 4JD7A 3IGHX 4OA3A 1U1WA 3DEVA 4J9WA 4IK0A 1W62A 3EKMA 1TM0A 2QB8A 5ANPA 4Q60A 2ENXA 5M47A 1WPPA 2PW0A 2ZXOA 3PTJA 5HA4A 1I74A 4K7GB 1U1XA 4K8LA 5IWEA 1WPMA 2GKEA 1BWZA 1S7JA 2H9FA 1QY9A 3EJXA 2EB0A 4JBDA 1K20A 2HAWA 4JUUA 3W5WA 4K7XA 4GL6A 2GKJA 1XUAA 2ZXRA 1U1VA 2ZVFA 2PVZA 2LT2A 2IW4A 3ICJA 2AZPA 2Q9JA 2MPBA 1K23A 2YMAA 2Q9HA 1IR6A 2QB6A 4LG3A 1XUBA 4JCIA 2ZXPA 4PY9A 5H2GA 4J9XA 4LS9A 3EDNA 4RPAA 4Q2HA 5H2YA 3PW9A 1W61A 2KPTA 2OTNA 1QYAA 3G7KA 1SDJA 1T6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W62 A;  2GKE A;  1BWZ A;  1YM5 A;  3EKM A;  2AZP A;  1TM0 A;  3FVE A;  1U0K A;  4IJZ A;  2Q9J A;  4Q60 A;  5M47 A;  1S7J A;  1GQZ A;  2H9F A;  1QY9 A;  2Q9H A;  3EJX A;  1XUB A;  2PW0 A;  4JBD A;  4JCI A;  4DUN A;  4LB0 A;  5H2G A;  5HA4 A;  4J9X A;  3EDN A;  4JUU A;  4JD7 A;  4Q2H A;  5H2Y A;  4K7X A;  1W61 A;  4K7G B;  2GKJ A;  1XUA A;  2OTN A;  1QYA A;  3G7K A;  1U1V A;  1U1X A;  1U1W A;  4J9W A;  2PVZ A;  4K8L A;  4IK0 A;  1SDJ A;  5IWE A;  1T6K A; 
#chains in the Genus database with same CATH topology
 1YM5 A;  3PVH A;  3FVE A;  1U0K A;  4IJZ A;  1GQZ A;  2QB7 A;  4DUN A;  4LB0 A;  2KW7 A;  3G98 A;  3WQZ A;  4JD7 A;  3IGH X;  4OA3 A;  1U1W A;  3DEV A;  4J9W A;  4IK0 A;  1W62 A;  3EKM A;  1TM0 A;  2QB8 A;  5ANP A;  4Q60 A;  2ENX A;  5M47 A;  1WPP A;  2PW0 A;  2ZXO A;  3PTJ A;  5HA4 A;  1I74 A;  4K7G B;  1U1X A;  4K8L A;  5IWE A;  1WPM A;  2GKE A;  1BWZ A;  1S7J A;  2H9F A;  1QY9 A;  3EJX A;  2EB0 A;  4JBD A;  1K20 A;  2HAW A;  4JUU A;  3W5W A;  4K7X A;  4GL6 A;  2GKJ A;  1XUA A;  2ZXR A;  1U1V A;  2ZVF A;  2PVZ A;  2LT2 A;  2IW4 A;  3ICJ A;  2AZP A;  2Q9J A;  2MPB A;  1K23 A;  2YMA A;  2Q9H A;  1IR6 A;  2QB6 A;  4LG3 A;  1XUB A;  4JCI A;  2ZXP A;  4PY9 A;  5H2G A;  4J9X A;  4LS9 A;  3EDN A;  4RPA A;  4Q2H A;  5H2Y A;  3PW9 A;  1W61 A;  2KPT A;  2OTN A;  1QYA A;  3G7K A;  1SDJ A;  1T6K A; 
#chains in the Genus database with same CATH homology
 1YM5 A;  3PVH A;  3FVE A;  1U0K A;  4IJZ A;  1GQZ A;  2QB7 A;  4DUN A;  4LB0 A;  2KW7 A;  3G98 A;  3WQZ A;  4JD7 A;  3IGH X;  4OA3 A;  1U1W A;  3DEV A;  4J9W A;  4IK0 A;  1W62 A;  3EKM A;  1TM0 A;  2QB8 A;  5ANP A;  4Q60 A;  2ENX A;  5M47 A;  1WPP A;  2PW0 A;  2ZXO A;  3PTJ A;  5HA4 A;  1I74 A;  4K7G B;  1U1X A;  4K8L A;  5IWE A;  1WPM A;  2GKE A;  1BWZ A;  1S7J A;  2H9F A;  1QY9 A;  3EJX A;  2EB0 A;  4JBD A;  1K20 A;  2HAW A;  4JUU A;  3W5W A;  4K7X A;  4GL6 A;  2GKJ A;  1XUA A;  2ZXR A;  1U1V A;  2ZVF A;  2PVZ A;  2LT2 A;  2IW4 A;  3ICJ A;  2AZP A;  2Q9J A;  2MPB A;  1K23 A;  2YMA A;  2Q9H A;  1IR6 A;  2QB6 A;  4LG3 A;  1XUB A;  4JCI A;  2ZXP A;  4PY9 A;  5H2G A;  4J9X A;  4LS9 A;  3EDN A;  4RPA A;  4Q2H A;  5H2Y A;  3PW9 A;  1W61 A;  2KPT A;  2OTN A;  1QYA A;  3G7K A;  1SDJ A;  1T6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...