1W62A

Proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
362
structure length
362
Chain Sequence
HQQKREIMRFKKSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFLFDPIEEGADLGIVFMDTGGYLNMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLDTPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVVLPKPYGEVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGFNTMLFDPTDPFKNGFTLKQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure, catalytic mechanism, and mitogenic properties of Trypanosoma cruzi proline racemase.
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Racemase
molecule keywords Proline racemase A
total genus 96
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 5.1.1.4: Proline racemase.
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w62A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w62A01
1W62A 1S7JA 2Q9HA 2OTNA 1U1WA 4JUUA 1SDJA 3FVEA 4K7GB 5HA4A 4K7XA 4DUNA 4JBDA 1XUBA 4J9XA 5H2YA 2PVZA 2AZPA 4J9WA 4LB0A 1BWZA 2GKEA 2Q9JA 1GQZA 1U0KA 4JCIA 1QY9A 1TM0A 4K8LA 5IWEA 1QYAA 1T6KA 5M47A 4Q60A 3EJXA 3G7KA 4IJZA 2PW0A 3EKMA 1U1XA 1XUAA 3EDNA 1YM5A 1U1VA 2H9FA 4JD7A 5H2GA 4Q2HA 4IK0A 1W61A 2GKJA
chains in the Genus database with same CATH superfamily
2OTNA 2HAWA 4LS9A 3FVEA 4K7XA 4DUNA 1XUBA 5H2YA 2AZPA 3ICJA 4LB0A 3PVHA 2QB7A 4IJZA 4GL6A 5ANPA 1WPPA 1I74A 1YM5A 2IW4A 1U1VA 2YMAA 4IK0A 1W61A 2GKJA 1S7JA 1U1WA 2LT2A 4JUUA 4JBDA 4J9XA 4JCIA 1QY9A 1IR6A 2QB6A 1T6KA 3IGHX 2MPBA 1U1XA 1XUAA 4JD7A 3PTJA 2ZXOA 3W5WA 1W62A 4K7GB 5HA4A 2PVZA 4J9WA 3DEVA 2Q9JA 1K20A 1GQZA 4K8LA 1QYAA 2KW7A 4Q60A 3EJXA 3G7KA 4RPAA 2PW0A 2ZXPA 3EKMA 3EDNA 2Q9HA 4PY9A 3G98A 1SDJA 1WPMA 2EB0A 4OA3A 2ENXA 2KPTA 1BWZA 2GKEA 1U0KA 1TM0A 5IWEA 5M47A 3PW9A 1K23A 2H9FA 2ZXRA 5H2GA 4Q2HA 4LG3A 3WQZA 2ZVFA 2QB8A
chains in the Genus database with same CATH topology
2OTNA 2HAWA 4LS9A 3FVEA 4K7XA 4DUNA 1XUBA 5H2YA 2AZPA 3ICJA 4LB0A 3PVHA 2QB7A 4IJZA 4GL6A 5ANPA 1WPPA 1I74A 1YM5A 2IW4A 1U1VA 2YMAA 4IK0A 1W61A 2GKJA 1S7JA 1U1WA 2LT2A 4JUUA 4JBDA 4J9XA 4JCIA 1QY9A 1IR6A 2QB6A 1T6KA 3IGHX 2MPBA 1U1XA 1XUAA 4JD7A 3PTJA 2ZXOA 3W5WA 1W62A 4K7GB 5HA4A 2PVZA 4J9WA 3DEVA 2Q9JA 1K20A 1GQZA 4K8LA 1QYAA 2KW7A 4Q60A 3EJXA 3G7KA 4RPAA 2PW0A 2ZXPA 3EKMA 3EDNA 2Q9HA 4PY9A 3G98A 1SDJA 1WPMA 2EB0A 4OA3A 2ENXA 2KPTA 1BWZA 2GKEA 1U0KA 1TM0A 5IWEA 5M47A 3PW9A 1K23A 2H9FA 2ZXRA 5H2GA 4Q2HA 4LG3A 3WQZA 2ZVFA 2QB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W62 A;  1S7J A;  2Q9H A;  2OTN A;  1U1W A;  4JUU A;  1SDJ A;  3FVE A;  4K7G B;  5HA4 A;  4K7X A;  4DUN A;  4JBD A;  1XUB A;  4J9X A;  5H2Y A;  2PVZ A;  2AZP A;  4J9W A;  4LB0 A;  1BWZ A;  2GKE A;  2Q9J A;  1GQZ A;  1U0K A;  4JCI A;  1QY9 A;  1TM0 A;  4K8L A;  5IWE A;  1QYA A;  1T6K A;  5M47 A;  4Q60 A;  3EJX A;  3G7K A;  4IJZ A;  2PW0 A;  3EKM A;  1U1X A;  1XUA A;  3EDN A;  1YM5 A;  1U1V A;  2H9F A;  4JD7 A;  5H2G A;  4Q2H A;  4IK0 A;  1W61 A;  2GKJ A; 
#chains in the Genus database with same CATH topology
 2OTN A;  2HAW A;  4LS9 A;  3FVE A;  4K7X A;  4DUN A;  1XUB A;  5H2Y A;  2AZP A;  3ICJ A;  4LB0 A;  3PVH A;  2QB7 A;  4IJZ A;  4GL6 A;  5ANP A;  1WPP A;  1I74 A;  1YM5 A;  2IW4 A;  1U1V A;  2YMA A;  4IK0 A;  1W61 A;  2GKJ A;  1S7J A;  1U1W A;  2LT2 A;  4JUU A;  4JBD A;  4J9X A;  4JCI A;  1QY9 A;  1IR6 A;  2QB6 A;  1T6K A;  3IGH X;  2MPB A;  1U1X A;  1XUA A;  4JD7 A;  3PTJ A;  2ZXO A;  3W5W A;  1W62 A;  4K7G B;  5HA4 A;  2PVZ A;  4J9W A;  3DEV A;  2Q9J A;  1K20 A;  1GQZ A;  4K8L A;  1QYA A;  2KW7 A;  4Q60 A;  3EJX A;  3G7K A;  4RPA A;  2PW0 A;  2ZXP A;  3EKM A;  3EDN A;  2Q9H A;  4PY9 A;  3G98 A;  1SDJ A;  1WPM A;  2EB0 A;  4OA3 A;  2ENX A;  2KPT A;  1BWZ A;  2GKE A;  1U0K A;  1TM0 A;  5IWE A;  5M47 A;  3PW9 A;  1K23 A;  2H9F A;  2ZXR A;  5H2G A;  4Q2H A;  4LG3 A;  3WQZ A;  2ZVF A;  2QB8 A; 
#chains in the Genus database with same CATH homology
 2OTN A;  2HAW A;  4LS9 A;  3FVE A;  4K7X A;  4DUN A;  1XUB A;  5H2Y A;  2AZP A;  3ICJ A;  4LB0 A;  3PVH A;  2QB7 A;  4IJZ A;  4GL6 A;  5ANP A;  1WPP A;  1I74 A;  1YM5 A;  2IW4 A;  1U1V A;  2YMA A;  4IK0 A;  1W61 A;  2GKJ A;  1S7J A;  1U1W A;  2LT2 A;  4JUU A;  4JBD A;  4J9X A;  4JCI A;  1QY9 A;  1IR6 A;  2QB6 A;  1T6K A;  3IGH X;  2MPB A;  1U1X A;  1XUA A;  4JD7 A;  3PTJ A;  2ZXO A;  3W5W A;  1W62 A;  4K7G B;  5HA4 A;  2PVZ A;  4J9W A;  3DEV A;  2Q9J A;  1K20 A;  1GQZ A;  4K8L A;  1QYA A;  2KW7 A;  4Q60 A;  3EJX A;  3G7K A;  4RPA A;  2PW0 A;  2ZXP A;  3EKM A;  3EDN A;  2Q9H A;  4PY9 A;  3G98 A;  1SDJ A;  1WPM A;  2EB0 A;  4OA3 A;  2ENX A;  2KPT A;  1BWZ A;  2GKE A;  1U0K A;  1TM0 A;  5IWE A;  5M47 A;  3PW9 A;  1K23 A;  2H9F A;  2ZXR A;  5H2G A;  4Q2H A;  4LG3 A;  3WQZ A;  2ZVF A;  2QB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...