1W6WA

3d structure of cota incubated with sodium azide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA02
2FQGA 3AW5A 1NWPA 3ABGA 2WO2B 2YQBA 1IBZA 3IN0A 3ASNB 1NPJA 3ZX1A 2J55A 4F2EA 3DIVA 3S3BB 1W6LA 3WI9A 3PAUA 2XVBA 2CBPA 1ILSA 1GS6X 4G71B 2QPDB 3WKPA 4W9ZA 4AZUA 3IN2A 1XB6A 1A65A 2DV6A 1OOWA 2PP8A 3OMAB 1SF5A 1HFUA 5B1AB 4AKOA 1SJMA 1X9RA 3CDZB 3JT2A 1WAEA 1N68A 1PY0A 1PLAA 4YSSA 3NP4A 1SDDA 4BWWA 3GXUB 3L45A 2CCWA 2FNWA 2FTAA 3CVDA 2XUWA 2CUAA 4HCIA 1AZUA 1NWOA 4KOCA 2PLTA 4A68A 1V54B 4G7RB 5B1JA 2QDVA 1AZNA 2OV0A 1M56B 1E5ZA 1PNCA 2NRDA 2HRGA 1ASQA 2PP9A 3WG7B 2FJSA 2FT7A 3ZIYA 1JZHA 4A2FA 2IDFA 4FA7B 5FC9A 4HAKA 1RZQA 4M3HA 1BAWA 2IH8A 1JXGA 3TBCA 2DWSA 1V10A 4G7QB 2QT6A 4YSPA 2BP8A 2BZ7A 3MBWB 3NJKA 4G7SB 2IWKA 2AZUA 3T71A 4N4YB 5I6NA 2X88A 4AKQA 1ASOA 2OCCB 4DP1X 4E9QA 2BW4A 4YL4A 1PZAA 2BP0B 2J57A 1W6WA 2R7EA 2LLNA 3DTUB 4AKPA 2IDQA 4X4KA 3NJHA 1NIEA 3KW7A 5PAZA 6PCYA 2GSMB 2CAKA 3AG3B 3AZUA 2HRHA 1AZCA 1JXDA 1ZIBA 2H3XC 3FT0A 2IAAC 1WS7A 8PAZA 2P80A 4ZK8A 1W8EA 2DWTA 4CSPA 3ABKB 1OV8A 3RYMA 4L0PB 3IBOA 2MRYA 1L9QA 3AY2A 4NAJA 3NSYA 4QLWA 3EH5B 2FQDA 2XWZA 3IEAA 1KCBA 5B1JC 2FWLB 1KV7A 5TK4A 5A7EA 2EIJB 5PCYA 2VM3A 3T6WA 2Q9OA 3NJFA 3PPSA 4G70B 1PF3A 2WSDA 3EHBB 5I28A 1I53A 4DPBX 4YSAA 2N0MA 2X87A 4FAAB 1MZYA 3X1GA 1J9RA 3NYKA 3X2QB 2PPCA 4KO9A 3WNJA 1L9RA 2YAHA 1MDAA 4GP8B 3D12B 3OM3B 2EINB 4HZ1A 1ID2A 2XYBA 3QPKA 3UAEA 3AG2B 3CDZA 4KNTA 1TU2A 1NIFA 3FU8A 4KNSA 1GS7A 3IE9A 5EHFA 3WNIA 5I6OA 2B3IA 1AAJA 2J5WA 1QNIA 3S8FB 5I6LA 5AFAA 3FQYA 1IC0A 1BXVA 5IY5B 1AANA 3SBQA 1BQRA 3FU9A 1KGYE 4A2EA 2EIKB 5I6MA 4CSZA 4HALA 2MTAA 1NPNA 2UXVA 2I7OA 1JZJA 3FSAA 4RH4A 1ILUA 1NIBA 1NIAA 2PPEA 1OE2A 3EF4A 3FQ2A 2JFCA 3ASOB 1E5YA 2UX7A 3WKQA 3N2JA 3X1EA 4A2GA 5B1BB 1ET7A 1OCRB 4PCYA 1JXFA 2H47C 4YVUA 5LDUA 2UXFA 3T6XA 1ZPUA 3NJGA 4UANA 4YSRA 1M9WA 1GY1A 4GYBA 3QJSB 2YAMA 3U25A 3ABMB 4MFHA 3UAAA 3FS9A 1JVLA 2YXVA 2ZXWB 2EIMB 2BWIA 1V55B 4HHWA 1DYZA 2TSAA 2CJ3A 3H56A 2QDWA 2XX0A 3FPXA 1BQKA 1SHWA 3HB3B 2IH9A 3QJQB 2JKWA 2WO3B 4DP6X 1NZRA 4E9SA 1ZDSA 2BZCA 1NIDA 2H5UA 3AG1B 2GC7C 2W88A 3T6ZA 3ERXA 2DYSB 4KOBA 4EF3A 3FYIB 2GBAA 4QKTA 2XX1A 2PPAA 3FU7B 3NJIA 1T5KA 1FA4A 1CUOA 1JERA 2W8CA 2PCFA 4YSTA 4BDVA 4N8UA 3WIAA 2AANA 2VSKB 3ZDWA 1BYOA 2AFNA 3EH3B 1PZCA 1BXUA 5D4JA 2FT8A 2FT6A 1NICA 1JOIA 2QPEB 3PXLA 2DYRB 1IKOP 4BWUA 4YSEA 1AS7A 4G72B 4DP5X 2HZHA 1KCWA 1BEXA 3KW8A 5ANHA 1HAUA 5I5JA 4DP9X 4P5RA 2ZOOA 4WKXA 4Q8BA 2TSBA 3TA4D 1FFTB 3QJUB 2B08A 1GYCA 1SNRA 9PCYA 5D4IA 1EZLA 2YAOA 1J9TA 3X1BA 1J9SA 1ZIAA 2BWDA 1AZRA 1RZPA 2I7SA 3PAZA 2YAFA 2HX8A 3EH4B 3SBPA 1E30A 4GXFA 2BHFA 1JZEA 1KBWA 3TASA 1FWXA 1KBVA 4NERA 2BP8B 3CVCA 3PLYA 3SBRA 4YSOA 1N70A 2VSMB 3NJJA 4A66A 3NSCA 7PAZA 2YAEA 1OE3A 3QQXA 1AZBA 4GP5B 1BYPA 2YXWA 4A2HA 1AG0A 2AVFA 1CC3A 4ENZA 1GW0A 3OQRA 4AI7A 4YSUA 3T6VA 4F2FA 1PLCA 3QJVB 3FYEB 1RCYA 4JHUA 4UAHA 3GDCA 1CURA 2GB2A 1R1CA 2EILB 3HEIB 1WA0X 1A4BA 1DZ0A 2XU9A 1IUZA 4YSQA 2AZAA 2I85A 4UF7C 4Q89A 4DP2X 2IDUA 2VW6A 1AACA 4PAZA 4KO5A 1ET5A 1NINA 4E9XA 1NTDA 1L9SA 1AOZA 5B7EA 2PP7A 4DPAX 2XXGA 2XV3A 1BXAA 1GS8A 3FSZA 3PAVA 1WS8A 1X9UA 4JKNA 1XB8A 2PPFA 2VW4A 4GP4B 1ZV2A 3FU7A 4DP4X 1GSKA 3C75A 2DY2A 5B7FA 1A4AA 2IWFA 4NB7A 2VM4A 1AIZA 1PNDA 4E9RA 2CALA 4WTQA 1XMEB 4P5SA 1OCOB 2BP0A 3NSDA 3FSVA 3X1NA 3H4FA 1JZIA 1QHQA 3NJLA 3NJMA 1PLBA 3G5WA 1AQ8A 1SF3A 2YARA 3FQ1A 7PCYA 3QJTB 1MG3C 4BXSV 3CVBA 2RACA 2VW7A 4KO7A 5E9NA 4HHGA 4F7KA 2VN3A 1PZBA 2PPDA 2P80D 1AG6A 5I5IA 1SFDA 3T9WA 1SFHA 5F7AA 3NP3A 1J5DA 1ET8A 2HX9A 3UADA 2ZONA 4BK5C 3V9EA 1A8ZA 2XLLA 5F7BA 2GIMA 4TXVB 4E9WA 1B3IA 3NJNA 3V9CA 3GYRA 2UXGA 5B7MA 2GI0A 3N55A 4AX3A 4BXVA 4YVNA 1KDJA 3QJRB 3JTBA 1JZFA 3MX0B 1A3ZA 4DPCX 2GC4C 1CYWA 1VLXA 4KO6A 3TBBA 1SHXA 1KDIA 2VMJA 2HLEB 2HX7A 2OJ1A 4W1TA 1SDDB 1AR1B 2IDSA 1MG2C 3OMNB 5D4HA 4HCGA 1KYAA 2YAPA 3OD3A 1E65A 1J5CA 4YSDA 2YAQA 5I6KA 3FPYA 4HIPA 5B3SB 5AZUA 1MZZA 3TU6A 4KNUA 1TKWA 4DP8X 2BW5A 2JXMA 1ETJA 3AG4B 1JZGA 5AKRA 1GR7A 3S3DB 1PCSA 3UABA 1TEGA 2Q5BA 1L9OA 3BQVA 1PMYA 1ADWA 1WA2X 2IDTA 4HCFA 3X1FA 3UACA 1OF0A 4DP0X 1RKRA 6PAZA 1BQ5A 1F56A 3NSFA 3S8GB 1EHKB 1M57B 1OCZB 1TEFA 2HXAA 4E9YA 1PAZA 4YSCA 1GY2A 5I6PA 4BDVB 4JHVA 5I5MA 4A2DA 2R7EB 2FQFA 2PCYA 2Y1AA 3PCYA 4A67A 3SQRA 2UXTA 1YLBB 3ABLB 3UGEA 3ZBMA 5I26A 4BWTA 3CG8A 1E67A 1L9PA 1ZDQA 3H4HA 3OMIB 2FQEA 4M4RB 1WA1X 5B1KA 3NT0A 2BO0A 1XB3A 5TK2A 2XV2A 1AS6A 2UX6A 1CYXA 2A3TA 1NDTA 2XV0A 2E86A 2GHZA 2ZWNA 1A4CA 4K9JA 3S3CB 1UATA 2J56A 3BVDB 1JVOA 2IWEA 1OCCB 1IBYA 4GY4A 4DP7X 4E9TA 3CZUB 1J9QA 1QLEB 4E9VA 1L9TA 1HAWA 1OE1A 2Y69B 3DKHA 3FSWA 1ASPA 2XXFA 1URIA 1AS8A
chains in the Genus database with same CATH superfamily
3BUDA 1EERB 3QRFM 1U3NA 3DVFA 3ECBA 3HNVL 4BFJA 4GQZA 3LCYA 3W56A 5IM7A 5DTFA 3S3BB 4PJHB 4NAMA 1MIEL 2P5WA 1ILSA 4G71B 1FNSH 1USQA 3FOMA 2RH0A 1UM6H 5ANMB 4Y2DC 5KSUA 1XGTA 3TURA 4JRXB 5F88B 3WKPA 3T0DA 5T5FA 2E6PA 4XNBA 4N90D 5IEKB 3LQAC 5FCSH 1HN1A 3EYSH 5IW3A 1VENA 1MCLA 4OCWH 5DFAA 5GJSH 1OHQA 2O26U 1ERNA 1RZGA 3OLDA 4WV1B 5LBSH 4MQXD 4DW2H 43C9A 1MCHA 4JFTA 4IGBA 3RVTD 4NT6A 2UZXA 1QLEL 1HL4A 2DYPD 4H5SA 3GRBA 3QIUC 5IJKC 1MFEL 1QQDA 3BRFA 4OZ4B 4NUGL 4LGRB 4BSVA 4G2AA 3TV3L 4TMPA 4OFVA 2ZJSH 3ULSB 1BM7A 3GIZL 4JPIA 5IUCA 4F9LC 4HT1H 2QADC 1XIWA 1F86A 5I75B 1IKFH 5A3IC 3UPAA 4Y16D 1CFVH 5B39B 4XO9A 4ELMA 3RAJH 1T0PB 1UACL 3JWNC 1JNLL 4HUCA 1OQXA 3SDDD 3F7PC 4LEBA 1BAFL 3J7HA 1JXGA 2XN9A 3ZSTA 2JB6A 2D0HA 4OY9A 3MOAL 2Y7NA 3SOBL 1KELH 3K91A 3MTXA 2HMIC 4ILDA 3K5RA 1JL8A 3U48A 4I3RL 3LIZL 3P73A 4OD3L 1VCAA 1I3RA 5I2IA 3R8BB 4JJOA 2LW3A 3HE6C 1BSIA 3L6FA 1AGCA 4IS6B 4RWHA 3T3MF 3HRPA 4CC4A 5FECA 5GS3A 2CAKA 3HMWH 3TTYA 2OW7A 5IV2A 3MV7B 3L3IB 3DXAB 3Q0HA 3FT0A 4F7CA 1W0WB 3L4VA 3V8CA 3MRMB 2X4NB 2E74C 2DWTA 3O4LD 1MH5A 4B5ZA 4N85A 4XXWC 3BIKB 5LNEA 4UT6A 3MRPB 3NZ8B 3MUJA 4R5XA 1WF5A 3WO4B 2W65A 4ZYKB 1GGIL 4TTDD 4F1ZA 2BOCA 4TQPA 3L3OA 5F9JA 4EI5A 1Q1JH 2OCFD 4PWEA 4ZD3H 3SKJL 4H0LC 4RZCB 1CTMA 3FCTB 4XCFH 1KY7A 2JKSA 3T6WA 3T4AB 4N2BA 2X4UB 1Y0LA 3SYCA 1ICTA 3O6KL 4B0MM 3ZXAC 4NS0A 1PFCA 4LMQE 4NFDA 1H3WM 5K69A 3AU1B 5CJ5A 4YBQC 1LEGA 4DOHB 2DIAA 2X5PA 1KTDB 2YXMA 1KCRH 1UH4A 1H5BC 3WY1A 5J3HD 3IF1B 4KU1A 5GISH 3L1GA 2K6YA 5FPIA 1FSKC 4QXTA 4QJ3B 5GGRA 2APBA 1R5VB 3OL2A 5D1XD 1ZT7B 5CJXC 5J0BA 1RU9H 1UWGH 3DROA 3I6SA 3OM3B 4HIEA 2O5NA 1FG2B 1E4KA 4N1EA 3ZTEA 5DZ9A 3HLKA 5ACMA 3DA0A 3IE9A 1XCTA 1QFHA 2IVFC 2X7LB 5FUOH 3RDTD 1X5GA 2XJLA 5HDBF 1EJ8A 4F2MB 3FU9A 3EH1A 1RI8A 2O5XL 3VB8A 1U41A 2VDKL 3QXAA 2UY7A 5BZWB 4J5VA 3F5WA 4JPWL 4I18B 1AMXA 5SWSA 3GQFA 4PJBE 3HBPA 1SN0A 4HJSA 4PGJA 3QXWA 1QLRB 4HIXL 2OP4L 4O02A 2R2EB 4HC1A 5D5MB 4OF0A 4NQEB 3SCMA 2P5PA 2Z9TA 5KEZA 3DSNA 1FG9C 1FZOB 3QJSB 3C5SB 3IFLL 1UJ3A 3NQKA 5EFIA 3SPCA 1DJIA 4N9GB 4XOBA 4X99A 1C12A 4L5FH 4UOJA 2WXRA 3V4UH 4GLRI 1DL7L 2DMGA 4R0LA 3NACH 2FO8A 1LWRA 3WTSA 1ORSB 2O5YL 3QVAA 2L7QA 4KK5D 3FHEA 3IDNB 3FQRA 1I7ZB 1YYML 2VXQL 1UZ6F 3LQAL 3QO1A 3S37X 3JWDH 1JI1A 4MASA 5EIIA 3P4MA 1G7JB 2DYSB 3CQPA 5CLZA 4JGUA 4FQCH 3NEOA 4KZDH 2I60H 5LAXB 2ADYA 4PJHE 1NBZB 2XWBA 2HJLA 3ZMEA 5JQ6L 1MN4A 4IDLA 4P5KA 1RP8A 1G1KA 5CS7A 4LNRA 2ADFL 2V3EA 5IB4B 4HK3J 4JRXE 1OOAA 3KL5A 3MNWB 4HIHB 1KXQA 3EOBB 3HN3A 2P8LA 4JAMB 4RESB 3U4EA 3AAZA 2DQJH 3CDCA 4HX1B 1SYVA 5TQ0H 3AY4C 1F18A 1BXUA 3L3HA 5D4JA 1IM3B 1E3XA 1NICA 2D9CA 1INQA 1KJMB 4X7EC 1QEXA 4YSEA 2J4WH 4RX4D 3ARFA 3QIUD 2GJ6A 4DP5X 3P02A 3LKOA 3O4OC 2CZNA 2UUDK 4HA1A 1JDDA 4KI5C 4BRJA 3K4DA 4F7PA 1MAMH 3MRKB 5B4MD 5C0BB 2KDYA 2ZOKB 2RMNA 4PW9A 2AAVA 2C9VA 5A3ID 2XWDA 5J11B 3WHE0 2AQ1A 3MFGB 2NUPB 4AV4A 1J9SA 1HH9A 3IDXH 4FXLA 1QO3B 2BVQA 4O5LH 4QRRD 4QRTB 2MIZA 1I8MA 3T3MB 1HHIA 1QBAA 1RZPA 2MCPH 1PYWB 5LBSA 4L4JA 2SEBB 5FKPB 2HMID 1N5AB 3OXRB 5J06A 2DQMA 3FRPG 2G3NA 4YXLH 4AYGA 4PUBH 5F96L 4ELDA 1LE5A 3NSCA 4UOZA 5F7UA 1RUML 3DJZA 2PCPB 3IKCB 3FU0A 3HPJB 3C5JB 1SYSB 1KN4H 5DHDA 2X1XR 4E9LA 4P2RB 1EV2E 3BUPA 1M7DB 2XXMB 3G5VB 4OGYH 1DBKH 3NPSC 5A6LA 1M7IB 3T6VA 2AGJL 4Z5RA 3CHOA 3G08B 4PGBA 1RCYA 3MV7E 3DOSA 4LRNH 3VE0A 1CDIA 3DXAE 3EJUA 2GB2A 2EILB 3HBQA 1ETZB 1HVXA 1MW1A 2DJSA 3TF7C 4JBSA 4G9DB 4PW4A 2DQUH 2HVJA 4FFWC 2DEXX 4OSUL 4GG6F 1IQWL 3GTNA 4OLXH 4WLCA 5I73B 4JQXA 3X13B 3TS8A 4E9XA 1PSKH 5DQDH 2DQCL 1EHAA 4NQXB 2PP7A 3H9HA 3WE1A 4WGWB 1C08A 1X7SA 4X5XA 4YBQD 1RFDL 1AHWB 1RHHA 2NY4D 3H3BC 4NNXA 4GRWF 4G42A 2OTPA 4V1DB 1RZIB 5HDBB 3PYCA 1DVZA 2DY2A 4PRAA 1WEJH 4KKBC 5C08D 3ZN6A 1TTAA 5DQ9A 2VAJA 4ZFZA 5ICZB 4ZNEA 3TCLB 2L0DA 2GITA 1OT4A 3JT0A 2D31A 3F65A 4YIQB 4H26B 4D9QD 1BOGB 2N0KA 3G5WA 4N8CH 3GMPA 3UAFA 3CN4A 1Z0NA 4HQQL 1KTLB 2A38A 3CBRA 2I27N 3WIIH 3GHEL 4EQ2A 4RSVA 3TPKA 5DZPA 3VMPA 3QQ9C 3RBGA 3BCDA 5E8PA 4F2ME 3FO0L 3MJ6A 1TQUA 5FO9A 1YC8A 3GSNH 1FV1A 4MQSB 1OP9A 3B9EA 5GRUL 3RGVB 3IJ7A 3RX9A 2GJJA 3HKZA 3TA3D 5AVXB 1B3IA 4XAWH 3N55A 4HBCL 5D5ME 4NQEE 5BXFB 2L3BA 3LKPB 1MWAA 5MERA 3WHE1 3CX5J 4DCQB 2HKFL 3ARYA 3UTSD 1JZ5A 2ICWI 3RUGF 2OJEB 2DL2A 5D1ZA 5LJYH 4OLWL 3WTYA 4JDTL 3S96B 3ZHDA 5T3XE 3U2SB 4PY7B 2DLTA 5DQJB 4WEBH 1EDQA 1JF5A 4E9VA 4PJGA 4ZTOL 1JHLL 1ZK5A 4N2AA 3DSFL 3PNWB 5DJDA 4I0CC 1EXUB 4DVBB 1JNJA 2GK0A 1VJSA 3UTQB 3RG1C 1ETJA 1ED3B 4U1JA 1EMTL 5FHBL 3S3DB 4BKLA 4G43A 3MKGA 3LOWA 3AREA 3CUPB 3I85A 2ATKA 4WKZA 5D1QC 1ZA6B 3STZB 1BZEA 4G6JH 5E8EB 1IL1A 1QBLL 5JQIB 3NQIA 2CHWA 5C0JA 1JTOA 1RKRA 3PJSA 4LPCA 3D2UD 1BMWA 3TH4T 1F56A 3GNMH 1IGTB 2HFEA 4NUPA 1I8LA 3ULVL 3NTCH 3AQXA 3ZUCA 1SJEA 3C9NB 4YSCA 3ZYIA 3DUHA 2OK0L 3BXNA 4JKWA 1U8PA 4JHVA 1WCBA 3QDGD 3L5WA 1NAMH 3UX9B 5DSCA 2BY2A 4JPVL 1CBVH 3ULVD 3S48A 1KIQA 3IT8D 3Q8AA 1CICB 2VL5B 2CO2A 5H94A 1TZGH 5KOMC 4Q0XH 4MA1B 3EJYC 2X05A 4D9RD 1B0WA 4KI5D 4Y4HC 4P9MH 4LCUA 3QH3A 1LMKA 4NEHB 3I9GL 2VC2L 4LKXB 3B37A 4OQTH 1NDTA 5AB0A 4Z9KB 2GHZA 4JFEB 5C0BE 5BOPA 3QG7H 2HUHA 2XZQH 4H20L 2BOBB 4KFMA 5MEPA 4LHUD 1X5HA 1JVOA 4LEXL 2OFQA 4XP9L 2N7AA 2IOMA 1MIMH 4PJXA 4XVJL 3FSWA 1MXGA 1R24A 2XY1A 2XIIA 4HUUB 4DUXA 1XCQB 4KY2A 5CUSL 3T3ME 4UM9A 1FIGH 1LK2B 3B9AA 1ZV9A 4IHBA 3QORC 2WO2B 4PP2A 5L8JB 2ICEA 3IXAA 5DS8B 3A5VA 4AGMA 4Q4IA 1JGLL 3EJJX 3L7EA 2DMHA 1KPUA 2YQ3A 3GSRA 4N0UA 4P57A 4UYQA 4Z76A 2DQTL 1G7MB 4GG6B 4I4WA 4CN6A 1CMOA 3Q9QA 2ALWA 3ISYA 2J21A 2PP8A 4FCAA 5GGTH 5IJDC 4JFZL 4P2RE 2HJKA 3GXFA 3ZTJH 4AJYV 3W0WA 2NW2B 4UNVA 1XSOA 4G7VL 5F9WC 2NY2D 5KSAC 2Z93A 1HKLH 1NCWH 3EJPA 3WDJA 2R2BA 1BIIB 5IT2H 1FNFA 3CHRA 4GRWB 4WCYH 4ZMVA 1I1FA 1QVOB 2AMGA 2ATPA 1S7XB 2V2WA 4FFWD 2PW1A 3GB7A 3Q6FB 2DIBA 4CVZA 4DEPB 3PABB 3CVDA 3BE1L 4NENB 3L95A 4NZTL 3VDAA 2G5BA 3C6LB 1GJUA 2GAZB 4RA0C 4P2QD 1MCPH 3RWDB 2FUTA 3T08A 3TBTB 5DZOA 3SZKC 3QZWG 3CH1B 2XHNA 3F8UB 3WG7B 3KLAB 1EPFA 3KYMA 2AK4D 3X12A 3INUL 4X0KA 2NQ3A 4M5ZL 4XMPH 1KENL 3T1FA 1MLCA 3EGSB 4HFWB 5HDBE 4A2LA 1V10A 2VXSH 2YLHA 1F11B 1OTSC 4OD1H 4BH7A 4Y19B 2XBDA 4XODA 3D48R 3HA0A 3OSVA 4WI4A 2VDML 1H3TA 1JZ7A 5IHZB 2KQNA 5C09D 3S5LG 2YQ2A 3WY4A 2BP0B 3FB7B 3IGFA 5JNYA 1I9RH 2DZEA 5C0AD 4J8RA 3RZWA 4JQVA 3N40P 4ONFL 3VFWB 1A6ZB 3QQ9D 1E28A 2ZKHH 4R7DB 1AZCA 3SCMC 1JXDA 1OPGL 3S4SB 5DZJA 3ZUNC 3WN6A 3MTRA 1U3HC 3RUGB 2YBRA 1BBJA 2JI2A 3ABKB 3GIVA 5IB5B 4J4PD 5GXBB 1U8CB 4P5TB 2MRYA 2VXUL 3WE6A 5I0ZA 2VM9A 3CVIL 3ESMA 4WO4C 3AMKA 2VZ1A 3JWOC 4GKLA 2DB8A 3FN0H 4Z78A 4PY8J 4QOKB 5IJVA 2PNDA 3NA4A 3TJPA 3VACA 5IMOA 2GW5A 2BXZA 4UT7L 3AROA 2OXHA 5I28A 4A1RA 1UZ6E 3QO0A 2ZF8A 3QUGA 5K39A 1X5MA 2WVUA 2G2NA 3BEWB 1NCGA 1BZDA 1JS4A 3D5OF 4ODHL 5ALBH 3D3VB 3FT4A 3PNRB 1A9VA 1B3JA 1MRDL 4XB8A 3I9AA 1U58B 4OJFH 5D7IF 4PLNC 4GS7C 1HH6A 5FK9A 4N0CD 5IVXA 5DEGA 3M8OL 4HZ1A 4ZUWA 3CDZA 1MFDH 1Z5LB 4HJGA 2BRRL 4QXGH 5I6OA 4JRLA 5D1QD 3QQDA 3BQUC 1ITCA 5DHXB 4CN1A 1UC6A 1K3ZA 1NLBL 1R3KA 1OW0A 4JDVA 4PJ5A 1JV5A 1WZKA 3CK0H 4IMKC 4PJFA 2ZOUA 3ARFC 3A67H 3NSJA 4W68A 1SM3L 3ILPA 3KCPB 1URLA 4U3HA 3B5GA 2OL3B 1A6UH 1JFHA 1QRND 1ZVSA 3VQ2C 2YGVA 4BGLA 4L3CA 4WTWA 4FFZH 2AEQL 3ROOA 4JPKH 4R97B 5FDWB 5L2JB 4ZQKA 5AL0A 2IXQB 4QJ4B 5AB2A 4K3JH 3SGEH 4QRQA 4UANA 1NM9A 3NGBC 1M9WA 2F08A 5SX5K 4NNPH 3VXNA 3U30C 1ZCRA 3GBEA 2N3JA 2OMWA 4WF7A 2YS4A 5HGAA 1OIOA 1U8KA 1UENA 1PKQA 4JFOA 5ENWB 3IVKB 1U0QA 2CJ3A 4PLKC 4DT2A 5DMGC 3F83A 4JFVA 1OK0A 3I50H 4JFEE 4OLVH 2C8NA 4ANXA 1P7BA 2B9AA 4MD0B 5IB1A 3SHSA 1TPXB 5EEZA 1ZTMA 2JKWA 2C9RA 2BFGA 5IB3A 1H6EA 3O2WH 4L8BB 5DD1H 4LVNC 3D52A 5FKAA 4PD4J 1CBJA 1H3XA 3VFVA 3WEMA 3QORD 5DJ2A 3VFPB 4NJAL 2IG2L 3O6FB 1E8XA 1CD0A 1KXVA 3VXPA 1KJ2B 1BVNP 1FF5A 2WSPA 2F8XC 4F8PA 2EACA 3BPLB 3RWIA 3H55A 4W6YB 4EZKA 2NT1A 3T0AA 4EDXB 4DKAA 4NO5A 3LRHA 5KYUA 4GG6E 1WDAA 3GM0A 2E9IA 4AYBA 4S1SL 3ECWA 1W0VB 1TO4A 2D7NA 3C09C 5KSAD 1XGUA 1KUMA 2EYTB 3HZKB 2R8SL 3ATDA 3EJTA 1E9QA 3CMGA 5ADPH 4IEFA 1S7WA 3GS4A 4U1HA 3OR7A 3ZHKA 2WCGA 3WFCH 4ELMF 5LG6A 1OCWH 5DVOA 2V2TA 2JK5B 3OXSB 2QZQA 3N1QC 4DF9A 5J12C 2DAVA 2DH3A 3FRUA 4NKIH 2J72A 5I5JA 5C1MB 5H37A 1M9SA 3BD5A 5LN4A 1CD1B 4CC1A 4Q8BA 2TSBA 3OPZH 4UUJA 1NSNL 4M7LL 4YFEA 1U8HB 4MZIA 3JV5A 4WSKA 4QHMA 4I1PA 1XH2A 2OCJA 3ARQA 2ZXGA 5SX4I 5ADOL 1UXWB 4RMWA 3BAIA 2YIHA 1JNNL 3K6FA 4IU3A 4MD5B 3BUYA 5GGTA 1J5OL 1SPDA 2CSPA 3VJ6B 1D5BB 5DUJA 3CFEA 4U6XA 1D5IL 2J1WA 2XG5A 3ZKMC 1I7RA 1N8OE 1OTSD 4JRYB 4N8PA 3EKCA 1HYSC 4HUVB 3UXFA 4ZXBB 4M93C 3U6XA 4Y19E 3CVCA 4HCRL 1N70A 2VMCA 4JM4H 3L9YA 1AG0A 3U4AA 2AVFA 2WC7A 3LD8C 3WNMA 4AM0A 4XPHH 2VQ4A 5HYSB 3NRFA 4F8OA 5ID0A 2NY5L 4F2FA 1NGQL 4GAGL 2C3VB 3TWCH 3CD4A 1U3HD 5C6PB 4A7QA 5MENB 3UL4A 4OZHA 1RIUH 2QFRA 5I18L 4ZT1A 3F7RA 2P26A 3EBHA 4FE9A 4G8IB 2AZAA 4L29A 2JB5L 5D1ZC 1KFAH 3VSUA 1XZ0A 2VNCA 4MCNA 4IRJA 4WO4D 2JKIS 2W0KA 3GD1C 2UZYB 3BYTA 4KO5A 3BPOB 3Q7JA 5D7IB 1Q72L 4L18A 1JD9A 1SHSA 2APWA 5EC2A 5ILTH 4HULB 4QOKE 2ZCLL 4OLYL 3ZKNC 1LO4L 4K9EH 5GPRA 4KX9A 1E4XL 5IFHH 2HFFB 3I2CH 3EOTH 4PP1C 4U6YA 4GW4A 4N8VB 4L9DA 2FYVA 1PTZA 2VW4A 4K71C 5ITFB 4L0ZA 1S5HB 2UZIL 1I9IH 4ZMQA 1GSKA 1RUQH 4JY5L 3EYFA 5EOTA 2AV7B 3D3VE 4JZOB 1KTRL 3BZ4B 4Y5XA 1TQBB 5DFVC 4P5SA 3GMRB 5I19H 4JDEA 3LSOA 2KZWA 4LVOC 3HMXA 3V7AE 1DUYB 1I3GH 4OJCA 5DWUL 4L8SB 5CHNA 1SF3A 3VCLB 4APXA 4P07A 3L17A 1YQVH 3W9EA 3G6DH 1I1AC 4IDJH 1DVFC 3CLFH 1FNSL 2EO9A 3B6SA 3ECBB 2IOIA 4HWBL 4QR7A 1YRKA 3KR3H 3C5XA 1UOLA 4L9LC 4Y7MA 3EYSL 5JORA 1LQBC 3JWDC 4P4RB 5DTFB 3ELQA 3QCVL 1C8QA 2HX9A 3RQ3A 4CADA 5D55A 3SGDI 3U7AA 1CFMA 4BK5C 5DGQA 3V9EA 5KSUB 2X3AA 4DW2L 2QKIC 1XF3A 1XGTB 3I02B 4WI9A 5CN2A 3TT1H 2NY3C 4LQFL 1NCHA 3OX8B 4KQ4H 3L3JA 2ZCKL 2CR0A 1WJ3A 2M83A 1UGKA 2GI0A 1PZUB 5DZVA 4WWNA 3SQBB 4W9KC 5GGVL 5F89B 5DCCA 3OHXB 3L9RA 3HG2A 5CCJA 5DMGD 2PXYA 4HT1L 5I0YA 3MRIB 2LLLA 4H5SB 1PDKA 5E6RB 4TS6A 4CNIB 4HKBB 1IKFL 5JMOC 3QUHA 4ODWB 1QQDB 4RMTA 4XX1G 3KPRB 5F7FA 5LCVA 3W11C 4BSVB 1B9ZA 4JO4L 5FO8A 1OM3H 1J5CA 1V8HA 3K6DA 1DCEA 4Z6AT 4U6VH 2HWZL 2XT1B 4JPIB 3VXUB 4HWEL 5DS1A 1XIWB 4NZRL 5KVEH 1KELL 3UC2A 2MTPA 4WRLA 1EVTC 4CGTA 2D4DA 2Q5BA 4ELMB 3O8XD 5GRXG 3DMMA 2XN9B 1P9MC 5GJTH 1FVDA 3H9SE 2B59A 5MI0B 2AXGA 1TEFA 2CH8A 3ARZA 5EU6A 3EJRA 3W5NA 5IQOA 4FI6A 1DSYA 3HMWL 3NEXA 3X3FH 2C4FT 1OXYA 5C0EA 3P73B 1T2JA 3VGBA 1I3RB 4XE0A 1EAQA 2JQZA 3APMA 1MHEA 2H6PA 2Y1AA 2IIJA 4HJEA 3ABLB 2AEOA 3L6FB 1AGCB 3WTUA 5FECB 4ZPTB 2BWQA 3VXOA 5IV2B 1VDGA 3IDJB 3TTSA 3UO1H 3CN2A 3F04A 4F7CB 4FLRA 1JN6A 4Z8FL 3CXFA 4YUEH 1CYXA 3NDZE 4G11A 1MH5B 2WQSA 4QAMB 3P30H 5HYIA 4XCFL 3B5TA 2P8MA 5A2BA 2W65B 2ZG2A 5AB1A 5JIKA 4XWOC 3CZUB 1DFXA 2BOCB 5GRVL 1VFOA 3L3OB 2EYSA 5G55A 1URIA 4OVVA 3AW5A 4ZUTB 3ABGA 3GZOA 5GISL 2ZX5A 1Y0LB 5ALCL 3L54A 2OMYA 1WGVA 1HYSD 5I8OL 5I9QB 2YK1L 4JRYE 3OAYH 1U8IB 5DZLA 2YRLA 4XPBH 1AKJD 2DWEB 4IBVA 1RU9L 4XAKE 4YFLI 1KYDA 1RVFL 1QYGH 5HJ3A 2XVBA 4OB5L 4XPAH 4RVBA 2ZNWA 5CJOH 4PCSA 3UMTA 4QXTB 5GGRB 2LVCA 1S9XA 5FUOL 4YOKA 5E2TL 5BRZA 3KPMA 3WJJA 1L7IH 1OD7A 3DROB 3ZT7A 4HIEB 4YHPA 5I8CA 1I85A 5TDNA 3UBGA 3AQYA 2OMBA 1XSKA 1T2XA 3FTGA 5DJYA 1HQRB 4LOFA 4NHCH 4PBWD 4BZ2H 5LUMA 2NSQA 5A16A 2A9ML 1ZLUK 3MREA 3KWUA 1WH0A 4XB7A 2ESVD 2ZUVA 3DECA 2VDLB 1PGRB 1FGNL 1X7QB 3SE8H 1P4BH 2F7RA 1WZMA 3QXDB 4BFKA 3FQTB 2UY7B 3US9A 5D7IE 5B1JA 3F5WB 3BWUC 1DJSA 1G4RA 3RWEA 3Q9PA 3UBHA 2NY0B 3DUSA 2FT7A 3K72B 1YNTA 1SDYA 2BVTA 4ZW3A 4K5OA 3W9DB 15C8H 1RERA 5JXAL 3DSNB 2ODHA 3B2PA 3BGFC 1OW0C 4YDMA 5DLMH 2E9WA 3B2VH 1UJ3B 2IPUK 5EFIB 5A2IH 1PD6A 5LXVA 4X99B 1LGVA 1C12B 3FZUC 4EEEA 3FFDB 3VD5A 4HUXB 4AQEA 4ODVH 2WJ7A 4KV5F 2HA1A 4X50A 4QD2E 4OCLC 4DNLA 1U8MB 2A9DA 3JWNG 4R0LB 4MJ5A 4NX0A 3M45A 3C6SA 5EZJA 1FZMA 1Y6MR 3T65A 2XI9A 3ARGA 1QSEB 4TM9A 4KDWA 4KWUA 1O6SA 4FQCL 2ITCA 3HNSL 1I1AD 4KZDL 4XNZC 4CU6A 2I60L 2OA9A 4QGYA 4TUKH 5D6DC 5T1MA 3JUZA 1UFUA 3QO1B 1IVLA 5EU3B 2P52A 1FDLL 5CIPA 5EIIB 3P4MB 4HOWA 3K0YA 2EECA 4JHZA 4JZNB 1A02N 1QX1A 3VXSA 3TEZA 1ZVHA 2IMMA 2XWBB 3OKMA 4PJGF 2HJLB 1LQSR 2P5WE 4P5KB 4XPTL 2NY3D 5DJ0A 5BQ7A 1T83A 4LNRB 3AADB 3ARBA 4AEHL 2V2XB 3GMQA 3KEDA 4AIZB 1A1OA 3QEGH 4EIGB 5AAPA 5KYNA 3AAZB 1SYVB 3GBNL 1XH0A 3SDXA 2OKMA 3BH8A 3DOIA 2ZSVB 1INQB 1CT8B 5DYOB 4UM8A 5IFAH 2BSEA 4FQXC 4ADGA 2UUDH 1HXMA 1J8HA 3LKOB 5MP6H 2P42B 4HUKB 2FECL 3WUWB 3QYMA 1MVFA 4N2KA 3PWJB 5CBAB 3IDXL 4MQTB 4OLZH 4QRFA 2Q8AH 5FB8B 1JPGB 1UH3A 1G6RB 4ODXA 2EINB 4QHLB 2APSA 4V11A 5EZPA 4DK6A 3NCJH 2MCPL 2F1AA 2NR6A 3H6JA 3MV8B 5F1NB 4C56A 3CBKB 1EEQA 3LH9A 3BKCL 3G5YA 3LZQA 3MV7D 1F4AA 2BVQB 5T33H 5DVLA 5AFAA 3OJDA 4W9HC 1I8MB 1FNGA 4YXLL 4ELME 4PUBL 4P23B 4PSRA 1JUFA 2XN9E 1TJHL 3P40A 1CL7I 1KN4L 1F4YL 2W07A 3MLSH 2UXVA 3F01A 2WZ0A 1NIAA 5DC0A 4FKEA 5F44A 4DKTA 3RNKA 1KCSH 1Z9NA 4A2GA 4MMZC 2H0FA 4LRNL 4PCYA 1LVEA 2JV6A 2ZCHH 4PJXF 2WBJC 2E56A 3QZBA 3ZDXF 2JJWA 2UXFA 4LASH 5E8DH 1ZPUA 4PJIA 1ULVA 4GYBA 4Z5RB 3N1FC 4PGBB 5GZNA 3DOSB 1JVLA 3VE0B 5I17A 3DGCR 2PO6B 2ZXWB 3V7AG 3VXQA 1F3JA 3I3BA 1DYZA 1J05A 3H56A 4ODUA 2HVJB 4HZAA 1F1DA 1C1EH 1BQKA 3FCSA 3GJEA 1M05B 5MHSD 3OQ3B 1KBPA 3BLBA 2C7UA 1G5AA 1SY6A 3MRJA 3GRGA 1IEHA 3PWNB 2ZCZA 4ICXA 2XQYG 4FNQA 3H9HB 3HI1A 1EEUA 1WEJL 3KLSA 4JM2F 1C08B 3E3QE 4Z18A 1NGXB 4PS7A 4X5XB 1PLGL 4BKTC 4X6BA 1I1YA 4AG4L 1U21A 3WXVL 2ZYHA 1S7UA 1ANUA 2WGNB 3DJRA 3HBGA 4I0PA 5AVQB 1YMHA 1GTFA 4PRAB 3LN4B 4YL9A 4A39A 1CUOA 3KDPB 1C5DB 4NC1E 2ISDA 2JIXA 4ZFZB 2OSXA 2ZOLB 2FNBA 1N6VA 1F41A 1ZAGA 2GITB 3BWSA 2D31B 2QL1A 4ZSOB 1SHMA 3NRPA 2YUZA 1W72A 2ZG3A 3BUQA 4LOEA 4NQED 4KZCA 4R7NB 4AQ8C 1B2YA 5EOQL 1BQUA 2BNRA 5DJAB 3GSNL 4XO3A 2VAAB 2V5TA 3R0MA 4KITB 4MS8C 3J8F7 4MDJA 2XKNB 5E8PB 4WFFE 5KAQG 2Y72A 4ZFOA 4WKXA 3ARWA 1PQZA 4NQUA 2GCYA 3APCA 5JPNA 2B77A 1TJMA 4UT9A 3D9AH 2W0FA 4K2UL 3BVXA 1RURH 4TNWK 1BF8A 2H8PA 3TF4A 4RDQF 4WEBL 1MOEA 2JKTM 3LAFA 3PAZA 1MWAB 5MERB 1C7SA 4PS3A 3LHPL 1GCFA 4E9TA 4YDLB 1W91A 2EICA 2B1AL 4LHUG 3LNDA 1GZPA 3NA9L 1P4UA 3GC3A 4BZ2A 1A6AA 3QQXA 4PJGB 5DUPH 2WYTA 2YXWA 1S9KC 3D1MC 1MHHA 2GBVA 4MB4A 4KXZH 5DO8A 4G6JL 1QSEE 3BVWA 5C6TH 4WFGE 4CC0A 2GK0B 4P46A 1FFRA 1FHGA 2R2HA 4U1JB 1X5LA 3GNML 3RI5F 5K1VA 3DYOA 5EEXA 4BKLB 1KEGL 5IBLC 3WFDL 1UKTA 3AREB 4WKZB 2ATKB 4JKMA 1IL1B 3MRQA 4TPRL 1MCQA 3ENEA 3BAXA 3RTQA 5C0JB 1OD9A 1PZSA 5C0BD 1K85A 3APNA 5CJBA 4PR5A 2HFEB 1VZHA 1A7RH 2XFXB 5JIQA 3S3SA 1L9SA 1AOZA 3V5KB 3BXNB 4I1NB 4DPAX 1U8PB 4U49A 1KXQE 2XTJB 4L3EB 3NFSH 2XWRA 2BNUB 3CHPA 4P3CH 4P9ML 4KTEH 4FQQA 2FBJH 1R9FA 2BK8A 3HR5A 3K81A 5LLIC 4OQTL 4X5QA 1AXTH 4LMQI 3CE1A 1KIQB 4FQXD 2MPAH 3VQLA 2XZQL 1OB1B 2OX5B 3H3PH 3REWA 4Z3FA 3DI3B 4PJFF 2YPKA 1T4KA 3DMMC 5BMFL 3MRNA 4X9YA 3QH3B 5F3FA 1T6VN 2XQBL 1FIGL 1A9BA 3THMH 1HSBA 1LO3L 1E9OA 3E8UH 1F3DH 2IBGA 4ZDHA 3CU1A 3HLAB 1GAFL 4PJXB 2IMNA 4LCWD 3ZDXB 1R24B 3BUTA 1RSYA 2MQGA 3CVBA 4ZQTA 4Z77A 4FN0A 5E1HB 1H9VA 2OQJB 3D87B 2IAMA 3JQOB 2EDRA 2ICEB 2E76C 3IXAB 4X8XA 4AZ8B 3B9VA 4M1CC 3GMLA 4J1UA 1CTOA 3PP4H 3RNQA 3L7EB 3UG5A 1KPUB 3R19A 5EU5B 4P57B 4Z76B 3QZMA 4IIQB 1HKLL 1INEH 1NCWL 4BH8A 1ZHNB 4AM0Q 2IALA 4WCYL 3TC9A 4H2CA 1MRFL 4FNTA 3RVXC 4Q74A 2IV9A 1ACYH 2Y06H 1NCUA 4YVNA 5HJBA 3VFOB 3W0WB 3MYJA 4JM2B 3NBNA 4EZMA 5ACLA 4XCCH 1J5IA 2IANB 1D9KA 1MHCB 3QEHB 4V1DD 3FCGA 1I1FB 5DI8A 1OAJA 1T3FB 2V2WB 1R19A 2NXZB 2PW1B 4DKFH 3GB7B 5DU7A 4CVZB 2G0LA 4A2MA 3L1EA 3L95B 4HK0A 4HJUA 4C58B 2RIKA 4U1LA 3K80A 1VFMA 1WZ1L 4FG0A 4NM4H 4Y7OC 5KW9H 1SDAB 5B3SB 3BZEA 2WP3T 1MZZA 2R0LH 3AXHA 3P9MA 2ICWA 4M00A 2UYLA 2EE2A 3AG4B 2H1PL 3MVSA 4UOQA 3EUDA 3L3GA 4HJJH 4JZJC 5D7SH 3IDYB 3KYMB 3I75B 2OZ4H 3N41F 2RR3A 1JPEA 1DLHA 1H0DA 1I1RA 1TEGA 4PI0A 3RGBA 3X12B 2EP6A 1IFRA 2RQEA 5GSRA 4X0KB 5KG9A 1MCNA 2QHRH 3BP7A 5DD3H 3UDWA 3R1GL 3T1FB 2Q7AA 1AFVH 1OZTG 2WXPA 3LEYL 3LKNA 4YHKL 4FHJA 2AW2A 1HWGB 1U2YA 1I9RL 4GKNA 4BH7B 5LXGL 4LSSH 1A8JH 1YYLH 5ITBL 1JE6A 4ZNEE 2ZKHL 3C60A 3SDCA 5JO5A 4CILA 1NKRA 4RMQA 3CLEL 1FUNA 4ZSOE 3FBKA 2ZP8A 4L3AA 5JDJA 1THCA 5JNYB 2XYCA 3VFSA 2DEYX 1A6VH 5L6YL 4J8RB 5A2CA 4FQLH 1KG0B 3HUJA 4MS8D 3GMNA 4K23H 4P2AA 4M4RB 4RGOL 1AP2A 3RA7H 1S4IA 2YBRB 1AS6A 1BBJB 3H8NA 3EF7A 2DQEH 4XOAA 4K3DH 4YHOH 4UU9A 5BVJA 3H6AA 4U7SA 4KV5E 2EDKA 2YC1A 3QDHA 1OP3K 1D5RA 3J07A 1DSFH 4Z7QF 3UJTH 3EUUA 2H32B 4Z78B 3DKHA 5C71A 4ODSH 5HHOA 3RWJA 5TDOA 1LDPL 3ESVF 3IJYA 5IMOB 1KLUA 1XWVA 4LAQH 5ALBL 5T5NF 5DJ6A 4OV6F 4XXDA 2OXHB 4K9EC 4N28A 3QO0B 4KHTL 1JYVA 4OJFL 3ASNB 5EU7E 3LY6A 4OZHF 3OG4B 5K39B 4GBXA 5TDPA 3NZUA 1E5BA 3V0HA 4AV0A 4HOMA 4OFIA 5AVWB 3R7QA 2G75A 4C57C 5F1KC 2XWJA 5HJDA 2QPDB 4FYRA 4PJGE 1AZVA 4X42A 4XNDA 5I1HL 2DV6A 4I3GA 5FGCE 1HH6B 2IDCA 1P7KA 5DEGB 1YZZA 4MJID 3CK0L 5B1AB 3PL6A 3CDZB 4R97C 3JT2A 1WAEA 3A67L 4PJ9A 4YAQA 1U3YA 1CICD 4HJGB 3SQOH 5GS2H 2FEEL 1EHNA 3KAAA 2EUZA 3QQDB 2ZWZA 4MA8L 1A6UL 5DJ8A 5SWQA 1H9DA 1IJNA 4Q9BA 4HS8H 1OAKH 4JDVB 1JV5B 1FJ1A 2FNWA 2FSEA 4PJFB 3BWZA 4FFZL 1YSOA 1NGWA 4KK6C 5BO1L 2IPTH 5HHQA 3EO0A 3W81A 5HSFA 1NOLA 3ZYOA 4L5FE 4TNVF 4J3OH 1ZVSB 2JCCA 4CAGA 3DRQA 1RH8A 3O41A 4NCC1 2XTJE 3C12A 4W9EC 4FZ8H 4ECNA 1DTUA 4LP5A 5FYLE 3ROOB 2HRPL 4XCEA 4ZQKB 1WCQA 3W39A 4NQDB 1ACCA 4QRQB 5CZVH 4OLVL 4OZFG 5HD8C 4GW5A 3U0WL 4EZJA 4K5NA 3SGJC 4Z7UA 4YSPA 4LDCA 1GJIA 2FH8A 3GSXA 3DETC 1M7UA 2W9EH 1PKQB 3LJ3A 3UC0L 1G6VK 2AMUA 2EE0A 5KSBA 4AKQA 1ASOA 1IT9H 1ZS2A 1U8OA 4AENA 1PZAA 5D72H 4PWIA 2R69H 4U7KA 1YDPB 4FMKA 5HGDA 1OGSA 4MMXB 5IB1B 2VDRB 3NK4A 2VDNH 1T04A 4R4FL 4UOW0 6PCYA 2R29A 1Y1DA 1EFXD 4PBDA 4PJXE 2H26A 1VADA 3QIBA 4I3SH 3ZDXE 2A2QT 5DJ2B 3S34H 3IFNH 1RHFA 1CJYA 3DURA 3G9AB 3QCTL 2ENJA 2H7WA 3EO9H 4M1CD 1HOCA 1C5CH 1UM5H 1E40A 1BM3L 1WTLA 1TLKA 2K8QA 2AQ3A 1MAJA 5E4EB 1P5UA 4P3DB 3RWIB 3CIAA 5ADPL 2CGZA 1TVDA 4NO5B 3AXLB 3WLWD 5KYUB 1LE9B 2FQDA 5C07B 2EKJA 3RVXD 1OCWL 2ZWYA 2E7MA 5AW4B 3QWRD 5TK4A 2CM6A 4HPOH 1BZ9A 4KRPC 4BQ6A 1DDHA 2Q9OA 4NKIL 3W0WE 1I4FA 4IQHA 1E9QB 3N41B 2ZAIA 3WIHH 4IEFB 1S7WB 2F8VA 5JXEC 1MZYA 4GSUA 2IANE 3OR7B 4U1HB 4M29A 3ZGHA 3Q8BA 2V2TB 3QJHA 3SY0B 1IV8A 1B4JL 1QZNA 4X4YA 1ZTXH 5CKAA 3NYKA 4DEWA 3WNJA 3FRUB 1JRHI 1L9RA 3GZQA 2NTFA 3S5YA 4WUUB 1EAPB 4GP8B 4GQ9H 4UUJB 4JO2L 3UAEA 3WNLA 4XHJC 5C97A 4QHMB 3WAKA 2D2OA 2XKUA 5FYKE 5EIIG 3V6ZA 2NCEA 5B22A 1TFPA 3WNIA 2VRAA 2JXMB 2JJSC 4UCFA 5JLZA 4IU3B 5I1KL 1RJCA 3BUYB 3BDYH 5IY5B 1KGXA 3LXAA 3O2VH 1OK8A 3CFEB 4U6XB 3SBQA 3UAJC 2GIYA 3T2NH 4DGWC 3ALPA 1I7RB 2EVJA 4P5TD 1SJXA 3ZMNA 1UURA 3HG1D 1A14L 4PWGA 4IRSC 4MD4A 3VRLF 1EGJH 1HOEA 3NZHL 4B95C 3MV9A 4QOKD 3EBGA 4LCCA 2JMRA 2UX7A 1EQWA 5F1SA 3X1EA 3SE3C 4Z7QB 1CQYA 1FO0H 5LDUA 2Y5TB 4WNQA 3VI3A 4AM0B 1HZKA 3MRBA 2BCMA 3PDDA 5ID0B 2D0GA 1KMGA 5FYJE 3Q6GL 4XWGL 2YAMA 3OKEB 4MFHA 5C0RL 1G84A 3CQQA 4GXUN 4OZHB 2YD0A 1D7BA 4OQ1A 3CXHK 3MLYL 2VQ1B 4HS3B 4LKCA 4POZC 4K9EL 3LKQA 2WKOF 5F7KC 1RZFH 1RP9A 2WCSA 2VN6A 2AF2A 1SHWA 1E3FA 1OAZL 3I2CL 3P54A 2Y7QB 5E1AA 5FUCE 4J2QA 3TJEH 3UP1A 3SKOA 3BX7C 3RPBA 4DP6X 3QUMA 4E5XB 1IGFH 3VH8A 4ABVA 1RUQL 1I8IA 2OL3L 3NN8A 3AWEA 1T7ZA 3G6JA 2B4CL 4U6YB 1S3KH 5I8KL 4EF3A 2GBAA 3VYPA 4IYKA 2GG1A 2HRLA 3VW3H 1JZ6A 3T8XA 1I3GL 4I89A 4ENEC 2LR4A 3EYFB 5EOTB 4A7UA 2C3GA 1LO0H 4NZUL 1CF8L 3D69A 4POYA 2BH0A 2PCFA 1AJ7H 5HXMA 3Q06A 1WFOA 3B7SA 4N8UA 3QQ4B 3VWKA 2R4RL 2BP5M 4KROC 5LGJA 2ZWSA 4I9WE 4Y9FA 3ESOA 1WZLA 2APVA 3LNGA 4POUB 3DLQR 2FT8A 2VABA 4YGVA 3PUCA 3PQYD 1FCCA 1J0ZA 3OZ9H 1YNTF 1XBRA 4CKQA 5DD5H 4Y4KC 3WGUB 5FOBB 2J25A 4ATWA 3WL9A 4EIBA 1KXHA 1N4XH 5IP4A 3B6SB 3V5DB 4PJFE 4KK6D 5I15H 1KJ2L 4KQ4L 1IAOA 1Z66A 4QUOA 5JORB 3GBMH 3HAEH 4NCC2 1HKFA 2V17L 5GZOA 4HIJB 1XTMA 1ITBB 3GXTA 3KBFA 4HFUH 1EZLA 5HI3C 4QHKJ 1XF3B 2NW3B 2ZUUA 4NNYA 5J56B 4MAZA 1FYTA 4F57H 2PR4H 4QAWA 4B6ZA 5L2KD 2I7SA 1A7OH 1SQ2N 2E0PA 5HD8D 4TNWF 4UV4L 3ZKXB 4FNUA 1FCGA 3DETD 4NOBA 3TASA 1OM3L 3AM8A 1A21A 3L9RB 1PKQE 1QR4A 2ORBL 2PXYB 4GO8A 2I9TA 1EAOA 4YC2C 1PDKB 3D25A 5DEFA 5KVEL 4FERA 4FNRA 4HGWA 3TYFA 5F6HJ 1HJCA 4ZX6A 2MQ3A 3MJ7A 1XL4A 4N26A 3QI9C 1VKXA 4HJIA 4NO0D 3APFA 1IAIL 5GJTL 2BC4A 2YFNA 2W9DH 3JVGA 4NO3A 3GDCA 4Z3EA 3NFNA 1BQHG 2YGQA 3GS7A 4UF7C 2C9AA 4QY8A 4OTXL 1BVKA 1KJ3L 1ML0A 4M6NH 3E8VA 2N1TE 3H3KA 3L4CA 4XN8A 1FVDB 3PWPA 5EO0B 1JYNA 1ET5A 1A6WH 2AXGB 4RGMB 5D4QA 5EU6B 2N1KA 4QMEA 4KRPD 5C07E 1FH5H 2YUXA 1LEIB 1Q8MA 2XXGA 3ZQWA 1KNOA 3PAVA 2YFOA 1MJ8L 3BCFA 3UO1L 2CNYA 1MHEB 2H6PB 3ULUF 4UTAL 4O51A 2X41A 1NL0L 3OR6A 4JRYD 4BUHA 5A2FA 2MHAA 3IDGB 3QNXA 3MGOA 4ZXBD 2FX9H 4OF7A 3CPLA 1MCCA 5EZOH 3HE7A 3UDWC 1S9VA 4OM0L 5LGHL 5CCKL 5EEUA 1H8SA 3VFGL 5CEZL 4WUUE 3SY6A 1JZIA 3O3EA 2P8MB 1QHQA 3BMWA 2G4EA 5C7ZA 2HH0H 1UD5A 2BIQA 1KYUA 2ZP0T 1MEXL 4KVCL 3VD2A 1JF1A 1E27B 2YARA 3VG0H 5IW6B 4FXKB 4S10A 4CMMA 2K78A 3M1OA 1A1MA 4HZLB 2EYSB 1QYGL 3MRGB 3UAJD 5MEND 4PJIF 5HHXH 2J6EL 1NAKH 4LB8A 5CJOL 1MVUA 1XSIA 2WLIA 5CEZD 3L16A 1V3MA 2OMYB 4ZG1A 1FGVH 1A4JA 1QFWH 3TJHC 4GMSH 2V8LA 3LPOA 1IGIH 2OW6A 1DSWA 2VDOH 1W16A 4HOZA 1G1YA 5IJBC 2BERA 1OB0A 2FWSA 5JPMA 3K6OA 4Z7QE 5KVDE 1UD4A 4NHCL 1S9XB 5TE7L 1OPOA 4HUNB 2PYFA 5BRZB 3KPMB 2WKLA 2A4EA 3QDJA 2LTQC 4RWYL 5B38A 4YHPB 5I8CB 5TDNB 1GJWA 1ZGLA 3HNTL 5DMJB 4XNMB 3TIDA 5IHUL 1ZLUH 3FTGB 1KEMH 4LE8A 5DJYB 1IGYB 2CBTA 2D0FA 4OZHE 5A16B 3LX9A 3NIDF 2H2SC 4GBXC 4G8AC 2WN3A 4U7MA 3N5AA 1KLGB 3FU6A 2O61A 2KKQA 2WWOA 2CDGB 3T0EA 2IQAA 3G04A 3O3UN 4OZGA 2X4TA 5EOCH 1NKOA 2YJLA 4A6YB 4KKLD 4MAUH 5AW6B 5DLML 4NFCA 4XNQB 3B2VL 5AKRA 3VNZA 3UTZA 3DUSB 5FWRA 3UABA 1YNTB 2M26A 4X5LA 4LOUC 4DH2A 5KVFL 3B8YA 2H1XA 3KGUA 4W9IC 1IC7L 5AG8A 2X4PA 1XQ4A 3S8GB 3C5ZA 3TT3H 1YPZB 3P77A 5DWPA 1K6QH 5E5MB 4KROD 4G8GA 4GJTB 4AQEB 5KBMA 5EUOA 4K7FA 2ZUXA 4WI2A 4TUKL 4PPTA 1UXSB 3M7OA 2IGFH 3CFJB 4FEIA 5G4OA 1DQIA 1F90L 1GGCH 3C6SB 1FZMB 5EZJB 3RURA 2UXTA 3T65B 3ARGB 2CK0H 1O6SB 4WI5A 4HDIB 2ITCB 1JHKL 4U3XA 3FH8A 5F3HA 5AVRB 3KJ4C 4KKCC 2EH7H 4IU2A 3WMSA 2W95A 2UX6A 5CIPB 3TO2A 1MXDA 1ZHBB 3KPRD 4K3EH 3BDBA 3NCMA 2AJSH 4PVBA 3BVDB 2P8PA 3BSZH 4LQ1A 3OKMB 1RK0A 4I77H 4MCYA 5HI3D 1AYRA 3COOA 3HRZA 3VXUD 4DP7X 5BQ7B 3BAEL 2Y69B 4D2NA 1CXFA 3ARBB 1WV7T 5IFAL 5IOPA 3RZCC 1AS8A 3EYQC 4RISH 1O7DE 2FLMA 3W2DH 1A1OB 3QXUA 4Q2ZA 3V52H 3MJ9L 3QIBC 3S3PA 3LDBC 4EIZC 3W37A 4TTGA 1IBZA 4TNEA 2AS5M 2X6UA 3BH8B 4JL1A 2J55A 3UYRH 2J8OA 3BJ91 3PAUA 3SD5A 2B5IC 3NCJL 3PP3K 4PJ8A 1HXMB 3BT0A 4UIMB 1YMMD 4X8CA 4ZOAA 3D39B 4AZUA 3T2LA 4LP8A 4RDQG 2DQDH 5FYKU 2NYYC 4XNAA 4KUZL 5DK0A 3QI9D 3HAEA 3SB3A 3V6FA 5JW4N 3VFMA 1WFMA 4C56B 5D7JB 1DUZA 3GKZA 4QRSB 2Z4QA 4N86A 3KLDA 3G5YB 4WWKA 3I3EA 1L9MA 2Z4TA 4JY4B 3GSVA 3BVUA 1KBKA 3OJDB 4JE0A 4QO1A 3TPUA 4QCIB 3WSQL 3EOAA 4X80H 4LARH 5DD6A 1JUFB 1DBBL 2ZSWA 4AL8H 4HCIA 2W07B 2ZCHL 1X5IA 2PLTA 5BS0A 5E8DL 1QHOA 5EU6E 3FTSA 3U7YH 3RNKB 3QZPA 3ZIYA 4G5ZH 3TN0A 3H0TA 1Y6NR 1U4EA 3K3QA 5FYJU 1UB5B 4JCLA 2HKHL 1T1YA 1X6NA 4MSWB 2DLGA 5F6IC 3WFEH 4WQOA 4AYEC 4LCYA 4PJIB 1T6WA 1ZWIA 1JZ3A 3KBPA 4L37B 2WKGA 4ISVA 4G7QB 2MFNA 2F74A 4TLSA 2WNGA 2B1HL 1F02I 2IWKA 3VXQB 4HIIA 1DP0A 3SD2A 2Z31B 1J05B 5C0CA 5E6YA 2OCCB 1CG9B 3VRLE 4ODUB 1IC1A 4TV3A 4DFHA 3O0LA 1RJZA 3L3KA 3EO1A 4FTVA 3FCSB 3GJEB 2OMZA 1TYEB 4Q56A 1AQHA 2C7UB 2VDLL 3D50A 4M5TA 5FLUA 1TVBA 4EZLA 4ZMPA 1RUAL 2JJVA 5F9OH 4HXBH 4HJ0C 5CZRA 5CBEA 4F20A 4NRYA 4GIOA 2VQUA 2WLMA 3U0TB 4FXGA 4OGAC 1BDYA 3V10A 4GAYA 1AR1C 1W8EA 4LNVA 3VFUA 3TJHD 2GTQA 2DQHH 4AEIH 1FYHB 1I1YB 1KC5H 1E6OH 1OV8A 1YNLH 4X6BB 3RYMA 4CMHB 3NIDB 4IJTA 2R4SH 1SN5A 3BAWA 4FJ6A 4I0PB 1YMHB 4RFEA 3VXTA 5CJQH 5TE6L 4NUMA 3VSQA 5K9KA 1AQMA 3HI5H 5DLLA 1J1PH 1BECA 3RFZC 3FSOA 1J1OH 4A7SA 4KKNA 5BRZE 4ABUA 4DEUA 4KPHL 3E80A 4G70B 1W72B 2WSDA 2ZAGA 5KUKA 4KK8C 4ODTH 4NBYB 3BP6A 5FM5O 4P2OA 4U4IA 3SYQA 1J0JA 2H2SD 1W9XA 4HS6B 4L1HA 2OSWA 3S98A 1KGCE 3QIWA 3F7LA 3UCQA 2PYEA 2CR3A 1A1NB 5HYEA 4ZFOB 2YKLL 3M7FB 2F7PA 2K9UA 4YBLC 2GCYB 4EUPH 5T1LA 3AG2B 1MCDA 5JPNB 1QSED 4M5YH 5HYQB 4WFGD 4DKEL 2R0KH 1N5YH 2W0FB 1B4RA 3RL2A 1UM4H 3PGCA 1FFPA 1MFCH 3BAYA 5GS1B 4LOUD 2H8PB 1DEDA 3QHFL 4UZGA 1BOYA 3QQ3B 4K3GA 4NZDA 1EUUA 4BUGA 5I1GL 1Z0MA 3FSAA 4ZMWA 1JZJA 3EZ8A 1GZPB 2ITDA 1A6AB 2R1XA 1C8PA 3QUZB 2MPVA 5LDSA 2KPNA 4NN6B 1UVQA 1WQVT 2QPUA 3V0IA 4ZS7L 5GS0H 1JV2A 4YZFF 1G6RL 1BQLL 5BW7A 1L0XA 2CO4A 4P46B 5HY9A 5DZAA 1BX2A 3O3BB 2R2HB 3BW9A 4FQ1L 1AE6H 4PRDA 4X6EB 1A7RL 2F53D 1A5FH 5T3ZH 5DMIH 5DRWB 2K0RA 3T1WA 2HLAA 3GUFA 1WPCA 4I85A 1T03L 3DX8A 3FJTA 4IK6A 4ADJA 3RTQB 3NFSL 1CK0H 3QFJA 3EFDH 4YDVA 4PR5B 3EXJA 3MV8D 4X7SL 1AXTL 2X89D 5AOMA 3TONA 3ZTJG 3A4AA 3O9WA 3EYQD 2BSTA 2YN5A 3RZCD 1N2RA 3ETBJ 1NIDA 2TRHA 2CK2A 3BSHA 4M61A 2IOOA 4MTMA 5FO2A 4CA4A 5ESQA 4JRWA 4J3OC 4P23D 2W88A 4FQQB 3JVGC 5CP7A 5I66A 5I6XB 3HS0A 3HR5B 4A38A 4M8UA 4YEEA 1IB5A 3QFGA 2ED8A 3E8UL 4XP5H 1J8HE 1T4KB 1ZVYA 3MRNB 5JHBA 4JNXA 2MOQA 2VR9A 2HVKA 3VWJA 1T0MA 2JTDA 4IIQC 1OO2A 5T5NG 4EVNA 1KPRA 3HTLX 2ILLA 4ZPVA 3K6SA 1A9BB 2JCWA 1AGDA 1HSBB 2ICCA 2JCCF 5I5RA 3BSZA 2YD7A 4Y2NA 2SODB 4C56E 4E42A 2DYRB 3ULUE 3LRGA 1AS7A 4AQOA 2MWCA 1J9CT 5DVMA 2AQQA 1RIHH 2PO6D 4Z77B 3PWLA 4G6FB 3RIFF 5E2JA 3FDWA 4GW1A 4JUTA 3KHQA 4TULH 2IAMB 4AY0A 2K6ZA 2VLLA 4IBYA 3RNQB 2WQVA 4GUPA 2B08A 2Y06L 4FG4A 1GYCA 4XHQA 5D70H 5KSBF 1NGPH 3UZQA 3GSQA 4LLWA 4MMYA 1QFOA 1BVZA 1RZ7L 4JVUA 4BFEA 1RD6A 5E51A 1QKZH 5DO2D 1OM9A 1P4LA 3PPEA 1TJXA 2ED6A 1E43A 4DGIL 5L0QC 3FO1A 1DJWA 1W80A 3KWWB 4Y9BA 5HHNA 1MUJA 5CD3B 3CPUA 4KKAD 4P4KA 2PTTB 3D18A 1GA2A 4PJIE 5B3JF 4EBQH 3AWGA 4ZUSA 1JZEA 1D9KB 1T2QL 4NERA 4NM4L 2LABA 2QGDA 1YEIH 2CHXA 2BP8B 5I1IH 1CLZL 3NJJA 5DI8B 3ETSA 3F12A 1K8DB 1KB5A 2K9FB 2OZ4L 4YO0A 4HK0B 1UEYA 3P2DA 4N0RA 4U1LB 4N0FA 5JPMC 2F19L 3UEQA 3LEXA 1DBAL 3OQRA 4NJ9L 4OAWA 3V4LA 4YSUA 2G2RB 4N87A 5KTEL 3P9MB 2ICWB 3QBTB 3ZL4L 3WS3A 2UYLB 4UAHA 4B53A 4TUJA 3L3GB 3EJZD 3MN8A 3JYCA 4K07A 5D96C 1FFQA 4LSSL 1DZ0A 2WXFA 2YMXH 1YYLL 1BQSA 1HDMA 1N10A 1GZQB 3OF6A 2CMRH 3PGFH 3CCHB 4IMLB 5JR1H 5GSRB 3UGXA 5INCB 3NIDE 5KG9B 3BP7B 4PRHB 5ABDE 1SUHA 3CH8A 3CMOL 2A4CA 3T4YB 1Y1UA 3D6GA 4H88H 2ZUWA 4NPJA 5E70A 3VTAA 1TXKA 4J3UA 2CA4A 5IROD 2B20A 3C60B 5JO5B 3SDCB 5EUKA 3EYVA 1BXAA 4I1RA 5JHDB 1UWYA 5HI5C 3A6CL 4AYMC 2X2JA 3QAZB 4JKNA 4D9LL 3WTVA 1XFPA 4Y5YA 2EADA 2J88L 2CLVB 2DQEL 4GP4B 5EF1A 3FU7A 5D7EA 1Z9PA 3I9PA 3IBEA 4EN3A 3GMNB 2J5LC 3C87A 1NFDA 2EH8L 2P44B 5AAMA 5TF1H 1AIZA 1DQDH 1FN4A 3N1GC 2V4LA 3UJTL 4OFKA 4WTQA 3C5ZC 2YGOA 3DVNB 3REVA 4NRZA 3LNEA 1B0RA 4UU9B 1SLVA 4S1QL 3NJLA 3BN9C 2A6KA 4NBXB 2YC1B 4U31A 1AD0A 4Z0XB 3RY6A 3ZTCC 3SKMB 2EDTA 4HMCA 5KYYA 3QJTB 3ZRFC 3K71B 3VI3F 1T1ZB 4O2FB 3RWJB 5D2NA 1A2YA 4HHGA 3F7KA 1KLUB 3ARED 2ODIA 4WVRA 1QR1A 3DBSA 4PRPB 4XXDB 1FAIH 3CFBA 2VN7A 1DQLL 3KLHC 1ZVNA 2WXIA 3V0DA 3T04D 1MWOA 5BNXD 1A22B 2G75B 2QBWA 2XLLA 4KJQD 5EBMA 3BLPX 4PBVC 1CXKA 4GRLA 4JFDA 4L3ED 2XTJD 3P9LA 1X5YA 5E7FA 5B8CA 2IBZX 1HYRC 3Q5TA 4BXVA 1P7KB 4HS8L 4EUPA 3JTBA 2A74B 2X0WA 2NUTA 3PL6B 1E5UI 3X11B 4B41A 5BVPH 1ZLWH 4PJ9B 4Y1TA 4YAQB 3G6JF 5JW4R 2FL5A 4U33A 4I87A 4JHAL 1XEUA 2DWYA 5GS2D 3HJ0A 4D0CA 2HTKC 5SWQB 1G0YR 3ATBA 1U92A 1QWNA 4JFFB 4WFED 2FSEB 4XNXH 3OD3A 1E65A 1AGFB 1NGWB 5C0FA 3S8WA 1OSZA 2OXGA 4KNUA 4MMXC 4N2LA 2BW5A 2JCCB 2OTUA 1CF1A 3B3IA 4NQVA 5EA0H 1DCLA 1JZGA 4J3OD 2COVD 4X9FA 5T1DH 1PEZA 4APQA 4MXQC 4OFQA 1L9OA 3P11L 3LXCA 4OFYA 4XCEB 5TTRA 1PMYA 3W39B 2AJXL 2X0UA 2VITA 3IFPA 2R69L 4GW5B 3G9VA 3LS5L 2VDNL 2YD2A 3GSXB 4X6FB 2D8KA 3CZJA 2M2DA 3D09A 3D0LB 4I3SL 5L4JA 5KSBB 1GY2A 2C3HA 1R3JA 3G3LA 5CGTA 1A3RL 1U8OB 3N42F 3S34L 4DVRL 5BJTA 4AENB 2Z8SA 2XWTA 5HGDB 3KXFA 3W0WD 1G43A 4JM2D 3VFTA 3D4ZA 3GXNA 2IAND 1GKOA 2PN5A 5FYKL 5FGSA 3ZQXA 3DURB 1T6BX 2BO0A 4WZ9A 2AVGA 2VN4A 3ZL2A 3EGDA 1BGXH 2NXZD 2A3TA 3D85A 1GIGL 2IJ0C 3E9UA 1LLAA 2ZWNA 4HPOL 5CP3H 1PFOA 2V6HA 2ZD0A 5HVHC 4GUOA 4BA8A 1P5UB 1MIEH 3VXMA 4PLJC 4DETA 2BSSA 3WIHL 2VZUA 4X6CA 5FYKD 4LSQL 3P3TA 1PCXA 4PQXA 1BZ9B 1C16A 4Y5VC 1DDHB 1KB3A 3LQMA 3PJNA 4KAQL 5H35B 3KCWA 1I4FB 2Z7WA 3O81A 5F7DB 4FXGC 2UWEF 4GQ9L 3T77A 3SGKC 4MAYA 4X4YB 1IBDA 1QLEH 5A2JH 3D0AA 4PJEA 3KPSA 4HD9A 5HGGS 3IN2A 4XO5A 4H1LH 2NTFB 4JMXA 4NUGH 4X4MA 2D03L 4OCYH 3BDYL 3HN8A 4HV8A 5KVGE 3O2VL 3GIZH 3V6ZB 1SGKA 2AITA 3RLSA 3VU1A 2YEVB 1BFSA 2FZ3B 4UWQB 4WFHE 5JLZB 3QWNA 4FL4C 3VSTA 4LAJH 1W2KT 4C59B 1ROWA 2E9GA 4P2OC 4X9GA 2YWZA 1UACH 1JNLH 2AAAA 4GAAA 2GFBA 3UCRA 1BAFH 3VGAB 1OGPA 4B9IA 1XX9C 4PRHE 3QIWC 1FO0L 1WWWX 4HSAC 4MD4B 4AXWA 1E4XI 4QXUL 1A47A 5AKTA 3MJ8A 3HCVB 3DWTA 4M62H 5HI5D 2HRGA 3LIZH 4LCCB 5C0GA 3CFMA 3TZVC 3WKNA 5HVFB 4OD3H 3MODH 1F58L 1OP4A 4H44C 2VZ3A 4M02A 4WNQB 3T3PF 3VI3B 4XP4L 2QTEA 1G9MH 3HHRB 5JIHA 5BUPA 1HHGA 4TUOA 1ZSDA 1RZFL 5I1EL 3HUJE 1ZRUA 1M1XA 2QT6A 3TBSA 1YG9A 3V6OC 4Z7OF 4LHQB 1Q90A 4N4YB 5D7KD 2XWXA 2F54A 2VWEC 4KTDL 4YL4A 3BN9D 1E50A 1QWUA 3P3YA 2LLNA 5E1AB 3G6AA 4I9WD 3GSWA 2AHIA 3AGVA 2DBJA 3RJQB 4UTBA 4AUUA 1S3KL 2A9AA 1GGIH 3QDMA 1R75A 3SKOB 1AO7A 3QUMB 3V0WL 2VMDA 3WEAA 3VH8B 3MUGA 2N01B 1LP9A 1I8IB 1JZDC 1THAA 1SVBA 3NN8B 3DV6A 3NCYS 4YZFE 1OHZA 1LO0L 1T22A 3G6JB 3O6KH 2FAUA 4PRPE 3KLHD 1CIUA 1G94A 2VDPH 2VR7A 1E42A 5CU5A 2L04A 3PJLA 3T8XB 5EOCJ 4LP4A 5H4ZA 3D30A 5E2UH 1ROCA 2OMTB 4DO5A 3A23A 3D69B 4OBRA 3VWKB 1KCBA 1F97A 1NBQA 2EIDA 5B3NA 4PJCA 1S5IL 4LSUH 5LGJB 4OZGF 1OLZA 3IMWA 3MXWL 1N3NB 4Q6YA 3T8VA 2XZAL 4NQDD 2VABB 2E4FA 4YGVB 3NH7H 4QHUA 1SJVA 2Z7UA 2VDRL 5E6IA 1A7QL 3HS0C 2VT0A 5E8OB 4U1KA 2R59A 1SEQL 5D93B 4JFFE 1TR7A 1MJUL 2Q3XA 1SN2A 3CHXA 4J6RL 1EHXA 4HETA 1ETB1 4OKDA 2CGYA 2O5XH 1IAOB 1NCOA 2F5BL 2I07A 4JVWA 1QD0A 2HB0A 2VDKH 1A7OL 3NFPA 1SQMA 5AW1B 5EUOF 3N42B 3VWJC 2NY6B 3HPLA 1WG3A 4WDIA 4KJYA 4XMLH 1JPST 1FL6A 1U3JA 2BRQA 2JCCE 3HZVA 5CM1A 4FA6A 4NNYB 2B3IA 4MXQD 2HT4C 5EEWA 1MCFA 1BWWA 3QNZA 4HIXH 2OP4H 3TBWA 1AANA 5CU9A 4JFYA 1KN2H 2EDEA 3RJOA 3OG6B 3QUYA 2WTRA 4ZFFB 1TG8A 3KH3A 4KMTH 5I1LA 4QWWC 3I6GB 1ZPLA 1OE2A 2NXYC 4LEOA 5C07D 5KSBE 3V5HA 1DL7H 3IETA 3D25B 4OIBA 5DEFB 5B1BB 3RPKA 1IBHA 5IJCC 1WAAF 1OCRB 1OT2A 2QVKA 3SO3C 3V4PA 3KJ6H 2DW5A 4HGWB 3B7UX 3TYFB 2O5YH 3EDJA 4F7TA 4BCYA 2AI0L 2Q8BH 1IO4C 5SWZA 2ZUYA 3MJ7B 1VKXB 3WN5C 2AJUH 5EEYA 2BC4B 2ZE0A 4NO3B 5I0WA 1YYMH 1BVLA 2XY2A 4YDJA 2VXQH 5E95B 3NFNB 1FZJA 4R3SA 3C08L 2UWEB 1A6WL 1KIRA 3ZPDA 5B3JE 2XNAA 2NPLX 2BIIA 3B7RL 1FH5L 3LEVL 1J0HA 4ZZKA 4WUUD 1BVKB 2F0CA 3V0GA 4PG2C 4LCIL 3PWPB 2RTTA 1ZXQA 3QG6A 5JQ6H 2TRYA 4X98A 4AL8C 5J13C 1IM9A 4PGEA 2H5UA 2E59A 4XBEL 3F3HA 4FXKC 1L4IA 1KNOB 3L3DB 2F6AA 3UPCA 4P9HL 4YFLF 5AOZA 1ZKAA 2BSRA 2ZNXA 2GBUA 4OZIF 4IBWA 2MHAB 2FEDC 4NQQA 1T4WA 3OZKA 2HH0L 2OMUB 3IE4A 4KDTC 4QLRA 5IBUB 5D1ZI 3CPLB 4W9FC 3HE7B 1S9VB 4JM0A 4WU5A 1DJZA 3GM8A 1T1WA 3WEOA 5F3BA 3AQDA 4HWZA 3O3EB 5DHVH 1NAKL 2V9RA 3SBWC 4U0RB 5KYXA 1E2WA 1T89C 4RGNB 2XN2A 5E6UB 1JBJA 5ISZA 3T3PB 1IGIL 2VDOL 2Z8RA 4GO6B 4Q4EA 2EEAA 2DYPA 3P3RA 4DJMA 1EEYA 3SDAC 3IRPX 1UCTA 1BREA 2WLIB 4QF1A 3KLQA 5ANHA 3WTXA 4Z7OB 2LV4A 5AAMC 2KMWA 3LB6C 2ZUTA 1A4JB 2GYSA 1GKEA 2ZUQC 2B0SL 4UQ2A 3CFTA 1KB9K 5AZEH 3HZYA 4FLOA 3CSPA 3AQZA 4H7VA 1J9TA 4Y16A 1TZOA 1X5ZA 1RUMH 3BD4A 2BWDA 4H1LA 2RD0A 3JTSA 4UDUA 1XAKA 2PYFB 4QXWA 3SDDA 3VI3E 2QMKA 3O2DH 3QDJB 5B38B 5I1DA 5D2NC 5DD0H 2YMTA 4MWFA 1JPFB 4BK4A 1BG9A 1JK9A 2CQVA 2JJTC 3HC4L 35C8L 1UA3A 5EOCL 2HT3D 1MFUA 3ECUA 3WMPA 3K4ZA 4JCMA 4AYID 2O61B 1IQWH 2JF1A 2XCMC 3T0EB 3TLRA 2IQAB 3G04B 1WFIA 4OZGB 2X4TB 1PLCA 3NJVA 1U93B 3LIZA 3VA6A 3C2AH 3TT3L 1RLBA 3SN6N 3G6JE 3O4LA 1IUZA 2Y5EA 2F2HA 2I85A 2K4AA 3V0JA 2X4PB 1GGCL 2KZKA 1X3DA 4MVBD 5FHAL 4AGOA 1YVLA 4F33B 3P77B 2H3NA 4NOFA 4JDZB 3MBEB 5EUOB 1DEEB 4K7FB 1Z1WA 4HU8A 5K59F 3P2BA 1S7SA 3HC2A 1XB8A 4IJ3B 1CWVA 2R9HC 5EORL 5GGVY 3ZZSA 4MZRA 5LCVL 4UQ3A 4HQQH 4K3EL 1ZV2A 2AJVH 2ADIA 2FECI 3MNDA 4QNPF 2UY6A 3C75A 1QNZH 1ES0A 1DDTA 1A4AA 5GS0C 4I77L 5HGBB 2VIRA 3JTTB 5F3HB 5FA3A 5CZKA 2Z6FA 3ILEA 4LL1A 4LSPL 5K9JL 1ODAA 1IIKA 4IU2B 3O45A 5K9OA 2BX5A 3FO0H 5D1XA 1XGRA 5JDSB 1UA6L 2CIKA 2P8PB 5TFSL 1CDJA 1RK0B 4MCYB 1AQ8A 5AOKA 1R3HA 2J44A 3HRZB 1QSFD 2HT4D 3QR0A 7PCYA 4B9YA 3VFNA 3J27A 3MGTA 4HU2A 3UYRL 5MEOA 1U9KA 2JQAA 2VW7A 4NM8L 3RDTA 5IOPB 4J8QA 1WYJA 4Q2ZB 2YA2A 1J18A 2CKBH 2P80D 3OJVC 4NIYE 4RQQA 4QWWD 3VRIA 2JVUA 3PP3H 5F7AA 3MA7A 1BFTA 5C0IA 2A6IA 4W4NA 4ZAKB 1AGBA 4OLWH 4JDTH 2NXYD 4PEEA 1UH2A 4BQ9A 3OWEA 4PJ8B 4YE0A 4ZTOH 3BIBX 4OV5A 4IBLT 5FV1L 3NJNA 4Y9GA 2J43A 4PGCB 5DK0B 2WQWA 4X80L 3UYOD 4XMTA 3J2PA 4F15B 3V6FB 1N26A 5JW4Q 1CGYA 3MX0B 1HC1A 4AL8L 2Z4QB 2VMJA 1ZGLP 3FQNA 3SPHA 1EMTH 5FHBH 5JHLH 1E2ZA 4MJ4A 3GSVB 4OZIB 4QO1B 5D4HA 4LLVA 4J3SA 2UVEA 3ZR5A 1QBLH 1PX8A 4WNJA 4J3VA 3WOVA 1CGUA 2DH2A 1AXSB 4YSDA 2ERJB 2YAQA 1OQOA 3EG9A 3ULVH 3PWPE 4M7KH 4AH2A 5DMKA 5BS0B 3RGHA 3UZVA 3WFEL 2OM5A 1TKWA 1VFAA 5E5UB 3UOAB 2OK0H 2C9PA 4G3YL 4WHDA 3HVDA 1PCSA 3AABA 3D0VB 3TN0B 3DYMA 3H0TB 3VO0A 2BHZA 4JG0L 2VR3A 4JPVH 4AUJA 4P0DA 5DF0A 5B1CA 2WLYA 1FFOA 4LCYB 2ZXCA 4Y2DA 1T7XA 4R7XA 1OCZB 3H9ZA 4ISVB 4RIRA 2F74B 2VXQA 5IG7A 4E0RA 1PAZA 4HIIB 1JYXA 2V9UA 3I9GH 2VC2H 1JIBA 2WXHA 4BDVB 3GDBA 5FFGA 1B6DA 2WQRA 3QUXB 2G2PA 3EDEA 1RJZB 2XZCL 1PX3A 2QELA 3EO1B 3L3KB 5F9DC 5BRZD 5T8IA 2VE6A 2OMZB 4RGNE 3L4UA 1GVIA 4LEXH 4XP9H 2Y1YA 5MEQA 3LNHA 1KC5L 1E6OL 1KBBA 3UGEA 1TVBB 2A77L 5GRJL 3T3PE 4RX4A 4DAGL 2R4SL 4NKDA 3QIUA 3SDAD 3TH3T 5J57B 1L9PA 5IJKA 2XFGB 5CUSH 4BHUA 5CBEB 4YHIA 4A6YL 1KGCD 5JOPD 5BRQA 3HG4A 3LB6D 3N44F 2ZP9A 4Z7OE 1J1PL 4Q9RH 3QJFA 4F9LA 1A4CA 1JGLH 4K9JA 5H2BA 2J56A 3S3CB 5FDYA 1NGYB 3VXTB 3L8QA 4ETQA 1ZTXE 2DQTH 2GIXA 3IDIB 2MNJB 3DX4A 4BRVA 1ONQA 5K9KB 1ASPA 4XZUB 4IHOA 4XP1L 1GGTA 4JFZH 4IRZL 5DHVA 3UROR 1RLWA 4FFVC 3QDJE 3KE0A 3QXTA 1KTJA 3QPQC 3BP6B 3OAUL 1NPJA 2QVTA 2UV3A 3ZX1A 2Y7SA 4N6QA 2ZX6A 2BVEA 1U8JA 1BFVL 2CBPA 2EUWA 1ZMYA 5F70A 1O6TA 1QA9A 1CGVA 4M5YL 1DQJA 1N5YL 3B2UC 2PYEB 3P0VL 1MFCL 3QUZC 1GGUA 1OOWA 2Q2EB 4NZTH 4X5WA 5K5YA 3T0EE 1AOHA 2G5RA 3L2NA 2FR4A 3P4OA 4OZGE 1N68A 3M07A 1PLAA 3NP4A 4UZUA 1SDDA 3PGCB 1FFPB 2WW8A 2QR0A 3F7YA 1R6VA 4XXWA 1ETA1 4WW1A 4M6ML 4GUCA 1NFDF 4M5ZH 5J6HB 3N1MC 4NC2B 1RJLB 2NY1B 3DDGA 1W8NA 1PG7L 2YKKA 4XR8C 1UD8A 1VPOL 3E6FA 4U0QB 1AZNA 1VIWA 2ITDB 2R1XB 4G8GE 4OH2A 3FH5A 2VDMH 5GGQH 1O9VA 3HC0A 3ARBD 5EUOE 1PIGA 2V7NB 4JB9L 3A0OA 4LLYA 1A5FL 5T3ZL 2A6JB 4B3EA 4OCRL 1RJYA 1YAIA 4CL7A 3H7LA 4TSAH 1UVQB 4HAKA 2Y2YA 1GOGA 1AHKA 2WGXA 2IADA 4CJ1A 4LIQH 3WO3B 5ABZA 4NHUB 5I6XC 1CGWA 4R96B 2N59A 4IK7A 3MCKA 2NDGA 3EFDL 3MO1A 4YN3A 2WM0A 5C08A 3SODB 3BW9B 4AMWA 5KS9A 1OPGH 2PTUA 4PRDB 4YHZL 4LLUA 4N20A 5BZXA 1PW3A 2YJQA 3QUYC 5T3ZD 3P3UA 3QRGL 3D39D 3L2MA 5E1QA 1N6QL 4HSCX 2J57A 5FA4A 1WHOA 3QFJB 2R7EA 4HWUA 2AJZA 3FF8A 1V3KA 2VLRD 2VXUH 4YDVB 3HHSB 3CVIH 4X4XA 1WAAE 1OGAD 3TO4C 2WNXA 5D7JD 2BCKB 3MUHL 3O9WB 1HHJA 4LRIC 1N2RB 4ZZFA 5KN5B 4M61B 4QRAA 1AXIB 1ZIBA 2CRZA 4UT7H 8PAZA 2X9WA 5I66B 4D8PA 1JYWA 5IEHB 5IBTH 5E99L 1MELA 5HHMD 3QA3B 1S9YA 3IJEB 1L9QA 3ZO9A 4J12A 43CAB 3AY2A 5IQNA 4H0GA 3F05A 4ODHH 1S7RA 3IJHA 2HVKB 2AABL 3CZEA 1FVCA 1MRDH 1T0MB 4FLSA 5C0DA 4TOYL 4EVNB 4ZPVB 4LVEA 1AGDB 1XXDC 3GT6A 4R4BA 4AGNA 2QPSA 3M8OH 3P4NA 3EHBB 4B9JA 1HI6B 3UTSA 3WLBA 2J12B 2BRRH 1D5XA 4WJG3 4OZIE 1NGPL 5C9JA 6FABL 4FLQA 1NLBH 3PWLB 2Z31D 4GW1B 1OTTD 3NCBB 5F7HA 1D6VL 5LAPA 1SM3H 4B9CA 3FUJA 2EO7A 2E7BA 5BS0E 1SXCA 2NZIA 3UZQB 3GSQB 4X8GA 5I16A 1QW8A 2WWMC 3WXWH 3WFHA 1P4LB 3HJEA 1QUPA 2GSGB 4YLQT 2ZIDA 4ORGA 5AOIA 5LNGA 3RVTC 1R0AH 3MLXL 4TVPH 1K4DA 4P4KB 1A7NL 1M1SA 3D18B 3D2UA 3PF2A 3BZFA 3A47A 3ZMRA 5I6MA 4MNQA 1YECL 1W72L 5T1KD 4ZUSB 5ERWA 2YD6A 3N44B 3SE9H 1TF4A 4PREA 2X42A 4YDZA 5EWIL 5JOFA 4BBWA 4KH2A 1EBPA 2GTZB 4DUWA 3GJFA 3JXAA 3AY4A 3OBAA 1V7NL 2CLRB 3F12B 3HI6L 3QUKA 3QDGA 4UZSA 1KB5B 2LAAA 4AYSA 2YMXL 2NOYA 3KHOA 4N0FB 2LFEA 5JR1L 3IPEA 3LEXB 3LRLA 4GKOA 1FNAA 2HTLC 3WS3B 3ABMB 5E2VL 5HDOA 4IBZA 2XICA 4NJAH 4TL4A