1W6UA

Structure of human decr ternary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
294
structure length
288
Chain Sequence
NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
pubmed doi rcsb
molecule keywords 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL PRECURSOR
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 102
structure length 288
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w6uA00
5JXWA 1YDWA 3GZNA 3GDOA 4MO2A 4AJOA 3JTMA 4BO5A 1MB4A 3CXRA 3FPCA 1T2EA 1EK5A 2BKAA 2DKNA 2GUGA 3ZNQA 2E6UX 1RM4A 3H8VA 5AXDA 4J1NA 3COSA 4B8ZA 3TNLA 1ISJA 1GPJA 3RQSA 1DHTA 4LCJA 3OJFA 4J4HA 3LT2A 3ZWVA 2GLXA 2PA3A 4IJWA 4AJHA 5A5FA 1KC1A 2DVMA 5ER9A 4JQCA 4E5NA 1QKIA 1W8DA 1HWYA 1Q7CA 5BNTA 4M89A 1DJQA 2AA3A 4U7WA 3HN7A 4Y9DA 3PQFA 2DLDA 3GNQA 5K9ZA 4UULA 1R4MB 3M2PA 2Y1OA 4AJ4A 1B2LA 1Q1NA 1JAYA 1E3WA 2VTEA 4P4LA 3WX0A 2R00A 1NM5A 3D4OA 4ND4A 2C7VA 3I1JA 3SVTA 1Y5RA 3DFZA 5L95A 4NBRA 4YT8A 3VPSA 2VUTA 5JY1A 4NHEA 4OJNA 2FWMX 1LRJA 2X86A 3P5SA 1TT5A 1U9JA 3AUAA 4OL9A 3PPIA 4JNKA 4DQVA 4I5DA 5C7IO 2DUUA 1ZIDA 1BRMA 5ICMA 3K31A 3TL2A 4GL4A 2QYSA 1NPYA 5KIAA 4Q3DA 4PG4A 1FF9A 5CDGA 1XQ1A 3FWNA 3IC5A 4EDFA 3QRWA 1K5HA 4XYMA 1Z75A 2Z1MA 1LQTA 4YAEA 1HTBA 2PH3A 3QV1A 4Y6RA 2BFOA 2O3JA 4O5OA 5A03A 4C7JA 4Q39A 1MUUA 1XSEA 4PLVA 4MVJE 3ANLA 3CH6A 1ISGA 3RFVA 1T25A 2ZCVA 3V8BA 3NKLA 3RSHA 1QYDA 3GOHA 4IQ0A 1UAGA 4RZHA 4UUPA 5A9RA 3GVHA 1GAEO 4BGVA 5K0ZA 1NWHA 2G0TA 1BXGA 2I6TA 2UUOA 4XIJA 4FFOA 4I1IA 3K9QO 3A9WA 5DCYA 2HJRA 1F8GA 3DAGA 3FWZA 4FPXA 2QRLA 3E9NA 3F6YA 3INRA 4BNGA 1X0VA 5JO0A 5L7TA 2I65A 4Z9FA 4DLLA 2JHGA 1P77A 4U8GA 2VZ9A 3GRPA 2B0JA 4XWYA 3CZMA 1L7EA 1T4DA 1I3KA 4EW6A 3ZWWA 3I9LA 3FCOA 1UXIA 1R0KA 1YS4A 2YHUA 3ONEA 5TGDA 4U6QA 4BV8A 4D79A 2JFHA 4MVJP 3GY0A 5G0VA 3TQHA 5IZCC 1ZXLA 5FEUA 4EGFA 3PJEA 1AHHA 3IJPA 5IFLA 4NFSA 2YDXA 4RVUA 1D8AA 1PZFA 3WGGA 4BNKA 1KY4A 4WKGA 4D0SA 3QLJA 1ZJZA 1CQIA 4MOWA 4NQZA 3D5TA 5HS6A 3H5NA 2I3GA 4BGIA 3BZUA 2GYYA 1GYPA 3KTDA 3TZCA 1ZSVA 3F1KA 3R0IA 3FBTA 1W0CA 5I7FA 1Y5MA 1S7CA 3UCFA 4BQRA 1LUAA 2BD0A 2C29D 2YQ4A 5AYVA 4OHUA 3MCVA 3A28A 4LMRA 3ONDA 4W4TA 4B7XA 4DVJA 4EITA 4HNGA 4YWJA 4WK6A 4P4GA 1EBFA 4E12A 1DLJA 1YB1A 1LDGA 3G79A 2Q2QA 4M86A 1QR6A 3QA9A 2YV1A 3JD3A 4F46A 5DCWA 4XGNA 3FTPA 2PZLA 3GAZA 3EZLA 1E7QA 2EKLA 2D2IA 3GGOA 3TOZA 1BSVA 1T26A 4ALJA 1A4IA 4YT5A 2PGJA 4CQLA 2YFHA 4B4OA 5KVSA 3W4JA 4CV2A 3JQAB 1W73A 1X1TA 2HU2A 2X23A 4JJIA 1YQXA 1LDNA 3UF0A 2Q4BA 1Y7TA 3ANNA 3BXXA 1I33A 3H9JA 3OICA 2VYNA 1WDKA 3JSAA 4KWIA 1YOVB 3Q2IA 1OBFO 3NGLA 1QP8A 3QSGA 1E7SA 5TC4A 2DTXA 1ZMTA 5JY6A 4NMHA 1UP4A 5DT9A 3GK3A 3GEMA 4QT0A 5BR7A 4W82A 2GN6A 3BMCB 3AUSA 3PXXA 2YUTA 5IXSA 4CUKA 4RJTA 2R6JA 3KZVA 1JWAB 3KXDA 4MINA 3C8MA 1JDJA 1K89A 4YTEA 4MVJM 1RJWA 3CIFA 1HLPA 4FOOA 1ML3A 4CLDA 4M1QA 2FRDA 4BKRA 4YJHA 4OGWA 1BXKA 2I67A 3JQ7B 3VH1A 4GMFA 3U5TA 4XZ3A 3SXPA 3ZNPA 4J1QA 3JQEA 5A9SB 3ADOA 1GQQA 4XQEA 3AWDA 4R01A 5IZCA 3VZSA 1UZNA 1Y6JA 3I4FA 4DBVO 2RCYA 1PQPA 1OZAA 2Q1SA 2WE8A 2HK9A 3ENKA 5G0SA 3NGXA 3DZIA 4R3WA 5A4DA 4BNWA 3C3XA 5G0UA 5HWSA 1IPFA 3BTSA 1YBVA 3I6QA 1EMDA 4BUCA 3FR8A 4E5PA 2B4TO 3O4RA 1N7GA 2GSDA 3IMFA 2EV9A 4FN4A 1EE9A 1EUCA 1ZVMA 1CF2O 2D59A 2IEBA 3FN4A 4IGEA 4CV0A 2YY7A 4ESOA 5LCXA 4K9DA 2V6BA 2VTDA 3S2GA 2DBZA 2O3SA 5ILOA 1E5QA 2BFAA 3VH3A 4AJ2A 3HDYA 3EHEA 5KJFA 1U3WA 4NJMB 2O3QA 1MP0A 1Y9AA 2D0IA 4R1NA 1R16A 1UP6A 4BNUA 1V9LA 4E0BA 3B1KA 4CM5A 4RQTA 1B0AA 2VYVD 1GADO 1Z82A 3VZPA 1VJ0A 2OP1A 1YQDA 3JYNA 2AXQA 3DBLA 4QO8A 3GUCA 1VL8A 1X1EA 2IDZA 3JYOA 5IDQA 2NUAA 4FR5A 2NQ8A 3WYBA 2FZWA 3Q2KA 4M54A 1SCUA 4PLTA 3ZWBA 5HA5A 5GMOA 2TMGA 1NFQA 5DP2A 3AM4A 4Q9NA 1ISFA 3H3FA 1DEHA 4QTZA 4GGOA 3RAJA 4J7UA 1EVJA 3EZYA 4A73A 3WXBA 4UVHA 4DRYA 3S2FA 1UUFA 2HMUA 4RF2A 2B4RO 2FN7A 1N2SA 3PFFA 2GDZA 4YAGA 3LYLA 5I7SA 3S2EA 3GDGA 2C54A 4HUJA 3WS7A 3QVSA 1TB4A 2OMEA 3QIVA 4L9RA 4NK4A 4RORA 2AQ8A 2P9GA 2VOEA 3INGA 2HK8A 1LU9A 1B3BA 5A3VA 4TMFA 3NTOA 4CUJA 4RF4A 1HXHA 2NWQA 1GV0A 4D43A 1SB8A 1F06A 3BMQA 2EERA 2IE0A 2YQ5A 1CQJA 2VHVA 3RUFA 3ZV6A 5BT9A 5DOZA 2PD6A 4M8SA 1PZGA 5JAIA 5JYDA 3ZHBA 1DB3A 4WJZA 1ADBA 1E3JA 3OQ1A 3FPLA 2VHZA 2VWQA 4DLAA 3GGPA 4FCCA 2JL1A 4BKPA 4J2OA 4NZ9A 1YB5A 1OI7A 2VRBA 4JROA 3W1VA 4XRRA 5JMPA 3WDSA 1EZ4A 1ONPA 4ZHSA 1WPQA 1E77A 3EVTA 2V65A 3AUUA 3G3EA 3OBBA 2JD1A 1OC4A 4LRSB 3F4LA 5G4KA 1XELA 4RL6A 3GF4A 1T24A 3PHLA 4PRKA 4JIGA 4WCFC 4CM9A 4YDRA 1FDVA 3VTZA 1I8TA 1U3UA 2AQKA 4BB5A 2GO1A 2PK3A 2W8ZA 1K6IA 4UEOA 4F45A 1D7OA 1N9GA 1QRRA 4K6CA 1PS9A 1V8BA 3IAHA 1FXSA 3KO8A 4YJFA 3AY6A 4R9SA 1NVMB 1DC3A 4MKZA 1LA2A 1QORA 4XD2A 3UXYA 1XDWA 4OKNA 1O94A 1NPDA 3OJ0A 3WLEA 4D41A 2YV2A 4E5YA 4DC0A 4WLOA 2FZEA 4HXYA 2GCGA 2PD3A 3AFMA 3SJ7A 1MG5A 4OMUA 1ADFA 2EP5A 4CM1A 1VSUA 4BVAA 2BHLA 1W6UA 3VPGA 3IJRA 5F5NA 1JKJA 1LSSA 4YB8A 1I3MA 3L9WA 1MFPA 5FWNA 5KOIA 4HBGA 5CP8A 3I9MA 3TRIA 3IIEA 2PD4A 4XGIA 3WIDA 1R4NA 2Y05A 1NYTA 3LZ6A 4BS9A 1B7GO 1EE2A 3E03A 3B20A 1X7GA 4CMKA 8ADHA 3KETA 5U1PA 3BMNA 4QQRA 3DC2A 4MIEA 5G0TA 3JD1A 2OL4A 5EN4A 2Q1UA 4WOKA 3I9KA 1DAPA 1V35A 2AHRA 3PLRA 5HM8A 1I01A 4ALLA 4BNHA 4MDHA 3X2EA 1U1IA 2JJYA 3U4IA 3V5NA 2EKQA 2BGKA 2O50A 3UGKA 4KOAA 3L6OO 4BO0A 1FK8A 4WPGA 1HE3A 3PDUA 3VOSA 4IS2A 5KJCA 4LVUA 1H6AA 5L4NA 2PWZA 3DQPA 4IXTA 3UHAA 2OO5A 4W7HA 3F3SA 3GEGA 3QWHA 3Q11A 5B12A 1MC5A 1NQTA 3Q9UA 1VSVA 5L7YA 1B3RA 2RBEA 1UXHA 2W90A 4OSOA 2J5QA 4P38A 3ZWPA 1HF3A 2EGGA 1KVTA 5TS3A 1A9ZA 3AK4A 4B4WA 2UV8A 1KOLA 4ZVVA 3GG2A 3TF5A 4CPDA 3GMDA 4O59O 1Q7BA 4WCFA 5J23A 4G2NA 1N8KA 1XU7A 1D3AA 3K5PA 2NVUB 3HWRA 4WCDA 4F3YA 4XYEA 3VPXA 4GAEA 1ZSYA 1IB6A 3JQ6A 3K73O 1B14A 1F8FA 4HFNA 4YJGB 5JC8A 1SZJG 2RHCA 3GMSA 5COAA 1YGYA 4WLUA 4NJOA 3HZZA 2HJSA 4WE3A 5DCUA 2X22A 5LDHA 3ICPA 4WLVA 4YQYA 3CTMA 5ICSA 1O9BA 4B7UA 2WSBA 3RUAA 3GVCA 3GR6A 1PJQA 1UXJA 4IDEA 3L07A 3V2UA 2BH9A 2VCYA 3MTGA 1C0LA 1H93A 4TKMA 2X5JO 4GMGA 1SBYA 4ZD6A 1KEWA 1J0XO 3ITKA 5IXYA 5DBFA 3WWYA 2O4UX 3H65A 3LLSA 5DN9A 3ULKA 1Z45A 2YHIA 3RROA 4D46A 4AJJA 3MJSA 5A04A 3JQ9A 2PZJA 4ZICA 1PIWA 2X9VA 3G49A 4H15A 5BSGA 1WAMA 1Y9EA 1C0IA 1HYEA 4PG5A 1BWSA 1WMAA 5F21A 2ZYAA 2IODA 3HADA 1I2BA 2DTEA 3RUCA 1ISHA 2UVDA 1UDBA 3OA0A 1LI4A 5F1KA 5GZ6A 1PJSA 1B8VA 3JD0A 4BKQA 4TROA 1ZK0A 1HZJA 2PKQO 3FD8A 4FOSA 2Y0EA 5EIOA 3OEWA 1PWXA 1BXZA 4BNVA 3B6ZA 2XXBA 3RBVA 1UH5A 3OF2A 2OGUA 3PFWO 1DXYA 4RVFA 1XYGA 1JVBA 1PZHA 1DPGA 3UN1A 5EMHA 1U5CA 3WTBA 4ALNA 1DIRA 7MDHA 5A3JA 1ZEMA 2P68A 1KY5A 1LEHA 2P5YA 4J4TA 1R0SA 2O7SA 3DHNA 4OIMA 1U8FO 1KC3A 1YB4A 1JW9B 4LVCA 3LC7O 1DOHA 2X0RA 4LISA 3EW7A 5IG2A 3LT1A 4Z6KA 1LQUA 4PLCA 5L51A 1DO8A 1F17A 4IZIA 5KKCA 2Z1NA 3SEFA 5CFZA 4E3ZA 3UAGA 1PGPA 1Y1PA 3HHPA 1A4UA 1Y8RA 5H81A 1QG6A 2BLLA 3EAGA 4R68A 3WMXA 1K2WA 2NTJA 5HRUA 5C37A 3G0OA 2A92A 3IP1A 3AI3A 4D42A 1X13A 4GVLA 1NWCA 1T2AA 3PHGA 3QQPA 5ER6A 3RFTA 2ZK7A 4R1SA 3CPSA 3WFIA 4JBGA 3GLQA 3UCXA 3EK2A 2CNBA 3QY9A 3KSZO 2FP4A 3MWEB 5THQA 4JXKA 3AOGA 3GZNB 2RAFA 1PS8A 4RLHA 1NVTA 3ZCXA 4ITUA 3PTZA 1NASA 1P44A 4OAQA 5JAQA 2WTBA 1E1KA 3RI3A 4J7CA 4AJLA 1PGJA 3P2OA 4YAJA 5G0WA 2GPTA 3M2TA 5JSFA 3TZQA 2LDXA 2X1HA 4OOFA 2ZB3A 4QXMA 1GU7A 3DMTA 5JE8A 4RPLA 4MVJI 4WEQA 2DPHA 1P31A 1RYDA 4BGUA 3VHRA 1JN0A 4E4YA 3JV7A 3Q9NA 3E1KA 1UAYA 2GN4A 4IDAA 3DWFA 1WW8A 3PK0A 1DC6A 3SC6A 5HS4A 3WICA 3PWKA 4FIZA 3PJFA 1JKIA 2QYTA 1E7RA 3GAFA 1NPTO 3GVIA 2IEDA 4FFRA 1DLIA 2HMTA 2J3IA 1BW9A 3I9JA 5IZ4A 4CM8A 1NFFA 2GZ2A 4CLEA 4IMRA 4R9RA 4GKBA 1NVGA 1CDOA 1HDCA 1NXQA 2OUIA 5BSEA 1XIVA 4J16A 1KEPA 1PJ4A 4PLYA 3IS3A 4DC1A 1IOLA 4UUMA 3ANMA 2B69A 2JHFA 2OZPA 3MTJA 4Z9XA 2NTVA 4XX0A 1GUFA 2VWPA 3S1LA 4CLOA 1ISMA 3GRKA 4H7PA 4I9HA 4FS3A 4LN1A 1QYVA 3W8DA 4CMHA 1K6XA 4L76A 1C14A 2PY6A 2P2SA 1N5DA 3HB4X 1PGOA 4CR8A 4PZDA 3UICA 4PN3A 1TLTA 2ZQYA 3ZV5A 1ZNQO 1HDZA 3ZWAA 1E6WA 1R15A 2O23A 5B4VA 1XKQA 3KV3O 1AGNA 1JA9A 1UJMA 1H2BA 4Y8VA 5CEEA 3DL2A 3TPCA 3ORFA 3RCBA 3M1LA 1ZBQA 4XR9A 4U0KA 3RIHA 3ADPA 4R1TA 1CYDA 4CMGA 4X54A 1PGNA 3BIOA 4OSPA 1LDMA 2CDBA 2JAPA 4JX8A 3HUDA 2AE1A 4OM8A 3QE3A 1T4BA 4JLWA 1BXGB 2B83A 1ZKMA 3RKRA 5AOVA 1EDZA 4FJ1A 4PVDA 4ZQBA 3AI1A 3CINA 1E7YA 3VKVA 3LC1O 3WG9A 4AL4A 4XJTA 3NUGA 4B3IA 3TOXA 1SOVA 1WZEA 4DLBA 2EG9A 4AJPA 3PVZA 1C0KA 1Z7EA 3PZRA 1VKNA 1EFLA 2Y67A 3JQGB 1PSDA 1EVZA 1IHYA 3KB6A 4IM7A 4YRAA 1P1HA 1HE5A 1H0KA 1XGKA 4RDIA 4BV9A 1Q0QA 4ZQEA 4IGFA 5H83A 5TSDA 5HBRA 2EGHA 3DOJA 1O6ZA 3UOGA 4BO8A 3EGOA 3WJ7A 2X0JA 1FMCA 3QVXA 1B16A 3H7AA 4B7CA 2V6FA 4KUEA 2NTNA 3VPFA 1LDBA 2HDHA 3I9OA 1P1IA 3ZGYA 1EDOA 1CETA 2BRUA 2ZYGA 4CMIA 4RCVA 4TRNA 2V6MA 4YRBA 4Q3BA 2FMUA 1I3NA 2RIRA 1NBOA 1GEEA 2DBRA 4RDHA 1HDOA 2D5CA 1C1XB 3H5AA 4RV9A 4NR0A 4XDZA 2VYVA 4NFYA 4BO4A 4W6ZA 4J1SA 4Z3DA 2Y0CA 4XYGA 4DXHA 5B4UA 2J3HA 3I23A 2CVZA 1RM0A 3JQ8A 3ZH2A 4YPOA 2Q2WA 4NU6A 3C1AA 3U4HA 5KCZA 3A1NA 1E3EA 1PGQA 4J90A 5DP1A 4ZQGA 4GWKA 1KVRA 2QX7A 3BTVA 1EQUA 3O26A 1LLQA 1J5PA 4MJLA 1JLLA 2PV7A 1EQ2A 1MV8A 4TRJA 1EUDA 1E3SA 1N92A 3GN2A 4KMSA 4WOJA 3ZV4A 2IZZA 1ZK2A 4CQLB 3E48A 1BTOA 3BHMA 1E6EA 4B3JA 4I5GA 1O95A 1DFIA 4HFRA 4IDGA 2W98A 3MJTA 4WLFA 3DZHA 2FR1A 2WD8A 1C0PA 1MA0A 4ZN6A 3RC7A 3AFNA 4D0RA 5TRTA 3PLNA 1GR0A 2JD0A 3GNTA 3OEYA 3PDJA 4D3FA 1LLUA 4DWVA 4IS3A 4WASA 1VC2A 1A7AA 2QQ5A 4GLLA 5KNLA 3BTUA 4FSHA 4MP6A 4CMBA 5KVCA 1X7DA 3WWZA 4TZKA 4GKVA 1LLDA 4YA6A 2J8ZA 1YONA 2YFQA 3QWFA 4KDEA 4YJHB 2Y93A 4HWKA 4M87A 3L6DA 1XLTA 4B8WA 4CJXA 4EJ6A 4Y67A 4CM4A 4AFNA 2A4KA 4DREA 1JTVA 2O2YA 1I2ZA 3AOEC 2O3RA 4E32A 3SBOA 3NJ4A 3ROPA 3BA1A 4BNXA 4A2CA 2P4QA 1FDSA 3AJRA 3ENNA 1BDBA 1GL3A 4AJ1A 1M2WA 2EWMA 4L75A 5ES3A 4AJKA 3D3EA 3WBFA 3CZRA 1M6HA 4XYBA 5JDIC 3PEFA 1GY8A 4FFPA 3DBHB 5JMWA 2X6TA 2W2LD 2FSVA 4MIOA 3WNVA 4KQXA 4JGBA 5IN5A 3QWBA 2ZIZA 3DEYX 4NBTA 3VH4A 4ALMA 3ZZNA 3RC2A 2X9NA 2NVWA 3TJRA 4YXFA 1WXDA 4HADA 4NBVA 1EVYA 1XA0A 4GX5A 4N18A 5I9NA 4IDDA 4S3MA 4K6FA 1BGVA 3IQDB 3DO5A 3PWZA 1LDEA 2DPGA 4TVBA 4W99A 1U7HA 2PKRA 1TA4A 5BSHA 4UVEA 2JAHA 3BMCA 2D3TA 3MJ4A 2PR2A 1VL0A 1HL3A 3JYQA 5JCXA 1ZZEA 2HRZA 3GH3A 1KERA 5THKA 2O3UA 2WYVA 4J0EA 2J6IA 3FNFA 3KHUA 1LRLA 3ZW9A 4G5HA 4R16A 3BMOB 1OC2A 3KYCB 1Y8QB 2NNLD 3A4VA 4MP3A 3BTOA 1ULSA 5DNAA 2AMFA 3WQRA 5MGBA 2VRCD 2Z95A 2Q49A 2VUUA 1I5RA 1ZCJA 1B15A 4IQGA 5BNFA 5A9SA 3PIIA 4U6SA 3ZWOA 4CUZA 2YYYA 5CPBA 2UAGA 5AXBA 4BKOA 1O0SA 1MLDA 4HFJA 3VVCA 4DPMA 2XAAA 5DBIA 2GGSA 3ZDFA 2PGLA 1FDUA 3IL2A 1UR5A 3RFXA 2BGMA 4J1TA 2BI7A 3EMKA 2B35A 3C24A 3LSYA 4IJVA 3WQQA 4U0JA 5JNLA 3OH8A 3KSUA 2C2XA 5TNXA 1GEGA 3RUIA 3D4PA 5IF3A 4OQZA 3Q6IA 4RQUA 1SAYA 2B5VA 1V6AA 4NJMA 1ONNA 5B37A 4RVSA 2PZKA 5FFFA 4KUGA 3GPDG 4BNYA 3G1UA 3WYCA 2GF2A 2NM0A 2YZ7A 3V1UA 5L45A 3K6JA 3Q0EA 3L0DA 1HZZA 3QJ5A 1KEVA 4J0FA 3V1TC 2D4AA 2H1SA 3VTFA 2CSUA 4PG6A 1M6WA 5TIIA 3AOEA 5JAMA 4DIBA 3ABIA 1AN9A 3TFOA 4MVJD 4ND1A 3ZWXA 5G4KB 4CL3A 3F5QA 3MZ0A 3PHHA 3V2HA 4NBWA 3N58A 2BF7A 2SCUA 3E5MA 2IYOA 2JCYA 3G17A 3KYDB 3RASA 2UYYA 2X5OA 5C5IA 3AW9A 3TDKA 5JDIA 1SO8A 1U3VA 2NACA 3OIGA 3DTTA 4GVXA 5IJZA 2PFGA 4FW8A 4IDFA 4RF3A 5B4TA 3DZJA 4CMEC 4ND2A 1N9GB 4WLEA 1GV1A 2O7QA 3I6IA 1UXGA 3QVWA 1TXGA 2VWHA 1Z73A 4XDYA 2DUWA 2HMWA 2QRKA 1XCBA 1NP3A 2FPIA 1XQ6A 4D44A 3OQ6A 1PJBA 3FSRA 2DQ4A 3D7LA 3WJAA 2P4HX 2IRWA 2JKVA 1DRWA 5COBA 5F1OA 3UW3A 4BO7A 3JQAD 3UVEA 4B4VA 2WEKA 3VH2A 3IP3A 3JQDA 1KBZA 3D1LA 1M67A 5L4SA 4D3SA 1Z74A 1T2FA 2OXIA 2AQIA 3WIEA 1EBUA 3HB5X 3AY7A 2P9CA 5CG2A 1XHLA 4UEKA 3HDQA 2IZ0A 3ZU2A 4FB5A 2ZB8A 3IOYA 4MIYA 3D64A 2NU6A 3D3WB 4PRLA 1KVUA 1YQGA 2HKIA 2Y1EA 3BMNB 3N74A 5T64A 4BNIA 1EFKA 3NDJA 2RH4A 4INAA 4CQMB 5CDTA 2Q50A 3JQ9C 4NG5A 1DBVO 3VDRA 1FJHA 1ENZA 4PVCA 1C1DB 1E7WA 2WD7A 4RF5A 1EK6A 4RVDA 3GNSA 4BQPA 1Q7GA 1A9YA 2ZCUA 2QIOA 1OFGA 5I8ZA 4DA9A 2GR9A 4HFMA 2YW9A 4UVDA 4J3FA 1PJCA 4W9NC 3L77A 4XIYA 2VHYA 3JCZA 1GFSA 5EPOA 5JDCC 4DTIA 1SEPA 1LNQA 3ROKA 4TKLA 1Z6ZA 3FTNA 5JAZA 1N1GA 3ZI0A 3K96A 4K1LA 4ROSA 3QVTA 3IUPA 4GX1A 4RPHA 3W8EA 4E31A 4JP3A 2AG8A 1K0UA 3IDSA 2JFGA 1WLYA 2A35A 2W2KA 3WYEA 1XU9A 1E3IA 3WR5A 2CF5A 2E37A 2DAPA 1ZMOA 3WGHA 2PTGA 3U3XA 4ILKA 4WCFB 3CE6A 1X15A 1QV7A 1NHWA 1DIAA 1A27A 3PWSA 4P8RA 1ZXBA 2I66A 3OFSA 1HDGO 4CM3A 4CODB 2UUPA 1PL7A 2E49A 2C07A 3D4NA 4U5QA 4CMEA 1UDAA 3NTRA 3GC6A 4OYRA 1ADCA 3C7DB 1P74A 1SOWA 3I9NA 2PZMA 3B70A 3RKUA 4FFMA 4E13A 4KTVE 3NJ8A 1B8PA 1O5IA 2I5PO 4JP2A 1PJLA 5G2OA 1T1RA 4LRTB 1PX0A 3TFQA 3PQEA 2PNFA 4YVFA 1XEAA 2H9IA 3PYXA 4OXNA 4J43A 2EW8A 3W4IA 5A5EA 5U9CA 1Q0HA 3DBVO 3ROMA 2GASA 2G1UA 2GZ3A 4YJDA 5AQ1A 4UEJA 1IE3A 1ID1A 2BI8A 3WSVA 1IYZA 2YDYA 5TQVA 1R6DA 1RWBA 1E1MA 3LQFA 1NR1A 4Y6PA 5H82A 3LK7A 1UDCA 1IL0A 5IDYA 1LLCA 3PHJA 5TT0A 3ZHZA 3I83A 4QFDA 3WQSB 3DMTC 3HN2A 4E33A 1YJ8A 4EYEA 1E7MA 3OJLA 1V0JA 3S2IA 4FFLA 3RBXA 1MC4A 4L0QA 4XQGA 3GVPA 2AEFA 3JYLA 4JJGA 1O8CA 3EVNA 3H9EO 1YO6A 3AM3A 2JCXA 3DBRA 3QW2A 2ZB7A 2Q3EA 2NVUA 1QV6A 4AVYA 1HLDA 5AXAA 3FBGA 3WNQA 4AG3A 4R5MA 3F46A 3EY4A 4I08A 5AVOA 1IPEA 4YJGA 1GZ4A 3ROQA 1PWZA 4R1UA 4W9NA 3O38A 1CJCA 3MJVA 5JDCA 4S1VA 4Q3EA 3DZGA 2HMVA 3OQBA 5GZ3A 4UVIA 4YT2A 2O48X 4BNJA 3AU8A 1GD1O 2B4QA 3W6ZA 5KJ6A 4DUPA 3T7EA 1QXSA 1Y8RB 4FD3A 4I5EA 3JQCA 3PIDA 2HMSA 3PYMA 4RVGA 1WZIA 3HSKA 4B3HA 4E2XA 1WP4A 4XEHA 2XXJA 1ZO8A 1ZH8A 6LDHA 3E5RA 1F12A 3LVFO 2NU7A 3ASVA 3MOIA 4N5MA 3K92A 1P1KA 3KUXA 4A27A 4A7PA 4NDNE 4XJSA 3U0BA 3O8QB 4CLRA 1QYWA 4DGSA 4FDAA 3HQ4O 5DDIP 4E5MA 4CLXA 2Y1FA 3H9UA 3I5MA 2H6EA 3C1OA 2Y1GA 1H6CA 1PU2A 2OHXA 1X0XA 4UAGA 1LBEA 1EVIA 1PJTA 5G4LA 3RUHA 4QECA 3VAZA 4UVGA 1J49A 2DC1A 3GN1A 3W8FA 5T5QA 3VDQA 5A9TA 5BNIA 1ZSNA 2BFMA 1HETA 3U4CA 4I5FA 5TT1A 1H5QA 4XYLA 4Z0HO 1A71A 1EEHA 1H6BA 4URFA 1VKOA 3LDHA 3HFGA 3VC7A 5JW6A 3MJCA 5JBIA 5CEJA 4CQMD 1M76A 1ZJYA 3WOHA 3G1TA 3FNGA 1ENOA 1BVRA 1J6UA 1XR3A 2R2GA 2EW2A 3ZU3A 4HV4A 1GCUA 5CEFA 4TWRA 1NR7A 1YH3A 1I24A 1RM3A 3QP9A 2G76A 5I7EA 4L73A 4XR4A 4IDBA 1HDRA 1VRWA 4FBGA 1DRUA 2WYUA 3NV9A 4CM8B 4OQYA 1LSUA 4KP7A 1LTHR 1A7KA 3K8ZA 5BSFA 3ONFA 4YR9A 9LDBA 3DTYA 3BYZA 4NK5A 4PG8A 2EHDA 3QWAA 4FJ0A 2J3KA 3DZKA 1LSJA 3HDJA 1YBMA 4RZIA 3AU9A 4Y98A 4XKJA 4QO7A 1U7TA 1E3WB 4GSLA 2HAEA 1V3TA 5FYDA 2EIHA 1E92A 4D3DA 3LF1A 3SX2A 4ZJUA 4YYZA 1DJNA 3ZHXA 3P7MA 3KYBA 3DHEA 1OMOA 5F3RA 2FPGA 3CEAA 4N5NA 1HDXA 4RO0A 3ZV3A 4BHTA 2PLAA 1TT5B 1MXHA 5C3MA 2E48A 4L8VA 1P3DA 2EXXA 2O2SA 1VJTA 4Z9YA 4PLPA 2P9EA 1NQOA 1ZK3A 5EQDA 1BG6A 2GERA 5T8KC 1MXFA 3RUEA 4QEDA 1PEDA 5JCJD 2RH8A 1TEHA 3ZWCA 2P91A 2AG5A 1H94A 3AI2A 2F1KA 3OETA 1NHGA 4BNLA 4OXYA 1ENPA 3WTCA 2PKQP 4DMMA 2H63A 3GDFA 5IN4A 1AUPA 2EEZA 4WUVA 4BMVA 1DC4A 2VHWA 3H9QA 1GCOA 4IXWA 4IMPA 1GUYA 4IIUA 4WNIA 5EQFA 4RGBA 4BNNA 3PYLA 4P22A 4NBUA 3K2BA 1HE4A 3PI7A 4XB2A 3PP8A 3AUTA 3F4BA 1P1RA 5GZ1A 2EJVA 2BMAA 2FR0A 1S6YA 5DULA 4R5HA 3TSCA 1LJ8A 2Q4EA 2ZJ1A 3AY3A 4HY3A 1JAXA 1WDLA 2C20A 4YT4A 5EJ2A 1R4MA 4B4UA 1MGOA 1PL8A 2ILTA 2OFPA 4BNTA 3KSDO 5FF9A 4JJFA 4P4NA 3DHYA 1F14A 1HSZA 3WGTA 1JU9A 3EUWA 2I9PA 5JO9A 4ZQFA 4N54A 2HSDA 1G0NA 1PQUA 1P9LA 2X4GA 5AXCA 1U4OA 3H6KA 5LDGA 4BO9A 4CMIB 3MJEA 4R69A 4HX5A 2Q46A 2X7HA 1BDMA 4BO1A 2W2LA 3VPHA 3R3JA 1YE3A 1QSGA 1JKFA 5T6BA 4IIVA 2G17A 4EI2A 1X7HA 2I3AA 2J3JA 4OH1A 5I7VA 5DZSA 3W6UA 5I8WA 1CERA 3KEQA 4WLNA 3C1TA 3GPIA 3L6EA 4JN6B 4DBZA 4EJMA 2YV3A 1GTMA 2D8AA 2UDPA 1ZW1A 2HK7A 5JPIA 1U5AA 2JFFA 2CY0A 4TVOA 4OO3A 4ZQHA 1YXMA 1YL7A 4MP8A 3U9LA 4UREA 4ALKA 3JQ8B 2BGLA 4PZEA 5KVVA 4Z0PA 1P1FA 4FGSA 1UP7A 1PR9A 3S8MA 4K26A 4GH5A 3T4XA 3A14A 1ARZA 3DR3A 4R54A 2I76A 4II3A 5MDHA 3DOOA 1D4FA 3PGXA 1RKXA 2VRCA 4R3NA 3WB9A 4F6LA 5CDSA 4FC6A 3OMLA 4CMCA 4I8XA 4NH4A 1NX6A 4J6FA 4NNJA 1ADGA 3JQGA 1XWFA 5KKAA 3WGZA 1I36A 2VNAA 4E2YA 5T8KA 4QX6A 3LC2O 4PFJA 2X0IA 3VZQA 5B1YA 4AJEA 4BO6A 2QHXA 1HE2A 3N7UA 4W7IA 2NVBA 4JBIA 1MFZA 5CDYA 4J7XA 2A9FA 3D0OA 3FR7A 3LT4A 1DFGA 3OIFA 2B36A 2V6GA 2ZYDA 5DBGA 3DZBA 3ST7A 3WGOA 2DBVO 3CSDA 1WWKA 3SLKA 4NIMA 4IDCA 3SLGA 4CR6A 3PGJA 2ET6A 3RJ9A 4GX2A 3E8XA 4YRDA 3PRJA 3TL3A 1C1XA 1NAHA 5FI5A 1PS0A 3E9MA 3ZN2A 5I9MA 1M66A 1P45A 1NFRA 1DIHA 2W4QA 1IULA 4FQ8A 5BQFA 2EP7A 4MVJA 3E9QA 3OA2A 3ON5A 4CM4B 3JYPA 3EYWA 1MX3A 4H16A 2C7GA 3DAFA 2J5RA 7ADHA 4ONEA 2Y0DA 2NADA 2ZKLA 2ZJ0A 3GEDA 4YCAA 4EUHA 4DPLA 4L74A 1YVEI 2X8LA 2J5KA 2IXAA 1YL5A 1PJ3A 4CMJA 3WSWA 3H5RA 1T2CA 1L7DA 3RWBA 5CDUA 4GBJA 5JFOA 5L7WA 4E2ZA 1P0CA 3PHIA 4Z3KA 2CMDA 5CG1A 3OM9A 4XQ9A 1DC5A 3ZWNA 2CUKA 4L4SA 3R1IA 1HSOA 4YACA 1U3TA 2HCTA 3LF2A 5CAEA 2DT5A 1WNTA 1Y81A 3ITDA 3UUWA 3KEOA 2JD2A 3RJ5A 4HNHA 5A06A 1A72A 1E1NA 2GN9A 3JQAA 4BOYA 3DXFA 2B5WA 4YQZA 4NI5A 3RD5A 4BMNA 5GY7A 1RYEA 1HRDA 2EKPA 3H2ZA 3QVOA 2VNSA 3NRCA 3JQBC 4DIFA 4BL5A 5HTOA 1CWUA 1YOVA 3K30A 4I9NA 3U62A 2VHXA 4E2WA 2CD9A 3DBLB 2AEJA 2OOSA 3NX4A 1B8UA 2GN8A 4H3VA 1NQAO 4ALIA 1E0DA 1WMBA 4ZRMA 4TSKA 4AICA 1TI7A 4WNCA 2Y68A 3DMYA 3IUSA 5A02A 5JS6A 1C3VA 1UZMA 3DDNA 4O63O 3RBZA 5TJ9A 4MKXA 3T4EA 2C59A 4FC7A 1KYQA 1JWBB 2F00A 4DMLA 4DYDA 1E3LA 1AXEA 1PR3A 3JQ7A 3C7CB 1R12A 2DFVA 1KS9A 3FNHA 4MVJG 1VLLA 3BHJA 4BIIA 2B37A 2DBQA 3SC4A 4IZHA 4QSMA 1AXGA 3DBHA 3F5SA 3RC9A 3U49A 2IZ1A 4N5LA 3V2GA 1ZK4A 2EJWA 5JYEA 2X5KO 3JQFC 1WDMA 4J2HA 1GYQA 1H9BA 1HEUA 4RPJA 1X14A 3F47A 3OECA 1J4AA 1L1FA 1LDYA 2C5AA 1P1JA 4CV3A 2OBNA 1GZ6A 4FFNA 4QFCA 4OKIA 4WECA 3I4CA 1OAAA 1KVQA 1YJQA 3BMQB 3O03A 2FR8A 3DONA 3GG9A 2ZTVA 3EC7A 4O0LA 2PGDA 4PLFA 4L4RA 3ZU4A 1ZEJA 3WGIA 1DIGA 2HRBA 4J4BA 3BMOA 1DFHA 4IJKA 3KYCA 3CMMA 4GX0A 3DOCA 1Y8QA 4NPCA 4PG7A 2WJPA 1GQ2A 3KLMX 2ZTMA 1GDHA 3NT4A 2D5AA 2I99A 4II2A 5FI3A 3U09A 2ZTUA 5TF4A 4ZRNA 1DDOA 2OBYA 5TJHA 3ZNOA 4MVJH 4KZPA 4TZTA 1GZ3A 2NU9A 1SB9A 3GGGA 3H9GA 4BNFA 3DZFA 4BO3A 4E21A 5L9AA 3IKVA 5TLSA 1UXKA 3RU7A 3IKTA 2WM3A 2QRJA 1SNYA 2QZ9A 5KVQA 4HP8A 4ND3A 4CM6A 1PZEA 3L9XA 2DTDA 3H3JA 5EINA 3UH1A 1K6JA 5A05A 3WFJA 4E30A 3WMWA 2PH5A 4CM7A 2WYWA 3FF4A 3NT5A 3GVXA 3U4DA 3WLFA 3FI9A 4Q3NA 3F9IA 2V7PA 4D7AA 3GHYA 3KVOA 1D1SA 2ZATA 1I10A 2XF8A 3JQBA 4TRRA 4IQ8A 3GUYA 4YJFB 4GLOA 2ZTLA 4GGPA 5CHEA 1SEVA 1V3UA 5KWEA 1EUZA 2VYND 2Q99A 1ZUD1 4IY1A 2IXBA 3MOGA 4DQUA 1PJ2A 4J9UE 4PLHA 5TX7A 2NU8A 1VJ1A 1PTJA 1DHRA 1YBAA 3HJAA 3P2YA 1QYCA 1B26A 5ENDA 1I32A 2HO5A 5U4QA 4PLZA 2Y66A 4I9UA 4M55A 3OSUA 3OJOA 4EEZA 2CZCA 3KBOA 4JK3A 1H6DA 3EDMA 4JCOA 2WD7B 1N1EA 4ND5A 4DPKA 1LXCA 1R4NB 3KYDA 2DM6A 1KVSA 4RPKA 1UZLA 3GA0A 3NTQA 2HLPA 4ZA2A 4LW8A 1TVEA 5T57A 1DSSG 3O9ZA 1CRWG 3ASUA 3CUKA 3JQFA 4WEOA 1ONOA 5CPFA 3LLVA 4IJUA 4BMSA 4TQGA 4YEDA 4ZU3A 2Y1CA 2O3TA 4KWHA 5ITWA 4R4JA 1DIBA 4ID9A 1ZK1A 2NSDA 5KJEA 3TZKA 4D45A 1U2DA 1ENYA 2LDBA 2WDZA 1QYXA 1QMGA 2AE2A 3NEPX 2W2KB 1RM5A 4KUHA 3UKOA 3Q3CA 4EUFA 2C2YA 1VE9A 2G82A 2X58A 3GZ4A 1I30A 2CDAA 1R37A 2C0CA 2CDCA 2BFPA 2VZ0A 3ZWYA 3BAZA 5C7LO 1E5LA 5EERA 4C7KA 3ICCA 2EF1A 3L4SO 4XQCA 1BHSA 1FDTA 3E6AA 4N7RA 3I3OA 2RHRA 3DB2A 1HT0A 5F5LA 4JBHA 4RPGA 2GNAA 2O4CA 4DIOA 4CLHA 3BHIA 3FRJA 2TMDA 4OXKA 4R51A 4E5KA 1E6UA 3F1LA 2C82A 4R41A 3D3WA 1QLHA 2CFCA 1LC0A 4XA8A 2H5LA 4F6CA 3CKYA 3QWIA 2Y1DA 4KTTE 4XGKA 4XB1A 2VOJA 4BO2A 3MWDB 2WMDA 4CQMA 4E6PA 2AEMA 1D1TA 5L40A 5L3ZA 3PZBA 4BNMA 1CIVA 2ZB4A 1GPDG 4NU5A 5F1PA 1SC6A 4A26A 4CMAA 4KQWA 1C1DA 3RC1A 4DQXA 5KTKA 1Q0LA 2DFDA 2GD1O 2GZ1A 1LSOA 1OOEA 3LU1A 3OJEA 1I2CA 4IPTA 3M6IA 4TRMA 1WVGA 1KETA 3C85A 1GYRA 2JCVA 3DFUA 1YL6A 3PQDA 1R0LA 2XOXA 2FPPA 2WWRA 2P5UA 3INTA 3K2EA 4DL9A 3JD4A 3RUDA 2ZQZA 2FOIA 2NQTA 3ZHYA 9LDTA 3ZU5A 2VWGA 2QZZA 2VUSA 4O6VA 4PLWA 3UFXA 2Q2VA 2POQX 1VPDA 4A0SA 5IDXA 2FSSA 5IAAA 1JQBA 1U28A 3GFBA 3QHAA 3DAPA 3GT0A 4LSWA 4O1MA 1HYGA 6ADHA 2VN8A 1YWGO 2YHIB 3E82A 1XG5A 2VZ8A 3RVDA 1IZ9A 1ZFNA 5KJ1A 3HE3A 1BVUA 1TT7A 1N7HA 3DBRB 5ENVA 3R3SA 3MEQA 1I0ZA 1IHXA 1VI2A 3NYWA 4PLGA 5ILGA 4PCVA 1AE1A 2FY8A 5IDWA 4ZGWA 5COQA 3HFSA 2FHSA 3C7AA 4NFHA 4DYVA 4IUYA 4GSKA 5ITVA 1BMDA 1MG0A 1G0OA 3L4BC 2A94A 3I52A 3ETEA 3X2FA 1V3VA 2NV6A 1YKFA 3W4KA 5JCJA 2E82A 1ISIA 5EESA 4A03A 4BNZA 4C4OA 2Q45A 1O89A 2Q1WA 5K6AC 3UCEA 1PL6A 4M49A 4EJ0A 4CM9D 4GPD1 2DU8A 1Z7BA 2HQ1A 3PJGA 4GI2A 3VZRA 1U4SA 3KRTA 4OOEA 4A10A 3PJDA 1IY8A 1H9AA 3NT2A 1I3LA 3SJUA 1HKUA 3H4VA 4Z0TA 2X0NA 4CLRB 3OHSX 4G65A 5JLAA 5L53A 5I9LA 3NAQA 4MKRA 1P33A 3VKUA 3V1YA 2Z5LA 1KEUA 3R6DA 4B79A 4A5OA 1RPNA 2IYPA 3CMCO 4L4XA 2NLOA 3STHA 1G6KA 5L4LA 1U2GA 3HDHA 8LDHA 4YBZA 1YRLA 2AW5A 3TN7A 1ULUA 4LSMA 3OIDA 1HYHA 3B1FA 3M1AA 4J91A 4PIVA 4IINA 2WE7A 1F0YA 1E1LA 1NNUA 3AM5A 1T2DA 5ADHA 4Q3CA 5DOVA 4GWGA 4J9VA 3E18A 4Q3AA 4BKUA 1FDWA 1GUZA 3FHLA 4XRGA 4QUKA 3RU9A 3ETGA 1SPXA 3GQVA 4YAKA 4HKTA 1GQYA 4XCVA 1NQ5A 1DRVA 3JD2A 4Y6SA 3HG7A 1W4ZA 2R00C 5DF1A 1M75A 4LMPA 1Q2XA 4EUEA 2VT2A 4K28A 5LC1A 2YJZA 3TZHA 4EBFA 1HDYA 3H2SA 1YDEA 3HNPA 3S55A 1VL6A 3KM0A 1U8XX 3NDIA 3ZWMA 1R66A 2OP0A 4MPDA 2X9GA 4RLSA 4CV1A 2Y99A 1A5ZA 4AJIA 3NDRA 3GFGA 1AHIA 3LT0A 3OP4A 2C5EA 1T1SA 4LCEA 2QG4A 1K3TA 4YAIA 1PQWA 1NAIA 1ORRA 2VT3A 3KLPX 3A06A 3VVBA 1NTOA 2QW8A 3D5QA 1CEQA 1DAOA 2AQHA 1LX6A 1VM6A 4FGWA 3TWOA 2D1YA 4RVHA 4G81A 3WBBA 2G5CA 3Q1LA 1IZ0A 3B1JA 3WGQA 4IBOA 4J49A 4BB6A 1SMKA 4MVJF 4LGVA 2GRAA 2HUNA 3WGYA 4EZBA 5JC1A 4UUOA 4KDFA 2XPCA 3O8QA 5A1TA 2OORA 3ETDA 3FNEA 3P19A 1BW9B 1G1AA 4CR7A 5T67A 4AJNA 5EL0A 4FJ2A 4WGGA 2CVQA 1KIFA 3TZ6A 3T7CA 4GQAA 3ZNNA 4CL8A 3GHHA 3L4BA 4EEXA 4PGFA 1JVSA 1P0FA 3KOUA 2E4AA 2VQ3A 1LRKA 2CF6A 1IUKA 1LC3A 2CVOA 1QLJA 1H2HA 4PZCA 5K6AA 4CLOB 2Q1TA 3ZW8A 2BELA 4UUNA 4BGEA 5C7OO 4LK3A
chains in the Genus database with same CATH superfamily
3V7YA 2O2ZA 4OHVA 3GDOA 4EGAA 2WTXA 3JTMA 1UMBA 3FZQA 4RZUA 4HBZA 1MB4A 3H04A 3FPCA 1T2EA 2GPSA 3PF9A 1EK5A 3RVLA 3N8GA 4R8RA 3W5HA 2E6UX 3H8VA 3SZ3A 2PIAA 3ZNQA 1SA0B 4J1NA 5BV0A 5EG5A 3IVCA 4EM6A 4MWOA 1K1EA 1RWWA 1S7GA 2AJCA 4PAMA 2QTBA 4WOCA 2Y8EA 3OJFA 4WIAA 1CUVA 3STTA 3MTBA 3IMCA 3ZY5A 1U0OC 4KGDA 4U2DA 3IERA 4F5EA 1Q3HA 1JLMA 2ZIWB 3IUNA 4LGMA 4RW0A 2ZIEA 2WUDA 2HSWA 5A7GA 3FUCA 1Z7GA 5ER9A 4E5NA 1F9EA 1HFKA 3C16C 1QHFA 1SKUA 3Q0IA 3KJNA 5BNTA 3Q5GA 3A7DA 3GPCA 3BA6A 2BZ1A 2DLDA 2GJKA 3ESRA 2OAGA 4ISCA 3A11A 4QYIB 5ICCA 3FSEA 4AJ4A 1PJRA 4Q21A 2OTCA 5HQ3A 1Z0UA 1ZESA 4JNCA 4NNPA 1AF4A 1E32A 1PG5A 3CURA 2VJNA 3LM8A 3UAOA 2XCOA 2Y77A 3TNFA 4ND4A 1MTZA 7REQB 1P1BA 5J1SB 2C7VA 4KAAA 3PQ6A 2EHJA 1EXWA 4YUAA 3LY8A 5HYVA 3FCCA 4D0NA 3TW6A 4DJFC 4QJ3A 5L95A 4YJ2B 4KPGA 3ZDCA 4RXMA 4X7BA 4ZVUA 5AVTA 3EOAI 4RA6B 2FWMX 2YV5A 1TT5A 4BPRA 5ELLA 4LGCA 2AMLA 4OL9A 3AMVA 4I5DA 2MINB 2DHEA 1VL5A 4WD3A 3IT0A 3PR2B 3TX6A 1IDN1 4IIDA 2B94A 2Y76A 2OXTA 2MYUA 1UBJS 2HCBA 3BB4A 2AZXA 4BE4A 3NVAA 1U0NA 2NT4A 2F9MA 2R6ZA 5IKEA 2QYSA 1OFHA 3TVDA 1GL6A 4XCQA 4G1EB 4HH3C 4QGAA 4D6YA 4DIUA 4MXDA 3CRVA 4FLMA 4YR7A 5IVKA 5I7RA 1FXWA 2O05A 4OHRA 4YIHA 3MELA 1E6MA 1Z0JA 1Z5GA 3U4QA 4M9SA 3FWNA 4PSKA 2NTEA 2JCSA 4WBNF 4EDFA 1CXZA 1MB3A 4RIHA 3QRWA 3F7TA 1EB8A 4FONA 4BATA 2Z1MA 1OZFA 4FKMA 3SK0A 5BXYA 5I3ZA 1ILEA 4Y6RA 1UBOS 4ETNA 5HJ5A 3U40A 1T8PA 1U1FA 3LW8A 1YR2A 5E4JA 2GCPA 2G5TA 3IAUA 1PR1A 4C7JA 4Q39A 3VVLA 4LBYA 1EFPA 4PLVA 5ALNA 5AWFC 3Q3HA 3CH6A 3DMFA 2AWNA 1QH1A 3RFVA 5I9TA 1DI0A 4KMMA 2ZCVA 3ZHUA 2AL7A 3BOSA 3O7MA 3RSHA 3BH7A 5A9RA 3GJ8A 2DQKA 2BFDB 3OAAA 3BCUA 2WHPA 2W2MA 3DUFA 2UUOA 1GGVA 2G0TA 4W5WA 5G53C 3RTDA 3HGTA 4PXSA 2Z6UA 4FFOA 1YIDA 3PNQA 3K9QO 5A6SB 2MYTA 4Y2HA 2RH5A 3KB8A 4UOEA 4RKQA 1IAQA 2HJRA 4DG5A 3TSAA 2AV6A 1ZIXA 2JGNA 3KZXA 3FWZA 3LA6A 1JIXA 1R9JA 1QNLA 4KIJA 3OUUA 4HAIA 5ICFA 2ZPUA 1P2UA 4Z9FA 4BFXA 3EAQA 4DWOA 1W25A 3AUYA 1YMQA 2O5VA 1K7XB 2J85A 1L7EA 3KQPA 4IXDA 3B60A 2FRDC 4L8WB 3ZWWA 3I9LA 3I45A 2WWHA 1C9JA 1FX1A 1II9A 1UXIA 3LXUX 4A2WA 2GAFA 4HDSA 1K6MA 4D79A 2VF7A 4MVJP 3NIWA 2J9FB 2JAOA 1PLJA 2EKBA 1CKEA 1PWYE 1G8KA 1XXLA 2P2GA 2AFHB 3BCHA 5G0VA 3TQHA 4E09A 5DWDA 4PSUA 5IFLA 3BWDD 1QHYA 4NFSA 2AGVA 2EEPA 2WQ7A 1TTTA 2QG6A 1Z4NA 3RVQA 1PZFA 3NHPA 1OE0A 1IMJA 1HLGA 5J59A 3L7BA 3HY4A 2AT1A 3QFHA 2OLKA 3QKSA 2IU4A 3ZXSA 4F1JA 2YKGA 3W5VA 4U2CA 5G02A 1DBRA 2I3GA 3MA0A 3BZUA 2YJGA 2Q6OA 2GYYA 4RD3A 3HFRA 1GYPA 1V9CA 2Q4OA 4OF4A 3TZCA 3F1KA 2OB2A 1QIKA 3VMMA 4Q9AA 4ZO7A 3LHFA 2D8MA 4N9WA 1K4KA 2Z9DA 3NZEA 2ZRAA 1K4YA 3OZ7A 4RD0A 2P9BA 2HBQA 3DMGA 3OMXA 1UC5B 1JIIA 1UZAA 4IVPA 1LUAA 5AYVA 2MR5A 4OHUA 2QI9F 1BYUA 2FK8A 2LKDA 1T0PA 3L0OA 2PWYA 4IH4A 1E8DA 2HRRA 3CF4A 3M6UA 4W4TA 2QS9A 2UZ3A 4C21A 4WK6A 2OBMA 2YIMA 1HNWB 2Q5JA 1YZVA 3T1VA 1SUBA 4WI1A 5DCWA 3RWMB 2R7AA 4C4XA 1ZISA 3FTPA 1VHTA 3HKBA 1FNBA 3VO2A 4P32A 2C57A 1RMTA 2D5BA 3V8PA 1A4IA 2JJMA 5C32A 3NFYA 3WKBA 3O3NB 2HV9A 4EW1A 4X91A 2PMEA 3WHKA 2P7IA 2OV3A 1ZA2A 1FFEA 1YB2A 4JUBA 3RYHB 4EKGA 5KVSA 3W4JA 4MMYB 1X7ZB 3C14C 1X1TA 4FWBA 5DI9A 4JJIA 1RAEA 2PKYX 1X1BA 2E4YA 2OHVA 3ANNA 3BXXA 3K09A 3WA6A 1I33A 5CUQA 2PIDA 5CLIA 1AUXA 2LRHA 3OICA 3UGQA 3F9RA 4JI6B 3JXEA 1I6KA 1NZJA 5BORA 1YOVB 1Q1AA 2QNBA 5A0FA 2JGLA 3K9WA 4ZXPA 2DTXA 3KSRA 4NICA 4AY4A 4B35A 2IE8A 5DT9A 4GZLA 1QHIA 4JY7A 1ECJA 3S8EA 2DT8A 2CLFB 1QCZA 2Q3DA 3QOWA 4W82A 2PV0A 4JL5A 4QU9A 3BMCB 1TZ2A 1VLVA 3AUSA 1L4UA 3PXXA 4ZOCA 1YTLA 2YUTA 3ROEA 1ZR2A 4I50A 4BNDA 4OLBA 4YP9A 4Z4HA 5CDFE 1D0VA 2ZSKA 3B3FA 3PL1A 2B1IA 2XNDA 4Q3LA 3SX0A 1VG8A 1JDJA 3B5EA 4MVJM 2XEDA 1G60A 1BHO1 4KR2A 4MR7B 4IIBA 3KHSA 1Q12A 4PAQA 1JHUA 1GRQA 3P0RA 3QUTA 4M1QA 3ZHSA 1M2OA 1XPJA 2WAMA 5K4HA 3RREA 3NALA 2Y0BA 3JQ7B 4MS4A 2OZLA 3OCJA 8OHMA 1YI8A 4LHXA 4GMFA 4TV8A 1SUIA 3NOQA 3ZNPA 5A9SB 5KOYA 5HUJA 3DS8A 4MRMB 5EUCA 4DR6B 3R77A 4HZGA 4I66A 4OJTA 1K27A 2QJWA 3PFIA 2ZBFA 4AMYA 1IVYA 3FHJA 3I58A 4MRVA 1KKLA 1KYWA 2Q1SA 3TBKA 3OO1A 5G0SA 5KVAA 2PT6A 1BH2A 3DZIA 3NGXA 4IP0A 3C3XA 5G0UA 5SZHB 3ZCPA 5A4DA 2QPOA 3I6QA 4BUCA 1WDTA 5CYOA 4BP3A 3O4RA 2JJ2D 3ERCA 2P2ZA 2ZUUA 3T7JA 2GAAA 1M2HA 1N3YA 1OR8A 2EV9A 2IPLA 3FUXA 2D59A 3GBPA 1HURA 2WIAA 2XB4A 1VBKA 1JQKA 2O1XA 4Z8XA 3PC4A 5I5EA 1C50A 2B20A 2V6BA 4NRDA 3G5UA 2DBZA 3JRNA 2BFAA 2YRXA 5K8IA 2AUMA 1UF9A 2VH1A 3MBIA 1EVQA 1MP0A 1WUHS 2CYBA 3D0KA 4XARA 2XE6A 1Y9AA 2A57A 2YNMD 4R1NA 4EB0A 3IHLA 5HGJA 1R27A 4DNOA 2CDRA 2DPYA 4YBRA 1GUAA 2QLLA 1POWA 3OZDA 1KE2A 1B0AA 2VYVD 1Z82A 2J6HA 3VZPA 2XUOA 4DJAA 1WUIS 4L85A 2AXQA 2OG2A 3DBLA 4OB8A 1TVMA 2WPDD 4QO8A 1O94C 1QG4A 1X1EA 2FWRA 2XDAA 4M53A 1JDTA 4S1PA 2HUPA 3VBCA 3WYBA 2XTNA 4TVKA 4YCLA 1SBHA 4NP6A 3LIIA 5HA5A 5GMOA 2TMGA 4MWZA 4ZOEA 3K8YA 4Q9NA 3G68A 3Q0TA 1O96B 2ZM5A 1DEHA 4QTZA 3MFQA 2ZVQX 4MLZA 1PW5A 1R1DA 1W5EA 3V4LA 4WOBA 1HGXA 2H7XA 4PZPA 3EZYA 2V7QA 4KOEC 3FSGD 4JL8A 3AFHA 1FVFA 1XHFA 3CO5A 1UUFA 1IK6A 4ZU1X 1TAHA 2FN7A 4YCNA 1J1ZA 1N2SA 5B7PA 4B75A 3LYLA 2QGFA 2WHEA 4H9GA 3GDGA 5H4HA 1E3DA 1L5RA 1P29A 4LBZA 3ZZMA 4MV7A 4IV5A 2Q4TA 3WS7A 1L5OA 4X60A 3RS5A 4RORA 3IURA 2XWQA 2P9GA 3JZIA 3INGA 5DBHX 5LYJF 1S1CA 4RABA 3HM9A 4MQMA 2DWQA 3G6WA 5KYWA 1QJ4A 2IIBA 4CUJA 3LXRA 5IKMA 3LQRA 2CMHA 2EARA 2QRUA 4HNAB 1T2VA 4RF4A 3KCQA 5AD1A 5BMVB 1C3LA 3NMUF 4FHCA 4C89A 1WCIA 1MEOA 2O8FB 4QUHA 3HEMA 1I7DA 4E70A 3K70C 5FDFA 1CQJA 3ZV6A 4MWGA 4YRGA 3E8SA 3B51X 3H5WA 4H17A 5DOZA 5A0TA 1G21B 4M8SA 4N3BA 4A9AA 1EVLA 1C4OA 2FZLA 3GP5A 3E3MA 1DB3A 2QSYA 4URYR 4WJZA 3OQ1A 3FPLA 2HA4A 2Z0MA 1Z47A 4L50A 3OX1A 3TCKA 3GLFA 1TPZA 2Q3CA 2QY9A 1W0JD 4DMUB 1LS1A 1YB5A 5AM5A 4EOGA 1RZRD 3W1VA 4LSZA 2QTRA 1US8A 5C5CA 1MAHA 3I2IA 3EVTA 4EQ6A 3AUUA 2Q5EA 4FXOA 4DCNA 4INZA 1OC4A 3B1WA 1EJ0A 3G2HA 4LRSB 4IOKA 4M1ZA 4DRZA 3GEIA 3GF4A 3PHLA 4PRKA 3WK8A 5DGXA 2FMFA 4ZGBA 3OE4A 4N6OA 1XEXA 2C0PA 4IXMA 5D5QA 4YRNA 3F6RA 3V7NA 3FROA 3PA8A 4GKAA 1KGDA 1NZDA 4KLRA 3MM4A 2C3MA 1Z08A 1I8TA 1NNLA 2AQKA 1SU4A 4BB5A 1HYBA 5DN6A 4HATA 4D4JA 2YJTD 3G6KA 3M5CA 5JZMA 2IYUA 2WLSA 2AOUB 4K6CA 5H7XA 3TIXB 3M49A 1TAQA 3OZIA 3AY6A 4PPQA 2JAUA 3U81A 3ABQB 5IMSA 5D1HA 4FQ7A 3ORRA 4GR9A 3RG8A 4ZHQA 2HMYB 1EWYA 4LVOA 3TIGA 3V32A 4LRXA 1QORA 1YOBA 4QYMA 4OKNA 4QDJA 4X20B 5EWMA 2QUBA 2MSLA 4JVSB 1NPDA 4D41A 4FEAA 2NXJA 4DC0A 2VR1A 2GCGA 1Q1BA 4CU2A 1MG5A 4OMUA 5EIAA 1L7VC 2EP5A 1OBOA 1X87A 1VSUA 2Q7XA 3AUKA 3BEDA 1EVEA 3B78A 3CONA 3HUFA 4KFSA 5C52B 1QRTA 3UANA 4WZAE 4FNMA 5F5NA 1SCQA 1LSSA 1Y89A 2COUA 4NPAA 4YB8A 2VH5R 3L9WA 1VFPA 1B93A 3NHUA 5KOIA 1Z2CA 4B83A 3I9MA 5DK6A 4XGIA 1R4NA 3LWDA 1YA4A 1NYTA 4TV9A 4DJDC 4BS9A 5BPHA 4XIIA 2C03A 4V0ME 1B7GO 1A5TA 3F6PA 5H02A 1MJGA 1EE2A 1MABB 3FW1A 3B20A 3ESQA 3P4XA 1TYDE 1JALA 1V47A 4OTZA 5DKFA 5HJEA 3RODA 3KETA 1SIWA 1ORHA 3BMNA 4DSUA 5PGMA 2OYRA 1X7YA 2HADA 3FMPB 1F4PA 1U9IC 5BRJA 5JNRA 3OLWA 4WOKA 1NL3A 2FUKA 3MCUA 5IAEA 4MW7A 1DAPA 3PLRA 5HM8A 1FU4A 2H1VA 5DYTA 3VDNB 2D2EA 3GPLA 2D13A 3DW1X 2XRFA 4POAA 4BNHA 4N1AA 2PLRA 2VBFA 4QREA 1KZ6A 3U4IA 4DV6B 4B6SA 3V5NA 2EKQA 4FFVA 3K5IA 4K7JA 1N0HA 4N01A 4OFZA 1XZJA 4G5YA 3MD0A 5FWYB 1VHLA 3MCTA 3G2PA 2H4FA 1E1QD 1GPKA 1HE3A 1YSCA 1E18A 4PN7A 2V45A 4PZYA 1RI5A 1ESMA 3RKSA 3KXIA 4JKYA 1NBIA 2X0FA 3A32A 1E0JA 2PMFA 1W5TA 5L4NA 4IXTA 3UHAA 4HAWA 1XNHA 5D3ZA 4F60A 4O4HB 4GPAA 3K9LA 2OB1A 4LXQA 1NQTA 1VZ3A 1X9HA 3WGUA 1WVIA 3G5LA 5L7YA 4Y9TA 1B3RA 1EXDA 3C7KA 4K9NA 3RR2A 3ANYB 2LTAA 5EUBA 3IIIA 1XRQA 5FADA 3SX4A 2AC7A 1KOLA 4JUAA 4HDKA 1DQNA 3GG2A 1FFAA 3G5TA 1HYQA 2P9JA 2XADA 2R5FA 4CPDA 1FTWA 4I4TA 3VSDA 4X5OA 3E9RA 3AONB 3KR0A 3P9ZA 4G2NA 3MWDA 4WXMA 3EBOA 2WNIA 3ZK8A 5AR1A 1CR6A 1G98A 1ZOLA 2A9OA 2JHCA 4H18A 4MJ3A 4XVHA 1ZSYA 1IB6A 3EUEA 2YYSA 3L82B 3L7MA 1YR3A 2MIIA 4N39A 4YJGB 5JC8A 4ZFNA 2EBFX 2G0NA 3AEUA 1SZJG 1Z4PX 3IVXA 4NJOA 3GLGA 4MQLA 2VDPB 3GBVA 1JEYA 2GN0A 4WE3A 5M34A 5DCUA 2GJSA 3ICQB 5KCMA 1XCPA 5LDHA 1O3YA 2FEPA 4KWTA 3CTMA 4JQZA 1TGYA 4V24A 2Q21A 2OM2A 2WSBA 4BC0A 4YXWD 5KOJB 1D9XA 2XYHA 3GR6A 4W5NA 1ISSA 2R5WA 4QE3A 1CJBA 1J8MF 2RGDA 2VCYA 2X4IA 3N53A 4P36A 4XM1A 5DRYA 4BP8A 3WGNA 1IOWA 3L1JA 3LGSA 4Z54A 5JJKA 2ZS9A 1WX1A 3M82A 3NEAA 3QW4B 2TS1A 2GEFA 4OI2A 1VL2A 3DEIA 1SBYA 2QBYB 1KEWA 5JBNA 4E5VA 3BD9A 5DBFA 1NSFA 1WVMA 2AYXA 2ZU0C 3CEHA 1RBZA 2O4UX 3FZEA 3KJEA 2NU7B 2ZTSA 3NS7A 1XLWA 3GJ5A 4O25A 3ULKA 3ZKWB 4UQPA 4POOA 3L0YA 4FNAA 4PRYA 1JHZA 3DHWC 2XYGA 1PIWA 4ZICA 3LFHA 2B82A 4WY2A 1UOQA 2Q8NA 3TTSA 1EGQA 1BWSA 2CXPA 4Q4JB 3MLEA 2IODA 3D6NB 1I2BA 3HCDA 4RE6A 5AJZA 3RUCA 4CIDA 1UDBA 4CTKA 4QLBA 3DDWA 1LI4A 1TYCA 3I0NA 4DN6A 2PUEA 2PKQO 1JEEA 5HDBB 4Y9RA 1WB9A 5EVCA 3RLIA 5EIOA 3F5DA 3HXKA 5LXTF 1BXZA 4GNKA 2XMGA 3QXJA 4G5FA 3FTCA 4C01A 3MXTA 3EXHA 4AS3A 3EC1A 3OF2A 2O2EA 2Y1KA 3UN1A 4JXZA 2HFKA 4YMTA 4CWAA 5JR3A 4JVMA 3WTBA 2JIBA 1CT9A 1DIRA 1T5OA 5A3JA 4FYKA 2H1IA 2WWTA 3I05A 1KY5A 4J4TA 1TMOA 1R0SA 2O7SA 2RHDA 3ZDAA 4M0MA 2HU8A 2QZPA 2I4NA 3MERA 4OIMA 3A6HA 4R7GA 5FLEX 3DNFA 1G41A 4LVCA 5LQMA 3B9QA 4QPDA 3E3NA 4Q24A 3SZMA 5IG2A 1MENA 4ILEA 2X2FA 1UPTA 4Z6KA 4AN4A 3FRIA 3CNEA 4BE7B 2GT1A 3LCCA 2Z1NA 3GCGA 3T3MB 2FGJA 4LECA 4E3ZA 3I8SA 3UV6A 4DQDA 4CEJA 1PKXA 3OM1A 1Y1PA 3TTTA 4EHLA 1IPHA 2FWAA 3QKUA 4JEUA 4R6WA 5EIBC 3R9KA 5JSZB 1L3BA 4H7DA 3LKVA 1DBQA 3OE5A 2V6IA 1G20A 4KACA 4TYMA 2WLTA 4BMXA 5C37A 1CR0A 2A92A 4DLKA 4MDEA 1GCIA 2ZI7A 1R5BA 1FFXA 4D42A 8AT1A 1JDNA 2G09A 4NS4A 5BOSA 4EMUA 4ARVA 5IWCA 1CY2A 2J41A 3NUZA 3T1TA 5ER6A 3TXYA 5J4HA 2C1XA 3EEIA 4CTOA 4URVR 3HDGA 3QY9A 3I2FA 4I6JA 4JA0A 1XDUA 1Z4OA 4KIFA 2RE8A 4OM7A 3MLAA 3KQUA 4LE0A 2OPHA 3A1VA 4UM9B 1IZYA 1PS8A 1JR3D 4LJ6A 1YR8A 1J5XA 5C8YB 4HRVA 2PKWA 3HI6A 2V7VA 1O6GA 5JAQA 4OAQA 4C06A 2WTBA 1E1KA 2Q2NA 3HU1A 1EP2B 4YMWA 4J7CA 5U4XA 4Z7QB 3Q7RA 3L7LA 4RD6A 3ONNA 4WJLA 1HI9A 3M2TA 4IX9A 3TZQA 3WMRA 1EFRA 5D6OA 1BQ4A 1ZPDA 1UT6A 5A2QA 1BE6A 1T8RA 2QN3A 4RMJA 3BREA 1Z06A 5D8DA 1GSIA 5JE8A 3RM3A 2BKLA 4MVJI 5HVNA 1RWQA 2JLCA 4JUIA 1IC6A 3S99A 4K0RA 1EB9A 5HMMA 2ZJZA 2WTEA 3WBJA 4D57A 2GN4A 3CLUC 4ZZ3A 2JBAA 2IGTA 4IDAA 2Q8PA 3PK0A 5HS4A 1DC6A 2ZRMA 2Z83A 4OHOA 3RF6A 6YASA 2PX0A 3DVRX 3FFAA 4PYNA 3WICA 2XQFA 3GLSA 5HTKA 4PYMA 4RTNA 1NPTO 4NV1A 2IEDA 1IN6A 1HFJA 4NABA 4LYDA 1WPXA 1DLIA 1KDPA 2ECQA 1CRQA 1BW9A 3FVTA 3S70A 1PJ8A 3DVQX 3WRXC 5B7QA 3T0IA 3FKSD 4US2R 5IZ4A 1AMNA 1Y8CA 2X0KA 1ZICA 4HEQA 5HZKA 2QX4A 3C3YA 3IHTA 4LYFA 4QYXA 2Q3HA 4IMRA 5K8LA 3UOWA 5K6RA 2PUJA 4OK3A 5F9HA 3W9BA 4CBVA 2W2TA 4NCNA 4XI9A 4DF3A 1NXQA 1SZCA 1UBFA 3QLVA 4N65A 1XIVA 5BSEA 2BTQB 4J16A 4YRSA 5DTRA 3S3TA 4ZDKA 5AW1A 5FBQB 3UHOA 1IBKB 1QU2A 2QT0A 4EYSA 3H4MA 1MX1A 2NTVA 3LIPA 4C1BA 1WXFA 1EX6A 3J80A 3SR4A 4I9HA 2XWBF 1Y1LA 4LN1A 4P4TA 1KIMA 3W8DA 1GDTA 4M8KA 4NLLA 3BF8A 3NOXA 1UBUS 4P82A 1XD8A 4C7OA 3UC9A 3K4PA 3BSWA 3ZIUA 4QJ4A 3HB4X 4HQNA 3DM9B 4PZDA 2SNIE 1QDEA 1TLTA 2ZQYA 5K3BA 2WC1A 1HDZA 4AKEA 4CKCA 4EVIA 1E6WA 4ND6A 4P7BA 4XGQA 4NZPA 2DQSA 2BR4A 1XKQA 1AGNA 1N9KA 3CG4A 2QT1A 1UJMA 1H2BA 2ZBUA 3EJ6A 3G8BA 3WL8A 5A4KA 1A77A 3IP8A 4IJMA 1ZBQA 4K81B 1Z6PA 3SR3A 3GLHE 4GWLA 1NVUQ 5JWHA 5C7YA 2WKQA 4LYYA 2J5XA 3ADPA 4US1R 5AVYA 2BJHA 1R5OA 3R5KA 4X54A 4CMGA 1WR8A 4XAQA 4OSPA 1MORA 1KI4A 1Q1EA 2JJ8A 1GGKA 2Y1XA 3R0JA 4OM8A 3VTKA 4EH1A 3WQBA 2F62A 4YP7A 1EXNA 1EDZA 3N8DA 4NYMR 2HQRA 1P2BA 1ZM7A 1MO3A 4N0EA 5MGNA 1E7YA 3VKVA 1HMYA 2PZAA 2FW1A 4W8GA 3WA7A 1DTWA 3NUGA 2J09A 4QOIA 3N28A 3H0EA 1Z28A 4EGSA 3D8NA 1BDHA 3PVZA 3VZDA 1GTRA 4KKXB 1K3FA 4U2BA 1GQRA 1PSDA 4OQLA 5K2MA 3KB6A 4YRAA 4YV1A 2G1AA 1HE5A 2WWWA 1H0KA 2FDRA 2XX3A 2W00A 3HB1A 4RDIA 5CH3A 3I2KA 3K05A 1ZD2P 3PUHA 5AIAA 3NC0C 4ZQEA 1PEAA 2KS6A 4ZT5A 5H83A 5CLJA 4II7A 2EGHA 2P4SA 4EHFA 3EGOA 2YVLA 3H8JA 4QODA 3AETB 3HBLA 3OJWA 4Y2UA 2UZ1A 2GHQA 1R6XA 1TD1A 5DXJA 2HJHA 3SHFA 1B16A 4GR5A 3ZE7A 2JJ2A 3WVNA 2IUFA 3FMVA 2OPBA 2NTNA 4PQEA 1AH2A 4WUTA 4L0CA 3H8SA 3U7HB 4DMFA 3SEZA 1EDOA 3Q87B 4CMIA 5DGTA 3QF7A 3QKSB 4XEUA 4RCVA 4TRNA 2HMAA 2IQ5A 2ZR0A 2V6MA 3HMQA 1GUBA 1N6OA 1WXIA 1KK3A 5CXQA 4P81A 2JKZA 2RIRA 2YNMA 3O31A 1RQXA 4XWWA 4V0KA 3BIXA 1RPJA 2D5CA 2YQZA 3DULA 3H5AA 3IEVA 2AWOA 4N0QA 2VYVA 1Y4AE 4RANA 4OX9B 2VAVA 3OE1A 4IH9A 2WDPA 3UKDA 4W6ZA 3UAXA 2CNDA 2QL7A 3DM5A 2WPDA 4QU0A 3NPMA 2Y0CA 4XYGA 1GFIA 1T3HA 3EDRA 1TCCA 2CVZA 2CYAA 2VJYA 3U3ZA 2W70A 4KI7A 1AIPA 4ZTZB 3C0KA 1RZVA 4TLCA 5FPQA 1ZUHA 3A1NA 5HJ7A 5KOHA 3OI7A 4LZAA 1YR1A 2WR8A 2BMJA 3EDQA 4MRSA 4EB3A 5JWOA 1ZRNA 1KVRA 2W6PA 2VAPA 4UNQA 3BTVA 4ZI7B 4UTPA 1M0WA 1HOXA 3HKBB 4HH4A 2I7DA 2K2WA 3D31A 1LLQA 1DKLA 1J5PA 2A14A 3BRWD 4RHCA 4WT7A 4MJLA 4Y1RB 3M6XA 1Y7HA 1GOTA 1EQ2A 3NP9A 4NV3A 4TMWA 5KU7A 4ZCTA 5KSZA 2ERXA 1EUDA 1E3SA 1GZDA 1QHNA 3FSGA 3LCUA 3NR2A 1OT5A 1ZK2A 1GHTA 2IZZA 1VPVA 3LVRE 4P3KA 5C8VA 3IKJA 1F4VA 4J7AA 4ZV9A 4FDTA 2Z6AA 1GTVA 4WLFA 4EG6A 3DZHA 1BU5A 1VTKA 5CCXA 2WD8A 4QU5A 5IKOA 4DLRA 5F7XA 4S2EA 2WU1A 1Q0UA 1AQLA 4UEQA 4XQ0A 1U63A 1K9VF 4CFYA 2PZFA 1ZOOA 4EHDA 2HGZA 5TRTA 3DF7A 3OCXA 4UHFA 2YVAA 3RIGA 3SMVA 4YPVA 3GNTA 3RS0A 1G8MA 1ORWA 1FMLA 2L69A 2ZB2A 1LLUA 5CIYA 3ZH9B 1OB2A 4KW7A 1N36B 5L3QB 2QQ5A 2OXFA 4Y3UA 3A1WA 4GLLA 4QQ8A 2REXB 1MJFA 3PQ4A 3A6DA 3BTUA 4FSHA 4UAVA 4Y9SA 5GJWC 2I4TA 5HF8A 4EI9A 2REOA 3DEZA 3DAHA 1N2BA 3GA7A 3WWZA 5KVCA 5LU9A 1KI7A 1X19A 4FNOA 1LLDA 3EFHA 2IXEA 2N1BA 1W0JA 3HFJA 3OPXA 4M37A 1QAOA 1M2OB 3DPUA 2CLLB 2XCQA 4FT2A 1I7SB 1RZRA 5NULA 5J3JA 2OZLB 2XNCA 4KSCA 4FGJA 4XXHA 4BECA 3HXQA 1IAVA 1Z2DA 5DO9A 5GQSA 4D9FA 4CJXA 4FK8A 5KNBH 3ROGA 1IVSA 4EJ6A 1JS1X 3DVAB 3OE7D 4HTFB 4DREA 1DCKA 1U9YA 4Z4GA 4ZT4A 4R0MA 2O2YA 2VQFB 4N3CA 3CE9A 1GNRA 1Y1QA 2O3RA 2QTMA 4YV2A 3NJ4A 2N3ZA 2PSDA 4MUJA 3QELB 3ROPA 3ZD8A 1R3UA 3V1NA 4BNXA 4A2CA 1AKMA 4F5ZA 2BI4A 1IHPA 3ZWDA 1C7IA 3BWMA 3DQQA 1Z63A 4AJ1A 2ZAYA 3EBPA 5E0KB 5AMXA 1L4GA 2GYWA 2YWDA 3HBJA 3B13B 4L75A 4KR0A 3OPYA 4NECA 3D3EA 3LYAA 2EFHB 4L2IA 3U7QA 4AJKA 1ZJ5A 3L7YA 3ABSB 1IRIA 5JDIC 3PEFA 3DMNA 4NAHA 1NT2A 5BQPA 1KBQA 1GY8A 2IPMA 1DPFA 3AC0A 3BH6A 1DWUA 3B9RA 5E9AA 1FTSA 3L41A 1GAWA 3H3XA 1ZI6A 2FXVA 1QZUA 2O54A 5J9FA 4NBTA 3DEYX 5LZ4A 4RYLA 2GYUA 1WXQA 2F1IA 2NVWA 3TJRA 1WXDA 1EVYA 3H4IA 4C2UA 3A58B 4YRFA 4K6FA 4MSUA 3PWZA 4Q4LA 5AW4A 3BVPA 3CF4G 4FU0A 2TECE 1IN7A 4FOTA 4TVBA 3NKVA 4W99A 2C4MA 2WIFA 1ECPA 5BSHA 5AM3A 5H80A 1OV6A 3N2KA 5HRAA 3FYCA 5JCXA 3AZOA 2VXCA 2OZKA 1QP0A 1WKCA 3GH3A 2I4RA 3MIIA 5ECWA 2O3UA 2WYVA 4URWR 1E61A 5J4KA 4MWTA 2J6IA 4HJRA 1R9MA 2XDQA 3BMOB 3R3XA 2P1DA 4LXIA 5AKKA 2Z58A 4QGFA 3O1IC 5B30A 3R0ZA 1BWQA 1IJEA 3BTOA 4Z99A 3F5FA 3HRKA 5E8JA 4DR1B 2Z95A 1P5JA 3HYRA 1OX4A 2C5FA 2XEXA 4JI7B 3EIOA 1I5RA 4IQGA 1Y5LA 4IO1A 4U6SA 3NHAA 1L7PA 4BKOA 1O0SA 3GROA 1NYQA 3P96A 4DPMA 4TTPA 5GGYA 4L5YA 2E2WA 3RFXA 4J1TA 4BFUA 3TRFA 4BLUA 1N5OX 3HCRA 3LX6A 4OLFA 3QE2A 1NU6A 1MB9A 3CRZA 2B3DA 2H52A 1L1QA 3ABZA 1JVNA 1XD2B 3JARB 5C0OE 4ZIRA 4S35A 1YQQA 4TXMA 1WBBA 2QPAA 4PS0A 3TXXA 1ODKA 1E1QA 3M3DA 1B74A 4IJVA 3WYGA 5F52A 4U0JA 4PWZA 1IK4A 3ED1A 5JNLA 3OH8A 4GSYA 5LUAA 1N2XA 4JMPA 3NRJA 2JARA 3R5FA 4TYQA 5TNXA 3SHVA 2AEEA 1WCIB 2JH9A 2GRUA 2O8BA 3D4PA 5B6JA 5IF3A 1SC1A 4WERA 3QFFA 3ZDEA 1CQJB 1HQYE 2B5VA 1V6AA 3LUBA 4NJMA 3TINA 2H85A 4RVSA 3R7WB 3WYAA 3RRZA 1N6RA 4KUGA 4R2KA 4B3RB 3GCZA 2QG9A 1RLUA 2NM0A 3I04A 2CJYA 3K6JA 4O5AA 4B6JA 3L0DA 5KQGA 3ESXA 4XWOA 4YLEA 1QUFA 3K9CA 1SVUA 2B92A 1QO9A 4J0FA 2YHBA 4FZ3A 3EZ2A 4G1UC 1T3ZA 1M6WA 3RSGA 5TIIA 2VJBA 3AOEA 5JAMA 4DIBA 2B6HA 5FX2A 4EQ6B 5BYKA 3ABIA 3ZG6A 4B3GA 1RQLA 3LOQA 3U4GA 3ZWXA 1G8HA 3TFOA 3RGWS 4OQFA 3GT4A 5BV7A 1SC3A 1J07A 2X8BA 2ZUWA 1H1LB 3HVKA 2QDKA 3F5QA 3NGMA 4G0PA 2QLTA 2G9NA 2IU6A 1QM5A 3N58A 4L6CA 1XEXB 1TU0A 4MGYR 1CUAA 4EQZA 1NT4A 4HQLA 8GPBA 5GONF 1AOXA 5JOQA 3K6SA 1ZUNB 2OO5C 2W2QA 1FUKA 3MJFA 3ORHA 4KJXA 2IP4A 3BK7A 3O4IA 1SO8A 4LDAA 3REFA 3DTTA 2DFKB 5KMGA 2WD9A 4YXWA 1J0CA 1KPGA 4IDFA 4RF3A 3DZJA 4CMEC 4GPEA 5KBYA 4EJSA 3LUKA 4H1UA 3IBTA 5E7QA 4J07A 2BSQA 1FFDA 3OO0A 1M74A 1GT91 1T35A 3G89A 3BE6A 5EJAA 1TXGA 3U3MA 4ZHQB 3WP1B 2G1PA 2FKAA 1Z73A 4S1NA 1WOYA 3UB2A 1K8ZB 1NP3A 1SUFA 5AKZA 5HK8A 3WYFA 1W52X 2B7BA 1F8XA 5LQNA 2H1OA 4LZLA 2PWAA 3OQ6A 3GFSA 4Q1AA 2VHCA 3FSRA 3IIKA 2D74A 1NE2A 4M9QA 1Y7IA 3D7LA 1UMDB 3DMRA 3WJAA 2PZEA 4BMDA 2XVXA 4B3BA 3R3WA 1QVAA 3QXCA 1P5ZB 4BO7A 5LU8A 3JQAD 1YZUA 4O2AF 3LVQE 3MIZA 3UVEA 1V9SA 4BLRA 2CV0A 3IP3A 3QVKA 5L4SA 1M67A 1OXBB 2E3JA 4D3SA 3OFKA 1WW2A 1Z74A 3D1VA 1HE8B 2BIFA 5LA6F 2B4AA 4JLDA 4ZYZA 2GRJA 3DO8A 4KE6A 2C8VA 1GTG1 4TV9B 4UEKA 2IZ0A 4MIYA 5T4FA 1PDOA 1UJ2A 1QGOA 1U8TA 3DXXA 2O1SA 4ZGGA 3BIWA 3BMNB 1UOPA 1KR5A 3CGWA 1DAIA 3LHSA 3WRYA 4JJZA 1DEOA 1V37A 2QXUA 5CDTA 2PPLA 5LP6A 2Q9BA 3OF3A 4F7DA 4P31A 3DV2A 4HAOA 4UFNA 1FJHA 3NHZA 5H9VA 4ZOLF 3MXOA 5T7BA 2C42A 3VKWA 4GL2A 1C1DB 1ZCZA 4IIXA 4RF5A 2LCIA 3RRBA 3DZ8A 4BRSA 5ADWA 1P7PA 2GZAA 2WJGA 3PUZA 4TL8A 4MWBA 5FQOA 4CKBB 3GNSA 5ES4B 1Q7GA 1A9YA 4AX8A 1EM6A 4OK6A 1IY2A 1ZD9A 1B6RA 4DA9A 1I7QB 4Q16A 2GR9A 2FQYA 2YW9A 4HFMA 4J3FA 5JALA 3INYA 4W9NC 2J30A 4M76B 3CW8X 4PCUA 4PV7A 1HA3A 3BXHA 4DTIA 3W3AH 3IQFA 4TKLA 1TTQB 1Z6ZA 1Q14A 1I5EA 1SXGA 1L2TA 3QITA 4J75A 3LNTA 3HYNA 3RYIA 3ZI0A 3ZY3A 1BFDA 3HR4A 4K1LA 4LE2A 2GOYA 2TMYA 1YJAA 3VU8A 1YZLA 2J0VA 3HA7A 2ONZA 3GRUA 4GX1A 2AK2A 2Z2IA 3LXMA 2J7PD 4JP3A 3W8EA 4E31A 2WB2A 2WNSA 1K0UA 4TLAA 5DHFA 1KS2A 3UG7A 4BP1A 1XU9A 3TGWA 2CF5A 4AMBA 2PTGA 1A76A 4I4TB 3FYSA 4RHTA 4WFIA 3OX2A 4U5XA 3OFND 1CBUA 1UINA 1B1AA 3WYDA 2IZOA 1DIAA 3PWSA 1NW7A 4NOLA 1JR3A 4L57A 3OLCX 2JRCA 3SIRA 4BWVA 5GPBA 4CM3A 2FPWA 2UUPA 1XRNA 3RSLA 2H2WA 2INGX 3LRXA 3HXPA 3EIWA 4AUKA 3AEUB 4OUKX 4OYLA 1UDAA 3E7DA 4A8JB 1WUYA 5HCNA 1DCTA 5DGIA 1V6CA 2GZHA 5FTKA 3GLGB 1JEYB 4N8DA 2HYIC 2PMWB 4FILA 3V4PB 1Z5NA 4R84A 1KJ8A 2OHIA 2P9ZA 3EEOA 4HDNB 4YO8A 1NDHA 4KTVE 3HP7A 1B8PA 2VEOA 2WZDA 3W9UA 2I5PO 2XUIA 2GARA 3AHFA 4P5EA 3CSUA 1DWQA 1MJGM 3DYIA 1OF1A 4LRTB 4LZPA 3SXUA 3TFQA 3C8ZA 4KGZA 4OFXA 4OXNA 1J42A 2CBXA 3OT5A 2EW8A 1ZNYA 3W4IA 3K1YA 1YASA 3MC1A 1U8YA 2G1UA 4YJDA 5AQ1A 4BUZA 1H3EA 1NN3A 1YS6A 2HIGA 2OGWA 1IE3A 2BI8A 2WZBA 4QAQA 1DUIA 1IYZA 2YDYA 3HRHA 3RS3A 1UKBA 4ZOAA 3H1EA 1E1MA 1KBOA 2ISCA 1IHUA 3FKSA 5DHQA 5JFTA 2AN4A 4F5DA 3VPBA 1S2NA 2GSWA 2I54A 3ACDA 3N2GB 5KYYB 1LLCA 2V7XA 5DVZA 5TT0A 2AF3C 3G9UA 4QFDA 2QMOA 1IEXA 2FWBA 4GIBA 3OJLA 1ZA1A 4YJ2F 4JDUA 2BFWA 1V0JA 5L8VA 5FI0B 3LQYA 4EPXA 2IW3A 1ETHA 4BLVA 3GL9A 2ZYRA 4JOQA 4KMOA 1MC4A 3GVPA 2L2QA 4BFWA 1XMXA 2I33A 4JJGA 1O8CA 4XUDA 3AM3A 3R9IA 1V8PA 2B2NA 2P3LA 2ZBVA 1OWOA 3N1UA 4AVYA 3NIDB 1K6EA 1QFJA 1WLSA 3C3MA 1ISPA 1K7SN 621PA 5JSYA 1JMYA 2G36A 4I08A 2YZNA 2I9KA 1IPEA 3HY3A 4XOIA 1GZ4A 3ROQA 3SYMA 2FPKA 3SBEA 4G5XA 4GECA 3O38A 1JFRA 1WABA 1CJCA 4UM7A 3EYAA 1CUYA 2HMVA 1TJ3A 3OQBA 4KO1S 4UVIA 1XPRA 2VH2A 4YT2A 2WF5A 1GD1O 1QIGA 1L4EA 2F3TA 4TMYA 3Q15C 4CEJB 2AJBA 1GN9A 4LUCA 3ZKAA 1X2BA 3HHEA 4UASA 4WZZA 5ENZA 2I6UA 3JQCA 2G72A 5DMHA 1PUIA 1G20B 1RTTA 1R9NA 2UUAB 4DY4A 2YV4A 4OJMX 3AR2A 1NIJA 3ZCTA 2I3BA 3DE0X 2N1MA 2BZGA 3ZWQA 1ZH8A 3ASVA 3MOIA 3UMCA 1JEQB 3WGVA 3G02A 5EJ4A 4A7PA 4NDNE 2ZOSA 3O8QB 5J2UA 1O58A 3ILVA 4WADA 2Y1FA 2PUFA 3DVLA 1RHQA 3ZIDA 4U9IS 2H6EA 1QOZA 3G8YA 2XOEA 4RMHA 2Y1GA 4JEHA 1PU2A 4G9BA 4EHKA 2Q5HA 2OHXA 2ZE8A 1XTUA 3KQYA 4P5PA 5ALYA 1LBEA 4DUGD 5I9SA 1PJTA 3PGVA 5FWXA 2IYNA 5LBTA 3RUHA 3RU3A 3VAZA 1H8HA 4CN8A 6Q21A 2HJWA 5JNTA