1W61A

Proline racemase in complex with 2 molecules of pyrrole-2-carboxylic acid (holo form)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
353
structure length
353
Chain Sequence
b'FKKSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFLFDPIEEGADLGIVFMDTGGYLNMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLDTPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVVLPKPYGEVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGFNTMLFDPTDPFKNGFTLKQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-CELL MITOGEN
publication title Crystal Structure,Catalytic Mechanism and Mitogenic Properties of Trypanosoma Cruzi Proline Racemase
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Racemase
total genus 95
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 5.1.1.4: Proline racemase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w61A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w61A01
4IJZA 4DUNA 1U1WA 4JBDA 1BWZA 5H2YA 4Q2HA 4JD7A 1YM5A 5IWEA 1W61A 1XUAA 4JUUA 2H9FA 4Q60A 2PW0A 3EJXA 2GKJA 4JCIA 5HA4A 3FVEA 1U1VA 1XUBA 1QY9A 2Q9JA 4K7GB 1QYAA 2Q9HA 1S7JA 5M47A 5H2GA 3EKMA 1TM0A 1U0KA 2OTNA 2AZPA 4K7XA 1SDJA 4J9WA 2PVZA 1T6KA 1W62A 3G7KA 4IK0A 4K8LA 3EDNA 1U1XA 4LB0A 2GKEA 1GQZA 4J9XA
chains in the Genus database with same CATH superfamily
4DUNA 1U1WA 4JUUA 4OA3A 3FVEA 2ENXA 2EB0A 1I74A 3PTJA 1QYAA 1S7JA 5M47A 5H2GA 3EKMA 1TM0A 2AZPA 2ZXOA 2KW7A 1SDJA 2KPTA 4IK0A 4JBDA 2IW4A 2LT2A 4Q2HA 4JD7A 1W61A 1XUAA 4RPAA 3EJXA 3IGHX 4GL6A 2ZVFA 3DEVA 5HA4A 1U1VA 2QB8A 1IR6A 4K7GB 4PY9A 1U0KA 2OTNA 4K7XA 2YMAA 1T6KA 1W62A 1WPPA 4LB0A 5H2YA 1YM5A 4Q60A 2H9FA 2PW0A 3ICJA 1K23A 4JCIA 4LG3A 1K20A 2QB7A 3G98A 1XUBA 2Q9JA 2Q9HA 1WPMA 2ZXRA 3PVHA 2HAWA 2MPBA 5ANPA 4IJZA 1BWZA 3PW9A 5IWEA 2ZXPA 3WQZA 2GKJA 3W5WA 1QY9A 4LS9A 4J9WA 2PVZA 4K8LA 3G7KA 3EDNA 1U1XA 2GKEA 1GQZA 4J9XA 2QB6A
chains in the Genus database with same CATH topology
4DUNA 1U1WA 4JUUA 4OA3A 3FVEA 2ENXA 2EB0A 1I74A 3PTJA 1QYAA 1S7JA 5M47A 5H2GA 3EKMA 1TM0A 2AZPA 2ZXOA 2KW7A 1SDJA 2KPTA 4IK0A 4JBDA 2IW4A 2LT2A 4Q2HA 4JD7A 1W61A 1XUAA 4RPAA 3EJXA 3IGHX 4GL6A 2ZVFA 3DEVA 5HA4A 1U1VA 2QB8A 1IR6A 4K7GB 4PY9A 1U0KA 2OTNA 4K7XA 2YMAA 1T6KA 1W62A 1WPPA 4LB0A 5H2YA 1YM5A 4Q60A 2H9FA 2PW0A 3ICJA 1K23A 4JCIA 4LG3A 1K20A 2QB7A 3G98A 1XUBA 2Q9JA 2Q9HA 1WPMA 2ZXRA 3PVHA 2HAWA 2MPBA 5ANPA 4IJZA 1BWZA 3PW9A 5IWEA 2ZXPA 3WQZA 2GKJA 3W5WA 1QY9A 4LS9A 4J9WA 2PVZA 4K8LA 3G7KA 3EDNA 1U1XA 2GKEA 1GQZA 4J9XA 2QB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJZ A;  4DUN A;  1U1W A;  4JBD A;  1BWZ A;  5H2Y A;  4Q2H A;  4JD7 A;  1YM5 A;  5IWE A;  1W61 A;  1XUA A;  4JUU A;  2H9F A;  4Q60 A;  2PW0 A;  3EJX A;  2GKJ A;  4JCI A;  5HA4 A;  3FVE A;  1U1V A;  1XUB A;  1QY9 A;  2Q9J A;  4K7G B;  1QYA A;  2Q9H A;  1S7J A;  5M47 A;  5H2G A;  3EKM A;  1TM0 A;  1U0K A;  2OTN A;  2AZP A;  4K7X A;  1SDJ A;  4J9W A;  2PVZ A;  1T6K A;  1W62 A;  3G7K A;  4IK0 A;  4K8L A;  3EDN A;  1U1X A;  4LB0 A;  2GKE A;  1GQZ A;  4J9X A; 
#chains in the Genus database with same CATH topology
 4DUN A;  1U1W A;  4JUU A;  4OA3 A;  3FVE A;  2ENX A;  2EB0 A;  1I74 A;  3PTJ A;  1QYA A;  1S7J A;  5M47 A;  5H2G A;  3EKM A;  1TM0 A;  2AZP A;  2ZXO A;  2KW7 A;  1SDJ A;  2KPT A;  4IK0 A;  4JBD A;  2IW4 A;  2LT2 A;  4Q2H A;  4JD7 A;  1W61 A;  1XUA A;  4RPA A;  3EJX A;  3IGH X;  4GL6 A;  2ZVF A;  3DEV A;  5HA4 A;  1U1V A;  2QB8 A;  1IR6 A;  4K7G B;  4PY9 A;  1U0K A;  2OTN A;  4K7X A;  2YMA A;  1T6K A;  1W62 A;  1WPP A;  4LB0 A;  5H2Y A;  1YM5 A;  4Q60 A;  2H9F A;  2PW0 A;  3ICJ A;  1K23 A;  4JCI A;  4LG3 A;  1K20 A;  2QB7 A;  3G98 A;  1XUB A;  2Q9J A;  2Q9H A;  1WPM A;  2ZXR A;  3PVH A;  2HAW A;  2MPB A;  5ANP A;  4IJZ A;  1BWZ A;  3PW9 A;  5IWE A;  2ZXP A;  3WQZ A;  2GKJ A;  3W5W A;  1QY9 A;  4LS9 A;  4J9W A;  2PVZ A;  4K8L A;  3G7K A;  3EDN A;  1U1X A;  2GKE A;  1GQZ A;  4J9X A;  2QB6 A; 
#chains in the Genus database with same CATH homology
 4DUN A;  1U1W A;  4JUU A;  4OA3 A;  3FVE A;  2ENX A;  2EB0 A;  1I74 A;  3PTJ A;  1QYA A;  1S7J A;  5M47 A;  5H2G A;  3EKM A;  1TM0 A;  2AZP A;  2ZXO A;  2KW7 A;  1SDJ A;  2KPT A;  4IK0 A;  4JBD A;  2IW4 A;  2LT2 A;  4Q2H A;  4JD7 A;  1W61 A;  1XUA A;  4RPA A;  3EJX A;  3IGH X;  4GL6 A;  2ZVF A;  3DEV A;  5HA4 A;  1U1V A;  2QB8 A;  1IR6 A;  4K7G B;  4PY9 A;  1U0K A;  2OTN A;  4K7X A;  2YMA A;  1T6K A;  1W62 A;  1WPP A;  4LB0 A;  5H2Y A;  1YM5 A;  4Q60 A;  2H9F A;  2PW0 A;  3ICJ A;  1K23 A;  4JCI A;  4LG3 A;  1K20 A;  2QB7 A;  3G98 A;  1XUB A;  2Q9J A;  2Q9H A;  1WPM A;  2ZXR A;  3PVH A;  2HAW A;  2MPB A;  5ANP A;  4IJZ A;  1BWZ A;  3PW9 A;  5IWE A;  2ZXP A;  3WQZ A;  2GKJ A;  3W5W A;  1QY9 A;  4LS9 A;  4J9W A;  2PVZ A;  4K8L A;  3G7K A;  3EDN A;  1U1X A;  2GKE A;  1GQZ A;  4J9X A;  2QB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...