1W6WA

3d structure of cota incubated with sodium azide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
total genus 143
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA02
2PP9A 2I7OA 5TK4A 1PZCA 2DWTA 4E9TA 2DY2A 4G7RB 2XVBA 8PAZA 1GR7A 2OJ1A 3QJTB 3S3CB 4AX3A 1GSKA 3ABGA 3FU7A 2YAPA 2XWZA 1E30A 5I6PA 1L9SA 1OE3A 1WAEA 3PXLA 1PCSA 1ASQA 1QHQA 3FSWA 3T6WA 4CSPA 2UXVA 4E9WA 1WA2X 1CYXA 3TA4D 4HHGA 1NWPA 4YSSA 2FT6A 1NIEA 3HEIB 4BDVB 2PPFA 2J57A 3CDZA 3TBCA 3ZBMA 3GXUB 2BP8B 4HCIA 1JVOA 4F7KA 1CYWA 2E86A 4JKNA 1V10A 3UAAA 3T6ZA 4GYBA 4YVNA 1GW0A 3NJGA 2P80A 3FSAA 1E5ZA 1PNCA 4FAAB 1A4AA 1KDJA 4WTQA 9PCYA 4A2HA 2OCCB 1ZDSA 2H3XC 3FQ2A 3AY2A 2QPEB 3NYKA 3PAUA 4ZK8A 3QJSB 1IBZA 1W6WA 1KCBA 1PMYA 2GC4C 1OOWA 1AR1B 3PAVA 1GS8A 4PCYA 3BVDB 2YAFA 1RCYA 2YXVA 2LLNA 3AG4B 1NIBA 3NP4A 4W1TA 2YAOA 3IEAA 1AAJA 1XMEB 2R7EB 5A7EA 3NJMA 2MRYA 2VW6A 1L9OA 3NJIA 1OF0A 2IDTA 4P5SA 4GP5B 1JZEA 2CCWA 3T71A 1PZBA 3CZUB 3KW8A 1PNDA 5ANHA 4KO6A 2PCFA 3SBRA 1HAUA 4FA7B 1A4CA 1AZBA 1BXAA 1TU2A 1WS7A 5LDUA 4AKOA 1OE1A 1KBVA 1ZV2A 5B1KA 3WG7B 4UF7C 3JTBA 2FQFA 1JERA 1ZPUA 4E9VA 5B3SB 3NT0A 2WO2B 2CAKA 5EHFA 2XLLA 1NPNA 2QPDB 1IBYA 1AS6A 1OCOB 2GB2A 1JVLA 2PLTA 1RKRA 3NJLA 1JXDA 2ZWNA 1CUOA 3N55A 4G7SB 4BXSV 3NJNA 5I26A 1KBWA 1NWOA 4A2GA 3WIAA 1UATA 2XX1A 3OQRA 2BZ7A 4GY4A 3V9CA 1JZHA 1AANA 4HZ1A 4JHUA 2I7SA 2AFNA 3FU8A 2W8CA 2XUWA 2XV3A 3QJVB 4BDVA 3HB3B 4HHWA 4BWTA 3NJFA 3WNJA 2CUAA 4YSOA 4AI7A 2PPCA 1PY0A 2B3IA 1BXUA 1DZ0A 5PCYA 4HCFA 1NIAA 1JZFA 2GIMA 2H47C 1CC3A 2DV6A 4HAKA 1JOIA 6PCYA 3FQ1A 1BQKA 1W8EA 5I5JA 1FWXA 3BQVA 3UADA 1NDTA 3GYRA 3ABLB 4A67A 1ET7A 1SHWA 1SFHA 4KO9A 5F7AA 3FS9A 3ZIYA 1L9PA 2B08A 2J55A 2HRHA 2PP7A 1HFUA 1QNIA 3TASA 1SJMA 4A2EA 4DPAX 5I6LA 1V55B 3NJJA 4RH4A 2PPEA 5D4HA 1ASOA 2TSBA 1PF3A 4KNSA 4DP5X 2BHFA 4BK5C 1FA4A 3T6XA 1J9QA 3PPSA 3MBWB 5I5IA 5IY5B 3UACA 4DP6X 3WKPA 4N8UA 1V54B 4TXVB 1AIZA 2PPAA 3NSDA 3X1EA 3PLYA 5D4JA 4DP4X 5I6OA 4HCGA 4YSDA 2IWEA 3UGEA 1OCCB 1SDDA 1W6LA 4NB7A 4YSUA 3CDZB 2NRDA 3OM3B 5PAZA 4KO5A 4DP9X 2DYSB 1JXFA 1BEXA 2FNWA 1BQRA 2GHZA 4E9SA 2BW5A 5B1JC 3ZX1A 2VSMB 3UAEA 3FSVA 3AZUA 3OMIB 1MZZA 4AKQA 3CVBA 4YL4A 1ASPA 1AACA 4ENZA 1E67A 1PLBA 4YSPA 4A2DA 1BAWA 2AVFA 4A66A 1AS8A 3WI9A 2YARA 2JXMA 1GYCA 3T6VA 1KV7A 2PCYA 2UXFA 3FPXA 7PCYA 1NZRA 2YAHA 3V9EA 2DWSA 1A3ZA 2PPDA 3EH4B 2Y69B 5I28A 1OE2A 4YSEA 1FFTB 4KOCA 4P5RA 3SBQA 5I5MA 3NJHA 5B7MA 2H5UA 5I6KA 1XB8A 1KDIA 1MG2C 1L9TA 3MX0B 5FC9A 4Q89A 2ZOOA 1SFDA 2WSDA 3X2QB 3DTUB 2IWKA 3ASOB 3CVCA 3H56A 2IDQA 3QQXA 3ERXA 4K9JA 3EH5B 1A8ZA 1AZCA 3WKQA 1BQ5A 2VM3A 4WKXA 3X1NA 3U25A 1XB6A 2CALA 2HRGA 3H4HA 2X87A 4A68A 1TEFA 5B1BB 1ZDQA 2VSKB 4AZUA 3DKHA 1J5CA 2RACA 1T5KA 1E5YA 2EILB 2IAAC 2XV2A 3S3BB 3IBOA 1TKWA 5B7FA 2FT7A 3QJUB 1NTDA 3C75A 3QJRB 2FQDA 2Q5BA 1SF3A 2I85A 1EZLA 2BP0B 3FPYA 3WNIA 1AOZA 2HX9A 4M4RB 2W88A 1NIDA 3ZDWA 4E9RA 1AS7A 2VN3A 3NSFA 2FJSA 2UXTA 2EIKB 1J5DA 1ID2A 4NAJA 1SDDB 4DP0X 3QPKA 1GY2A 3EHBB 2HXAA 2TSAA 4DP8X 1VLXA 1EHKB 5I6MA 2J5WA 2EIJB 1M57B 2CJ3A 4QKTA 4DPCX 2J56A 5B1AB 2HZHA 1ZIAA 1MDAA 4YSRA 3UABA 1PLCA 1ZIBA 2XXGA 2QDWA 1M9WA 2VMJA 3L45A 4HIPA 1AG6A 4HALA 4E9YA 4N4YB 3D12B 4KNUA 2IDUA 4YSTA 4EF3A 3ASNB 4YSQA 7PAZA 1AQ8A 1ET5A 2UX6A 1OCZB 1GY1A 1J9TA 4L0PB 4AKPA 2FWLB 2DYRB 1JZGA 2EIMB 2VW4A 1ADWA 2IH8A 3X1BA 3GDCA 1BYOA 2AZAA 2XU9A 3PAZA 3QJQB 1SF5A 4KNTA 1OCRB 1A65A 2IDFA 1X9RA 1RZPA 3S3DB 2IH9A 1JZIA 3PCYA 4CSZA 1TEGA 4JHVA 1L9RA 3AG3B 5AKRA 1ET8A 1GS6X 2ZONA 3NSCA 5TK2A 5I6NA 2XX0A 1ETJA 2AZUA 3ABKB 2EINB 2XYBA 1WS8A 1MZYA 4G72B 2A3TA 2MTAA 1M56B 2WO3B 4MFHA 4GP8B 3SQRA 3IE9A 5B1JA 4DP2X 3IN0A 3G5WA 2UX7A 2Y1AA 3FYEB 3FYIB 3FSZA 1URIA 1A4BA 1R1CA 2BP8A 4GP4B 1F56A 4YVUA 3RYMA 2JFCA 2BO0A 3KW7A 2GSMB 1NIFA 2AANA 3NSYA 1AZRA 4E9QA 3EH3B 4DPBX 2P80D 3FT0A 4Q8BA 3AW5A 3JT2A 2VM4A 2HLEB 3SBPA 1HAWA 5F7BA 1PZAA 2GC7C 3TU6A 1SNRA 1J9SA 2R7EA 2N0MA 2YAMA 1IKOP 1XB3A 2OV0A 4NERA 5AFAA 4X4KA 2GBAA 1KYAA 3FU7B 2FTAA 3NJKA 3S8FB 2FT8A 4BWWA 2BW4A 4BWUA 1DYZA 3CG8A 3X1GA 3OMNB 4YSAA 1GS7A 3AG1B 2IDSA 3OMAB 1KCWA 2UXGA 1PLAA 5B7EA 1SHXA 1JZJA 2BWIA 4F2EA 1IC0A 1CURA 1NPJA 3X1FA 4GXFA 2FQEA 4DP1X 1B3IA 2XXFA 1E65A 1OV8A 1WA0X 1AZNA 5D4IA 4M3HA 2CBPA 1KGYE 1X9UA 3CVDA 2GI0A 4PAZA 4F2FA 5E9NA 1J9RA 2FQGA 2HX8A 1I53A 4YSCA 4QLWA 1L9QA 1ILSA 2YAQA 3H4FA 2JKWA 2ZXWB 4G71B 2YXWA 3T9WA 2BP0A 2YQBA 3N2JA 4W9ZA 1IUZA 3AG2B 2QDVA 1BXVA 1AZUA 3IN2A 4G70B 1NINA 4UAHA 2Q9OA 2HX7A 4G7QB 2BZCA 2BWDA 1WA1X 3FU9A 4BXVA 2X88A 1NICA 5AZUA 1RZQA 4UANA 2VW7A 4KOBA 4DP7X 2QT6A 1MG3C 6PAZA 3DIVA 2XV0A 2YAEA 1YLBB 2PP8A 1QLEB 2IWFA 3ABMB 1ILUA 1PAZA 3EF4A 1N70A 1AG0A 4E9XA 4KO7A 3OD3A 1JXGA 3TBBA 3S8GB 3FQYA 1BYPA 3NP3A 4A2FA 1N68A
chains in the Genus database with same CATH superfamily
4XCNA 2YGPA 2X2YA 5INCA 1PZ2A 5EU3B 4ZNEA 3OC5A 4WJ5B 1FAIL 4E9TA 3F5WB 5GGRY 1BQLL 4HZLA 5EU7C 1J18A 1AKPA 5GIRB 3LKSA 4BQ8A 2Y1VA 3EOBB 4KV5E 3KYOB 4N8VB 3D4ZA 1PZDA 5C08B 3GBDA 3R0NA 4GKNB 4HK0A 5CIPA 5D2LF 5IVZA 3ZO9A 1GGBH 2HJFB 2K45A 3RVTD 4JKPH 1MFAL 3QJFA 4P5KB 3WXVH 1JCKA 4IRZH 1SOSA 4ZS6C 4UTAL 5F9JA 3KBPA 2JLPA 1S7RB 1FNFA 5HHVH 1BPVA 5B4MC 3ZKMD 3NCYS 3QISA 4AENB 5KSUA 5BRZE 4F33A 4IGBC 4I3SL 2B4CC 4OCMC 3HEIB 4J39A 2VISA 3TC9A 3JV5A 3HN3A 4QRRB 5DMKA 3FCTA 4XMLL 2HYMA 1INQA 5BRZA 5E94A 1CL7H 3ASWA 3C5XA 4ZW8A 1NGXB 1ANUA 1KLFB 2OP4H 1T83C 3K6IA 4APQA 3MDJA 2J21A 1XV8A 4JRFA 5D7SL 4PJ7B 1OW0C 4L05A 3OPUA 1ROCA 4OI7A 2Q1EA 2DIEA 2Q7AA 5E9AA 4GRWE 3OHMB 4KKPA 4NQDD 4ZK8A 4HUUA 4YDZA 3W5NA 3L3OC 3SDDC 2PYEB 3GSNA 3K2KA 5BO1L 2BMKB 3B2UC 3DXAD 4Q0XL 3HLKA 1H8NA 2AEQH 4D8PA 4Y9BA 3B5GA 1OGSA 5ICXA 2FX7L 4XVSH 1F6FB 5D7EA 1P84J 2E27H 3VSUA 1UXSA 1XD0A 4LCCA 1EAPA 5FO8A 3FUJA 4KITB 2M2DA 5E8OA 3S34L 4G80B 1HILB 5DMGD 5DZVA 2R4RH 3CFBA 3MLYH 1WAAF 3B9KA 3SYPA 4P0DA 3HMWL 4F8TA 2FH6A 1TQTA 2XICA 4KZDH 4G11A 4F2MA 1LLAA 4FHJA 1BBJA 2VR5A 1CICC 4KO6A 4AUUA 1LWHA 1CGXA 4HFWA 5LAXB 1TLMA 1MWAB 3CHQA 4U2ZA 4QRRE 3MCKB 5BO0D 2GCYA 1AQDB 3A4EA 2QPUA 3BD4A 5E9DA 3WLBB 1FV1A 2NY6D 1Q9LA 1JFQL 1CIDA 4FC3E 4LB8A 2WLMA 2UZIH 1IFRA 1PU0A 5DYOB 3QO1A 1MRDL 2F8OA 2CPCA 3QXAB 5FLUA 3ZE2F 1KLUA 2ZKWA 4ELKA 4G7SB 3EDDA 5I26A 1A7NH 1EXGA 3GF8A 3VD2A 1C08B 1YCSA 2IXQA 2HMIC 1CE6B 1HZHH 1IEAB 1J0JA 1KN4H 4FQLL 2P5PA 1XX9C 4JY4B 5DLMH 3AM8C 5C0RH 1JZ3A 5JHMA 4TNFA 1SLVA 3FUDA 1N19A 1ZHKA 2QGDA 3K4DA 3DHMA 4JPQA 3HB3B 4FDWA 2Y22A 5AOLA 1AI1H 2XTJC 3WNJA 3P3RA 4AQAB 5SX4H 2WXHA 2E9IA 2DEWX 4ZO7A 4NRXA 3TYFA 4GW1B 3ZDXB 3BVNA 4HFWB 1P0SE 1URLA 4PVLA 3K8KA 1AHKA 1RUAL 2CO4A 4MNQE 1IC7H 1SJEA 3FQ1A 3VUAA 4QTHA 1QRNA 3CX5J 2Y0SA 3NGBC 4X98A 3VFTB 3VMPA 2CR6A 3CFBB 1Q38A 2QFRA 1E2ZA 3HE7C 3OZKA 3MOBL 2A83A 1I85A 5KTEH 2AK4E 4LCCB 3F6IA 1E6JH 3CIAA 1L9PA 3V5KB 1SUHA 2UVEA 2VDQH 3NIDE 4S1RH 3UAJC 1RIVH 2HRHA 4CBPA 1UTDA 1C12B 5TDNA 4BZ1H 2QQLH 1JPTL 3AITA 3SIKA 5HYIA 4YDKH 2BFGA 4FXGC 5DJZB 4FYTA 5LBSH 1YEEH 1NGPH 5FFGA 4W4NA 3ZGHA 5KANI 2L7JA 4WGWB 5C0CD 4BK5C 3CC1A 1JS4A 3L3GB 5SV4A 1SQ2N 4I0PB 35C8H 2R1YB 5E4OA 3HAEA 4ODVL 4HK3N 4NBYB 1KWGA 2ZWLT 5IG7A 1UKSA 2E7BA 5B39A 2DQ6A 4R26H 1DBKL 1F97A 1Z5HA 3W0WD 4BBWA 3IDXL 3TZVA 3X3FL 1G7HB 5DMYA 2DD8L 4FYRA 5DMKB 4ZQTA 2WVUA 3L5WB 1QASA 4N86A 3SZKC 4LSPL 1U8HB 2C8NA 3LVEA 1UXMA 4LCWE 3TO2B 1SOXA 4RVBA 2DQDH 1JMXA 2H1PL 4H0GA 4K5NA 4NN5B 1XF5B 1HOEA 3TNNB 4QHPA 1S5HA 1ZK9A 3AABA 3SDYL 1AACA 2UYLB 1YDPA 2Q8BH 4H88L 1AYOA 1WFNA 2ARJB 2IBZY 1CBVH 4OM0H 5H37G 2F15A 2YARA 2A6DA 4NUGH 2F7OA 4O2CA 3X13A 2G9KA 1TJHL 2BFVL 1TTBA 4N2IA 4MQXD 4A7GA 4I5BA 2NSXA 3HI5L 3TN0B 3DJZA 3CSYB 5E4IA 1XH1A 5LGHL 3ETTA 2XWXA 5HVWA 1H8SA 3M8OL 3L7FA 3RFZB 3O6LL 2ZYHA 1KDIA 4PI2A 1WK0A 4RFNC 3WY4A 4AEHL 3BZ5A 2WY3B 3O3AB 4MNGB 1AP2B 5FYJH 4NNXB 2IGLA 4FXKC 4JFFE 3BESR 5LWYL 1H6TA 3I50H 4TYUA 5GZOC 1TJMA 2CRIA 3F7QA 3H4HA 4PB0L 5E5UB 5KYYB 4WSJA 2HKAA 3OR7A 1ZDQA 1D9KD 3HN8A 1U8IA 1K4CB 1EDQA 3WS3A 1FIGL 3A4AA 1MFDH 4IRSB 2ITDB 2VXQH 5SX4I 3V10A 4Z7AA 2ZWKA 4A6YH 2G5RA 1F4YH 4N8PA 5EU5B 4WNJA 3BWUF 3VM5A 4F9PC 1BZDA 2ZAHA 3KPNB 4Y1AD 4XBPB 3IGUA 1X5AA 3DK2A 3DPBA 4WW1B 4P5MA 1CGVA 4E36A 1AMXA 3MLVH 1J5DA 1SDDB 2HKHL 3D5OF 4N8VG 1Y6KR 5E4EC 5F88A 1OSPH 4E0RB 4B9IA 2OTWA 3AGWA 3I9AA 4BE6A 2OXGB 1OXYA 3VG9B 3IDMB 4P2OA 1HZKA 4MTMA 4YQXH 2J5WA 1QOKA 3GXIA 5IB3A 4WO0A 2YQGA 4P9ML 2DI9A 1LNUA 2ZF9A 2C4FT 4WU7B 1A7BA 2V9UA 4MRBA 4L9DA 1LO3H 4M5SA 2APFA 4G2AA 4HFUL 5D7KE 5EIVA 3FO2B 1IAOA 1VPOH 3ATFA 5AVZB 3C2AH 1G6RB 3BEVA 4L2YA 1MJ7H 1SXSA 3TT1H 3K8MA 3VFWB 4NRYB 4PJ8D 4GUPB 1QFOA 3FFOA 4X5PA 5F6IC 5HPMA 5JORB 3O3EB 2P24A 1OW0A 4N2LA 3VMOA 5KBNC 3VXRD 4BSWA 3H2QA 2C3WA 2KC0A 4DFIA 1AE6H 1S9XB 3MV9A 5FEBA 5IVXE 5BZDB 1R34A 1DVQA 4NFCA 5AVRB 4M8RA 5GSVA 1HWGB 1N6UA 1E4WL 2BSTA 1M7IB 3POCA 3OB0H 4J27A 1OAYL 4I3SH 4KNQA 4JLRB 3T8XA 3IFLH 2WV3A 3HBPA 1FZJA 2R56H 3PCYA 2O6PA 4UUJA 5IQNA 2OMXB 5ICZB 1DDTA 2X4PA 4ABQA 4AW4A 2NY2B 3LYRA 5I6NA 2XWBA 1AD9B 3RPBA 5I15H 4J3XA 2NTFB 1OO2A 3VFGL 5GS2H 5E5RB 2P43B 2H6PA 4XB8A 4LARH 4P4KD 5T5NG 5T1DH 2MTPA 5MEQA 2WXLA 2EYSA 1UA7A 3WJMB 4QRQB 4DP2X 2DH3A 5B1JA 5AALA 3FH8A 1X5LA 3QPQD 2D7PA 4M03A 5D2NC 3FYIB 5M94B 4DO5A 2FX7H 1R3LA 3BQUC 1DJGA 5AAMC 5E6IB 3OKNA 3QPXL 1FG2B 4UT9H 5DA0B 1LE9B 4U7KA 1WPCA 3QE5A 4AE0A 2C3HA 1KXQA 2Y6TE 3SKOB 5T1MB 3QIBA 5BZDA 4J8QA 3IXTB 2IFFH 2VLME 2X70A 2D7QA 1C9SA 1FYTA 4CVUA 3QUMH 3BO8A 4MBRA 3TWCH 4TUKH 4JHWL 1GZHC 5ISZA 4G82A 3SBPA 5I1EL 3LCYA 4TUOA 1MY7A 2F5BH 4X9GA 4YHLH 3R8QA 5F7HA 1S3KH 4F2ME 4MB3A 4GUPA 1AXTL 4R3SA 3ZZQA 2G4GA 5JORA 4OVVA 2Z35A 1A6PA 2BZDA 5FS5A 5LBVA 3KYNA 1QBAA 4PJGA 3GSOA 1DQDL 3L5XH 2WLLB 5C09E 1T5WB 3VWKD 3BWAA 1NQBA 2P5EB 1E5UI 4OF6A 4NO3B 3O45A 5FYLD 5EOQL 5GJSL 5HVHB 1XF4A 3SEPA 4NO5B 4QUOA 3IFPB 5I71C 2FYYA 4GRLA 5EUKA 4L37B 1PLAA 3WN5C 1QSED 4PJAF 2XN9D 5IBTH 3RNKA 3NIFE 1HTYA 1DBAL 1JZJA 1Y18B 5K1VA 1AYRA 3ZT7A 2V9QA 4XI5D 3QT2A 3RTQB 1OL0A 3QUYD 5DZ9A 4S1QL 4Z5RA 5L0QC 1CDCA 3FNKA 1M7DB 3APDA 3N91A 5LDSA 4HU8A 4XRCA 3FW6A 4A55A 2X40A 1C8QA 2IAMB 4R97B 3TJHC 3KPNA 1BLIA 4FADA 4F7MB 2GI0A 2XY2A 5AG9A 2MCPH 4QRSA 1SJHB 3MOAH 2KDYA 4JPVL 3UTZB 4PCSA 1E27B 4UV4H 3UPRB 4YSCA 4K7PY 1ILSA 3MRPA 1KFAH 4HK3J 4IHOA 4Z78B 2VE6A 3I3BA 3QQ9C 4XN1A 3MNZB 3KPRB 4YXKL 1RZFH 1YYML 2RA1A 5IROA 1XSIA 1OAQL 4HWUA 4XWGL 2WYZA 4LLYB 1X5IA 3SGKA 3VQ1C 2C7FA 1NICA 3DX8B 5AVXB 2VW7A 5SV3A 5KTEL 3L95A 5E6IC 1EZUA 3MRKB 3RX7A 5JXED 4NC1E 2HVJB 3NCMA 2QT6A 2VDPL 2ZXBA 3T0EE 4AQ1C 3QZMA 4K3JH 4W9HC 1I3RA 4HMCA 1UHVA 2V7HA 4NRZA 1MHHA 3K80A 4F57H 2BVOB 1YQVH 3O0LA 5CGYD 5F6HI 4B9JA 1BX2A 3ZKMC 5E2TH 4KK9C 1N68A 4JHZA 3VFOB 5TK4A 3PABA 2WOBA 1KGUA 2BOCB 3MJWA 4LCWB 5D1QD 2ZKXA 3CZEA 5CCHE 3CFEA 5C0JA 2CUMA 1T0NA 2HFEB 4M48L 3RY5A 2R0WL 1AJ7L 4NUQA 3VFRB 4CC0A 3ATDA 3L1OL 2I9LB 2E75C 4G7RB 4MD5A 3RVUD 5M7QA 1D7DA 3M17B 1S5HB 1S3RA 4HKBA 3EUUA 2ILLA 1N67A 3HRZB 3IDXH 4O4YH 2CU9A 2BS8A 1WBYB 3ZYJA 3QYNA 1ZGLM 3FCGA 4UZUA 5FCUL 2CO2A 5G55A 4PGBB 4B53A 4P2RD 3W3BA 2BNQA 4JB9L 4JBSA 3RB7A 2OAAA 1IGIL 1WA2X 3GBLA 1RFDH 1FHNA 3TA4D 2XFGB 3FRPG 1VFOA 2NCEA 1TEYA 1DQJA 4FFVD 4JJOA 5EDSA 3GD1C 1A7RL 4LMQI 1EH9A 1BFSA 1HQRA 3FFCA 1ZLSL 1UB6A 5MP6H 3KLSA 2ZCKH 1HEZA 4XXWC 2WBJB 1P4IL 2EXYD 4LVHB 3LZPA 2NNCA 4WTQA 3NFSL 4FI6A 2Z7WA 3L13A 4GIOA 3CUPB 4KGJA 3DJ9A 3EFDL 4MNQB 5LGHH 2XTSA 4HJJL 1SOKA 5BV7B 4EZJA 1R33A 4GUOA 1OAJA 3VFVB 3IGAA 4Y89A 1NOAA 3TOPA 1ZLUK 5DRNA 2Q7YB 3O2WL 1KJMB 4JFFD 3VYPA 2VXQA 4LSDA 3U79A 2QQNL 4A6YA 5DJ0A 4NKQB 3N41F 1NDMA 3CN1A 2WK2A 2PW1A 3L08A 5J1TC 2VXUL 1BQHA 4AYFA 1MKFA 3QWRA 3VB8A 5IJVA 5JPMC 5CKAA 3R06B 4HX1B 2VXQL 4KVPA 3WEBA 4FNTA 3U7AA 3KW8A 1HHKA 5ANHA 5E8PB 3V7AE 5CZXD 4D9QE 2ENSA 5FOBA 1MH5A 4N25A 4P4KC 4ZNEE 2FX9H 2NXYD 2IMMA 4IMKC 3CXHJ 1X4ZA 1ZT1A 1B0RB 1ZV2A 3MLVL 2HKHH 1ZANL 1SJVA 2CGYA 3PDDA 4M93C 2HT2C 2R2HB 2WO2B 1KB5B 1VCAA 2AJSL 5IHHA 4YE0A 3G5ZB 1X7QA 1CFNB 4GO9A 2YN5A 3HRPA 3W9EB 4KKLC 1KLGB 1HT6A 2X4UB 3RDTC 1M4KA 2D4FA 3DV4A 1JZ2A 4FYSA 1CUOA 1JI2A 1WAPA 4HIXH 5J6HA 5E6YA 1NWOA 3DNKA 1CB4A 1WDAA 4WV1C 3IDIB 3TT1L 3MLTB 2WQUA 3PHOB 5D7LB 1M6OA 3PJNA 4C56E 1FG9C 2OSXA 5DZJA 3HE7D 4P2QD 1TZIA 1YEHL 3QORD 4C83A 2C1OA 5IMMA 4KKAC 4RA0C 4MD0B 3F6JA 1KJ2A 2YRPA 3WIIL 1AQHA 1RJLA 4JFQA 4OFDA 3AU1A 3SJVB 5JDSB 3PWNB 4EOWH 1T22B 2H8PA 3VVVA 4ONHB 3SO3C 1ZOXA 4WK2B 4O5LL 1E8YA 3US1A 4KVCH 1IZJA 2XPZA 4CMMB 2H47C 4DGIH 4FQQB 5ICUA 1EO5A 1CO1A 2H8PB 4GI6A 3OHXA 4M4PA 5C0AE 3CZLA 2YD4A 1CE1L 4P48A 5JHDA 2PYEA 3GSNB 3ULVE 1Q8MA 3FS9A 3BZ4A 2EDJA 3QZWG 4L4JA 2E0PA 4R7NB 5IGXH 2HVBA 1RAMA 3PHOA 1EANA 1UG9A 3BSZL 4NUJB 1D2OA 4LQFH 5HI3C 3V4UH 1KYUA 2C9QA 1J1XL 4HEMA 3SGEH 2BHFA 3DOHA 1OVZA 3F00A 5I0ZA 2FGZA 3APNA 1WWWX 1J9QA 1VADA 4N9GB 3CZFA 4QRRA 3U2IA 2NNRA 4XNUL 2PKDA 3WKPA 5GHWL 4OSUL 4P2QE 3V55A 4C59B 1I7ZB 1LD9A 4IBQA 3SYOA 3WNPA 1DFBH 4QXUH 2JKLA 3QUMA 4RNRB 4HXBH 1B88A 2VAJA 2WLZA 3TVMA 1FFRA 4WFGD 1KPRA 4JFDD 2BRRH 3H54A 5DFWH 5C9JB 5JIDA 1OP3H 3CXFA 4PS4L 3QUML 1JXFA 4KK6C 8FABB 1BEXA 3OKEA 5I1EH 4MCYB 3W2DH 1FNGB 3L9RB 1TZAA 3VTAA 1DP0A 3UO1L 3KYOA 4N8VA 4LU5H 3BP6A 1BG1A 3BPOC 6TAAA 4ENZA 5GIRA 4R0LB 5EBWA 4A2DA 5BVPH 4HZLB 2H26B 5I8EA 3C60A 1MHPH 4YHZL 3GNML 1WIPA 1NDMB 3ARFD 3SDDB 3FF7A 4JFPA 5IV2A 1MNUL 2DLFH 3PXJA 4X99A 4JX0A 5I1LA 2ZSVB 2PPDA 3RGVC 4DVBA 1GA2A 1OSZB 4DVRH 4F8OA 2FD6L 1D5BA 1R3HB 2Q6WB 3TBTA 4QRPD 2QSCL 2VUYA 5GRWA 1A6UH 3DJSA 3NCFB 2YXFA 1TZHA 3QDJE 2E6PA 5T1KA 4WENB 1KIPB 4UOW0 4ZXBD 3H9SB 3DIFB 1WE5A 3FQUA 3WNLA 2XVKA 5TQ0H 1PLGL 5D8JH 1UACL 3DECA 4Z77A 1PIGA 4ZUVA 2CSPA 1EJOH 2BJMH 5KZCD 3WKQA 2WBJA 5D5MF 1YY9D 2YO3A 2O5ZH 4M5ZL 4IIQA 2Z4TA 2MCPL 3O9WA 4W68A 1Z3GL 1UM5H 2ATPA 5CGTA 2F19H 4WO4C 4AY0A 4F58H 2W0KA 2WM0A 4DGWC 5E56A 3BISA 3MRQA 2VC2L 4TNVF 2VR7A 1CLYL 4FFYH 5KW9L 4U1LB 4Z9KB 5CP7A 1NTDA 1RZFL 1JGLL 1UZ8A 1YYMH 3QO0B 1CTOA 3V0AC 5EORH 1JTPA 2NZ9C 3CFDA 4JFDA 3HUJE 1CTNA 4FTDA 4I3RL 5LG1A 1EBAA 1T3FB 1IT9L 4HT1L 2DQMA 4IDLA 3WD5L 3KE0A 1WBYA 3FUNA 1BZ9A 1ID2A 3VFNA 1SXZA 3LH2H 1K8IB 4KKAD 3JXAA 4K3JL 4WWOA 1ITBB 5E8EA 5HI4C 2I9LA 2I60L 2VDLB 3P1VA 4AGMA 3POHA 4DKEH 1N8OE 4P3WA 5CGBA 3L1GA 2KPNA 3KLQA 1LMKA 2Y3AA 3DMMB 3IPBA 3HZVA 3OKKA 2WUBH 5IJDC 3FU5A 2X6CA 3K6SA 1JPST 2BSEA 2XXGA 4WFGE 5DQ9B 3IMSA 2B77A 1IL1B 1QR4A 2BS9A 2W92A 1I3UA 1FQ9C 1MUJB 2V7HB 3G6JE 3L1OH 4YO0B 1NFKA 4NWTH 2IANA 3K8LA 4N2CA 2HLAA 4QI3A 4EVNB 2DL2A 5JHDD 4X9HA 3SCMC 5HXMA 5HDBF 4AH2B 3IJHB 4F7CA 1ET5A 3BAEH 2FWOB 1T1ZA 1T4KB 2IANE 3KXFB 3X14A 1OTSD 3S35X 5GISL 2LLGA 2ZTBA 2HLFC 2VW4A 3US0A 4LF3A 3BN9C 3BMVA 2VMFA 3ZKNC 5MHSD 4LCUB 3U0WL 3LN4A 1ZA3A 3MNZA 1WJ3A 3L3KB 3CXDL 3RDTD 1MLBA 4KDTA 1HXKA 1LHZA 2W9EH 3KPOA 3DRQB 4M6ML 3I6SA 4CVXA 1A47A 4XMKH 5IBLC 2DLIA 3O6FD 4O2EA 5A2LH 4ABUA 4FQJL 1N8ZA 1U8QA 1TEGA 5MP6L 1ODUA 1QSEA 2ZCKL 4PJ9D 5T1JA 3MZTA 1ET8A 2AQRA 3RL1A 2VDMH 2ALAA 4GAYA 4XODA 1GGBL 2IAMA 3OLDA 4M7KL 3GUTB 3DV4B 2N7SA 4NO0B 1R3JA 1A64A 1WWAX 3ZZSA 2E7MA 4N9OB 1HJCA 1G1CA 3QHZL 4HGMA 3OPZL 1MY5A 1KB5A 2WP3O 5BV7H 3IE9A 3GI9L 4L37A 3SKJL 1XF3A 5FM4A 5DC4B 1XF4B 1OP3K 3ELQA 2ODIA 5J13B 3DWTA 3VWKC 3F12B 5G4MA 4KXAA 1HDMB 25C8H 4E41D 5C09A 5ITBH 2QQNH 4GUCA 4TSBL 5TGBA 4K5MA 4UQ9A 3W0WE 4ZW7A 3MUUA 3ARFC 1GPOH 4LPUA 2E46A 3K74B 4H0LC 3DX1A 3Q13A 2XWJA 2Y7QB 3VRJB 1U2YA 2Z91B 3I75B 4KK8D 3PP4H 1AY1H 1MEXL 4RGOL 3QDJA 2YGOA 2OMYB 2F53B 5F7BA 5T1KD 4HG4J 4WSGA 3ZKXB 3KGUA 1TENA 2XT1B 4GS7B 1T04A 2OV0A 5C0BD 3NIGE 1INDL 5AFAA 3PDOB 5IW3A 4UM9B 3GBEA 1QPXA 5FWQA 3BVWA 4U1KA 3QDGB 2OZ4L 2I26N 3C5ZB 1AOHA 2CRZA 3PV6B 1E28A 3LS5L 5CWSA 1QRNE 2VN5A 3EXJA 4R90L 3VVWA 4QGTA 5EWIH 2ZKMX 1M6UA 3KPSA 4PRNB 3HI6L 3FB8B 2KI6A 3SE8L 3VJ6B 1D5IH 3FMGL 5IVOA 3FUKA 2QGEA 1V7ML 4P5TD 1RVFL 2E56A 4M7ZB 3VB9A 1A8JH 5JHDE 2PTVA 1U8LA 4QRQA 3DX0A 4RMRA 4DCQA 3U2SA 1ORQA 5CSBA 1GGTA 4YXLL 5MEQB 1WH0A 3QEGL 3MRDB 1PG7W 1AXSA 2CHWA 2VZTA 4YGVB 5KUMA 2XXCB 4M7LT 1KXTB 5CEXB 3OXRB 4TNWF 5HD8C 1TQCC 4V2CB 2P5WD 2HG5A 1Y6MR 1KUMA 3L1FA 3BWSA 4EOWL 1CXEA 2FX8H 3RRQA 4TLKA 4XNBA 4QLWA 4ZMNA 1QEWA 1KCRH 2ZXWB 4IQHA 2P26A 1TYEB 4XXDB 5B21A 4I9WE 3CPUA 4M5TA 3H3PL 1BF2A 1KN4L 1WGOA 4FQLH 1BXXA 2BC4A 4X7EC 3VG9C 3IN2A 3SYQA 1NFIA 1XF2A 1UOVA 5C0AB 4M1DH 1BZEA 4FF9A 3LDBB 4BXVA 3SBWA 2X88A 4UTBH 2MQCA 5IFAH 4GT7A 2DJMA 5I1GL 5FDYA 43C9A 4KK5D 1FN4A 3ESPA 4R9HA 1T6BX 1XD1A 4TULL 3SCMD 1NANH 4NNYA 1XGRB 5K9KB 2FEEL 4GKSB 1XL6A 1YLBB 1PZUB 4RFNB 1UOKA 3LB6C 5E8NB 2MHAB 1YY9C 1MHHB 5IB5B 4NRZB 5FYKH 3QB7C 4G6JL 2EDBA 3BEVB 3LPGA 1FORH 4F5CE 4W9LC 4KJYA 4JN1L 4ETQA 2I7OA 4PJXA 1CG9A 1KGIA 1DSFH 1NBZB 4PJEE 1ZAGA 2XN2A 3FDWA 1NFDB 2YUZA 5CNHA 1U3YA 5D7LE 1OCWL 2DDQH 1A1OA 3RWIB 4NQSB 2QVFB 2EIBA 4M43H 3S7GA 2P7TB 4P5TA 4K73A 1ZT7A 3FU7A 4FG6D 4NZRH 3TV3L 4YEFA 3KPRA 4BHUI 1CD8A 4HJGB 5F1KC 3D50A 5DZPA 5KYWB 2J3SA 1F42A 3PXLA 4PV9B 4U1SA 4YDKL 1JAEA 2P52A 1A6VH 4CSPA 4U3SA 4HHGA 3P9MA 3TM6A 1YNKL 2ICEA 4AYSA 3CVHB 1YEKL 2FT6A 3DBXA 4L8SA 4MCNA 5K93A 1UADC 2EKJA 3WMPA 3SGEI 2XCMC 3UZEC 1OM9A 2XYCA 4LBEA 5IW6A 2KL6A 4UT6H 3QZPA 2ICWB 4J23A 4R26L 5DJAB 2DLFL 1UM6H 3QI9C 4Y1SA 2DD8H 4N28A 1C5DA 5I16B 4LGPB 2QVTA 2ISDA 4FYQA 2YQ3A 5JXAH 5CN1A 1QAWA 1KCVL 4DO4A 2OW7A 1TVBA 3RWCA 5CM1A 2QPEB 3NA9H 3PAUA 2DQDL 4OZHB 1CG9B 1CTMA 1J48A 1J9CT 2DKUA 2H1PH 4WI0B 3V5HA 3HMXA 4MMZA 4ETQB 4IMLA 4ZTPL 2C9AA 2GAZB 3IGKA 4KQ0A 1KIQA 1NEZB 2J2ZB 1HL5A 3BVDB 2DL9A 2YAFA 4MA1B 2LU5A 5F7YC 5HDBE 4Z8FH 2Y36L 4I5BB 3NCJL 3U1PA 1RMFH 3JQOB 3LXUX 2VLKE 2Z35B 3N44B 4GIPD 1Y6NR 3QK0A 4O2CB 2ATKB 4M5ZH 1C5BL 1P5UC 1R5IB 1O7SA 2X89D 4DZBA 1ESOA 1A25A 1L9OA 4AIEA 2AEPH 3ZTEA 3QP3A 4HOXA 1MQKL 5BVJA 4UWQB 2CCWA 1WGVA 4M00A 2ROYA 2X42A 2NY4D 3CZUB 3TZVC 5KW9H 5CJOL 3D0AA 1AGDB 1XF5A 1JHLH 5DD3H 2NX5E 4I3RH 4AKOA 3HCVB 1OE1A 3F7VA 1KBVA 1URZA 1E5BA 2JK5A 4PW9A 4JRXA 3C5ZC 3LKQA 3LH2L 5B3NA 5AL0A 1KCSH 5D9SA 1MCIA 2XG4A 2XDHA 1DBML 3CSGA 1NPNA 5EHFA 5EZLA 4UNTA 1LYQA 2H6PB 3GXNA 4KU1A 5AW4B 4R4ND 1FIGH 1QFWH 1UEYA 3KH4A 3CNKA 4GBXD 1FZMB 3LKRB 3BQUB 4GSDL 2ZWNA 3HAEH 3LRHA 4FQIL 5IBUG 4YDNA 1QPPA 2C9XA 5B1CA 1ZT4B 4EKJA 3GJFK 4JY6B 2VDPB 1D5MB 4LCIL 4ZMZA 2YN3A 4IDJL 1P2CA 5JW5B 3LMJL 4JFZH 2GT9B 4HZ1A 2EIZB 1S6NA 1GVIA 1MJUH 5E8DH 4AV0A 3BE1L 4OCSH 2XUWA 5I74B 1HINH 3VXQA 4NOBA 2A83B 4OGXL 2QJDA 2KZBA 3AT8A 4WDIA 1H15A 2B1HL 3PFQA 2CDFA 3UL4A 2GBTA 1DQML 2V33A 1S7XA 3PQYA 2ZPKH 3MUGB 4UM9A 3TPUB 3LXAA 4RAUA 2FEJA 3MNDA 3FONA 1MREH 3FTGA 1VPOL 2P24B 1Q9WA 2BLFA 2D7OA 2OMYA 4HAKA 4YDLB 4ZSOA 3QH3B 3BKJL 1HEHC 3GBMH 3D2UD 2IPTH 3EYFA 2Z91A 3V6OA 3C9NA 5FHBL 1FSKB 4U1MA 1WYJA 1EDHA 2NCMA 3LKPB 4NP9A 5DTFA 3VWJC 3E6HB 2ZUXA 1OTUC 4GKLA 3FO2A 4PJCE 3RWDB 4B9GA 1P5UB 1L7TH 3ZIYA 4F92B 1W72B 3L2MA 4KDWA 1H0DA 4FQ1H 1WUZA 1GYAA 4LRNH 4Y7MA 2V5SA 2YD1A 3G5XA 5J89A 4KK6D 1I8MA 3QIUD 4DPAX 2GK0B 2PXYA 1N64H 2D03H 2IV8A 5EZOL 5SWSB 1E4WH 2IXQB 5SWZD 4UQ2A 4AJVA 3CLWA 5FGBA 1BW8A 2R1XB 2Z4QA 1JWMA 4D0DB 1R3JB 3NG5A 1JJUA 1N6QH 3WE6A 3QG7L 1G7LB 1AIZA 1BREA 25C8L 3CSTA 3IF1A 3FFCD 2A4EA 3PLYA 1E7UA 4GAYB 4LO9A 4TSBH 4MJ6A 4ELMB 1AR2A 4PHZA 1GPOL 1OT1A 5DO2D 4NJ9L 3MRNB 3MTRA 4MAYB 3VFGH 4F3FB 1NMCB 3EJRA 1W6LA 5J4MA 1FZOB 3ROLA 3UO8B 4H40A 4ZMLA 4DP9X 3DUUA 4LARL 2DYSB 3C09C 5CJQH 3IT8D 3STBA 3OR7B 3UTTA 1YJDH 3L3KA 2MMXA 4AKQA 2PXYD 1YPZB 2FYVA 1QLRA 1HE8A 4HXAL 3DGCR 4K9EL 3RAJH 1KZYA 1LP9A 4UQDA 3ZDYB 2OZ4H 3GSXB 4HIJB 4R7DA 3HHSB 2LV4A 3KS0J 3OWEA 4ALAH 2VLLB 3LZFH 5E8OB 4RFEB 5EBMB 3LS5H 1XIWC 2LTQB 4DQAA 1JBJA 3C8KA 4R90H 3LRSA 1NZRA 4YHKL 5BNXD 3ZN6A 3HG1D 3W37A 4YFDB 1W91A 1MFVA 1TTFA 3HI6H 4PYGA 2IFFL 3SE8H 4WEMB 1MIMH 3NSXA 1VZIA 4Q74A 4TUKL 1WWBX 4FJ6A 1MCSA 1D6VL 2IEPA 2W94A 2WLHA 3X13B 5KSBF 2B2XL 2H1LM 4G6KH 4MHHG 3U2JA 3LD8B 5TF1H 4ZFOA 5CEYB 2CDEB 4FJYA 2DJ4A 4ZOEA 3DTUB 3P4LA 5KYUB 2W0PA 1G9HA 2VM3A 3WY1A 5GS1B 1O7DE 2W65B 4XN8A 3F65A 1X5FA 3VFNB 2X87A 3RTLA 2X4RB 2NY1D 5L0QB 5GJSH 3OAZH 3DHPA 4AZUA 1XH2A 2Q3ZA 3BD5A 3EF7A 4M8VA 4CMHC 1J5CA 1AC0A 3HW7A 5IMLA 4J3TA 1U0QA 2EYTB 3MCG1 3WTYA 3AQZA 4U1LA 5CN3A 1I1RA 1GGIL 1ZVYA 3C75A 5F9JB 5GZNC 2ZKYA 3IM1A 4JFSA 3KYKL 4PLOB 3N0AA 1SF3A 2I85A 3JTTB 3IVKA 3QJFB 2HX9A 2IOMA 4P5KA 4BGLA 1G7IA 1N4XH 3ARPA 4XPGH 3ZDWA 4A63A 4OLEA 2F6AA 4HS8L 3SDCB 4ETYA 3VGHA 4LZKA 1EAOA 2HXAA 3DJRA 3E1ZA 4JPVH 3HG0A 1ED3B 1EZVY 3U9PH 2XACC 1S9VA 1KPUB 1HCYA 4G3YH 2NTSP 4DN3H 3NIGB 4FFWD 4I87A 1JYVA 1T89A 4KQ4L 4DQOH 2MCG1 3FB7B 2Y2TA 3GWJA 5DK2B 4HF5H 4POZC 4XP4L 4P3CH 5T3ZE 2DDQL 1FF5A 1IJ9A 4FTVE 4P9HH 3ZMRA 1QSEE 2EC8A 2WXNA 1ORSA 1Z9MA 4I48B 2VDPH 3TV3H 5DURB 1AQ8A 3SDDA 4PLJC 5DXWA 2C1PB 2HB0A 4NZTH 4QWWD 1MLCB 4Q6IA 4MS8C 4CKQA 3H85A 2BSRB 4Z7NE 3IWUA 5JXEC 1S7TA 5I1AA 3AFLA 3IMVA 2KQMA 5IHWA 2AZAA 3PAZA 1RJZB 4Y4KB 5E2TL 5KS9F 1LDSA 2AXWA 3U7WL 1F18A 4AVHA 3WEXA 3MO1A 3ARED 5IKCB 3WXWH 5EMYA 1ICTA 1XCXA 5HHOB 1AJ7H 2OXHA 3ULSA 5FGSA 1WC7A 1TFPA 4NQCD 4KI5E 3T2PA 1YECL 4B3EA 1FUNA 2OSLB 1SDAB 1UM6L 4NN5C 4OU3A 3MV8E 4ODXB 1OQXA 3SGJC 4XZ4A 1WFOA 4L5FE 1FYTD 2RGSA 3WELA 4YC2C 4RWYL 4XBMA 5JXAL 2X5PA 1U3HA 1WS8A 3NA9L 3GS4A 4WWKC 1XO8A 2EDNA 3R0MA 3QRLA 1FZKB 2P9RA 1M2VB 3D08A 1M56B 3KBHE 3FUMA 4MFHA 1FV1B 5F7EH 3L3JA 4HKZB 3VXSE 3QNYB 2WQAA 3NCJH 4H0HB 4N0UE 2J6EA 3KDPB 1B0WA 4HUMB 2VUKA 2X4TB 1OPGH 4LEOA 2CH8A 4GP4B 2F61A 3WTUA 4UNIA 2JQAA 4QRTA 3MV01 2VZUA 4EI6A 1HVXA 3FCUB 3IXAA 4YWGH 5JZ7C 1XCQB 2VDLH 2D2CC 5I73B 4JM2C 2R69H 2WCGA 3MBEC 3TESA 3FQXA 3FT0A 3EFDH 1AZVA 1MIEL 4U1IA 4WUUE 4F93B 5EFIA 1FVDA 5DGQA 3UTSB 5GZNA 1TQVA 3QNZB 4G7YH 2WGNB 2N0MA 4MMXA 2ZAIA 3LNGA 3PJLA 4Y16C 5DD3L 5AVQB 4ISVA 1COBA 3EYVA 4ODHH 2W0FB 1N7ML 2JLLA 4QXVA 4Z7UA 5JIMA 2X53A 1EMTL 2E6JA 3KCPA 5HYQB 1O6TA 1PDKB 2VWEE 2EADA 1TNNA 1XIWB 3CG8A 4BM7A 1BCIA 4FMFA 5L2KA 2VXUH 3KWWA 5EU6E 3T5WA 5IMMB 4EDWH 5JIIA 4WEEA 2QHLA 2OMUB 1S8DB 3FBQA 3P0VL 3OAYH 1LGVA 2IDCA 3MLSL 1ZLWH 1HC1A 4Y2DA 1RZ7L 1ONQB 4P46D 4YJZL 1S4IA 3OLIA 3MJGX 4JM2A 3MCLL 2JXMB 2V5MA 3QUZB 1A7OH 1U2CA 2FX9L 4HZAA 3LMJH 1AKJB 1C16A 1MCHA 5A6IA 4JW3A 1NCWL 1A21A 2R1WB 3DETD 1MJUL 5E8DL 4IIZA 4MAUH 4NIYE 2FATH 2VDNL 3UG3A 2OBGA 2X9ZA 4OGXH 2AJSH 1T2QH 3H53A 2BH0A 5FO9B 4M4RA 5KJRH 4JQXC 1MFBH 3H9YA 4G8GE 4NZJA 1FHGA 1P7QB 4HWNA 4PJHE 4BQBA 1ZKAA 5IVZB 3G7TA 1P7KB 3BKJH 2X0UA 1F4WL 3JWOH 3VXNB 4YHML 4Z3FA 2HSIA 5DEGB 1Q1JH 3NZSA 3D0LA 2D2OA 3F5WA 2IGTA 2JIXA 2MOVA 5GSRB 1FFOA 2VDNB 4XBGA 5MHSE 5E5MB 1NBVH 4M6OL 4Y16A 2JB5L 4A6YB 5AW1B 2DAVA 1SZNA 4ANUA 2R2EB 4K5OA 5FWRA 3OKYA 1A9VA 3I84A 2OL3B 2OPCA 3RA7L 2XWCA 1BFOA 1EZSA 4KAQH 2IH3A 3P11H 5JPMA 5BJTB 4J2QA 4AGLA 3AWEA 5I0DA 1F4XH 3T0AA 1B6DA 3TH2T 4MNQA 4A7SA 1MPAH 4L1LA 4N22A 4Z7VB 3ZOAA 3COOA 1N6QL 2VSDA 3GZQA 2XZAH 1CE1H 2BINA 4ATTA 5E7BA 4F7EB 2IPKB 4FHKA 4GRLD 3ULUL 1RZ8A 3B1UA 3FKUS 3GZKA 4HUNB 1ZSDB 2P4AB 4MA8H 1HQRB 1I1YB 4U49A 4ZXBB 3M1BB 5I1KH 3PJSA 3VRIA 4LLMA 5HGDA 3B7YA 4H8WL 1AGBA 5AAWC 3R4DA 4OZGF 4CGTA 4QXGL 2BNQB 1A6ZA 1NIEA 4GKOA 4RGND 3ZW3A 4AL8L 3QSKB 4C56A 2W81C 4L3AA 5HYJB 4OI9A 4BFNA 3L3IA 2D0GA 1CK0H 2BP8B 5HHXL 1CYWA 4K8RH 5EF0A 3D9AH 3UAAA 4P99A 1S7VA 5HYSB 3IB4A 3ZLQC 4V11A 5FW6A 1UXWA 4FLQA 2QVKA 2Z34A 3GIVB 2WNXA 1TPXB 4U1NA 3QZLA 4U1JA 4UINL 3N44F 5TF0A 1LQBC 3KPRD 2EE6A 1VACA 2HFTA 3S3SA 1F1AA 1QI3A 1WQVT 1VRSA 5FUOL 1NA8A 2MPVA 4AQ1A 1CFBA 3QRFM 4LU5L 1IGJA 3LN5B 3Q6GH 4LSTH 1HHGA 4PGEB 5EIQA 3RHWK 5TQ2L 3EJZD 1HNYA 1NIBA 4W1TA 1ZGLP 2ADGB 5HGGS 4G1MB 3OJDB 1NCUA 2E4TA 3OJVC 4GH7B 4ONGL 4ZYKB 4Z3GA 1MNUH 2GJ6B 2OQJB 3IEAA 4IOFD 2DQHH 1P4BH 1BJ1J 2BX5A 3OF6D 4PP1D 3B37A 4PJ5E 3HC2A 2CMRH 2QZ5A 1F13A 4GRWB 4OCXL 2AXHA 2FD6H 2FJGA 2V2XB 3KPQB 3SGDH 2EUVA 3RJDA 5KN5B 3QUYC 3MREB 4FG0A 4DUVA 4XMZA 4EXPX 1AIFA 1DQTA 4U6XA 5IB4B 1PD1A 3OKMA 3GSWB 2J25A 1AZBA 1BFTA 3TJHD 1TIUA 1ZLDA 1G9MH 3AJ7A 3T65B 1A3LH 3AGVA 3IMRA 4NFDA 2BVTA 5EF1A 4HS8H 2FQFA 4Z7UF 1ZPUA 3DETC 2COVD 1FO0L 2R23A 1XSOA 4I7ZC 5FV1L 3FFDA 1NBQA 2CIKA 4OIAA 3KPMA 2IQAA 1SYSA 2VLMD 1OTTC 1DLFL 3E3QE 3SKMA 1YAIA 4L23A 2VC2H 1SEQH 2OTUA 1IM9A 3ESVF 4G6ML 3VG0L 5I75B 3ZRCC 1AXIB 1GGUA 2ZG3A 3IE4A 3FUIA 4X6CA 1KBWA 4EE2A 3A47A 4Y5VA 4HF5L 4ZFFB 2R0KH 3CDYA 3L7EB 4P3CL 4NAMA 1IQDB 5HJDA 1JZHA 3WTTA 5JLZA 1AHWB 2QADD 4HT1H 3O45B 5CZKA 4N24A 2VQTA 5F7DA 3DUHA 3QDAA 3WJLA 4WUUD 4K23H 3VQ2C 1JXJA 3H6AA 3CFQA 1N2RB 2VLJA 5DJYB 2HRLA 4BWTA 1W0YT 5JW4R 5AKSA 5ADOH 1QBMH 3F58H 3OWRA 3LH9A 2JKRM 2WBKA 3MXWL 4AQOA 3WTWA 2V3EA 3OLGA 4GPVA 2YWYA 1DZ0A 1FBIL 4IM8A 1IEBA 1B2WH 4EIZC 2BSSA 3LKOB 4D9QD 4BQCA 3EW3B 5ADPL 6PCYA 4BFIA 1RLWA 3ZHDA 3LPFA 1FYTB 4OCRH 3P3YA 3BAWA 2V8LA 5F97E 3VWJA 2ADJA 1XDTT 1VFAA 2IJ0C 3E6FA 4D8OA 3O8XB 1FG2A 4H20H 5EZIL 2HFFA 3O3BA 1U58B 4B6ZA 1SEBB 3DA0A 2KKQA 2EE3A 2RR3A 4WLCA 3UZVB 3FT1A 1W16A 1ZWIB 3REVB 5I6LA 2B8OT 3KLAB 1RPKA 2J6EH 2BSDA 1B0GB 1EPFA 1A0QH 3QIWD 4M1GL 2AJVH 2XPGB 4YDIL 4M6MH 2VNCA 2R4SH 4XMKL 3T6XA 4W81A 2NX5A 2EIEA 3QXDA 1A5FH 2HTKC 4QT5B 2PPAA 1AO7A 5D7KD 1CMOA 4W9KC 4FFYA 2VDLL 1YUKB 4YDJA 3GPSA 5F7MC 1T66C 5AVUB 4XNMB 1MIEH 2GHZA 3GRBA 1BQRA 2AJ3A 4JLRA 4KTEH 3GJEB 5BXFA 3OPZH 2BNQD 1ZGLA 1M7IA 1VGKB 2NR6C 3UAEA 3UTTD 4E5XB 4M9OA 4UV7L 5AB2A 1OWWA 2CIIB 4PY8I 1FP5A 2F58L 3O4LD 1CFVH 4XH2A 1XGZA 5LUMA 7PCYA 2VLRB 2DWSA 3OAZK 5CBAA 3KLDA 2CLRA 3P0VH 2Y69B 1SMDA 5B8CA 2WXJA 3M88A 2FL5A 1MEXH 3G08B 3EYOB 2C3GA 4GT0A 3L3OB 3TYGL 3BUDA 3DURA 2J88L 2AI0H 5SWQB 4WU7A 4JQVA 2ITEA 3M1CA 3FO1B 1H3GA 3V6OE 2P42B 3FRUB 4G42A 3QIWA 1FRGH 1NOFA 3QQXA 4PBXA 4K15A 5IREA 4HLZH 1B9KA 4N1CA 4WTWA 4QNPF 1QLFB 5JQ6L 1LDPH 3U25A 1UZGA 1EFXB 4P2AA 5MERA 1WT5A 2FSEA 3GXDA 5EWIL 1A2YB 2DYPA 5C07E 3L4VA 3N85H 1I1AC 4L8BA 5GJTL 3AB0B 3CFMA 4MCZB 2JB6A 4JQXA 4XBPA 4L3ED 3BRDA 1O6SB 3PPEA 1U8CA 3TN0D 4WHCA 4YXLH 4CC1A 3BHBB 3QEGH 1HNFA 3SJVD 1F4WH 1BLNA 4Y0GA 1Q1JL 4IRSA 1AGFB 3GSRB 3F85A 4XCFH 1GOGA 3ZE0E 1BD2E 1NBVL 1XEUA 2EIKB 2YA0A 4XC3H 1AH1A 4UOQA 3D0VA 3EJZC 5DS8A 1A4JB 4LCYB 5DJ8B 1JK8B 3RL2B 3ZE1B 5F7KC 3K71B 5F2FA 2FX8L 4MA1C 3EYSH 3RA7H 3TCLA 2QV2A 2A6IA 1SLWA 2YBRB 4DAGH 1KCRL 1P84K 3RX5A 1N5YL 4FTVA 2QR0B 1HXYB 1NCTA 2IBBA 3U0PB 1A6AB 1G84A 4MJIA 1U8PB 2WVVA 4M1DL 3U82B 3WL9B 5B38A 1KGJA 3CD4A 4YSTA 1JPEA 2H9GA 2VYRE 5CU9A 2EVGA 5TD4A 3D4CA 3BZEB 2NUPB 3A22A 3D4GA 4PTTA 4ZFZB 5F3BA 2DKSA 2H6UA 4I8DA 3GGWA 3V9FA 2O61B 3L2LA 2ARJA 3H42H 1JZGA 2EIMB 1SGKA 4G6JH 1ZPLA 1FORL 4ATWA 5ICYB 1IBFA 2YZ1A 3ZR6A 3BSGA 4PU2A 1T21A 4TF4A 1UM4H 4OKVB 1X9RA 3UOAB 1DVUA 1G7QB 3G04A 4U6YB 1CK0L 4JO2H 3VFMB 5D71L 2NQCA 4XPTH 4BK5A 5F0MB 4NZRL 4PJFE 3NEXA 3AS3A 3N1FC 4R4BB 5TK2A 1IX2A 2GTWB 5JZ7D 4HUXB 3SDAB 2OYKA 1CDJA 4Z7WF 2Z6FA 4WKZA 1KENL 2XIIA 2R1YA 1RK7A 1BVNP 2X1XR 1XFPA 3TIDA 4L2LA 4RCAA 3EJYC 5TDOB 1OM3L 4GP8B 2Y9RT 2AEWA 3IN0A 3F8UB 4MZIA 2PW2B 5IVXB 5TQ2H 2VH5L 2Z92A 5ID1B 4GIAA 1E9OB 2RMNA 5FDWA 3KJ6L 3V0FA 3ZHFA 1A4BA 5C09D 1R1CA 1S5IL 3EG9A 1T2JA 1A4KA 3C6SB 5HHMD 3U4AA 4KBPA 3DRTB 2GSMB 2M26A 5I6XB 5JHLH 4Y4FC 3T04D 3DHJA 4ABVA 4P04A 1L0YA 1UA6H 4KUZH 4KKBD 4X9IA 2UWEA 5CXPA 4ZTPH 5FKPA 3TU6A 5MENB 3KNBA 3BLBA 5D1ZB 4J12A 2R7EA 4QRAA 1SXAA 4EDXA 1YVLA 3B5HA 4JJHA 3RIKA 5KJ7E 4J3SA 3C6LB 2Y36H 3MUHL 3FZUD 2NY2D 1KYOK 1XCWA 2AJXH 4XNQB 4H2CA 3QUXD 5LCVA 2O5YL 4QHNA 4JG9A 4AIZA 4LVEA 1MCJA 2OX5A 1ZHKB 5LN8A 5AOZA 4GQ9L 3LS4L 4EIGB 1JNJA 3II3A 4B3VA 5IESH 3PYCA 4N20A 1BQHG 1I1FA 1UWEL 2BWIA 4XP6H 3CDCA 4TQHA 4QOKB 4RQQB 3F3HA 2FGWH 1OP4A 1B3IA 1PYWA 3JV4B 1OV8A 1EXUB 1XGUB 3VFPA 2FDBP 1NGQL 3WJLC 2ZUTA 1I82A 4IW4C 3EKCA 4ZPTB 1BF8A 3TH3T 2LR4A 2JCCA 4U33A 5FFLA 5KG9B 1AQDA 3JWNC 4Y88A 1IBDA 4GLRH 3MFFB 5CP3A 4CADB 3MBXH 5T3ZD 5J12B 5LNDA 5HI4D 1F3RB 1V7NH 3B6SA 5C6WH 3TO4A 1RK0B 2NXZB 5LAXA 2BY2A 1MHEB 3G6DH 1B2WL 2Q0ZX 3WTXA 2X4QA 1CLZL 3TF7C 1X5JA 3B1TA 4NJAH 1OY3B 4UT6A 1JGVH 4IDJH 5GGVY 5ERWB 1CFMA 1LEIB 3AMLA 3IU3A 1QO3A 3QS3A 4KZEL 1BGXL 5AL8A 5GGSA 1HQ4B 2O6CA 3KDMB 4OCSL 1E7VA 5EZIH 3KEHA 4NN7C 2CO6B 1KEML 1MI5A 2V7NA 4LOUC 4Y1AB 2EAEA 4Y8DC 5I1JH 4JNXA 1ETA1 2HPOA 4B5EA 2H32A 3MRBA 4ZD3L 4UOJA 3VNYA 3QIUB 1MREL 1ZHBA 3JTSB 1IQWH 3QR1A 2YEZA 3ZKND 5JA9A 3E9UA 3H7LA 3GRWA 5D96B 5DD5H 2YSSB 1D9KA 3UJJL 1FL6B 3QQ4B 4HUUB 4PJIB 2IPTL 4PJAE 4JAMB 4J2XA 4LVOC 5K59F 3ULVC 1A5FL 2FEDD 3PE9A 4Y5YB 3V0EA 5IROD 8PAZA 1OZUA 2YFNA 2FBRA 1NC2D 3MMEB 3VD9A 1Y0LA 2FO1A 1UWXK 4BFKA 4PJ9C 4MSWA 5F7NC 4FQ1L 2L7EA 3ZRFC 2X2UA 3NK4A 1KG0A 1JSYA 4TVPH 1NGWB 1R3IL 3VXUB 2Q2EB 4BUGA 5CN2A 5ID0B 2VISB 1N64L 5K9JH 5LG6A 1XBRA 4FMVA 2FH8A 5C2UB 4G5AA 4N0FA 4JPIB 4HHAB 2YD6A 3PNWA 4J7RA 4WTXA 4UZSA 4PWGA 1E3ZA 4RWHA 5IQ7L 5C0DB 5D2LB 5A6MA 4P3DA 2X1PA 2BP3A 3N40P 2Q3XA 2E86A 3P77A 4FQPA 3VSTA 3T6ZA 4HK0B 3CHXA 4D0BB 1NC4D 4KJQD 2WQ8A 3C08L 3FQWB 3LKNB 5AOJA 2IAMD 1G43A 3H55A 1J87A 4PJDB 1ZDSA 2V17L 2NXZC 3NMEA 3D39D 4MDIA 4OGZA 1G7PA 4YH6A 3SKUD 1AR1B 1HXMB 4PG9A 1JV2B 2DEYX 4JDTL 4AYEC 3OTTA 5E6UB 3BKCH 4IIQC 1CFTA 4MQSB 3NCWA 4WI9A 4XAWL 3RDTA 1XZWA 4OFYA 4PD4K 2G0LA 1CT8B 2GI7A 4XR8C 5JOPD 1ZTXH 3B3BA 1FL5B 2AF2A 1I31A 2JTDA 3L81A 3QEHB 4YPGB 1TU2B 5H35A 4JKLA 3LD8C 5AD0B 4K3EH 4XPHL 5EU7E 4GP5B 1HH9B 1EO8H 4Y4KD 1JPGB 1RHHA 4EZKA 4YLCA 1KIUA 1MJ8H 5IK3A 1ADQL 3TA3B 1A4CA 4N5ED 3H9HB 1BZ8A 5ANME 4F7TA 4XCFL 2BVYA 2H3KA 1VEOA 2N01B 4NQVB 5D6CB 4Y5YC 5T3ZH 5I2IB 1L0XA 2JF1A 2JJVA 3JTBA 2K3TA 3NCYP 3KPLA 1QATA 4L4VE 2WTPA 4XC3L 1I1AA 2WPGA 5FYKU 1B2YA 3BYYA 1CF8H 4KROB 4UDUB 5B3SB 4E9LA 3WDHA 1M1XA 4UM9D 2BOBB 3S4SG 5FA4B 4UIMA 4WIQA 1QW9A 3TBWB 2YPLA 3LQZA 4DAGL 5FGRA 1JVLA 2CO1A 3MRRB 1MW1A 3O6KH 3QWOA 1CLCA 1UENA 2PTTA 2E74C 4K7PL 5HGAB 4B60A 4R7XA 5C3LD 1I8AA 1XGQB 2XX1A 3IJYA 4N0CD 3BXNB 4LPCA 1TJIL 3ARXA 4XPFH 2FO8A 1LO2H 4XPGL 2A0LC 4G43A 4L8CB 1XTMA 3IDGB 1QTYT 4RBPH 3A4FA 2HCZX 4F15B 5E1GA 4DK3A 4XPBL 2ENYA 3DROA 3NCEB 4X80H 5DD1L 4JG5A 2UV3A 4LFHG 4G8IB 4JREB 3VWKA 2OZ4A 3Q8BA 2OJEA 3QG6B 5EEYA 2DLHA 3CPLB 2APVA 2WB7A 4HUCA 2E9WA 1X5MA 3AROA 4PJAA 3F83A 1PJWA 3UADA 4ODUB 4BA8A 4OJFH 1UFUA 1SFHA 2MPAH 1JV5B 1PZ5A 3VO0A 4OVUA 4IKJA 2ZUSA 3VXOB 4B96A 2X2IA 1JWSB 5F0LB 4DZ8A 3LQAL 3KZ8A 3II1A 4A2EA 4Q52A 4PJFA 5IT2L 3IDYC 5ESQB 5I23A 2AJUH 3QFJD 2OYMA 1OB1B 3I6KB 3FAXA 5IEKB 4LEEA 1OM3H 4ANVA 4FRWA 1AGEB 2WZ0A 1DVFA 3VDAA 5F3HA 3D39B 3GO1L 1UD6A 5BW7C 5I66A 2ERJB 3KJ6H 3VI3B 3S3PA 1A9EB 4NGHL 4R96B 1C1EH 3VE0A 2ORBL 4EEEA 2VQ4A 4ZMYA 2Z31B 3BAXA 3L6FB 4P23A 3Q1SH 1Q9KB 5D4JA 2NW3A 2ZX7A 5FB8A 4HKJA 5HHQA 1XSKA 1LEKA 3QQ3A 1NGZA 4FNLL 1Z32X 3RIFF 3JUZA 3W39A 3APFA 1LK2A 2WKLA 3GTNA 1YN6A 1HOCA 2BIQA 2X4SB 5F7EL 1CR9H 2C9RA 2K8QA 3PQYE 4H1LH 3CVBA 3ZL4H 2B4CH 4TQIA 4PWJA 4Z3IA 3D25A 2AJXL 4MJJA 3PL6B 3QR0A 1F1DA 2DWDA 1MCNA 1DHKA 1QUNA 1XT5A 4WY7L 3O11A 4AMWA 2WXMA 2BSBA 3LS4H 3R18A 5IESL 4PTUB 1XGTA 2WZAA 5CJXC 2YJLA 2QEJA 5CKGA 1JHKL 2VXSL 3REWA 3S2CA 3V6FA 4GQRA 5C7ZA 4XXWA 3WBDA 5JXEA 1SY6H 3LPWA 3IMWA 2FWSA 3U0TB 4HUVB 5CMAA 3DXAE 4NENB 2YGNA 4G9FD 4Q89A 2XTLA 5C07A 3IETA 5CP3H 3DUSA 4IGBD 5DVLA 2LAGB 3CC5B 4LPXA 1G7MB 3VU2A 3AXLB 1DUZB 2DLTA 2WWMC 2ZOLA 4BH8A 2A38A 3U36B 1G9NH 1V7NL 4ONOA 3P02A 3HZYA 4YHIA 1RZ7H 3MRHA 4GOSA 5AKTA 5C0GA 4FL4C 2APTA 5B7FA 3LZLA 2E59A 2HJLB 2NXZD 3TLRA 2JVUA 4HSAC 3QCVL 4PCKA 1AOZA 1YRKA 2OW6A 1MCQA 1NEUA 3QJHA 4QYAA 1NIDA 5J13C 3HR5B 3Q8FA 5CFHA 2H32H 2J72A 3I9GH 2CJTA 5D2NE 1BZ7B 1QWHA 5DCCA 1PGRB 2P5WB 3DOIA 3CZSA 4NYLA 5G5DA 3GRWH 5LQBH 2QLVB 4OCLC 5T8IA 2EIDA 1ETB1 4L4TA 4KKCC 2IH1B 4JM4H 3LAFA 5TJWK 4DO6A 1ZIAA 1TMQA 1MVYA 1X5XA 2NNAA 5J1AA 3SDXB 3FQRA 1AG6A 3AMKA 1XBDA 4BZ2L 1DFXA 5BUAA 4IU3A 4XP9L 2R69A 1KTBA 2DI8A 1SVZA 2YPKA 1T4WA 2X6BA 4GW5B 3RU8L 7PAZA 3ZDZE 4F91B 2UX6A 4PBDA 1OEZW 1KBGH 2D0FA 3D85B 4LDLB 2F54E 4QHKJ 1U92A 1UEMA 3HUJA 4V1DB 1RZGB 4XP1L 4PY7B 4MA3B 2DIAA 2QELA 3D51A 3DSNA 3ZU8A 3F7RA 3P11L 1AR1D 2P8LA 5EA0L 3QJQB 1CU4L 3UCQA 5DRZA 3N3EA 1DSYA 3BUPA 4JRYB 4WFFE 4PREA 4AIXA 1OD7A 3QWRD 4ZUUA 3NH7H 5C0IA 2UZXB 5DO2C 3IFOA 2Q7NA 1WWCA 1YEDB 4L4VB 4UCFA 4A7GF 4NKMB 4OIBA 4JEGB 4Y2OB 3IETB 3RWJA 2VM9A 3LXCA 4KH9A 4MA8L 2WLIB 2V2TB 3U0TA 4L1BA 5A16A 5IB1B 4PGDA 5F7FA 5D72H 4HUVA 4J3UA 3M07A 4Y19A 3DMMD 1T20A 1Z6JT 1ZVSA 3BPCA 2CHNA 1GYWA 2V2WA 5C0CA 2IQ9L 1QX1A 2YPLE 3BW9B 4P2RE 2EC9T 1URIA 3T0BA 4NQEB 2H7WA 1ZVHA 3WAJA 1H19A 4L4TD 5DD6B 3NTCL 4YK4B 1PY4A 4IGBB 3LNIA 1BMZA 3NSYA 4UINH 5EO9B 4JZOA 4ZSOE 3VXMA 3TFKD 3TPKA 1XZ0A 3UYPA 1IAIL 1RP9A 3LIZL 4GO6B 2FIKA 4ILDA 1CDHA 4PWIA 4LKCB 2B3RA 4AQZA 3N41B 1J9SA 2YUWA 4PJDE 3W9DA 3Q6GL 2NLJB 4LNRB 3K4AA 4X4KA 2OMVB 1KYAA 2P46B 4LPTA 4LSVL 2WMPB 3L6FA 4P23B 1I8LA 1B4TA 1MFCL 1DBJH 1IAKA 2CK0L 3TV8A 4KI5D 4DKAA 3JWDC 4BWUA 1CBJA 3X1GA 2IALA 4OLZL 3OB8A 2IPUG 2X3BA 1KCWA 2EDFA 4JM0A 5IHZB 1J0ZA 3QARA 4FFZA 4P46A 5MEPA 5ESQA 4R2GD 1SHXA 2B0SL 4TS6A 5DHEA 4YMPA 2J7LA 2YZ8A 5DI8B 3QA3A 4DZ8B 1TVHA 5KEZA 4NC0B 1TJIH 2R8SL 1F6LL 1HKLH 1L5GA 5KAQG 2MOQA 4PRIE 3GMLB 1CDBA 4JRXE 1X9UA 3L3DB 1FO0H 3Q2CA 1OP9A 4PAZA 3LV3A 2V4LA 4PJAB 3T2QA 3UGUA 4Q6IC 1CFQB 4QF1A 2EDQA 4BH7A 3P2BA 4QRRD 5I30L 4OAWB 4RESB 4G8EB 2JKWA 1F0LA 3WHXB 2HAZA 4AVIA 4YFEA 4X0KA 2YQBA 5F1IA 1IU1A 3N2JA 4W9ZA 1PZ3A 4UT7H 4WO4A 3RKPA 2DOCA 1DJZA 3T2LA 3ZE1F 1BXVA 1AZUA 2F5AL 4WQOA 1WZ1L 2HX7A 5E2VL 1X5YA 5L7XL 4HH9B 3BGMA 4K23L 1MVUB 3OAUH 4D0CB 1EJFA 1TT6A 4HV8A 1XR8B 3L3HA 2VWEC 3EHBC 5ADOL 3ARBA 3DIVA 3MU3A 4J3VA 6FABH 4HD9A 1ILUA 3EF4A 2GABA 1N70A 3B5TA 1N59B 4N0RA 1IGCL 5CINL 1FBIH 4GO8A 4YBQC 3IDJB 2UWEE 3IGFA 4A2FA 1GTFA 2EH7L 3BVXA 3VH8G 1XEDA 3O8XD 2XV6B 1I1AB 1UURA 2WKOF 1C1EL 2G3MA 3DV6B 1U95A 2W60B 2PN5A 5CS7A 4YE4H 1GSKA 1KXVC 3S4SB 2YAPA 4OZIE 3ARFB 3K46A 5GRYA 1CGWA 4U4BA 5AKVA 3HE7A 4P2QA 5FOJA 5GGTL 1Z5LB 3SGJA 4H1LA 1KGWA 4KKQA 4GQPH 5DT1H 2K6YA 1CVRA 3DMMC 4IOSD 5ESAB 2F7PA 4GRMB 3T6WA 4BKLB 1A0QL 1SVBA 1CR9L 1OSYA 4HUWB 3GMPA 2JCCF 4S2SB 4YDIH 3HS8A 2L7QA 3BQUD 4JN2B 1PG7X 2X3CA 4G5ZH 4JVWA 3L8QA 2PPFA 1N0XH 2RFXB 5CSZB 3CK0L 1ZV9A 3SDAD 1EWHA 4F7KA 15C8H 3PREA 1SXBA 4FXGB 5J9PA 2AEIT 1IMHC 4KDVA 4Z3HA 3GEFA 5ES4B 2OS7A 4KTYA 5BQ7B 3DVNB 3UXFA 1J1OL 2YR3A 3G9AB 4U6VH 3RVVD 3CGTA 1IFHL 1HH6A 3MRCA 4IU3B 4Y5XC 5DJDA 5JW4Q 1MRCL 2GC4C 1R5VA 3HC0B 4GSQA 4UV7H 3EFFA 4AZ8A 2C5DC 2CJUH 3V4LA 5IOPA 5E00B 4BINA 5D5MA 3AG4B 3NP4A 4YR6A 5AWNH 3MA7B 1KBPA 3N40F 3GPEA 3HS0C 3C6LC 1VJSA 3WDIA 5BS0A 4YAQA 4FQ2H 2KHAA 3EJJX 2N56A 4X5WB 3QW9A 4ORGB 2ZOKA 5CO1A 2VITA 3CH1B 4MXWH 4HA1A 5D1XE 5FHAH 1CICA 1LL1A 2BIMA 2XQYG 2AI0L 3H7BA 3PHQA 4XVJH 5CZVH 5E0QA 1FVEB 3GMRA 4WI6A 4RGNE 1BXAA 2MSPA 2IGFL 2GJ6D 1Z9LA 3FH5A 1UH4A 1YNTB 2W07B 1FRGL 3HPJB 3OSKA 1VFUA 3F7YB 2OA9A 4E9VA 3HC3L 2KUTA 4PJIA 3DJTA 1NLBL 1DVSA 2OCJA 5LQBL 5GGVL 2J5LC 3HA0A 3QQ9D 4OLXL 3OG6B 2GB2A 4C4KT 3VGFA 1ACYL 2X38A 2VDOL 4PV8B 5IOPB 2F7QA 2NZ9D 2WTRA 3VFSB 4JZNA 4PVNA 1M2OA 5DHVH 2BZ7A 3MACL 3AS2A 4NKOA 4FNPA 4BZ2H 4JCWA 2Y5TB 3VTMA 3NFPB 5AENA 4JHUA 3Q0HA 1U93B 4WUUA 4XOEA 4WEBH 5ALCH 4B7LA 2LFEA 1P9MC 5EU6D 1KBGL 1LEIA 3PGCA 4BDVA 4X4YA 5BOZG 4NCC1 3CWGA 4JL2A 3MNWA 5ILTH 4KV5F 4AI7A 4JFTA 4FXGA 2PPCA 5AAMA 2I32A 2WXFA 1ZHNA 2I9TB 3W38A 4FOMA 5SWZE 3LN9A 3NSJA 4P2RB 4YHYB 3QFDA 4I1NB 5K33A 3BIKB 5F8RC 3X3GH 3RVXD 3UYRL 2XPYA 4ZUSB 4H7VA 5IW1B 1MW3A 4NIKB 2AGJH 3NH7L 3WKMH 4OZ4A 1XWVA 4DH2A 2AP2A 2ICES 5I8CB 1LWRA 5FM5M 4NP4H 3QFJE 5EPMA 4PRPB 4L3CB 5TH2A 3HC4L 3VGDA 3ZDXF 4HG4K 5INDB 1JGDA 2ITCA 3HPLB 4ZS7L 5F1SA 1F3DJ 5C0AD 5F7WC 4N26A 5KWYC 1D3CA 5JOFB 4PRBB 1D5RA 1I8KA 3AT9A 2A9BA 1I9IH 1L4IA 5TDPB 5K9OB 3TTYA 3KR3H 4MNQD 3IDNB 5ANMA 4UQIM 5I71B 4OV5A 5DK0A 2APXA 4QXTA 5HDQL 4NQQA 1IC1A 2BVEA 5EBLB 4NM8L 5JMOC 5IM7A 5CCJA 4LASH 3C6LA 5JIQA 3IAQA 4B95C 2G9HA 5JYMA 2UZYA 4YSDA 3UTTE 3W82A 4ZFGL 1KENH 1ITCA 4CUCA 5DSCB 3PIQB 2A5UA 4KO5A 4L9LA 2EYRB 3ESOA 3U4BL 2UUDH 1JDCA 1GHFH 2FNBA 2GHWB 4G6FD 4XMXA 5EU4A 3VD4A 4IRZA 4AW7A 5DMIL 5DJCA 3WMSA 3EG9B 1AS8A 4HBQA 1U93A 1EHNA 2JKSA 4K5LA 2XQ0A 4JQIL 1J88A 4NX0A 1R0AH 3DSFH 3O0RL 3BFOA 3SOTA 3TEUA 3DI3B 2AK4D 1E6OL 1O7DC 4OLZH 4PJBF 4Y4FA 3QI9B 2PCPB 1D9KC 2PW2A 1FNSH 1HZLA 3EH4B 2B14A 3GK8L 5IMKB 4NDMA 4XGZB 4S11A 1EIBA 4JQIA 3C6LD 3N1MC 2XRAL 3L3DA 4KOCA 4M7LH 4KUZL 2P8MA 5KVEL 4PB9H 2D7TH 3KH3A 3TCTA 1PZSA 4KY2A 4OLVH 5CR8A 1I3GL 3GSVA 5H2BA 5AVVB 2YMXL 1XB8A 3WFEL 3MX0B 2R8SH 3G3LA 2C4XA 2CDGB 1WBXA 3X2QB 5K9QG 3RGHA 3SCMA 3CVCA 5F21B 3WTVA 4PIBA 4JRXD 3GSNH 3PG2A 3AAZA 4QO1A 4DSYA 4XO4A 3HZKB 4N2DA 4PG2C 4PCTA 1IBGL 1JNNH 2MWCA 2J71A 4LLUA 1FVEA 3GMRB 4NI3A 1QFHA 2X2HA 4AQEB 4DW2H 1OTTD 4PUBL 2XV2A 3S3BB 5HGBA 5I9QC 3IBOA 2DQFA 4XP6L 3I3EA 2PWEA 3MLWL 1CZ8L 3C5SB 3SE6A 3L9YA 4CW1A 4IOIA 2RQEA 1QQDA 2ID5A 1NGQH 1GZQA 5DJ2B 1JK9A 3HLAA 5MI0B 4XAKE 3JSSA 3BUYA 2UWEF 4DK6A 5L4MA 5T3XL 3QORB 3FH7A 4HJ0D 3WIFA 1LE5B 3I02A 2H0FA 3QC6X 1ZE3H 2B1AH 3CU7A 1S7SB 2VN7A 3FT3A 4AZ8B 1QBLL 4K3GA 4X4ZA 5AG8A 2ATAA 4LLDB 3HJ0A 5B4MD 5CHNA 1A9BB 3EOYG 3WXVL 2PYFB 4GJTB 3W57A 1VZGA 2CRMA 3B9KC 4HJSA 4IRZL 4QKTA 3S96A 4U6HB 3TXAA 2XI9A 1L6ZA 2YPVA 3HHRB 3E0GA 2J20A 1JGVL 1ZIBA 2EDXA 5HHVL 3N04A 2OMWA 4AGPA 5C9KA 3QUZC 1J11A 1JK8A 3BT2H 2IDUA 1K5NB 3KXFD 4IJTA 2EDLA 4AWJC 5I0VA 4AVKA 4WNSA 3V6OC 1KXVA 1V3MA 5AW6B 1A6TA 3K6NA 2EVJA 4MB4A 1MF2H 1CCZA 4I0PC 3GDCA 4NKMA 4X7DC 3QJXA 5C0IB 3VI3E 1DQQA 4ZUUB 2YKLH 2WCPA 5FYLH 4KJPD 1F58H 3UJJH 4CJ1A 2YD9A 1N0XL 1ES0A 1EX0A 4OD2A 2FB4L 2AEQL 1VGEL 3EOTL 5ACZA 3LH8A 4ZUWA 4CSZA 4PY7A 3DV6A 1SBSL 1M05A 3AG3B 3ME0B 2LTQC 2YD0A 4OJAA 1KIRB 3NRPA 2R15A 3HKFA 4GG6F 3N0PB 3MI6A 1DVZA 5E2WL 3VXTB 4EPSA 4H26B 2KMWA 4KZDL 2WWKO 3STZA 4GAFB 5E1AA 1HJBC 1QFWM 3BPNC 4Z7WE 5EOTA 4WHTA 4X7TB 4B5ZA 4HULB 2W38A 1OB0A 4W70A 2H2PD 4HV8B 2EUWA 1TZOA 3M45A 3ULVL 4ADIA 1B9ZA 2HN7B 5K1JA 1GRWA 1AMYA 2FIRT 4QY8A 2CIIA 1W9XA 3A23A 3FSOA 2DQCH 4XX5A 1FFNA 4E9QA 4BSVB 2A77H 4ZXBC 3T4YA 3WY3A 2FO4B 3C09B 2FSDA 1BIIB 4APXB 1IBHA 1Z0NA 2EEAA 2CKBA 5CZVL 1XB3A 1A7NL 3G5VB 1RZIA 3GC3A 4QF1B 4LLWA 4TNVK 4NXKA 4ZUTB 4XAWH 3RWEA 4MLIA 4NWUL 3ZVVA 2HTLC 1H8OA 3V95A 4QT5A 4BWWA 3QXDB 4X6BB 3G6JF 4GW4A 2GBUA 3BLKA 4DEWA 1OGTA 4XO3A 3ZY7A 3AG1B 2A4CA 2WZ6A 2XPGA 3UTPD 1M3JA 3D3VB 4OLXH 3U9UA 5F0PB 3E8UH 5DHVB 3E7JA 4CRPA 5MEPB 2NY3B 4L1HA 3REVA 4Z76B 3C87A 4YHNA 1ADQH 4I0KA 3X1FA 1XXDC 3B43A 4AQ8A 2PR4H 2W9LA 5ESVB 1IC7L 2VR9A 1XQ4A 3D85D 4CA4A 4HOZA 1GGYA 4KKNA 3VI4A 1IILE 3VWJB 1CF8L 2AKRB 2WMPA 4OGAC 2ZUQB 5E9NA 2CLVB 4ENEC 1QUNB 3CFJB 1KXHA 1SHSA 4I9XA 4PJCF 4GXVL 2AC0A 4QHLA 4K8RC 1YY8A 4NHUA 2GUYA 4PP2B 4XMUA 1FFPB 3NZ8B 1NGPL 3ARGC 3RZCA 3WKML 3BZFB 5DJYA 3OHXC 4U1HA 4XPFL 4TLTA 3RVUC 5AZUA 3LZRA 3K5RA 4UANA 4PGJA 3MRMA 4JO5A 1SVCP 5KOMC 4F5CA 1FE8H 1FGNH 1NJ9B 3HN5A 4DP7X 1GZPB 3P9LA 2X09A 1MG3C 3LHPL 5C0CB 2BVQA 2PP8A 4X80L 4TTDC 3E2HB 1OGPA 1FH5H 4KJWC 2XNAB 4OR1A 2O5XH 1SYSB 2IQAB 3WV0A 2WLIA 3KR3L 5EN2B 4YHNB 5IEKA 5J12C 4P57B 4AEIL 1M53A 3IJSA 1Q9OA 2VJ0A 1NC2A 1E4XI 2UZXA 5GS0H 3U9UB 4YHPB 3VSVA 3ABGA 1MCRA 5GGQH 4ACTA 4HJ0C 1Y07A 2P1YA 5D6DC 5I6PA 3FT4B 1L9SA 4PJBA 2QADB 1WAEA 1G9MC 4UIKL 4W9GC 5IT2H 1TJHH 3K0WA 4H8VA 2A73B 4JFHE 3GLAA 1ZSHA 1JXKA 2GIYA 4I18A 4WVRA 5KBLA 1EHLH 4Q9QH 2OMZA 4E9WA 5JR1L 3BKYH 1HYSD 2B5IC 3M8OH 5HHPA 1CDUA 3T6QC 3FQNA 4CL7A 4QYOB 4QEGA 2D31B 4A7VA 4K94C 1P5VA 5IQMA 2BVPA 1L0PA 3VGAB 3L4UA 2G3ZA 1R0AL 1OAZL 4IBVA 1AO7E 2ZICA 1LO4H 3PL6D 2EICA 5LWYH 4Y1AE 3GXTA 1YPZF 1LP9E 3CQPA 1FNSL 3DOSA 2N1KA 4R5TA 5I19H 2XRAH 4LGRB 3CFTA 3T8VA 2I07A 2OCCB 4WWKB 1PEZA 1V05A 2D7TL 3O41B 1IBZA 1W6WA 2F9BT 1F4YL 3V0GA 4PMFA 3KVQA 2HLFD 4AG4H 3FCSA 2DLGA 4U1JB 3HNVL 2J1ZA 4HP5A 4LPWA 4EIUA 1RH8A 4K94L 4OQTL 3ZYZA 1JG9A 3TNMB 3VSQA 1PL3A 2GEEA 1RUPL 3FZUC 1K3IA 3HR5A 2OSYA 5DC0A 3GSNL 2BNRA 3VXTA 3BRGC 2KLTA 4Y2DD 2J8UB 4MKMA 1A1NA 3CU1A 3STLA 3EYUL 4AL8C 4ZTEA 4NLHA 2HT3D 4OUUA 3DGDA 4P23C 4PUBH 2IADA 3D2UB 4CSSA 5A3ID 1G7JA 1PZBA 4RZCB 5D93C 4JFOA 5JQHC 1SY6L 3BUQA 3U36A 4F9LA 1QTSA 1R9FA 3P9WB 2J1KA 3DVIA 1G7MA 2TRHA 3GRGA 4WNQB 4MYPA 3MV8B 5CD5C 2DM3A 2WBJD 2VR6A 2DPKA 3PWPB 2UVFA 1JERA 5GGRB 1JNHA 5C0ND 1G6RH 1KPVA 1ZXQA 4URKA 4YHOL 2YPVH 2G60L 4HKXB 4CN1A 1MNNA 4P2OD 3R8BB 5EF2A 1FDLL 1S9KC 5BJTA 4JANB 5ETUB 4B0MB 2ZUYA 1AS6A 4M3JA 1SYVB 2BXYA 4AT6B 1D5ZB 1BFOB 2EO7A 3GB7B 3IKCA 3N50A 3MJ7B 5T1LD 4PJ9A 3B7SA 4DEPC 1UATA 5DVPA 1WEJH 4MMXC 3ARGD 1ETZA 1GIGH 3IFLL 4IJ3C 3BT2L 4PRID 3EO9L 3VW3L 1Z9SA 5CHNB 2JIXD 1WRFA 4Z7WA 2PCFB 3C5JB 5DEGA 2CD0A 5GPRA 4HHWA 3GRWL 3CJJA 5KS9A 1OHQA 2P8PB 4KX9A 3TWYA 3UBGA 3L17A 3V7AG 4XO8A 3CN0A 4KRMB 4OJCA 4QRFA 3FN9A 4NAQA 4LHUG 5DZAA 3WNMA 4WUKL 5ECGA 3WGVB 1CC3A 2X7LB 2VABA 3ZTNH 1F3JB 4CW1B 4HPYH 3QQ3B 4D7PA 1GKEA 2NY4B 1HWWA 1MCDA 4JDZB 3EBIA 1VERA 3SE9L 1HL9A 3ESUF 4KROD 3G6AB 2BSED 1SHWA 2R1WA 2X28A 1VAHA 1OP5K 3VE0B 5IROC 2O30A 3F7LA