1W6WA

3d structure of cota incubated with sodium azide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
total genus 143
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA02
1W8EA 4NAJA 2RACA 3FU8A 3PAVA 4E9YA 2IWFA 2QDWA 1OCZB 3S8GB 1OCRB 2BWIA 4BWUA 6PCYA 4RH4A 3T6XA 2EIMB 5B1AB 3ZX1A 1AZBA 7PCYA 3CVBA 1JVLA 1WA0X 2UXGA 1URIA 1CC3A 5I6LA 2XV0A 2XX0A 1TU2A 3CZUB 2QT6A 4GP5B 1ASPA 3ABMB 1OE3A 2HX7A 1JXDA 1IBZA 4NERA 1XB6A 4DP9X 4DPBX 3OMAB 2OJ1A 4G72B 1AACA 3MBWB 3X2QB 1L9PA 1KDJA 3TU6A 5TK4A 4BK5C 1NDTA 4JKNA 5B1JC 2W88A 3EH3B 3WKQA 3WNJA 4A2DA 4DPAX 1AANA 1A4BA 1MG2C 3ABLB 2IDTA 5IY5B 1AG0A 3SBRA 1OF0A 3WIAA 3G5WA 1SNRA 1SHWA 4L0PB 2HX9A 1AIZA 2QDVA 1SJMA 2HXAA 3PLYA 3TBBA 4UANA 4BXVA 2FT7A 2NRDA 3FQYA 3H56A 2WO3B 1ILSA 1X9UA 2HX8A 4M4RB 3CDZB 4DP0X 1PLBA 1V55B 2B08A 2X87A 1J9SA 5I5MA 1A65A 4HALA 2DV6A 2VSMB 4YSAA 1PF3A 1JZFA 5B1BB 4MFHA 3NJJA 2PPCA 4A2FA 4YSUA 5B7FA 4PCYA 2XV3A 3QJUB 3ABKB 3N2JA 3MX0B 3N55A 3WKPA 2DWSA 2J56A 5ANHA 1JOIA 1NWPA 1JZJA 4YSOA 3NJFA 4WKXA 4P5RA 3S3DB 4AKQA 1V10A 3QJQB 3SBPA 1VLXA 2HLEB 4CSZA 2IDSA 4NB7A 1XMEB 2TSBA 3D12B 4E9XA 1PCSA 3JT2A 3S8FB 4E9TA 4G71B 1JXFA 2WSDA 3OD3A 1WA2X 1JZGA 4BDVA 4Q8BA 4HHWA 4YSSA 2YAPA 5I28A 1MZYA 1R1CA 2BZ7A 2DY2A 3EH4B 3NJHA 2R7EA 4K9JA 1KYAA 1M57B 1ZV2A 1KBWA 5D4JA 1GR7A 3PXLA 3PAZA 5AFAA 4EF3A 3QJVB 2CJ3A 3FYEB 1ADWA 3L45A 4KO7A 4Q89A 2BP8A 2IDFA 3FQ1A 2PPDA 3FU7B 4W9ZA 4BDVB 1BQ5A 1OE2A 2H47C 2A3TA 1GW0A 3HB3B 1AS8A 1WS7A 1PY0A 4UAHA 2Q9OA 2WO2B 1BQKA 3S3CB 1NZRA 2BHFA 1IUZA 3KW7A 1PNCA 2GHZA 2UX6A 4F2FA 4DP4X 1JXGA 1OV8A 3PPSA 3NYKA 1T5KA 1BAWA 2FQDA 2BZCA 2ZONA 2CBPA 1N68A 2H5UA 1FWXA 1QHQA 1KV7A 1M56B 2DWTA 2XXGA 3QJTB 4KNSA 5LDUA 3FYIB 1GS7A 3AG2B 4YL4A 3RYMA 2P80A 2YXWA 2VN3A 3FPXA 3QQXA 5D4IA 3OMNB 1E30A 2TSAA 3T6WA 4QKTA 3X1GA 1ET7A 2HRHA 1ET5A 1CURA 1QLEB 2FT8A 2ZWNA 4GP4B 3OMIB 1HFUA 3NSCA 5EHFA 2CAKA 3SBQA 2UXTA 3T9WA 2YAEA 4G7SB 5D4HA 2UX7A 2Y1AA 4DP1X 4YVNA 4FA7B 3GYRA 1KBVA 1ETJA 2EIJB 2GB2A 3ERXA 3TA4D 2IAAC 2CCWA 1QNIA 1SDDA 4E9VA 4F7KA 4YSRA 2FQEA 3ZBMA 2PCYA 2VW4A 2EILB 3NSDA 1NIAA 4JHVA 4AKPA 3KW8A 3FSZA 3UGEA 1BXUA 1MZZA 3OM3B 1A4CA 2Y69B 2IDQA 1JERA 2FWLB 2H3XC 3AZUA 3FSAA 1PLAA 3OQRA 4A2HA 2YAOA 2QPEB 1JZHA 1ZIBA 1J5CA 5B3SB 1IKOP 4P5SA 1AZUA 1SHXA 2MTAA 5A7EA 1GYCA 5I26A 1J9RA 4G70B 4KO6A 2AZUA 3AY2A 2VM4A 1BEXA 4KNUA 4QLWA 4N8UA 1DYZA 2E86A 2XV2A 6PAZA 5B7EA 4DP7X 1UATA 1WA1X 2VW6A 2YXVA 4G7RB 1YLBB 3BQVA 3QJSB 3TBCA 3NSYA 2UXVA 2YQBA 4DPCX 1ASQA 1SDDB 2BP0A 3NJGA 1L9SA 2OCCB 3HEIB 4W1TA 1AOZA 2BP0B 1NIBA 3FS9A 8PAZA 1RKRA 3IBOA 4YSEA 4YSPA 2EIKB 1RCYA 2P80D 1NPJA 1HAUA 2XUWA 1E5ZA 3CVDA 1JZEA 1PZBA 4E9WA 1I53A 2X88A 2XLLA 5I5JA 1NICA 1ASOA 1KCBA 3IEAA 3V9EA 1L9QA 3IE9A 1J9TA 1OCCB 2XX1A 4A67A 4HCGA 3ZDWA 5B1KA 4GXFA 2CUAA 3PAUA 4KOCA 2FT6A 3ASNB 5AZUA 1OOWA 3S3BB 3UAEA 2GSMB 4FAAB 3EH5B 3T6VA 1JZIA 4KO5A 3X1NA 2I7SA 2GC4C 5PCYA 4UF7C 3FT0A 2Q5BA 3DIVA 1PZAA 2I85A 3NP3A 1L9TA 1ZPUA 2DYRB 2QPDB 1MG3C 4KNTA 1PLCA 1CUOA 1RZPA 2BO0A 3CG8A 4HCIA 3U25A 3UACA 2PP7A 1CYXA 1NIEA 3T71A 2J55A 4YSTA 2HZHA 2BP8B 2XVBA 1SF3A 3JTBA 1FFTB 1E67A 4X4KA 1BQRA 2MRYA 2JFCA 2AFNA 4BXSV 2J57A 1RZQA 3H4HA 4GP8B 5F7BA 3NT0A 7PAZA 4KOBA 4A2GA 5I6KA 4YVUA 2LLNA 2FJSA 3FQ2A 1L9OA 3QJRB 4BWTA 4YSDA 1V54B 1XB3A 1ID2A 1E5YA 2IH8A 1F56A 3H4FA 1GY2A 2XU9A 3NJMA 2GC7C 3ZIYA 2PPAA 1BYPA 1SF5A 3DTUB 4WTQA 3NJNA 1AZNA 2FTAA 2VMJA 2EINB 5I6NA 2PPFA 1AQ8A 4F2EA 2ZOOA 2YAHA 2YAMA 3BVDB 4G7QB 3EHBB 1WAEA 1L9RA 1MDAA 2UXFA 1X9RA 4AI7A 1IBYA 1XB8A 5B7MA 1GSKA 1NTDA 2GI0A 2BW4A 1B3IA 4DP2X 3X1BA 1WS8A 1NIFA 1DZ0A 2VM3A 4HHGA 3NJIA 3FU7A 2HRGA 3X1FA 2JKWA 1E65A 1ZDQA 2FQGA 2PLTA 3FPYA 1NWOA 1TEFA 3V9CA 1KDIA 1PAZA 3FU9A 3NJLA 1ZDSA 2BW5A 4HCFA 2GIMA 4AZUA 1FA4A 1PMYA 1A8ZA 3SQRA 4DP6X 3CDZA 2YAQA 3GDCA 1KGYE 2R7EB 2I7OA 3FSVA 3UADA 4M3HA 4A68A 1J9QA 1GY1A 2IWEA 3DKHA 4PAZA 5I5IA 2FQFA 1NPNA 3X1EA 1NIDA 3WI9A 1OCOB 2YAFA 3UAAA 1M9WA 1TEGA 1N70A 2JXMA 4ZK8A 5TK2A 2IWKA 4DP5X 4DP8X 1J5DA 2XXFA 3UABA 1AR1B 5I6OA 4AKOA 4BWWA 2PCFA 4GYBA 2CALA 1OE1A 4A2EA 1KCWA 3C75A 1SFDA 5AKRA 5B1JA 1PNDA 2PP9A 1AZRA 4YSCA 4HIPA 1AG6A 3NP4A 2GBAA 5FC9A 3AW5A 2YARA 4E9RA 2OV0A 3IN0A 1EZLA 1AS7A 5I6MA 3AG4B 3IN2A 2ZXWB 2J5WA 4N4YB 4YSQA 4HAKA 5E9NA 3AG1B 2B3IA 2PPEA 3CVCA 3ABGA 4HZ1A 1AS6A 2XWZA 4E9QA 1BXAA 1BYOA 2W8CA 4A66A 2PP8A 2N0MA 1A4AA 3PCYA 1NINA 5I6PA 3QPKA 3EF4A 1BXVA 2VW7A 1AZCA 4ENZA 3ASOB 3WG7B 2XYBA 4KO9A 5F7AA 1HAWA 2IDUA 3FSWA 1GS8A 1GS6X 4JHUA 1W6LA 4TXVB 2IH9A 2AVFA 3TASA 1ET8A 3NJKA 4AX3A 1SFHA 1JVOA 1A3ZA 1EHKB 1ILUA 1ZIAA 2DYSB 2VSKB 2AANA 3NSFA 1W6WA 3GXUB 4GY4A 1AAJA 2FNWA 5PAZA 3T6ZA 1IC0A 3WNIA 1PZCA 3AG3B 4E9SA 9PCYA 4CSPA 1TKWA 1CYWA 2BWDA 2AZAA
chains in the Genus database with same CATH superfamily
1ZPLA 4P2OD 4IRSC 1IGYB 2CCLA 3K6FA 1FSKC 1YC8A 1GGCL 1PAMA 3GS0A 1JE6A 3QZWG 4R2GB 2ITCA 5J6GB 1OCZB 4WWID 3KPRE 1M1XB 1JHLH 3BH9A 3K1KC 3VYOA 2PW2A 2N56A 5JUEL 1QFUL 1IAOA 2V3FA 4ELKB 3ZKQD 5C70A 3S5ZA 5I1CL 3FTGA 2H1LM 4FOMA 4AV0A 1AZBA 2PTTB 3DLQR 3BW9A 3TA3D 2HTLC 4QRSB 2WBJB 4GAJH 1IO4C 3VI4B 4YC2C 3HUJA 1U93B 4XX1E 4IDLA 1Z5LA 2Z3FA 5CSGA 2VDKB 2OJ1A 3NTCL 2VJ8A 2PXYD 4IDJL 1L9PA 2OFQA 5F70A 4FNQA 3RI5F 1CZ8L 1IM9D 4PG9B 3ARGC 1SJHB 4TPRH 4GRLA 2YD1A 3DROA 5C9JB 3NCJH 1RUPH 1SHWA 2D3NA 1URLA 5CP3A 5DVOA 4PHXA 4UANA 4E41E 4Q0XH 1CGUA 4X4XA 4YHOL 4YXHH 2DBJA 3QJHB 4EVNA 4F8PA 4M4RB 2A6IB 1ZSHA 2F7RA 3KPNA 3BVTA 4UV4H 2I25N 4JFFA 4YEFA 4LKCB 5AKTA 1V55B 3RPIA 1BIHA 1LMKA 4MB1A 4Z77A 2EVFA 1J9SA 2B59A 3I6GB 2BIOA 2O5XL 3BH4A 2MKLC 1XGRB 4IK6A 1TCRA 4GSUA 5B1BB 4WHDA 2EH8L 2WZ0A 4MFHA 2X4NB 4XNZB 4A7GF 2J44A 5E00A 4BGDA 2DQUH 1OB0A 4X6BA 1OAUH 1WZLA 2YPVL 2VDQB 3QEGH 3TBSB 2FB4H 1HE8A 5CF3A 4JRXB 3HFML 3Q48A 3WLWD 2EDWA 3C2SA 4H8VA 4FL4C 1V10A 4G3YH 4LBEA 1IRAY 5HTSA 4LEOA 5DJXB 4ELMB 3SZKC 1TTUA 2FLMA 1OT2A 4AYMC 2VDOL 4UCFA 1U8CA 1OHZA 3AXLB 4PRBB 3IDXL 4O9HL 4TVPH 3WHE0 1XF3A 4C56D 4Z9KB 3ZTNH 2WLHA 3Q5TA 1CF1A 2FJFB 4HJSA 3L6FA 1DEEB 2CM6A 3AB0C 3LCYA 4QRFA 1XF4B 1ZA6A 2A9DA 2Y5QA 3EOBB 3MRPA 3OXSB 5D7EA 3UYRL 3QUKB 3V4VH 4APQC 4Y2DA 5EZIL 1R1CA 1YNTB 2ESVE 4LLQB 5C0IA 1O7DE 4N1CA 4LMQE 4K9JA 1KELL 3AJ7A 4FABL 1CLZL 1KBWA 4NZFA 5TDOB 5DJAB 2J3SA 2ZWYA 3IU4L 4WWKD 3OXSA 4F58L 3FAXA 1AD9B 1BZ8A 3EDKA 1KYOJ 1Z3GH 3L6FB 1VFBA 5I0VA 2ZG1A 1MHHA 5FUCE 4P46B 3VE0A 4XCNA 1AS8A 2KMWA 1N0LB 4D7PA 1WWBX 3KXFD 2YC1A 3ETBJ 4UTBH 1MDTA 4X8JB 2QADD 3MGOB 4EN3C 4I0PD 5ISZA 4AL8H 1XH3A 3HN3A 1FO0A 5SWSA 2KZBA 3TA3B 3VW3H 1S7QA 1MCOH 4ETYA 2Q76A 1NLDH 2EDQA 3O6LH 1BP3B 2BP5M 3FQNB 5M95B 1SY6A 3UZQB 2VZSA 4B27A 1RHFA 5C07A 4Z7UB 5HDQH 1E9QA 3MR9B 1QWNA 4TL4A 3B9DA 2DL2A 4OM0H 2PO6D 4J8RB 4AGMA 4B5EA 4GUCA 1E30A 1C5DB 4QKTA 2R69A 5ABAA 1RIUH 4DGIL 4JFEB 2EYRB 4NKMB 5F7FA 3CQQA 1RLBA 5JPNC 2P5EA 4KUZH 5CEZD 5D6CA 1ZS2A 4KDVA 1SXSA 4PJAA 5IUCA 4S1SH 3U48A 3DX8A 1ZE3H 3K6DA 5DC0A 4HS6B 3L08A 5FHAH 1ETJA 1AGBB 2JLLA 2AQSA 2HT4D 3ERXA 3BHBB 1QWUA 3LNIA 5CZXD 5CR1A 4PJDB 5H8DA 3OX8A 1IC5L 4WTXA 4CMMA 3NSJA 3BRFA 4XO3A 3CSBA 3FCBA 1S9XA 4DTGH 1BXUA 2HH0L 2AAAA 2V37A 2PYEE 4CVUA 1YEDA 4HFUH 1JNNL 5D96B 3OQRA 5DLMH 2YFNA 4NUJA 4RIRA 1UM4H 3L3JB 4WO4D 4HGWB 4DZBB 1J5CA 3AC0A 3N9GH 2EH7L 4PJGB 1LEGA 4F9PC 3VXUE 1HHIB 1IC7L 4NKOA 4OD2B 3JYBA 4JDZA 2NY2C 3RWJB 1WK0A 2HWZL 4ICWA 3WFBH 4AM0A 3CMOH 1S3KH 2BSCA 1AXSB 1RJLA 5E2VH 1D5ZA 4P5MA 1HOCA 2VDLH 5T5NG 2AC0A 2Z31B 4XZ4A 1U42A 5I1IH 3L4YA 4KC3B 4DPCX 4OJYA 1YPZE 5J7CC 2QQLL 3WNPA 2P5ED 5IROA 1MFDH 2ICWJ 3B9VA 1F3DJ 2DQFB 1FNGB 2F7IA 3WS3A 5ICYB 2QVFB 4XNQB 1RZJH 1TQUA 2FYVA 5GS1C 2W07B 4CNIB 1KFAL 4M1CC 2OXHB 3ZYOA 1S7UB 3REWB 1GW6A 2APBA 2JCCF 3CZJA 3RUGF 3GNMH 5MP6L 4YNYA 3F8UB 3TBVB 4APQD 5I5JA 3CXHJ 4MYPA 4AW4A 1DCEA 4E9LA 3OF6A 2BK8A 4QXTB 4RGOL 1AY1L 4CL7A 1MFCH 5E8NB 1R47A 2RIKA 4NO0A 2VZUA 3VSTA 4YBQD 3C8KA 4XC1H 3MCG1 4P3CH 4WO4A 1A6ZB 3DDFA 5JLZB 1A5FL 2FWOA 5DZAA 4YUEL 3RWDA 1T21B 5EOTA 4KNQA 4PLJC 1PLGH 5FEBA 3EO9L 1HYSC 2GC4C 1F6LL 4M1CD 4NKIL 4UF7C 4C47A 2Q5BA 4U3CA 3LZLA 3ARDA 1ITBB 4FFVD 3O4LB 3BT2H 4MGXA 2F8VA 5J6SA 2WXRA 1DLFH 1QYGL 2V2WA 3NG5A 2VSDA 1LL1A 5A2BA 3R19A 4JLRB 3CN4A 1HCZA 1BQRA 1YJDL 4Y4FC 4OIIL 2O5ZH 3HC0A 2CDGA 3IS0X 3SYCA 5FB8A 3DIDA 1JMXA 1R0AH 1KLGB 4XGZB 4Z6AT 3NESA 4I5BB 4HUXB 4ABWA 4GG6B 3VFGL 4GUPA 2CRYA 1VPOL 4GT0A 4PRHA 3JTSA 4Y5VC 1T7VA 5G4OA 1D6EB 4Y19A 3NJMA 1WWWX 3OBAA 1NGQH 2DEWX 1OWRM 3JWDH 3WNKA 2E7LA 3HJ0A 3LY6A 2JXMB 5I6NA 3LS5H 4HU2A 5IQ9A 2PETA 4AC4A 3IMUA 5D1ZB 4G7QB 2Y06H 3Q1EA 4O02A 4X0KA 4GKOA 4KI1A 3PF2A 2LU5A 4W81A 1NTDA 5L2KE 3L1OH 3VFPB 3PDOA 1MQ8A 1WS8A 4XPFL 4HHGA 2VM3A 1KBPA 1F58H 2X0VA 3GIZH 4WJ5B 1FBIH 2Z4QA 3W9EB 1BF2A 1EO5A 2CJTA 4WWKB 3JV4A 1A02N 2EXTA 3LRGA 1JWMA 3BE1H 1A7QL 1AI1H 3FH8A 4KQ4L 1QLEL 5BV7B 3BPCB 3PXJA 4CDHA 1ETA1 1U2HA 3KNBA 4PRAB 3SPGA 1KEMH 5IHUH 4N2KA 3VAEA 1ACXA 5B8CA 5KVDE 4M3JA 1DDHA 4AMXA 3NJLA 4PJ9A 1U30A 2BFVH 1I7TB 5CLZA 4I0KA 2VERA 5ETUA 1KJ2H 1MEXL 12E8L 2FSEB 4N90E 5F7EH 3ZK0A 2ESVD 3ESMA 3CH1B 4UV7H 4C4BA 1JL8A 2OMYA 2NUTA 3MV7A 5EEWA 1QFUH 1IZKA 4XVOA 1I7RB 4AG4H 5CZRA 1A66A 2M83A 1BFSA 1MCOL 1NPNA 4XNYL 3TO2A 3WNLA 2CO3A 32C2A 3FTYA 2XN9B 4RX4D 4L48A 2ZTBA 1MHEA 1S6NA 1XD1A 4MXWL 4S2SB 3C9NB 3UAAA 3DECA 5DJXA 5E6YA 4WW2C 4DP5X 2ZF9A 1YYLH 5ENWB 3TX4A 4AQ1A 4HJ0D 1RJYA 2EVJA 1V5JA 2AGJL 2E6QA 4NUGH 4PWGA 4Q2ZB 3UEZA 5IT2H 3EO1A 3CN1A 1DL7L 3K2IA 1YMHB 5FYJD 3O9WC 2ATKB 3B8YA 5FO8B 1CZ8H 1SYSB 2JK5A 3KJ4C 4KAQH 1W2KT 4M5ZH 1PNDA 2RQ8A 2VITA 3BC9A 5AG9A 1FFOB 5ALBH 4Y2OB 4FQXC 2Y7SA 1S78D 3PGFL 5D7JA 1GKEA 4H25A 4JPKH 3F7LA 3OPZH 3IN0A 2CLRB 1AS7A 3CVIL 1LO2H 5GZNC 5T1DH 1GJWA 2W65A 1G7PB 3DGGA 5AZ2L 5GJSL 3QI9D 4UQAA 2GTZA 4MD0B 3U9UA 4HAKA 1RZ8B 5E9NA 4B60A 3VGEA 1EZSA 1U2YA 4JCLA 5CS7A 3KYNB 5F7LB 1AHKA 3TZVB 4OFKA 5E2WL 5D7LE 2BC4A 4PLNC 3NBNA 2VAAB 3MNZA 3MRCB 4X8GA 5C09E 2XZAH 1QPKA 5CLYA 3L3HA 3QG6A 4XNXH 3L81A 5AVSB 1P5UA 3TCTA 4XPTL 2DWEA 4J3OF 5DS1A 3TVMC 1F3DH 3MBXH 4XTRC 3IMRA 4W9JC 5DD1L 5GGRB 1KXQA 4WGVB 3GIVB 4ENZA 3VYPA 3C6SB 3TT1H 1U8PA 2X0WA 3SYAA 1NOLA 4FFYL 4X99A 4HJJH 4HPOL 3GZKA 2IH1B 1C12A 4X80H 4EQ2A 8FABA 5F8QC 1JGUL 3EJPA 3OJDB 3ZL2A 4JDTH 3OKYA 4UQ2A 3V0EA 3G9AB 2X89D 4BFNA 3FB7B 1YEEH 4QLRA 5J5EA 1U95A 5JHBA 4NOBA 2AANA 1S7UA 1PG7W 2JB6A 5EZPA 4PBVC 4M5SA 4F7CB 4QI3A 3E7JA 3NUKA 2OX5B 4UZSA 5C8JB 2UZPA 5SX4I 4G7VL 5DS8A 5C0AB 4BK8A 1RSYA 4ZDHB 5EZJA 1TKWA 5DRZB 5BQDA 1QA9A 3HZYA 4YLBA 2OW7A 4HXBH 4X4ME 2NY4D 3EBHA 3RKDC 4DGVL 5E0QA 2IWFA 3LJ3A 2FZ3B 2QDWA 3KLAA 2YBRB 4KK8D 3U6XA 3QEQA 3J27A 1BQLL 1TTFA 4A7GA 4KY2A 1Q0YH 3P11H 4RMUA 3RUGA 5KUKA 1WWCA 4RWYL 3FBQA 1KCRH 2NUPB 7PCYA 4I89A 2XZCL 1Q94A 5JHLL 2DWEB 4PJ8D 5DURB 1AMXA 1JGLL 1JHTB 3DDGA 4UQBA 4HIEB 2HVJB 3HPLB 5KAQG 2ROYA 1OE3A 2WANA 5IMOB 2CIIA 5E51A 2OULB 5C08D 4L8DA 3CMGA 3GJFK 4KQ3H 4GMSL 2VXQH 5CR8A 2QQQA 1O6TA 3S37H 2NMSA 1NDTA 3CC5B 4A2DA 3I75B 1YMMA 3ZE0E 3DX9A 1D6VL 3ZKMD 4QHKJ 3G5WA 3L1FA 3GSQB 4K5NA 1J1OH 4J4PD 3PV6B 3UJTH 4FQHA 4X6DA 3TBBA 4AV5A 3SKOB 1NMAH 2NRDA 1NGYA 3J8F7 1J5IA 2CRMA 2OMZB 2AKRA 2OPCA 2QR0B 5CJ5A 4DP0X 4B95C 1QQDB 2B08A 3GKZA 1BQSA 3RVVD 3U2SA 3RUGE 1OM3L 2JCCE 3BRDA 3FB8A 3Q9QA 4ODTH 3FDWA 4PM1A 1IKFL 5MEND 3KPTA 1ZLVK 4KVCH 3QXUA 3RU8H 3LTVA 3O6MH 5ADPL 3KPRA 2DWSA 2EJ1A 4X4MA 4D0CA 2CNZA 4N68A 3B7TA 1CS6A 2PABA 1UOLA 4AKQA 4P5RA 4EI5A 1MIML 1NFDB 3CK0L 4YQXH 1MRCL 4AJ0A 4L8CB 4GW1B 3PIQB 5FYKU 5ALCL 4U1GB 4F27A 3NZUA 5TGBA 5GGRY 1Q0EA 4POYA 1EO8L 2XJKA 1IC7H 4JFHE 3L9BA 3S8FB 5CJ8A 1G6VK 3CZNA 2VLMD 3V4UL 4S1DD 4BCZA 3KXFA 5IB5B 2DQUL 1VGKA 3QIWD 3NJHA 3NA9L 3I02A 2CHXA 2P43B 1MQKH 1KYAA 1CCZA 3C5ZD 2X9XA 4QHNA 4OV5A 4OLUH 4WGWB 4R26L 4PV8A 2AXFB 3WFCH 2PW1A 3WNOA 3FU0A 2WY3B 3H7BB 3V6BR 5AFAA 5F6IB 1Z5YD 2X6MA 2G3MA 3KJ6L 3ARFB 1BQ5A 1QSVA 1OE2A 3GM8A 1GW0A 1R3HA 1EJOL 1JZDC 5FYLD 5J13B 1NBVL 5ESAB 2CLVA 3RWEB 5F9OL 1XV8A 5DHVB 3FFOA 3HG1B 1S5IH 4PMFA 1JXGA 2FDBP 3DETD 5FA4B 1FC2D 5F1IA 2DLHA 4O51B 4CADA 3CWGA 1HSBB 1RURH 4YHNB 4I13B 5TH2B 3FTGB 4LOVA 4WVRA 2DKMA 2VDNB 4YBQC 2ITFA 4O2FB 1KV7A 1M56B 5DO2D 2W92A 5F7YC 3RWGB 5IQ7H 2ZCHH 2ZWZA 1RZ7L 4E5XA 1WG3A 2B9AA 3PJLA 4PI2A 4S1QH 3VXRE 1FZJA 4M4PA 3QQXA 1KY7A 4FRWA 2AQQA 1DVXA 5KYWA 3RZCA 3ETBF 5GGSA 1GC1C 4P2RA 5ECGA 4P4RB 2WMPB 3MNZB 1P5VB 1Y0LA 3H9ZA 4V2CB 2X70A 3ZVVA 2ZWNA 3WD5L 2VR4A 3ZTJG 1L0PA 5L2JB 2GSIB 3R4DA 4XBEL 4ZNEE 3DRQA 3TL5A 1G7JA 4AMKL 1F1AA 5FYJU 1RUML 3HMXA 4QEGA 1JIBA 2H9GB 5C86A 1N6QL 2PTUA 3KVQA 4I9WD 3L7EB 3NABH 3WEMA 4G1EA 4F7KA 3QUYC 4XCCL 4TULL 3KYMB 1LK3L 3IAPA 5GS0L 4QF1A 4F8LA 1N9PA 1KJ3L 4HBQA 1A1MA 2Z7WA 3V8CA 1RUQH 1QSEA 1IKNC 1MZZA 4HIJB 2H0EA 2Y25A 5I0YA 4K5PA 2FH6A 2JJSA 2WP3O 3WJLA 1IIIA 4C4KT 1P7BA 3QUGA 3TS8A 3OAYH 5B3SB 2XPYA 2BP3A 4Y9GA 4M48L 2VQTA 3R8BB 5DXWA 1DQTA 2EYTB 1QR1B 4WEUD 4ABUA 5FFGA 4K55A 2VM4A 4NRZB 4QWWD 3UAJC 4BFIB 3AS2A 3ISWA 1HINL 4F33A 3CFNA 3W0WE 3BUPA 3H9HB 2VW6A 2R56H 5ICZB 1UACH 1BGXH 4G5AA 4AJWA 1EXGA 4YX2L 5K9KB 2W1NA 5D1XB 4HXBL 2NUTB 4E2OA 5DZPA 1RMFH 2YUZA 3ZTCC 3GTNA 2VMDA 5EDSA 1OPGH 1KB3A 1INQB 3B7RL 3RJDA 3GSRA 4LCIL 4XE5B 5JIIA 3FTUA 5HHPB 4NQUA 4ZUWB 2RA1A 4RGND 3W9DB 5F3HB 2OR8A 1E5ZA 2OJEB 3ARDD 4PG2A 1TVBB 2JKLA 4G9FD 4ZOEA 1T20A 3CSPA 3TO4B 2VLME 2I60L 2KPNA 5EUOB 4Z7WB 1UWXH 4QJ3B 4M1GL 3TYGH 4HKZA 3OKNA 3FQWA 5B39B 1KCBA 3IEAA 4OZIF 2J7LA 5GGRA 5DQ9A 1MRFL 1OCCB 3WSQH 1P4LB 4A67A 3S37L 2D7MA 3NAAH 3LNDA 1CPUA 1Y6KR 3VXMB 2XFXA 3WN5C 5E6UB 5FOBA 1VFMA 3IRPX 3QIUD 5D2LA 5E8PA 4G43B 5EH1A 3LD8B 4WI2A 3D0VA 5IVXF 3GLDA 4K94L 4I1NB 5PCYA 3FRPB 3IJHA 3IBEA 4QYOB 1I75A 1HNFA 1YNLL 2CK2A 2KERA 4JFDE 3GK8H 4OB5H 1C7TA 4GQPH 2YK1H 1S7VA 2AI0H 5T3XE 3OPZL 3OVUB 1G94A 2B1OA 4K3JL 1LK2B 4QRRB 5SX4H 4FP8H 3FT2A 1KXVC 4ZPTA 2BP8B 1S5HB 3MV8B 5E1AB 4IBTA 5DRWB 2OXGA 1OSZA 1OO2A 2FX8L 3LIZH 4QRPD 4PVBA 1NCAL 3RX8A 3FUFA 5HI3C 1P6WA 1QLFA 4KOBA 4HUUB 2Y9RT 3PP3K 5J1TC 1I9JL 1HQRA 1N8OE 1U8KA 2OL3B 4UMSA 5EFIB 5IMKB 5K1NA 4LF3A 1KIUA 1FNLA 3WUWB 2GC7C 4XPTH 1OAZH 3FU5A 1ZD6A 5E8EA 3NJNA 3EG9A 4ZMOA 3LD8C 1OP3K 2R1YA 4U1NA 4QRTA 1NBYB 2APVA 4HIHA 1A4KB 2XN9A 3US9A 3D08A 4H5SB 4UT7L 4JZOB 1IBYA 1YEHL 5LAXA 5B7MA 3KPQB 1CD1A 1CR9H 1RJZA 3QUXB 3V4PL 3VU1A 2V4LA 3KD4A 3OZ9H 1OHQA 4QRAA 3ZDXF 2AJYH 3EADA 2NY5L 4G6KH 1BPLB 5IEHA 2CPUA 4QAMB 1G9MH 2YUXA 5I71C 1NWOA 2X10A 3SE3C 5FKAA 4UIMA 3U7YL 1KT2A 4HWBH 5GGVY 3U0TB 4EDXB 1SXAA 2E9GA 3TV3L 5C0BD 1IZJA 1DBMH 1NCTA 5DA0B 2EIDA 4N5ED 1CXEA 3QWRA 3QUMH 5EC2A 4X2UA 2ARWA 4XPAL 4GSDH 1BQLH 1OPOA 3JXAA 4FGMA 2KLSA 3NGBC 5KS9B 3DKHA 1TJHL 4K7PL 4D3CL 1JPFA 2FLBT 4PJXB 5IIEB 5D1ZA 5C3IA 1DJSA 4H8UA 2FUQA 3HG3A 5ITBH 4PJAE 4BZ1H 1MWAA 1N70A 2CE6A 4QXUH 3NPSB 1A7RL 1KEML 3NEEA 3Q1SL 1J5DA 4OD2A 4C59B 5IHUL 1KB5L 1ZT4B 2AQ1A 2R1WA 4ZUSA 3K71B 4JM4L 1JGVH 3MUGA 4LLVA 5AOIA 3MX0A 4LLMA 4XCYB 4JM2C 3FRUA 3QUMA 3STLB 1L3NA 3ZKSD 1TENA 3GLAA 12E8H 3QUYD 1PJWA 1JRHI 2E9BA 4YE0A 4MS8D 5AKRA 3P3TA 1D6VH 2XTSA 4RGNE 3IJ8A 1Q9KA 1M05B 3L1EA 1BIIA 1IM3A 2FD6L 4LSTH 3QDGE 2BVPA 2MPVA 1T03H 3QIBC 4N87A 4X6CF 3MA9H 2Y24A 1TF4A 1IC4L 2X4PA 4YSQA 1T04B 1FL5A 4P06A 2AEPH 4IMKC 2R2CA 4MDIB 4FDWA 2KLRA 5ERWB 1MNUL 4PWKA 4QHPA 2ZOTA 1QUNB 1XSIA 4E9QA 1W80A 4F80A 1NCBL 3H0TA 2UY7B 2JLPA 4DKDC 4AQAB 4GQ9H 2YMXL 2E8YA 1A4AA 2ZXQA 3C8KB 5I6PA 2FAUA 3E80A 1HILB 3QCTH 4ZBJA 3D69B 1K4CA 2K9UA 2NLJB 4XN1A 5GJSH 4PYGA 3G6AA 3UMNA 2WQAA 2V5YA 2E6JA 3RAJL 1XF5A 4JFQB 2X4QB 3U0WL 2D7TL 1L0YA 5E6ID 4X83A 2AVFA 3P4MB 3QJFA 3CDYA 3OKMA 3GSRB 1S7XA 4DQOL 1BYNA 2ZE0A 2P8MA 4RMTA 2H1PH 2XV6B 5K1JA 1BVLB 1I8UA 1P53A 3KWTA 2QFPA 2ZUSA 3FQRA 4JZNB 4WV1C 4FXTA 5C0EB 5BV7C 4L0YA 2DQ6A 1E8XA 2V9QA 1H9VA 4BZ2H 4YZWA 4NIYE 4ZD3H 5IFJA 5F88A 2FJHA 4A7QA 1MLBB 2VXSH 1OGAA 2X3BA 1YN7A 4NAJA 4RGMB 2E47A 1JFQL 3A67H 3Q6GH 4NKDB 3RL2A 3PY9A 5C3LD 1FRGL 1COBA 2YHGA 5K9QI 1GA2A 4AYDC 4BKSC 1R3KB 3ROLA 4H7VA 4AQ8C 1E3FA 5BW7A 1WCBB 5HDQL 1P2CB 3WIIL 1UA6L 4X5XB 1N8ZB 1FG2B 2D4DA 4BKLA 1S46A 2MQGA 3N1GC 1ED3B 1OQXA 1ZHLB 2P48B 4R83A 4W6WB 1SPDA 4JO5A 5I1GH 1ASPA 5KN5B 4FTDA 3ROLB 2OM5A 4N0RA 3AGVA 3QHFL 4K3GA 4DP9X 4BSWB 1IE4A 3MV7B 4OF7A 4OCMC 1T7WA 1R4XA 5EWIH 4FQIL 4H8QA 5BVPL 5B1JC 3EH3B 5IJVB 3G04B 3MI6A 5FDYA 4FP8L 4YDIH 5C08B 2Y5EA 3KLLA 4WDIA 4ZMVA 4M5TA 5CJXC 3T0VA 1JGEB 3KLDA 4U3XA 1U3HC 2A1WL 1UWYA 1I1AC 3R06B 4NWUL 2XA8H 1Z9PA 4QTHA 4C56E 5A2FA 1XGYH 5KSBF 3ZHLA 1EK3A 2FO1A 4ZS6C 1FCCA 4ZMZA 4CC1A 3HI6L 5DTFA 4NKMA 1WFNA 1ORQA 1Y1DA 4WI6A 1U8HA 4MD5B 3GTTA 5IZ7A 5T3XH 1OGTB 1QLRB 3SD2A 1PSKL 3T1FA 3UIYA 2HLAA 3NJJA 4OZGE 4PJ7B 4KJYA 5HI5D 4A2FA 5I0DA 2L0DA 2Y2YA 4QCIA 5L9DH 1AHMA 4MX7A 5LWYH 2Y3AA 2WINB 4KTYA 3V79C 4JZJA 1J1OL 5ANHA 4AC2A 3C5ZA 3GMOB 3V0IA 3KGUA 1MI5A 3D4GA 3MZGB 1LWHA 3HHSB 4MAYD 2TRHA 5C0RH 1K2DB 3JQOB 4NB7A 4N5EC 2PUQT 2UYLA 5HYJB 5MI0C 2V7NB 4D9LL 1FZOB 1OM3H 4UT6L 3SOBH 3LZQA 3FO9B 2ICWB 5L6YL 1WA2X 3EJZC 4DOHE 2ZYIA 5EN2A 1KN4H 2D2OA 3AQXA 5I19L 5TFSL 4HMCA 1KEGL 1VFOA 2DY2A 4ZMXA 1J5HA 2F1EA 4HLZH 2P47B 4FXKC 1FYTB 3W38A 1BG1A 4DN3L 1Q72L 3TV3H 4AEFA 4LB8A 5GGQH 2X38A 3GRGA 2EKSA 1UT1A 4OUUA 3IKKA 5AB9A 1BZ7B 3I9PA 3WIFA 4EF3A 3QYNA 1PZ3A 1SOXA 4OAWB 1I8AA 2ZIDA 2BCKB 5ADOL 3U7WH 4PRDA 3CFBA 1FVEA 1ORQB 3IM1A 3HB3B 1MVYA 4EIBA 4EMZA 4KRPB 1ZCRA 1F02I 3GBLA 3TBWA 2YJLA 2QPFA 3PL6D 2MIZA 2FE0A 1C5BH 1G5AA 3QZOA 1TO4A 2KI6A 5C08E 1TQWA 1OAYL 2WOYA 4LEOB 4B9GA 4MJIA 2I07B 3UCRA 3ZMNA 3QHZH 4MX7B 3BZ5A 1BAWA 4KPHL 1MOEA 1CFBA 2H2PD 1GRWA 1NEZG 3KWWA 3MMEB 4M03A 1A9EA 3IF1A 1ZTXE 5KSBE 1KGCE 1GGYA 3ARRA 3P2BA 3RYMA 2HJKA 3FN0H 4PGDB 2FBJL 3RGHA 1NFIA 2OL3L 1PTZA 2N4IA 5DVMA 4L4VA 5FKAB 4CN1A 4PRPD 4X4YA 3FTWA 1HL5A 3WKML 1T5XB 1XQ4A 5BOJA 3QGVA 4KH2A 2OR9L 2X9YA 1J8HA 1HFUA 3LDBC 3NSCA 4WHYG 3QNYB 2DDQL 2MSPA 3L3OB 4KK5C 5KVGH 3DHPA 3GLZA 1INDH 1JYVA 2CBOA 3TLRA 1BZOA 5JW5A 3QIUC 1U8LA 4WAFA 3TA4D 5MENB 3I75A 1RUPL 2WWMC 4NCC2 4JZOA 2K7QA 4OJFH 3BEVA 3SCMD 4YSRA 4ZFFA 4X9FA 1F4XL 2C9XA 3HOGA 4PJGA 4TLKA 2HVJA 4UV4L 4WI8A 1I8IB 4AEIH 1SXNA 3FH5A 4CVXB 5IMOA 3SN6N 4JMNA 1DBAL 4D8OA 4CJ1A 2VUOA 2ZJSL 4J3UA 2ZWLT 4PHZA 2BNRB 4YDKL 4FYSA 4UDTA 1JN6B 1JHTA 4JANB 1EVTC 2X4TB 4LIQL 1BOYA 1WIPA 1QLEH 1NGPL 1ZMYA 2FK9A 3BEWA 1AGCB 2LHAA 4LP8A 4P5SA 1JYNA 1IGTA 3PP4L 3OX8B 3ZZ1A 1ZGLA 2I07A 2O1AA 4UU9B 5C09D 3EJCA 1MCQA 4X6DF 4BFRA 1HNYA 1PY9A 3VFWA 2G5BB 3QZMA 3QZLA 4J4PA 3FCSB 4ELME 1QVOB 4OGZA 3D39B 1MFEH 3HS8A 3M7OA 3QJSB 4NJ9L 1IAIH 3TBCA 3UOAB 4JREC 3C60A 4W93A 1J8HD 4GAGH 4R4FH 1OAQL 3VJ6A 1S7VB 5C7XL 3WGVB 4NPYB 3TTYA 3DO7A 3VA6A 3F58L 4N86A 3IKCA 4YHLL 5KAQF 5IBUB 3BPOC 5DZVA 1FFPB 2NY4C 1N64H 1KJVB 1YY9C 5EF2A 4N8CL 3QUMB 1SJEB 4X98A 2VH5L 3SDAC 1MSPA 2APSA 2XLLA 2YA0A 4ZTPH 1Z9SB 4NO3A 3UAFA 5ALBL 2ORBH 1JN6A 1CG9A 4PJEA 3ESPA 4P23A 4R4ND 3TN0D 4XC3L 2N3JA 3DRTA 3GHEH 4RNRA 4TNVF 3QA3B 4Z7UF 3LQAC 1J12A 1U8IA 2FT6A 3DSNB 5DZ9A 4U1HB 2PN5A 5IEKA 5C2UB 1AFVL 5TE6L 4I18C 5EO0B 2ADGB 3N0AA 4PI0A 4L9DA 3MAWA 2X05A 3KH3A 1L9TA 2WXMA 1IJNA 2DQIH 4RFNC 3RTQC 3UERA 2FD6H 4QRPB 2YEZA 2XBZA 3DJZA 2I60H 3ZQ9A 4I7ZC 4BQBA 4KKCC 4LDEB 5ACZA 5KJRL 5J12C 1B0WA 3QZWB 4R7DA 2BNRE 4MJ5A 3RHWF 4JG5A 4BZ2A 5K1VA 3DI3B 3MBXL 5DD1H 1SQMA 3PGCA 2XVLA 3GSUB 1QR1A 5EC1B 5HGBA 4YHKL 1IIKA 2E7MA 4UTBA 3UTTE 5ITFA 3FQ2A 3K5SA 4HG4J 1V54B 1H8OA 5C6WH 2F54E 2OI9C 2V9UA 1KTDA 1F56A 5CIPA 2XU9A 2GY7B 3K6IA 4YHNA 5C0BE 1M2VB 4OZHA 1BFVL 3R1GL 2PR4H 5K9QG 5FS5A 2JF1A 4NM8L 5HPMA 4MJ6A 4POZC 2IWGA 2IJ0C 3MRQA 2JB5H 4F2EA 4N6QA 4XVTL 3QXWA 1XH1A 4NDMA 3MSPA 2XNAB 5JIQA 1YEJH 4YJZL 2CKBB 2H3NA 4X5LA 2OMXB 1Z66A 4LHJB 2LR4A 3GSXA 2VN6A 3PABA 4YXKH 3VD0A 2E59A 2LU3A 4FF9A 5D7IE 2R2EA 2WBKA 5TPWL 1GYVA 1ZLWH 2P9RA 5EORL 1OSZB 1K5NA 1E5BA 1NAMB 1UM4L 4DPRA 1RV6X 5DRWA 3WMSA 3LNEA 2YRLA 4AEHH 1RFDH 4WU7A 1ECYA 3SGDH 5CU5A 3F12A 4Y5XA 3VWJC 3ZZQA 3CFEB 5D7KD 2XVGA 3WY1A 1A0QH 1XAUA 4UB0L 1TJGH 4QY8A 1ZVYA 4NQCB 5E2VL 5ACZB 4NZUL 3IVKA 4ORGB 4LSVL 1RPKA 3B9KA 4WJ5A 3ULSA 4NSKB 4DP6X 3NFNB 4OZGF 1KENH 5AVZB 4GBXA 2IC2A 3LHAA 3B8SA 4FQXB 2C9PA 5I1IL 1FH5H 2VN4A 3D0VB 4PAZA 3DTXB 2KS0A 4OVVA 4KQ3L 2VR3A 1H9DA 3RGVB 4WFHD 2AVGA 5DD3L 2IMMA 1N3NA 1P84K 3VFTA 1LP9E 3LZPA 1CLOH 2JXMA 4W9KC 1M3IA 3C2AL 4H4NA 3KLKA 4PRNB 4KXAA 1NCWL 4UM8A 3VFNA 4DEPB 3QHFH 5ESQA 2OP4L 1FAKT 5IK3A 3OJVC 1QLFB 5KBNC 3IYLW 5DQ9B 2DMKA 1ACCA 4DZ8B 5BRPA 3BP6B 2DWYA 1BSIA 4YSCA 3DVFA 4WFFD 3R0MA 3QDJE 5AB0A 2AXFA 1QO3A 1G87A 3AW5A 3Q8BA 3HKFA 2OV0A 1K3ZA 4FG6C 2BC4B 3MV8D 3HI6H 1DUYA 5I73C 3ISYA 5FX3A 3BN9C 2OMZA 5ADPH 2CGRH 3KLSA 3B2UC 1S2EA 1SHSA 4N4YB 4Z3JA 5EULV 3FCGA 2VLJB 2W9LA 5JR1L 1M7DB 2RCSH 5KZCD 3MLPA 4OZIE 4HZ1A 1X3DA 2OKMA 1DLFL 3D1MC 5CKAA 1BXAA 1Y6MR 2G60H 2LW3A 3DX1A 4GEIA 4MDJA 4DVRL 1EIBA 1EO8H 2X40A 4YBHA 3VXQB 4EKJA 1A3LL 1A6ZA 5T5FL 3OL2A 1HZHL 3VX0A 2G9KA 4NO0B 4KTDH 3U30C 5B39A 5D7HA 5JYLA 1A4JA 1AZCA 4Z7QE 1DBBL 3W5NA 3CZGA 4WUUB 2MMXA 3B2UD 3WG7B 3NK4A 3NIFB 3JZYA 1FFNA 4KV5E 3ECUA 3HLAB 2HKHL 2Q2EB 3OZKA 3VRIB 4JPSA 4JHUA 4IEFA 1G7HA 4TXVB 3WEAA 3WFCL 5L8LB 5INCA 4PJ8B 2K6YA 4EN3B 2F58L 1QFWI 3LRSB 4JN1H 5HI5C 3WFHA 3FFCD 1E7VA 4FJZA 4ODXA 3IGLA 5AKVA 1OM9A 1UG9A 2PO6B 1JPFB 2YPVA 3L7FA 1IEAB 3NACL 2W9DH 4P5TC 5HJBA 3VO0A 5A16A 4A1RA 1GAFH 1ZLDA 4WW1B 2F1BA 3CVHB 4I4WB 1HHHA 1LO5A 1U8LB 4PLOB 3T8XB 2VSCA 3T08A 2CIKB 2WVVB 3BKMH 3WCYA 2F61A 1S5IL 3BVVA 4K3DL 2RACA 4FQJH 3BSZH 1DFBL 1LO3L 3UTZA 3I2CL 3QFJB 4UNTA 4PS4H 3PHQB 3G6DL 1FC1A 4LPYA 1KIRB 4J23A 3HCVA 2X2IA 3CFTA 5I23A 2A9AA 3L4XA 4EOWL 1NCCH 3CDGB 5DRNA 4JRYA 3QORC 3G6AB 3L3JA 4UILL 4QJ4B 4QO1B 1URIA 4JM2F 2OTWB 1AH1A 2JELL 1TTAA 5DZLA 3GSWB 4O2EA 1JXDA 1W72L 5TH2A 2LTQB 3UIZA 1MHCA 4JHBA 3OKLB 3OMAB 5B39G 5D7IA 1O6SB 3WAJA 1KDJA 4BK5C 5CKGA 4PJ5D 3TH2T 4NC1E 1KXTB 1S9YB 5FO9B 3BZEA 1MG2C 4BUHA 5F1SA 5F8RC 3VJ6B 1J8SA 2ICEA 4DN4H 4LLYA 1G0YR 1AR1D 4LLWA 1OIOA 3QPQC 1E4XH 2J88H 3LH8A 3KCWA 5IWLC 4RAVB 2XRAL 3T8VA 1YO4A 5BRZD 4YHKH 2X6CA 1JPEA 1BIIB 3MUJA 3FOMB 3BAKA 3MYZA 3RX7A 1H0DA 5ID1A 2CDGB 4OFPA 2V2TA 1JZFA 4J1UA 4Y8AA 1EHLH 4N85A 2ZOWA 4OKDA 5FGRA 3WO4C 3BT0A 3BEWB 3GJFB 3EFOA 1IGFL 1OW0C 5FA3A 4CADB 3FKUS 1UEMA 2FO4B 5D1ZD 4BH8A 4K7PX 3MUGB 2J56A 4LLVB 7CGTA 2BOBA 2QKIC 1VJSA 1TOXA 2QKIB 3GGWA 3GSNA 1KZQA 1DBJL 1MWAB 1W15A 4ELDA 4HJEA 1Z9OA 2WWKO 4PJHA 1TVHA 2CR3A 4QOKD 4AIEA 4YX2H 4D0DA 6FABL 5I1JH 3KWVA 1T1XA 4YXKL 2YC1B 1TEYA 1JPGB 1AKPA 2VWEC 1J9CT 2DBLL 4E9TA 5DUML 4V1DD 2OMYB 5EORH 3OD3A 3DX3A 1Y18B 1OPGL 5EIQA 1WYJA 2C9QA 2VLRB 3ABZA 2FR4B 3ULUE 3MV9B 1AO7B 5DWPA 2DB8A 3HBGA 1MJJA 4FCHA 4Q7DA 4D0CB 1MFBL 4Z7WA 3EH4B 2R7EA 4PSRA 1E4KC 3STZB 3U1SH 3UTSB 2FBOJ 1G7LB 4P99A 3IU3A 1KGWA 4HS8L 1QASA 1OGTA 1QLRA 3N6YA 1JV5B 2P46B 4RZCA 3DC0A 3KNBB 3PXLA 4IOSA 4PRAA 3WEOA 2WXQA 1WIUA 1DSWA 1H3PL 4Y4FD 5DD0H 3D85B 3VWKD 2A99A 5BO1H 4YHLH 2L4OA 3QULB 4LQFH 5T1LB 3FQ1A 4Q58C 3MRMB 2FL5A 2FR4A 3UBHA 4NZJA 1YEGH 3O8XD 5HDLA 5IFJB 3OAWA 4LU5L 4OFVA 5D5MF 1WS7A 4FFTA 3I3DA 4LCWA 4X7DC 1T6VN 3N91A 2R1YB 3REVB 4DEPC 1HJBC 1YCSA 2Z93A 2E4FA 1KTLB 2NY0B 3ECWA 5LVEA 1GCFA 4Q56A 1FNSH 3HE6C 3JWNH 1HH6A 1CQYA 5E7FA 4FG0A 3S2AA 5KOMC 2GUOA 1DVFD 4ZXBA 3BQUA 2PXYA 3DVNA 2E56A 3HPLA 5C6PB 1A22B 5H37A 3EZ8A 1AGDA 3D34A 4UT9H 2FX8H 3UMTA 4BELD 3GT6A 2AQNA 1WCBA 3FPXA 2QSCH 1TCRB 4U1SB 2NPLX 1IGJB 1SEBB 1V7ML 3SO3B 5C0CE 2EKSB 1EUUA 2R0KL 4TF4A 5EZJB 4MDJB 2NR6C 4Y16B 4QRRA 4HHAB 2IQAA 5EMYA 1PG7X 2CAKA 3SBQA 4XPBH 3UO8B 2AS5M 2VXQL 4B50A 4EE2A 4M7JH 4H1LH 4L3AA 4N5UA 4N20A 5DUJA 1MUJB 5EZLB 4EZJA 3JWNE 2GB2A 1LO4H 3H54A 2IAAC 3MO1B 3QUZC 4XMKH 4Y7MA 1CICC 1X9LA 4G6JL 1UWEH 4MA7H 5D2LB 5EPMA 1GGBL 4O02B 4BHUA 3BUYA 2QSQA 2UV3A 1I3GH 2X4OA 4LPCA 1K8DA 4LDLB 3O45A 3Q5OA 1Z5HA 3A4DA 2HJLA 1CFNB 3AREA 4NQED 5CFHA 5T3ZD 3TEXA 4R90L 4XVTH 1CDBA 5BS0E 5L4JA 2NY7H 2E7CA 2LVCA 4LSRL 3D18A 2E9JA 3ESVF 1INDL 3CV5A 5E6IC 5I1KH 4W9DC 2VZTA 4U49A 3CSGA 4O9HH 2A74C 4TVPL 4HISA 2ATPA 3V0FA 1MCPH 5TQ2L 4OLZL 1WIOA 4BQCA 3FH7A 5IB3B 1Q9OB 5F3HA 5K39B 3RBGA 4QLWA 5FB8B 5KSBA 5IW1B 1XIWB 4PJXA 2MPAH 5DFVD 4HK0B 3IJSB 3BUTA 3BQVA 1TYEB 3MRCA 4OQTH 4M8QB 1I8LA 4FQJL 2BP0A 3WELA 2M2DA 4GW4B 4RLDA 4JHAH 1AGEB 2K3HA 2BIQA 4PR5B 4OVUA 2ED8A 1L9SA 4KKQA 2BM3A 2HG5A 3PREA 4CVZA 4O02L 1Y6NR 4HHAA 4PVMA 3IETB 3IGFA 1CD0A 1B2WL 4Q97A 2Z1KA 3V0VB 3D3VA 1S7RB 3LVTA 1PZBA 4U1MA 4FTVA 2NY1B 2AEIT 3JWNC 4NT6A 3B5HA 4KROC 1IAIL 3HG1D 1HK6A 4I77H 1N6UA 4OY9A 4A7TA 2FJFA 1IEBA 1X5MA 2IEPA 5F1NA 5JO5A 3KYKH 4GT7A 4OLVH 1ZT4A 3K71A 3GPEA 1CXLA 4U1MB 3R7QA 4MRBA 4X7FC 1CIUA 2CKBL 4B9CA 4UYPA 3CFCL 5KVDH 1UJ3B 4IS6A 4IBZA 4DVBA 1BCIA 4FCAA 4FAAB 3D52A 5MENA 1R34A 3H8NA 4MJ6B 1UM5L 1T1YA 4WRLA 2DM3A 1QFOA 3FT0A 4XPGL 3DV4B 1GH7A 3SPCA 4AM0Q 5J6HA 1KIUB 1U3NA 4RMRA 2X2HA 1NIEA 4ZTPL 3RDTC 3TH3T 1FL6A 4LL1A 1EJ6A 4DH2A 3H9SD 3QUZB 4MMXC 1P4IL 5E9AA 2JFCA 3ZYJA 2ZPKH 3GMNA 4ZMYA 4PJCA 3KGRA 4GP8B 2Z8VC 3KL0A 3B6SB 5IESH 2LLNA 5IM7A 3WS6C 3FONA 1IL1B 5FV1L 1JPSH 1UWGH 2PO6C 1ZAGA 3GTVA 5FA4A 1RJZB 1EDHA 1CL7L 2BS9A 15C8H 1T0NB 2ZUQC 4H13C 5D72H 1UJ3C 5HGAB 3IMSA 4BFGA 3JYCA 4PJ8C 3JWOH 4TUOA 2ZOOA 2GK2A 2FEEL 1JZ3A 4U1HA 1I7RA 3OR6B 4GKSA 1MFBH 5C09B 1KJ3H 4LDOB 1KJ2A 2AITA 3GBMH 4GBXD 3SE9H 1ZTXH 1B3IA 5L8JB 3QRGH 1OSEA 1T0NA 4LF3B 2UY6B 3DOIA 4JVWA 4MQXC 4F7TA 4JJ5A 2G2RB 2QV4A 4KDWA 3BPNB 2FQGA 3QPXH 3P0VL 2HPOA 4PS7A 4F57H 1NSNH 3PPEA 1XVSA 4HC1A 5IBTH 2AEQH 3UP6A 3QEQB 4F15B 5EZIH 1B3JA 1CLVA 4QHNB 4P8QA 2ADJB 4HWNA 3RTQB 1JGIA 4XVSL 2L04A 2IMNA 3BVNA 1UWXK 3T2NL 4LPTA 3O2VL 4XNMA 4PR5A 3D7PA 5DUBA 3LKNA 3I2CH 3AU1A 4M7KL 3CDZA 2EADA 1AKJA 3GJFH 1QBAA 3D39E 3ML8A 3HE7C 1J9QA 3D39A 1XF3B 4HC1H 5A6IA 1HHJA 1R5WA 1RMFL 4L3EE 4E0RA 2ED7A 4DGYH 1S9KC 1OGAE 4MBOA 5BO0D 3MRQB 4WFGD 3KMDA 1PZ5A 3GM0A 4D9RE 1EZUA 1LD9B 4JPQA 4D94A 3G5YB 1ZGLB 1D5BA 4I48B 2V2XA 5E2TL 4LCWB 1FV1B 3PRZA 1CVSC 2D7PA 1NKOA 4GUPB 3TBVA 4GKZB 4JRFA 1AGCA 3TBSA 4LRNH 3T09A 4UB0H 4GSXA 3P77B 4HP5A 4NO5B 4U33A 3O2DA 3SSGA 1F8TL 2J2ZA 4IBVA 4AMWA 3T2QA 2XI9A 2X4NA 3NK3A 3D05A 4ANKA 3LXAA 4GNKB 3VX1A 3GPSA 4MDRA 4JG9A 4MCYB 2HSIA 1I1AA 4KMTH 3ZYIA 4CW1A 5C92A 4ZUWA 3VMOA 4R0LA 2N0KA 1A47A 2BJML 2J5WA 3GHPA 1OEZW 1TPXC 2BFGA 4UDUB 3BVXA 1XGTB 3QZPA 2FATL 1KCLA 3AG1B 5DVLA 5JW3L 5EEYA 4X80L 3DSFL 3OKDA 1LO5B 2NSMA 2WLMA 2EUWA 1RL1A 4LFHG 2DQHL 5FF6B 4M5YL 5HYJE 1MCHA 2Z31A 5AZEL 3B83A 4UZUA 2W8CA 4MCYA 3X17A 2AAVA 3P4OB 5GHWL 1X5GA 5F6HI 3QA3A 1AR1C 2EEBA 2DKSA 2HPTA 1IC5H 5C97A 1KB9J 1U93A 4PJCE 1S7XB 5JHLA 2I69A 2JK5B 3MLRH 3S7GA 1UT9A 3ZO9A 4C58B 4Z3IA 2BOLA 4HSQA 5I1JL 1E0OB 4PLKC 3U4EA 3FSWA 3ULVE 1KBBA 2NY0C 3TOPA 5D6DA 3L16A 4H40A 3G5YA 4LFHD 5D7LD 3MLXL 4JCMA 1QZ1A 5ADOH 3C6LC 4TUKL 4NCC1 2W9EL 4CMMB 2DIBA 3QJHA 5T5FH 1TKWB 1AI1L 3G5ZA 3N06B 5DJ0B 1R3HB 5F21B 1ZS8A 5AOLA 4AWJC 2EYSB 4ISVB 3SOTA 2HFEA 3CTTA 1X7SA 4LL9A 1WITA 3L4WA 4PRIA 3RGVD 1XIWA 2QLYA 5J11B 2YKLH 1MVUB 3Q43A 5C07D 3WTTA 3L3DB 1C5DA 3K0WA 4HJIA 1CL7I 2HCZX 5J8OA 3PAVA 3QJFB 4G8IA 4AVKA 2AJYL 1UH4A 2KL6A 2XIBA 3KH4A 3SE8L 1D7BA 4DZBA 4FTVE 4RFEB 1U8PB 3I74A 4BWUA 1ML0A 2X2UA 3D3VE 3Q9PA 4HLZG 5T5FA 4X99B 5GS2H 5B1AB 3APCA 4TOYH 1NMBL 4U6XA 1CFNA 3GIVA 1SDYA 5BRZE 2NY3C 3TA3A 1VFAA 4L8BB 2OI9B 3IRCA 4N0YL 1JRHH 4Z7UA 4GP5B 1TYRA 3AWGA 4JM2D 4PSPA 3WNMA 4AQ1C 4U0QB 2VAAA 3O3AA 1YY8A 4KJQD 3UTPE 4WW2F 5D8JH 3LPOA 3FJTA 3FTXA 2VZOA 4DPBX 1DFBH 1AYRA 1LO3H 2ITCB 4K8RC 1X5LA 1NFDA 3MZTA 4KK8C 1MNNA 4PJ5E 1GYUA 1GVIA 4H8PA 2NY1C 2IDTA 3N43B 1QHOA 1F00I 1C8PA 1A7RH 4L0PB 5JQHC 3D2UA 2YGVA 5KJ4A 4MSWA 2VQ1B 3C5JA 1BJ8A 4F9LA 5KTEL 5DJAA 4DFHA 3FQYA 2MOVA 1ILSA 1FZMA 1WEJL 2F8XC 2HRPL 5KVMC 3LXUX 2YZ1A 3LNGA 1QYGH 4H8WL 4IU2B 1I8MB 3MOBL 1YC7A 4X7EC 1K4DA 4NN5C 5KYNA 4B9IA 1S7TB 3MNDA 4WFFE 1FDLL 5T33L 3L3KB 1DEEA 2D0FA 4MNGE 5C0JB 3BXNA 4MMZA 5EU5B 4JFEE 2QMKA 2QKSA 1MWAH 1ESOA 3O4LA 2VO5A 4XNXL 1P5UC 1RZKH 2GI7A 5AOMA 3W3BA 1THAA 4YK4B 3OC8A 5ESVA 4WKXA 3S3DB 4AQEB 3NIGF 2E9IA 1ZV9A 3QR0A 1ERNA 3L3IA 1OSPL 3P9LA 2MCAA 1VLXA 1T21A 3FO0L 5EOTB 5GZND 5SWZB 4Z7AA 4L8DB 5F7HA 1U8JA 4NGHL 1UUNA 2IDSA 4XHQA 4P9HC 3DHMA 4PJDE 3HRZB 3Q8FA 4HJJL 3QNZA 1SJVA 2IPTH 4OLZH 4DF9A 4G71B 4ZPVA 4GQ9L 3QPXL 4N0CD 3Q2VA 4N3UA 1ROCA 4DSYA 4ZX6A 3ULUC 5AAWA 4HUWA 3C12A 5I28A 5HHOB 5FFLA 3L1OL 3ARWA 4KBPA 2EE9A 5LQBH 5CZKA 2B4CC 3CX2A 1U8KB 5K59E 3QSKB 3D3VB 1M57B 4DEUA 4QNPE 4NO0D 4HUVA 3LZNA 1E4HA 2H7WA 2O72A 5F0LB 2XZQL 4X4XB 3U2SB 3QRBA 4DKFL 1TSHA 2ICWI 5JORB 2EE0A 1GMIA 4M29A 1F4WH 2B14A 1HI6A 1WBXA 2H1PL 2VR6A 3L3OC 3O2WH 4DGVH 3S35X 2WVTA 4I1PA 4G6FB 4P5TB 3DO4A 1LDPL 1UUSA 3B1UA 4U2YA 5CBAA 4G83A 3DX9B 1IJ9A 5EZOL 4FHBD 1NBYA 4ZW3A 4ZAKA 2UZXA 3WIHH 5I30H 3SDAA 1NZRA 4BE5A 4P4KB 2BHFA 3OR6A 4YDNA 3L9RB 2C9VA 3MJ8B 4WWNA 4W9CC 2W0FA 3TFBA 3VFOB 4K8RH 2PTTA 1LEGB 4PRHB 2VMFA 2EVGA 2D31A 4PBDA 1FWXA 1TZAA 3HE6B 4BQ6A 1OQOA 2DI7A 2QQNL 5BW7C 5LXGL 3CSYB 4JN2A 4J39A 2DWTA 2Y7NA 5D1QD 3ECBA 4OJCA 2VRKA 5IREA 1FIEA 1GS7A 2D0GA 4GG6A 2A6DA 4I18A 2VJ0A 4K9EL 5I1HL 1HILA 2GKIA 5E8DL 3STBA 1H3VA 2DIAA 2VWEE 3RTQA 1KPVA 1ZJAA 1RUQL 5F9JA 3WFZA 1ET5A 3CVHH 2SEBA 1MCBA 4YBLC 2OJEA 2YQ2A 1J48A 2FT8A 4LSUH 4NUPA 1M1XA 5DK2B 3FUMA 1BD2E 1GC1L 3EJYD 5HHOA 3MXWL 5L7XH 1UXLA 1P7KA 2IQ9L 3C5XA 4N1HB 1VRSA 2HFGL 3DVIA 4YDMA 3NCFB 1NGWA 4F7MB 1IEHA 4Q9RL 2IAMD 4NQSB 3QDJD 1XCQB 3CZFA 4HYTB 5FLVA 1N59A 4LASH 1UWGL 3Q6FA 2A77H 3SDCD 1NFAA 1G1YA 2EILB 1NDGB 1FORL 3EW3B 3VI4A 4ZOAA 4AKPA 5JHDD 1DQQB 4NFCA 2DLFL 5EF1A 1YPZF 2IDQA 2YD7A 2H3XC 4PJ9D 4ZNEA 1IFHH 3X11B 4P2RE 2Y7QB 3WFDH 3HR5A 4MQ7B 3GMMA 5IR1B 5FM5M 3I85A 4R5VA 5ENWA 4K73A 2WUCH 5ID0B 1A6AB 4JG1H 3O4OB 1GL4B 4FFYH 3IFLH 4N8UA 1DYZA 3PGDB 1QOKA 2WYIA 4PGEA 1CDYA 1IGML 3VD3A 3O3DA 2R2BB 2A9NH 3QQ3A 1BZDA 1YAZA 1S7WA 2IAMB 4G9DA 3BKCH 3WSQL 2NY4B 2MJWA 2VDPH 3R8QA 3V9FA 4Y5XC 1VCBC 4EKXA 1CD9B 3KPOB 1SY6L 3WJJC 1P7KB 3HS0A 3K2UH 3FRPG 3WTXA 3GUTB 2YD4A 3L5HA 4K15A 4M6AA 4A7SA 2EDBA 4JRYE 3QQ3B 4ZUUA 4H44C 3VTTA 1MFAH 3O3AB 4OB5L 2AK1H 3K91A 2BOCA 3GBDA 4L4VD 4L8SC 4I8DA 1H5BA 3UPAA 3UTSE 2YPLB 4QGYA 2XN2A 1F90H 1BPVA 2BHUA 1MJUL 4LLQA 3D18B 2VDKH 2N59A 3VWKA 5KVFL 1FFQA 2D03H 1G7MA 4ENED 1FP5A 2RH0A 4NHCH 2Z91A 5FYKE 4HGMA 1KCRL 3EKCA 3CSTA 4X0KB 3V0HA 5H35B 3VQLA 3UROR 1JGLH 3QHTC 1XCWA 3CLFL 3DYMA 3Q2NA 2O5NA 2JSFA 3KXFE 3NZSA 4KO5A 3LKPA 4HG4K 2OMWB 3QORB 2OSLA 2BRRL 4KI5D 4JFDD 3DIVA 1FYTD 3TESA 3LH2L 4YHYC 1IGCH 5I8CB 5JMOC 4PRIB 4OV6F 5FHBH 3RZCC 3W39B 5DS8B 5C0AA 5I71B 2BO0A 2EIEA 5AOKA 4KPHH 2PP7A 1EAJA 4X6CA 4XP9H 5FGCB 2FYYB 3B5GA 6CGTA 2EP6A 1I7TA 3WXVL 4XBEH 3I6SA 5F7DA 5HYIA 3U1PA 4XPHH 2EUVA 4C4UA 1RZQA 1YEHH 3TIDB 5IW6A 2APWA 2P5WB 5CLWA 3ML9A 3OJDA 5KBPA 4UAOC 3HNTH 4FXGA 4ALAH 5AZEH 2H41A 3Q06A 3FQNA 1R3LB 5HY9A 1MCJA 1NC4D 2IH8A 4O51A 1J1XH 5HYEA 1GY2A 5EO1A 3FO9A 4NRYA 4OZIA 4WF7A 1IKNA 1SJHA 1Y7VA 4BBWA 1SF5A 1GOFA 3D25A 3TEZA 1U3HD 2DIJA 1A9BB 2WQ8A 1CGSL 2F53E 3TYFB 4QNPF 3GMRB 4HOZA 3OKLA 4MA1B 5EBGA 1N0LA 2BY2A 2YRBA 3EUDA 4P9HH 1TUPA 2FHBA 2NXYB 1BFOB 1JPST 1T5WB 3HHSA 2HJFA 1IBGL 1H6UA 3HUJB 4LSPL 2X42A 1LNUA 4HJGA 5ALCH 5CSZB 3PWVB 5G4MA 2K70A 3FUNA 3JTSB 3NIGB 3QEHA 1BAFL 4U3SA 3BLKA 3QFJE 4JRYB 4PJDF 2JVUA 5FO7A 3C8HA 2JKSA 3QNYA 4P5TA 1LEKB 1XGUB 1CIDA 4KRPC 1A6VL 4OGAD 2AJSH 1CL7H 1E2ZA 3B6SA 1NCCL 2RFXA 3QAZC 5LGJA 4HUWB 3GRWL 2F7PA 3CFKB 2BW5A 4MJHA 1K4DB 1TNMA 3RNKB 1HSAB 5FK9A 1OGSA 1M42A 4HA1A 4U4IA 2VKXA 1KBGL 4NXKA 4ZZFA 4HH9B 1CK0H 3WN5B 1YEKH 2R83A 2IWEA 2ED6A 3N44F 4HWEH 3UO1L 4H5SA 5I6XB 1FHNA 4YHZL 1JZ6A 3L2LA 3O0RL 3DV4A 3RIFF 2EO9A 2IVFC 2F6AA 1HHIA 2C4FT 2AJXL 5F7NC 1OZUA 4JM2B 3WN5A 4A6YA 2P49B 5I8EA 2CIIB 2NNAA 5EFIA 4OGXL 4G8GD 2ZG3A 3RWFA 4ZNCD 4PW9A 4XN9A 3DK0A 4GG8B 4OAWA 1IMHC 4TPRL 2PP9A 4JE0A 3ARGA 4WQOA 1E43A 2J12B 4L05A 1BMZA 3NJXA 4OCLC 3WE6B 4WUKH 1ACYL 3I6GA 4RZCB 3T4AC 1YEFL 5CEXB 3CD4A 5FC9A 4KH9A 4DGYL 5I1LA 1HIMH 2QGCA 5DR5H 3Q6FB 5D1XC 4EQ3A 2R0LH 4YE4L 5AWNH 4P46D 2HFGH 1LO0L 1CXHA 4O00A 1XCTA 3BZDA 4QRPA 5FPIA 5L0QC 5IWLA 2G3ZA 4M62L 2O61A 4R3SA 4P2OB 3ZDYF 5E2TH 3MGTA 3SDXE 4OGYH 1JPTL 2YD6A 4ILDA 4DKTA 4H1LG 1FDLH 3H85A 4NPJA 5C09A 2HFEB 3FUIA 1U6AH 2X6VA 5D7LA 1DQDL 2XWZA 3O0LA 4XP4H 4IRZA 4ZO7A 2DLFH 2DI9A 2F18A 5C71A 4PD4J 4ZO9A 4OZFH 3RKPA 4G6AC 1XF5B 4JFQA 4LP5A 2X3AA 3OGCA 5T3ZL 1GIGH 5DMJB 2NZ1A 2XYBA 4KO9A 5H94A 4APXA 3QDMB 1S3KL 1QZNA 2IDUA 1Q38A 3KLHC 3RRQA 2VDLB 1JNJA 3BI9X 4L2YA 1IGMH 1VERA 3K8MA 5HI3D 4AX3A 3J7HA 2WNWA 1H0DB 3FSOA 1FVCA 1FO0H 5KYUB 3B2DC 1JHKL 3T2LA 4Y2DC 4OZFA 1ILUA 1KTRL 2CLVB 2CRIA 4HAGA 3ULVF 1QSFD 3R0NA 3WIIH 1E4KA 1EMTH 3ZIMA 3ALWA 2BVEA 4OF3A 5DFVC 1TLMA 3OLIA 1N7MH 1QAWA 4F7EB 2OCFD 1RAMA 4P46A 1BJMA 3IU4H 3KG5A 1F6AA 3OKDB 5L2KB 1OF2A 4PJEE 4RGMC 1BVNT 3UBXI 5DSCB 4X4ZA 1YRKA 2D3VA 2LVEA 3ZHKA 2JQAA 3II3A 4DK5A 4O58L 3S5YA 5BVPH 1SLVA 1WISA 4N0CC 5CIPH 2MCPH 5DRXB 4YO0B 2J21A 4AIOA 1IGJA 1SEBA 4N2GA 3IFPA 2AK4D 2BWIA 5ECJE 3F83A 3F7YA 2AXGA 1AY1H 4Y2DD 6PCYA 4V2BA 4J3OD 1BX2B 4H1LA 3UG5A 1NA8A 4MHHI 4KKPA 2QSCL 1BF5A 4FYRA 4GXVL 1PCXA 2XX0A 4BZ1L 1P2CA 1TU2A 2Y72A 3BD3A 4GI9A 3ABMB 3IMBA 4XBGA 4WEMB 3BQUC 2OMTB 3QXDB 1UEYA 1XB6A 3D4ZA 2B0SL 4OT1L 3A4FA 4KI5F 3T0EA 3P9LB 4G6ML 3WTVA 4ELMA 4JDEB 3BX7C 1JHLL 1YA5A 5JIHA 1CLOL 1KTJA 3WIAA 3S36L 2DMHA 2A6JA 3RVWD 4BXVA 4AGLA 3TO4C 2NQCA 4I4WA 3QUXD 4KKAD 2GY5A 3CDZB 3D85A 5LJYH 3HBPA 1TTBA 2P8MB 1QR4A 4JFUA 1MVFA 2CCVA 4XNMB 2VSMB 5GRWA 3OG6B 1YECH 3BKJH 4M6MH 1IX2A 2ERJC 4HVBA 2ZXAA 2DQGH 3EO1B 5F2FA 3RB5A 1U3HB 3GC3A 4U1KB 4WLCA 4PJGE 4R4BA 3JWDL 2C1PB 4PVLA 1RJYB 2ALAA 3QJUB 5E4IA 5SWZD 3N55A 3UYOD 2Y3NA 2HH0H 4LBAA 2H26B 1NWPA 4NJAH 4RBPH 5DO8A 3VSQA 2EDEA 5DHDA 2K8QA 4LCUB 4LIQE 3SBPA 1OAKL 5D2NE 5LGYA 3SBWA 5KSVB 3SJVD 1FV1A 3ZKXC 3MA7B 3ZKND 4BFFA 4ODWB 3VXSA 4XPFH 1RP8A 1G7IA 1DR9A 1LGVA 3JT2A 3UL4A 1K2DA 2WM0A 1UD6A 1W9XA 3HMXH 4L4VE 3UTSD 2W0LA 3ARSA 1Q94B 1VB9A 2UZIH 3LB6C 1T3FA 3IGAA 1HQRB 2OL3A 3BYYA 3W81A 3LEYH 2Y6TE 2IQAB 4HUUA 4UINL 4UZGA 3D0LB 1R3JA 2G75A 2IGFL 3FB5A 4WV1A 1G6RH 2P5WA 1G5GA 3N40P 4HQQH 4KKCD 4NN7B 1BHGA 5DMKB 3QJXA 2YQGA 4J8RA 1G6RB 4HD5A 4ZO6A 5K9JL 3FOMA 4N28A 5IQNA 4W9ZA 2J6WA 3FU7B 3LKOA 4KZ0A 4HDIA 5GQBA 5GS1A 4JLRA 4BA8A 2DLTA 4JX0A 3O4OC 1CE1H 4OI7A 2OL3H 2Z31D 4UAHA 2XWRA 1P7QD 4KUCD 1SM3H 2Q9OA 4OFIA 3LX9A 3ZKMC 2ITEA 2Q76B 2QPSA 1RU9H 4X9HA 5JIDA 2ZXDA 3VFTB 5F93C 2D03L 5KYYB 1KCVH 4UQ2B 5E5MA 5F3BA 1Z9NA 4D3CH 4GKSB 2H8PB 4EI5B 4MCNA 3DTXA 3CCHA 1YQVL 1ANUA 3SJVA 1P4LA 3QDGD 2TAAA 4KAQL 4M5ZL 1HESA 1PLGL 2XXGA 1Z3GL 5LDUA 1U33A 2ZYHA 4UILH 1I7UA 1KCKA 5EWIL 2Z7YA 1LQSR 3EDJA 1LDPH 4PD4K 2R0LL 4YE4H 5AWNL 5IMMA 1XBDA 4YDIL 3OMNB 4TQEH 3PGCB 5T1DL 4Z7OF 1G9MC 4P49A 2HRHA 4PJBB 1QATA 3RZCD 1DZBA 2H2SC 1XGPA 2MQCA 2WD0A 1XTLA 2Q7NA 2QR0A 3PHQA 4ONGH 2W38A 1JMZA 1W8NA 4FNLH 1BD2D 4ENEC 2AQ3A 3OHXB 2PYEA 3ARFC 2UZYB 4PP1C 4WDIB 3SKOA 3T65A 3P1VA 2QTVA 5INDB 2HG0A 3EOBA 1EAPB 3U6RB 2WXOA 3V5DB 1EH9A 3Q2CA 2WQXA 5A3IC 3P0YH 2BSBA 4K7PY 1E40A 1RZGA 1XZ0A 3VFGH 4QTIL 2D0HA 3WS6A 1TLKA 1HHHB 1WPCA 2EDOA 4N2CA 3BGMB 1WSST 2VW4A 4MNQB 4NUMA 5DCCA 4FNTA 2CUHA 1ZHLA 5KN5A 4L9LC 4HK0A 4QRTB 1MNUH 5EOQL 4N9OB 3LRSA 1GHFL 1HXYA 4JB9H 4M9PA 1RIUL 1RZIB 4ODXB 3CVHL 3UCQA 1TTCA 4P3DB 3H53A 2HUHA 1WFOA 3M17A 2FO4A 2P5EE 4PLKD 3V4VB 4GS7C 5C0RL 2GW5A 4JDTL 1MW0A 2H32H 4X8XA 4X98B 1LWRA 1BA9A 1LE5B 3LQAH 3K72B 4JPWH 5EIIA 1M6UA 4X5QA 4FEIA 5I26A 4D9LH 4JFTA 1U3YA 3QT2A 3T2NH 1ZHKA 3NCXA 3P9MB 4FZ8H 2ZKHH 3F7KA 3U0WH 3WY4A 4G7VH 4MB5A 3VFSA 2DM4A 1G9NC 5DZJA 2E46A 5GJTH 3KM2A 4OI9A 1ZK9A 3IT8D 1LDSA 1XWVA 2YQBA 4EXPX 3FQUB 1M7DA 4YFEA 1SUJA 2OX5A 4NQSA 5B8CC 4L4TA 4KV5F 4XAWL 4GRWF 5FO9A 2AV7B 3DRQB 1F4YL 2MCPL 1MEXH 1R24A 3FT3B 5B4MC 1Q9OA 2G2NA 4LPXA 2IANB 3N1MC 4LAJH 5DYFA 4OUUB 4RWYH 1V7NL 2EYRA 3CVDA 2CR6A 3CMOL 1AZVA 1C12B 4XWOC 3ZKXB 4CC0A 4LSSH 1QMUA 3EJZD 5EG6C 1KPVB 4YMPA 4PW4A 3D69A 1RK0B 4TN9A 1P4BL 2UY6A 1GOGA 2HJLB 3AREB 3HNSL 2BY3A 3MRJB 3QCUL 2DQDL 3AAZB 4JQVA 1ZLSL 3LXCA 3DYPA 5HI4D 3PYCA 1P5UB 1MCWM 2V2XB 3ASNB 1SY6H 3DX4A 5IT2L 2N1TE 3EOTL 5C6TL 1BEYH 3ILPB 4Y89A 2N7BA 5T1MB 1OALA 2OYPA 1CI5A 1FO0B 5FYJH 4ZAKB 4FQ1L 4NPYA 3KEDA 1ZWIA 1DQJB 3QAZB 3GXFA 4M7LH 2CHWA 1MG3C 1AKJB 2EYSA 4ISVA 4F91B 5E8OA 1J8KA 4ZX5A 3WTWA 3HFFA 4Y5YA 4RX4A 5F0PB 3QORD 5KS9F 2HZHA 1HI6B 1WBXB 3JTBA 2ZAGA 5GHWH 5T1LD 4WWKC 3MRMA 5JHDB 2DQGL 2XKNB 2ID5A 3TONA 3VFWB 2AFNA 4PWFA 4PV8B 1TMCB 5E94A 4DERA 3RNQB 1IGTB 3WXWH 5TDOA 5FO8A 1FZKB 4LLMB 3STLA 1L9OA 2BRRH 2XZAL 1VGKB 3KPSB 3UBFA 2ZX7A 5DDHB 5F7UA 3SDAD 4JFOA 3FZUD 3N85H 4TQPA 3MACH 3QG7H 4HIJA 4IIQA 4WY7L 3G04A 1AZNA 2FTAA 2EINB 3VDCA 2A9MH 3MNMA 4BSWA 4XOCA 5I18L 3ESNA 1HX0A 5BMFL 5MERA 1MDAA 4B7LA 5GRUH 1BBJB 2MQ3A 5I66B 3POCA 4U0RB 2ZSWA 3VG9B 5IGXH 1ZXQA 1PKQA 2VABB 1K5WA 1KWGA 1A9VA 2YKLL 1WBYA 2NXZB 5I74C 1JHKH 1OP9A 4X5WB 4IGBC 1V3KA 4BEIA 4OLUL 4Z7VE 1E65A 2HMIC 3TXAA 3ME0B 2GSIA 4A7VA 1A7NH 5EC1A 3DOSB 3BRGC 1YDPB 4W9IC 5JUEH 5KBDA 3CIAA 5GGSB 1CGSH 2V3DA 1MCPL 3HZVA 5TQ2H 3RL2B 2HB0A 3GSUA 4YHYB 3ATAA 1FZJB 3SGJA 3RFZC 5BRZB 4BD4A 2Y06L 4R9HA 1EEUA 1MLBA 5LHDA 5I76A 3QUZD 1U3JA 5ILTL 3SQRA 3IU3B 1CD1B 2J2ZB 2L7QA 3NZ8B 4WZ9A 1BLIA 1WFTA 2YAQA 3VRJB 3WEXA 1RU9L 1B4RA 4EVNB 4LSPH 4K5MA 4PRBA 4Q6YA 1LK2A 3MROB 2ZUTA 4FQ2H 2RQEA 4OLWL 3U7WL 4IGBD 4IKKA 4NP4H 5T8IA 4L18A 4PJ5B 5HGDB 1TJMA 3WJMA 1L6ZA 2C7FA 1HU8A 1YUKB 1BFOA 1T5WA 3HKZA 1UZGA 3QS2A 2DD8L 2JTYA 2IH3B 2BNUB 2IWKA 3BDYL 3TA3C 1AR1B 1WD8A 4Q0XL 2BDNH 1FNAA 2HT4C 3CFQA 3QIWB 5ICXA 3S5LA 3UFIA 1KZYA 1JTTA 1CTMA 4OQ1A 4P04A 2KQMA 3EOAA 4GO9A 5H37G 2NOYA 2X0UA 1KBKA 1CG9B 2YUVA 3MOBH 4MWFB 4P2QE 4UQ3B 5FCSH 2DTMH 3O8XC 3U0PB 4IJ3C 4ONGL 3DARA 3HAEA 3MRLA 3O45B 2EH8H 4NLAA 3MJ9H 5A2KH 1NMAL 2YGOA 1SBSH 1TPXB 4ZPTB 4RFEA 2G75B 4AMKH 5IOKA 1KYFA 3BP5B 3QWOB 3NH7H 1DJIA 1WFJA 3SJVE 1FLTX 4ZYKB 5KYXB 3HBZA 4GEJA 3F05A 5I1AA 3TWYA 4PJIF 4OGXH 3O9WB 4M9OA 4ONOA 4S1DC 5J56B 1TZGL 4GSRA 2ROXA 4H0GA 3I50L 4ODWA 3VXSB 4MMZC 1BYOA 4C54A 5JDSA 3D30A 2PP8A 3KS0J 5JOEA 3PCYA 1NINA 2Z6FA 5E95B 3BW9B 1ED3A 2ATAA 2LABA 1MRCH 3SYOA 4ES8A 1OAKH 5EUOA 1LO2L 3HMWH 3WFEL 3BWUC 4NENB 5DD6B 1G7HB 4ZQKB 5E1IA 3PAYA 1DBAH 1JV2B 1T0OA 1ZLEA 4BSJA 4OZGB 2Q7YB 3KYAA 5BJTB 4LIQH 1YEJL 4OJAA 2PWEA 4WUUA 2IH9A 3KPLA 1FL3A 5CBEB 4XMLH 3MRDA 5GS0D 5AOZA 3KBEA 4FTVD 1WT5C 2HVKA 3I6LE 3H9YA 4CC4C 4BFOA 3U4AA 3T8XA 3WS3B 4BGLA 3K5RA 3MCKA 3NCBB 35C8L 5PAZA 2R8SL 1XGQA 4HMDA 2ALWA 3V0JA 4E9SA 3GHBL 1AQDA 1WJ3A 4N0UB 2E6PA 1CFVL 3ZSTA 3L5JA 4JE4B 3FT1A 3QZNA 1VEPA 4ZSOE 5F97E 1W91A 3IDMA 2D9QB 1HYSD 5G55A 3L3OA 4MB3A 4PS3A 4Y4HB 1J11A 3U9PL 2WCSA 3HI1A 4JDZB 3RWJA 1GGIL 2A73B 1OCRB 3BO8A 1ZHBB 2B4CH 4X4YB 1PL3A 3VUAA 2CGZA 3KR3H 3L48A 4X5RA 4WI3A 3BP6A 1TQSA 2VLRA 4YC2B 3GMQA 3V7AG 3MMEA 4MQ7A 1M6OA 3HLAA 2QT6A 2B2XH 1TETH 1DUZB 3MODL 1JV2A 2OCJA 4PMEA 2IDCA 3DIFB 4KJPC 5MEQA 1S7SA 3KL3A 3LS4H 1IBZA 2LT9A 4ADJA 4I48A 4RBPK 1JZ7A 4MHHG 5FCUH 3CZKA 1CGYA 1QA9B 4FYQA 1AGEA 2R29A 4IRSB 4IBQA 2QDVA 2J73A 3OAYK 4XO5A 5TE6H 2DLGA 1KCSL 4X6BB 5DQJB 2OR7A 4EDWH 2C4FU 2YZ8A 4HPYH 4OCRH 4U6HA 1QVOA 3ULSB 2PCPA 5AG8A 3K3QA 3L9EA 5AVUB 5I5MA 4FFYA 4A38A 1QBBA 4YSAA 3H7BA 4N2EA 4UU9A 5FGBA 1G7LA 4K94C 4Y9BA 2HT2C 1U9KA 4OV5B 2XYCA 2G2RA 2LGNA 4H2CA 1C16A 5EN2B 4PRNA 3MX0B 5L4FA 3X14B 2F8OA 4XP1L 3PWJA 1F4HA 4FL4B 2R1WB 4ZUSB 1I1YA 1DQLL 1JZJA 5HHVL 3UJTL 2F0CA 1T4WA 1JPGA 1ZVHA 4ZFOL 1U2CA 4JUTA 3W11C 3GLEA 4XCFL 4UTAL 2DQHH 3ASWA 2PR4L 1XMEB 2B1HL 2KKQA 2TSBA 1S4IA 4G7YL 5C0CD 1NJ9B 1DHKA 1Q1JL 4G8GA 1D5XB 5D7IF 3T3MB 1WLHA 3MREB 4L8CA 3N1PC 3IGKA 3PWJB 4EIUA 1TIUA 4NN5B 1MF2H 4JK0D 3KDMA 3SPVA 2K1MA 2EXYD 4A39A 4CMHB 2XKNA 3DWTA 2ZCLL 1HEZA 3LN4A 4NJAL 1XXDC 1DBML 4OCXH 4OGAC 5MP6H 1T89C 5ID1B 3IWUA 2F68X 1HHGA 2OA9A 4A55A 5L2JA 4AVJA 4M02A 1SXZA 3WJJA 2X3CA 4QKXB 1KGUA 1UXMA 5KVFH 1BVOA 5KSUA 2IDFA 4E41D 3LN9A 3QZWA 5EA0L 4TUKH 4OFYA 3KAAA 5AVTB 4BSVA 1U4EA 1V05A 2DKUA 2J5LC 1TJGL 1B4JH 3V4UH 4PG2C 1H5BC 5LAXB 4AQ1B 3NMEA 3IXAB 5HPMB 4Z7OB 1AP2B 2DM2A 2F19L 2CM5A 1PPIA 4W4OA 3BN3B 3DXAD 1FFRA 2QVTA 3BWUF 1CGVA 4RA3A 2V3EA 2GG1A 2CKBA 4XPBL 2A4ZA 1ZLSH 5DFWH 2XWCA 2YRZA 3QUHA 4HWBA 2FECL 2BSEA 4BZ1A 1BEYL 2R0WH 2VR9A 1FVEB 3WXVH 2VDQH 3B7SA 3FYIB 4OZHB 4U6VH 5MHSE 4GFTB 4YL4A 1QSZA 2GT9B 2O5ZL 4HWUA 3ZE1B 3GK8L 3PWPE 4GAJL 2VR5A 4YXLH 1QLEB 2MNUA 4DESA 1EVUA 5BV7L 3L54A 1KXVA 2AEPL 4TSBL 3L5XH 2MWCA 3NTCH 1NKGA 2XRAH 3LIZL 5D4HA 4IK7A 2CPCA 4UTAA 3B34A 1EHAA 1UCTA 4LLDB 5IQ7L 2RBLA 5AD0B 1U92B 2KZ1B 5C0EA 4XMVA 2IV8A 2PCYA 4GQZA 4G43A 3ZE2B 2L7UA 4UMGA 3OAUL 1MHPH 3FCSA 4JFPB 3II2A 4WI0B 1O7SA 2XG5B 3DMMC 1A6AA 1GTFA 4PW3A