1W62A

Proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
362
structure length
362
Chain Sequence
HQQKREIMRFKKSFTCIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENMDYLRRGIMLEPRGHDDMFGAFLFDPIEEGADLGIVFMDTGGYLNMCGHNSIAAVTAAVETGIVSVPAKATNVPVVLDTPAGLVRGTAHLQSGTESEVSNASIINVPSFLYQQDVVVVLPKPYGEVRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEANYKNVVIFGNRQADRSPCGTGTSAKMATLYAKGQLRIGETFVYESILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGFNTMLFDPTDPFKNGFTLKQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure, catalytic mechanism, and mitogenic properties of Trypanosoma cruzi proline racemase.
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Racemase
molecule keywords Proline racemase A
total genus 96
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 5.1.1.4: Proline racemase.
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w62A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1w62A01
1BWZA 5M47A 2Q9HA 2H9FA 1XUBA 1YM5A 2Q9JA 4DUNA 4Q2HA 3G7KA 1U0KA 4IJZA 5IWEA 2OTNA 4Q60A 1W62A 5H2YA 1S7JA 4JBDA 4JUUA 2AZPA 3EJXA 1U1WA 4JCIA 2GKJA 2PVZA 1T6KA 3EKMA 1GQZA 1U1XA 4J9XA 4K7GB 4IK0A 1TM0A 4K7XA 4K8LA 1U1VA 4LB0A 4JD7A 4J9WA 5H2GA 1QYAA 5HA4A 1XUAA 2PW0A 1W61A 3FVEA 2GKEA 3EDNA 1SDJA 1QY9A
chains in the Genus database with same CATH superfamily
2Q9HA 4LG3A 2ZXOA 2KW7A 1U0KA 2OTNA 1W62A 4GL6A 4PY9A 1T6KA 3EKMA 3IGHX 4K8LA 2IW4A 4JD7A 2ZVFA 5HA4A 2PW0A 1W61A 2GKEA 1QY9A 2ENXA 2QB6A 3ICJA 3W5WA 5M47A 2H9FA 4DUNA 2ZXPA 5IWEA 3G98A 1IR6A 2AZPA 3EJXA 1WPMA 3WQZA 4OA3A 4JCIA 2GKJA 2HAWA 1GQZA 5ANPA 3PVHA 4LB0A 4RPAA 3FVEA 3EDNA 1K20A 2KPTA 3PTJA 2MPBA 1XUBA 1YM5A 4Q2HA 1K23A 3G7KA 5H2YA 1S7JA 3DEVA 2PVZA 4IK0A 3PW9A 4K7XA 1U1VA 2EB0A 1QYAA 2YMAA 1SDJA 1BWZA 2Q9JA 1I74A 4Q60A 4JBDA 4JUUA 1WPPA 1U1WA 4LS9A 2QB8A 4K7GB 1U1XA 4J9XA 1TM0A 2ZXRA 2LT2A 4J9WA 5H2GA 1XUAA 4IJZA 2QB7A
chains in the Genus database with same CATH topology
2Q9HA 4LG3A 2ZXOA 2KW7A 1U0KA 2OTNA 1W62A 4GL6A 4PY9A 1T6KA 3EKMA 3IGHX 4K8LA 2IW4A 4JD7A 2ZVFA 5HA4A 2PW0A 1W61A 2GKEA 1QY9A 2ENXA 2QB6A 3ICJA 3W5WA 5M47A 2H9FA 4DUNA 2ZXPA 5IWEA 3G98A 1IR6A 2AZPA 3EJXA 1WPMA 3WQZA 4OA3A 4JCIA 2GKJA 2HAWA 1GQZA 5ANPA 3PVHA 4LB0A 4RPAA 3FVEA 3EDNA 1K20A 2KPTA 3PTJA 2MPBA 1XUBA 1YM5A 4Q2HA 1K23A 3G7KA 5H2YA 1S7JA 3DEVA 2PVZA 4IK0A 3PW9A 4K7XA 1U1VA 2EB0A 1QYAA 2YMAA 1SDJA 1BWZA 2Q9JA 1I74A 4Q60A 4JBDA 4JUUA 1WPPA 1U1WA 4LS9A 2QB8A 4K7GB 1U1XA 4J9XA 1TM0A 2ZXRA 2LT2A 4J9WA 5H2GA 1XUAA 4IJZA 2QB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWZ A;  5M47 A;  2Q9H A;  2H9F A;  1XUB A;  1YM5 A;  2Q9J A;  4DUN A;  4Q2H A;  3G7K A;  1U0K A;  4IJZ A;  5IWE A;  2OTN A;  4Q60 A;  1W62 A;  5H2Y A;  1S7J A;  4JBD A;  4JUU A;  2AZP A;  3EJX A;  1U1W A;  4JCI A;  2GKJ A;  2PVZ A;  1T6K A;  3EKM A;  1GQZ A;  1U1X A;  4J9X A;  4K7G B;  4IK0 A;  1TM0 A;  4K7X A;  4K8L A;  1U1V A;  4LB0 A;  4JD7 A;  4J9W A;  5H2G A;  1QYA A;  5HA4 A;  1XUA A;  2PW0 A;  1W61 A;  3FVE A;  2GKE A;  3EDN A;  1SDJ A;  1QY9 A; 
#chains in the Genus database with same CATH topology
 2Q9H A;  4LG3 A;  2ZXO A;  2KW7 A;  1U0K A;  2OTN A;  1W62 A;  4GL6 A;  4PY9 A;  1T6K A;  3EKM A;  3IGH X;  4K8L A;  2IW4 A;  4JD7 A;  2ZVF A;  5HA4 A;  2PW0 A;  1W61 A;  2GKE A;  1QY9 A;  2ENX A;  2QB6 A;  3ICJ A;  3W5W A;  5M47 A;  2H9F A;  4DUN A;  2ZXP A;  5IWE A;  3G98 A;  1IR6 A;  2AZP A;  3EJX A;  1WPM A;  3WQZ A;  4OA3 A;  4JCI A;  2GKJ A;  2HAW A;  1GQZ A;  5ANP A;  3PVH A;  4LB0 A;  4RPA A;  3FVE A;  3EDN A;  1K20 A;  2KPT A;  3PTJ A;  2MPB A;  1XUB A;  1YM5 A;  4Q2H A;  1K23 A;  3G7K A;  5H2Y A;  1S7J A;  3DEV A;  2PVZ A;  4IK0 A;  3PW9 A;  4K7X A;  1U1V A;  2EB0 A;  1QYA A;  2YMA A;  1SDJ A;  1BWZ A;  2Q9J A;  1I74 A;  4Q60 A;  4JBD A;  4JUU A;  1WPP A;  1U1W A;  4LS9 A;  2QB8 A;  4K7G B;  1U1X A;  4J9X A;  1TM0 A;  2ZXR A;  2LT2 A;  4J9W A;  5H2G A;  1XUA A;  4IJZ A;  2QB7 A; 
#chains in the Genus database with same CATH homology
 2Q9H A;  4LG3 A;  2ZXO A;  2KW7 A;  1U0K A;  2OTN A;  1W62 A;  4GL6 A;  4PY9 A;  1T6K A;  3EKM A;  3IGH X;  4K8L A;  2IW4 A;  4JD7 A;  2ZVF A;  5HA4 A;  2PW0 A;  1W61 A;  2GKE A;  1QY9 A;  2ENX A;  2QB6 A;  3ICJ A;  3W5W A;  5M47 A;  2H9F A;  4DUN A;  2ZXP A;  5IWE A;  3G98 A;  1IR6 A;  2AZP A;  3EJX A;  1WPM A;  3WQZ A;  4OA3 A;  4JCI A;  2GKJ A;  2HAW A;  1GQZ A;  5ANP A;  3PVH A;  4LB0 A;  4RPA A;  3FVE A;  3EDN A;  1K20 A;  2KPT A;  3PTJ A;  2MPB A;  1XUB A;  1YM5 A;  4Q2H A;  1K23 A;  3G7K A;  5H2Y A;  1S7J A;  3DEV A;  2PVZ A;  4IK0 A;  3PW9 A;  4K7X A;  1U1V A;  2EB0 A;  1QYA A;  2YMA A;  1SDJ A;  1BWZ A;  2Q9J A;  1I74 A;  4Q60 A;  4JBD A;  4JUU A;  1WPP A;  1U1W A;  4LS9 A;  2QB8 A;  4K7G B;  1U1X A;  4J9X A;  1TM0 A;  2ZXR A;  2LT2 A;  4J9W A;  5H2G A;  1XUA A;  4IJZ A;  2QB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...