1W6WA

3d structure of cota incubated with sodium azide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
502
Chain Sequence
b'TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA02
2IDQA 1V54B 3DKHA 3ZIYA 1AG0A 2HX9A 4X4KA 1DYZA 3OM3B 2IDUA 3X1GA 2HX7A 5AKRA 1ZPUA 2TSAA 3FU7A 2IWFA 5I5MA 3QJQB 2UX7A 1W8EA 4E9WA 1CURA 1PNCA 4KNTA 1T5KA 1GY2A 3UAEA 3X2QB 2DY2A 4BWWA 1L9RA 2I7SA 4BWUA 2HXAA 4QKTA 4KNUA 2XV3A 2UXGA 1AIZA 3X1NA 2NRDA 2CCWA 3NJHA 5D4HA 1RZQA 2PP7A 2W88A 2UXFA 2VM3A 2FT6A 2ZWNA 1L9SA 1NIAA 5AFAA 3H56A 3S3DB 5I5IA 1ET7A 1AAJA 4AKOA 1DZ0A 5B7FA 1AZNA 3X1FA 1RKRA 2IDFA 3IE9A 4E9RA 4E9SA 1IKOP 1IBZA 1KDIA 5E9NA 1WA0X 2HRGA 2AZAA 4A2HA 1J5CA 4HZ1A 1HAWA 2VW4A 2GC7C 5I5JA 1MG3C 2EIKB 3WG7B 3FS9A 1GW0A 3UACA 3CVCA 4DP4X 4JHUA 3WNJA 3ABLB 1BQKA 4AKPA 1NINA 1ASPA 4F2FA 3FQ1A 1MZYA 1WS7A 4W1TA 2GBAA 3EHBB 2R7EA 1N68A 2Q9OA 3FYEB 3PPSA 4DP6X 3ASOB 3H4HA 3QPKA 2YXWA 1NIEA 1OCCB 2I7OA 3TA4D 1WAEA 1AZUA 2X88A 1SF5A 1BYPA 2XXFA 3RYMA 2UXTA 3TASA 1JZGA 3NSYA 2MRYA 3SQRA 3NJIA 1IUZA 1TEFA 3FQYA 2A3TA 4HCIA 2UX6A 4PAZA 1BQ5A 3S8FB 1PLAA 2FTAA 2AZUA 2DYRB 2BW5A 2YAPA 2IH9A 4BK5C 4AZUA 2DV6A 2HRHA 1ILSA 2QPEB 1MDAA 1KBVA 1TKWA 1UATA 1OV8A 2XV2A 2PCYA 1AG6A 1L9PA 3FYIB 1WA2X 5I6NA 1XMEB 4YSOA 4M3HA 1OE1A 3WKQA 2QDWA 3QJTB 1KYAA 2JXMA 2CAKA 3CDZA 3ABGA 3NJLA 4HHWA 3EF4A 1E67A 2DWTA 3OMNB 2FQFA 3WNIA 4P5RA 1CUOA 4E9VA 5I28A 5IY5B 3NJJA 1SHXA 3FSAA 5I6OA 3AG2B 5B3SB 1ET8A 2Q5BA 1OCOB 1NIDA 1KGYE 4EF3A 2YAMA 3FT0A 1JERA 2BW4A 3TBCA 1PY0A 1SF3A 1JXDA 3NSCA 5ANHA 1ID2A 4YL4A 5PAZA 3U25A 3CDZB 1SNRA 1GY1A 3GDCA 1ADWA 3QJVB 1AZCA 3QQXA 3G5WA 2XUWA 1SFDA 5LDUA 2OCCB 3PXLA 2J5WA 2YAOA 5B1AB 4YSAA 1NPJA 3FSZA 6PCYA 1AZRA 1XB6A 2MTAA 3TBBA 5PCYA 2EINB 1CYWA 2P80D 3N2JA 1JZEA 2JKWA 3NJKA 2PLTA 2VW6A 2B08A 2PP8A 1AS6A 1J9RA 1IBYA 4FA7B 3NJNA 3OQRA 1A4AA 2AANA 2VSMB 2HX8A 1SHWA 3AY2A 2PPFA 3GYRA 3D12B 2FT8A 3EH3B 5I6MA 1V55B 2FQDA 2XX1A 1N70A 2ZOOA 1OCRB 1NIFA 1BAWA 1FA4A 4WTQA 1KBWA 5FC9A 5B1BB 2IWEA 4HCFA 1WA1X 3NP4A 1GYCA 5D4IA 3IN2A 2BZ7A 1PLCA 1AR1B 5I6LA 4ZK8A 1EZLA 4YSPA 5A7EA 1SDDB 2IDSA 1PNDA 2CALA 2IDTA 1GS7A 2ZONA 3HEIB 4E9XA 1R1CA 4KOCA 2FWLB 4G7QB 1ZIBA 4YSEA 3PAUA 2ZXWB 1X9UA 3SBPA 2FQGA 3N55A 4KO6A 4NB7A 4YSUA 4GYBA 1NIBA 2AFNA 4YSTA 1L9TA 1FWXA 3MX0B 2H3XC 1ZIAA 2WO2B 2EILB 7PAZA 3NSDA 1XB8A 2DWSA 3EH4B 1PF3A 1YLBB 2XVBA 3X1EA 2GB2A 3NJFA 1GSKA 4CSPA 1HAUA 4N4YB 2CJ3A 1A3ZA 2VMJA 4AKQA 1GS6X 3QJRB 4HCGA 3DTUB 1E5YA 4AX3A 1J5DA 3MBWB 4F2EA 1AQ8A 1BXVA 2BZCA 2PPEA 2YARA 2H5UA 4NAJA 3T6VA 3FU9A 2XV0A 1SFHA 4P5SA 3WI9A 1BXUA 2GHZA 2OV0A 4YSQA 3NT0A 3ABMB 3AW5A 1M9WA 1ASOA 1A4BA 1TEGA 1B3IA 2P80A 3IBOA 2PPCA 4HAKA 3BQVA 2BO0A 3CZUB 1VLXA 4DP7X 1MG2C 2IAAC 2YAEA 4AI7A 4QLWA 1QHQA 3S8GB 1RCYA 2IWKA 3PAVA 1NWOA 1W6LA 1AZBA 3T71A 3FSVA 2PPAA 1OF0A 1PMYA 4E9YA 2DYSB 2Y69B 1E30A 4DPBX 4DP2X 3PLYA 2RACA 4A66A 2UXVA 2J55A 4ENZA 1ASQA 1PCSA 1CC3A 3V9CA 4BDVA 1OCZB 2X87A 1EHKB 2J56A 5B1JA 5F7BA 4DP1X 1WS8A 1E5ZA 4YSRA 1ZDSA 4CSZA 1KV7A 1ZV2A 3UADA 2BWIA 1JOIA 2XWZA 4N8UA 1FFTB 4UF7C 3EH5B 4G7RB 2XYBA 4UAHA 3S3CB 3UAAA 1L9QA 5F7AA 3DIVA 3AG4B 4HHGA 4GY4A 2CUAA 1NTDA 2XXGA 1J9SA 1ET5A 1F56A 2HLEB 4YVUA 5B1KA 2B3IA 3H4FA 1AANA 5EHFA 2I85A 1X9RA 3NJMA 4A2EA 1JVLA 2N0MA 4KO9A 1BYOA 3CVDA 4HIPA 4BDVB 2LLNA 1AS7A 1SDDA 1V10A 1OE3A 1GS8A 3OMAB 1W6WA 3ASNB 4M4RB 2IH8A 3NP3A 4A2FA 2BP0B 3PAZA 1NPNA 2EIMB 3KW8A 3ZBMA 1OE2A 1TU2A 4JHVA 4GP8B 5B7MA 4KO5A 2BP8A 4RH4A 9PCYA 3L45A 1NDTA 3SBQA 1PAZA 2YXVA 1BEXA 5I26A 3UGEA 1AS8A 1JXGA 3SBRA 1KCWA 2XLLA 4YVNA 3T9WA 3NJGA 2TSBA 3IEAA 4Q89A 4G7SB 4F7KA 5AZUA 2WO3B 2YAHA 3S3BB 1E65A 1ILUA 2BWDA 2PPDA 4A68A 4DP5X 3AG3B 6PAZA 2QT6A 4BXVA 4DP8X 3T6XA 3IN0A 1GR7A 3OD3A 2CBPA 1JXFA 1J9QA 4KOBA 1AOZA 3FU7B 2BP8B 3FQ2A 8PAZA 2GI0A 1QNIA 3QJUB 1JVOA 4A67A 2YAFA 4GXFA 4K9JA 1A8ZA 5TK4A 4DPAX 1PZAA 2OJ1A 3WKPA 4JKNA 2VM4A 1KDJA 4A2DA 4DP0X 2EIJB 3AZUA 1JZJA 2Y1AA 4L0PB 2GSMB 4WKXA 3TU6A 5I6KA 4UANA 1CYXA 2GIMA 1A65A 1AACA 3ABKB 5I6PA 3OMIB 1L9OA 1KCBA 2QPDB 4W9ZA 1PZCA 3T6WA 3FU8A 3FPYA 2QDVA 1NICA 5B1JC 7PCYA 2H47C 4NERA 4Q8BA 4E9TA 3CVBA 1IC0A 2YQBA 2VSKB 2W8CA 1SJMA 4A2GA 4FAAB 3KW7A 3C75A 1HFUA 2PP9A 1JZIA 2FNWA 3FSWA 3AG1B 2WSDA 3JT2A 4YSDA 4KNSA 1ETJA 1M56B 2BHFA 1RZPA 2FJSA 2VW7A 3CG8A 1PZBA 2R7EB 2AVFA 4TXVB 1I53A 1BQRA 5B7EA 4YSSA 3ERXA 3GXUB 3PCYA 3UABA 2HZHA 2XX0A 4G72B 4HALA 1XB3A 2YAQA 1ZDQA 1A4CA 4GP4B 1QLEB 4DPCX 2FT7A 1BXAA 3ZDWA 3QJSB 3NSFA 1J9TA 3BVDB 5D4JA 2JFCA 3T6ZA 2VN3A 2J57A 5TK2A 1PLBA 1OOWA 2BP0A 4YSCA 3JTBA 4GP5B 1URIA 2XU9A 4G71B 4MFHA 3X1BA 3FPXA 2E86A 3V9EA 4BWTA 4PCYA 3WIAA 3HB3B 3NYKA 1NWPA 2FQEA 1JZFA 4BXSV 2GC4C 1M57B 2PCFA 4E9QA 4G70B 4DP9X 1JZHA 1MZZA 4KO7A 1NZRA 3ZX1A
chains in the Genus database with same CATH superfamily
1L6XA 1T3FA 3I2CL 5DHEA 3ZHFA 3AROA 4AMXA 1S9VA 1XF3B 4U6XA 2PF6A 4ONHA 1BJMA 3VYNA 4XAKD 4FFYL 1AXTH 1YCSA 3QIUB 3LHPL 5CCHE 2RFXB 4BFGA 4YDJA 3FSOA 2N1TE 2OMUA 2YRLA 2W0FB 4IK6A 3F7RA 2FBJL 1UXMA 4BWUA 2OL3L 2BSTA 5FS5A 3G5XA 5IMLA 5DEFA 5AB9A 1DEEB 4F3FB 3VWJA 1OALA 3L4UA 2FLMA 2CCWA 3ARSA 3F12B 5AD0B 2P24A 2YD9A 1DQDL 1USQA 2ZXAA 1EEYB 4RWHA 2ZWNA 2F7IA 3VRIB 1WITA 2H6OA 1J9CT 1E4WL 2J1YA 2VDRB 4HWNA 4K7PH 4MYPA 3WKMH 2O6PA 1P84K 2VXSH 5DZPA 1E8XA 5GZNC 3RWFB 3QWRA 5EMYA 2UWEE 1BREA 2HRGA 4JM2F 2J21A 4ZMVA 2MNUA 4ZPVB 4N8VA 4J2XA 4MS8C 1NLDH 2AXGA 5D7IE 1MI5A 5I8OH 5JQHC 1NLBL 1UWXK 1JJUA 2YD8A 1S5HA 2X4SA 4LMQI 3N42B 1CXIA 4MD0B 3WNJA 5JW5A 4P2RE 2V9TA 2VXUL 5GGRB 1PDKA 3IJEA 2VZOA 5DDHB 1X5FA 4N0UE 3EHBB 4HU8A 4GW4B 2B1AH 4ONGH 1JHKH 4S0SD 2WXOA 2XHNA 2V8MA 3QWQB 2Y2TA 3QPKA 2APSA 3IU4H 2VUOA 5K9QI 1NAKH 4NQCD 3L3OB 1LE5A 4ELMA 3U4BH 3QDGB 3TH3T 5E6IB 2FR4A 2C8NA 4Z7NF 3VQ1C 1IUZA 5KVGE 4A39A 1ETB1 1HH9A 3A6BH 3BP6B 4LPWA 1AGBA 4YHLH 3HG1B 1KIQA 1H5BC 3H3PL 4KKCC 4WHTB 4BK5C 1EZVY 4MYWB 5FYKD 2YA0A 5C0AB 3FFCD 4AYSA 1EPFA 4H8UA 1DBAH 2BOBB 3LD8B 2OZ4H 3S36H 5BUAA 4U6HB 2ZX8A 4ZFOL 4OB5L 2JJTC 4F2MA 4F8OA 1NC2B 2R23A 4S2SB 1G7JA 2QSTA 5HDOA 2H1LM 1ZS2A 3Q5YA 4D0CB 1J1PL 4E36A 1GL4B 2DTMH 5BQDA 3U7WH 3KBHE 5F3HA 3D30A 1X5KA 2A99A 3PWPE 2QTVA 2AKRA 2HT4D 3HLAB 4GAGH 5AL0A 5ID0A 3BO8B 2FLBT 2HJLB 5IW1A 2ROYA 5AG8A 5IVNA 3DJRA 3NJJA 1JRHH 1JGDB 3TF4A 3QE5A 4I0KA 4FQXC 1TKWB 2VAAA 2Y5TB 5BJTB 1NMBL 2VDOH 5BS0B 1UM6L 4O9HH 2BVPB 3RVTC 3VX1A 4M7JL 4MB3A 4NQDE 1VZHA 3U9UB 5T3ZH 2WTRA 2MPVA 3IFOA 4OZ4A 3F05A 2CHNA 3KYOB 3CH1B 1FBIL 1XAUA 3RGVD 5T8IA 3Q13A 3KYKL 3QEUB 3MNVB 1E40A 2DLFL 3QUYB 4FD0A 4LPUA 5LGYA 4GSQA 5KTEH 4V33A 2QPFA 5LDUA 1R5IA 1T7WA 2DH3A 4GO8A 2HJKB 3C6EA 3VX0A 5IHUL 1QUNB 2EABA 3QW9A 5E7BA 2VDQB 4GSRA 3TBSB 1I8MA 5KVFH 3EYFA 4MLIA 4RA3A 1QSFB 4LRNH 2HT3D 3FOMA 2E5EA 2BVOA 2QFRA 3HNSH 3L95A 4KZDL 3O4LE 1AS6A 3LEXB 4MQXC 5CWSA 4KAQL 1IBYA 4ZUUA 5F7YC 1H8LA 3QUMH 3EYUL 1PKQA 3ZDYE 2NY2B 3VU1A 4PJXE 4NT6B 4ZX5A 3A67H 1SHWA 1BG1A 3HUJE 4BEIA 3LV3B 4XVJL 2OS7A 5GS3A 1N70A 2BJMH 2K6YA 3Q3GB 2A6DB 5CF3A 5E08L 1NKRA 4LHUB 4I88A 4RGOL 4WTQA 2YR3A 1UGKA 1TQCB 2ZWKA 2XWJB 2NT1A 1EDQA 3MSPA 2X05A 4BFIB 4BIKA 1E4XL 2NY5L 1TLKA 1EAPB 3DHMA 3GMRB 4FNUA 5B1BB 1E4KC 1R5WA 5J1AA 2PCPB 4OZHF 4UM9A 3IDXL 3QCVH 1A0QH 5C0CE 4CMHB 5BV7H 1SN5A 5I5RA 4Q2ZA 4WF7A 1NMAL 4W9GC 1PX4A 3DROA 2C9RA 3BRDA 4P99A 2AQRA 4FG4A 2DB8A 1F02I 4FXKA 4OCXH 3UG3A 1BZDA 1MN4A 2HH0H 2ROXA 4YPGB 5SWZA 1VA9A 1KTKE 1ZHLB 4OT1H 4W70A 4QHKJ 1ESOA 1XIWA 2ARJB 3O9WC 5EDXA 1GPOH 3QJHA 4MXQD 5CINH 1JPFB 4AYFA 2CKBB 2ZXGA 5KSBF 3T0EB 3MRKB 3QUZD 1QVOB 3NVQA 4PVBA 3DIFA 4G5ZL 3WEBA 2Y5QA 5L2KB 4MNHB 4KK8D 1SXNA 4S0HA 5FA3A 4PB0L 1DQML 2JMRA 4P07A 2VIRA 4FQPA 1G7PA 2ICWA 2VMJA 5CLWA 3HG5A 4LCWD 2GBUA 4NQTA 4G7VH 3TURA 4IHOB 1MFEH 4AYGA 3F5WB 1EXUA 5C86A 3DTUB 1UZ8B 2OMXB 3A4EA 1N2RA 1TR7A 2VNCA 1G0DA 1P5VA 3ZDZE 1BMZA 1BAFL 3BUDA 3N1PC 4HJIA 4U4BA 2GHZA 4X8JB 5INCB 2OMTA 3L9RA 1A7NL 4ADJA 3LHPH 4JUTA 1MPAL 5DRZB 1D5MA 2RA1A 1I85A 3BQVA 2RMNA 4TYUA 3PWJB 4RRPG 3SODB 5EG6C 2JQZA 4XN5A 3MRNA 3DDFA 4BYHA 4F7CA 5A40E 5JHDA 3IDJA 3TS8A 1IC7L 1YEFL 3WD5L 3KLHD 3SDXE 3QRFM 4LARL 1B0RB 1K8IA 1DQDH 1P0SE 3U2SA 2NY1D 1MCWW 4LDLB 3ESOA 1S9WB 2BVYA 4IMLB 4TSAH 1E4WH 1XGPA 2Q7NA 5DT1H 5E4EB 4AOFA 5J6SA 3P11L 1CXKA 3EJZC 2O6EA 4EOWH 1W72L 1GYWA 1JTPA 2WJ7A 5FW6A 4UTBL 3CAFA 4ZYKB 3MREA 1Y0LA 1IC5L 1NJ9A 1CMOA 4BUGA 4OJFL 2XFXB 1A3LL 1YUHB 1FN4A 4MNGA 1EHKB 3JQOB 1SVCP 5CJOL 2ZYIA 4DUVA 2VGLM 3M7OA 4M4RA 4KGLA 4TPRH 3U1SL 3CD4A 3IMVA 4FQHB 5EU6D 3V4PL 4AGPA 2DWEA 3ARFB 4TOYL 3HI5L 2PWFA 3VFNB 2VXUH 2Y7SA 2XYBA 4UAHA 4N90E 4PRID 5IVZA 2ILLA 4JO2L 1JDCA 4PBWD 4JFUA 2OQJB 2P5EE 2DJ4A 3FOLA 3KYNA 4UOZA 4G11A 3S4SB 4NGHL 2W81C 3L2MA 5CD5D 3F84A 4WRLA 2F54B 4PRPE 4UUJB 2C4FT 4M6OH 5TQ2L 3FF8A 3M88A 5I73C 2DIJA 4I2XE 3RX9A 1HCFX 3Q8FA 1Q94A 3ZQWA 4JFWA 1DJXA 2BP0B 4R2GB 3HFFA 4PJFB 2F53A 3KW8A 3ZBMA 4ODSH 2FECI 3BXNB 3TLRA 1AO7E 3H3PH 4JHVA 5DJ8A 4KO5A 1A9EB 5I1DB 5T1LA 3WMQA 3DVFA 4KPHL 5HHVL 3T5WA 3NBNA 4ZFFA 3LHAA 4OFPA 1MY5A 5D1XB 5FYJE 2YXVA 3NDZE 4P05A 4UOW0 4Y5YB 1YNKH 2CLRA 4OB5H 1A22B 2CE6A 2DM3A 2F7QA 2AJYL 1EFXD 1I9EA 1G7HB 2X9XA 2AGJL 2EEFA 3QHZL 4OKDA 3CZNA 3DJTA 4YNYB 1J88A 5CJXA 3MO1B 4N2OA 5D7KD 5FGBC 2X4NB 2KPWA 3INUL 1F58H 2NXYD 1T20B 2MH4A 3B34A 3Q8EA 1ILUA 4IDJL 1EBAA 4UU9A 1BQSA 3UZVA 1T2XA 3G5ZA 5MEOA 3RUGE 5C0GA 4KOBA 2B5IB 4QJ3B 2WLIA 1QNIA 4ICXA 1UB5B 2AVGA 5HHOE 4NC2B 3PJNA 1U6AL 1XGUA 3LRGA 1M7IA 3DA0A 3GSQA 5EU3A 1DFBL 1I1AD 1MCDA 1PSKL 4WI2A 1DBKL 3QIWD 1KDJA 1NUNB 2KS0A 5DFAA 2QZQA 5DVLA 5D7LE 1ES0B 3AM8A 3ZZ1A 1UACH 3MZTA 4L4VE 2YWYA 4WKXA 1T6WA 2ZCZA 3KYKH 4UANA 4IW4C 1GCFA 5BRZD 4NUPA 1T4KB 2RALA 3MRCB 3ABKB 4EI0A 5KOMC 3GMMB 3SDAC 1TPXB 2YBGA 1HN1A 1LQBC 3KWVA 5CD3B 3FU8A 3D4YA 4JE0A 1NICA 4LSRL 3SD5A 1BPLB 1EJFA 3DVNA 4Z7UF 2YD5A 3G08A 1T04B 2DYPB 2PWEA 1S9YB 4KAQH 2OTWA 4G8GA 3ESPA 4H25A 1EO5A 3EYUH 1QMUA 3AG1B 4MX7B 4ZFZB 5DI8A 3FCTA 4P04A 4YPJA 1M56B 3VFOB 3WS6A 1FE8L 4X0KB 3VFSA 2V8LA 2XY1A 1PG7H 3KMDA 1PZBA 3S3PA 1E3FA 1Z9SA 3Q8BA 4TXVB 5TE7L 4ZNEE 1AR1C 1I4FA 3HZVB 4OLWL 4V1DE 4AV4A 2V3DA 2I26N 5TPWL 4RGOH 4DGIL 1C8QA 3LQMA 2YAQA 3GPEA 3CXHJ 3PUCA 3TA3D 4RZKA 4FC3E 2J73A 1BXAA 4FTVA 5DUBB 3WJJA 2AJSL 4U2YA 1NH6A 5IB1A 3HPLA 1NMAH 2WP3T 1MCCA 1K4CB 5B8CB 3DETD 5DMGD 5EOCJ 2QHLA 4GQRA 1HQRB 1EXGA 3JTBA 3MGOA 1IAIL 4LLWB 1H3GA 2J5LB 3WIFA 4U05A 3C60B 4XN9A 3V9EA 3FB7B 4QNPF 4ZZKA 2LFGA 1LEGB 1WGVA 1OWRM 5KUKA 2BSRA 5TQ0L 2DEXX 4XN1A 4PGEA 3B9KC 4AG4L 1M57B 5GJTH 4ODWB 4G5ZH 4XO4A 5TE6H 1JZHA 3MRRB 2LVCA 1Z7JA 5IF0A 1WBZA 2BOCB 1DQMH 4PB0H 4Y8AA 2O72A 4WWPA 3W11D 1E2VA 3H9SB 3NCYS 3DOHA 3HNVL 3UO1L 3FB8A 1IX2A 1H8OA 3D25A 2H2PD 1YN7B 3SDDA 2Y9RT 3U30C 1XF5B 3QFJE 1BAFH 2B20A 2J8HA 4BWWA 4IRSA 1NKGA 5MEND 4BA8A 5I17A 1ADQA 5DO2C 1OGTA 2C4FU 1IIKA 4QJ4B 1A7NH 1ZLEA 1F18A 1TZ8A 2UXGA 2NRDA 5TDPA 4OCLC 4RQQB 4UQ9A 3EOBA 1MPAH 5D7JA 4XCYA 4Y9EA 3KJ4C 3HC0B 3BAEL 1NIAA 5AUMA 1TETL 1MQKH 3SDCC 4PD4J 1IC7H 1YEFH 4IS6A 5A2FA 4LARH 4H8WL 3TCLA 1A25A 2VUKA 3LAFA 3UJIH 4HHAB 3DYOA 2NOYA 4XZ4A 1V7MH 1TO4A 2DQUL 3HI1B 4ZUSB 1KXQE 3E8UL 3P11H 1HAWA 4O02H 1W72H 2AQNA 3ECWA 1VFBB 4UTBH 1IC5H 5GS2D 4OJFH 4J3OH 4TL5A 4UAOC 3UJTH 5EH1A 2XKNB 1A3LH 2WUCL 4TQEL 3ABLB 4DQAA 4NNXB 1AC0A 1NINA 1VENA 4OBSA 4BSWB 5EEWA 4QOKE 2JIXA 3U1SH 4E41B 1WT5A 4H88L 5GRVL 5IJDC 3OXRA 2Q9OA 2VL5B 3V4PH 1UCTA 2YJLA 3DV4B 4TOYH 1CVSC 1U8JB 1XFPA 1WAEA 4PFEA 3E3QC 3HHSA 3OPZL 4Z3IA 4JO2H 4HKBA 3ZMRA 3ROLA 4MGXA 1W0VA 3V4UH 1JHTA 2UX6A 1K3IA 3UCRA 4PG2A 2LQRA 3M17B 1RULL 2YPKA 3FH5A 3OKKB 1WBXA 5TQ2H 2DV6A 4L8DA 5LNDA 2HAZA 1MIEH 3CVHL 3KS0H 1X5HA 4CVUA 1FZJA 1G9ML 4U1KA 5IUCA 4WFHD 1BFOB 3FYIB 4OVUA 1A4JB 3CFKA 4LPTA 4N8VG 3WY3A 3ZYOA 4RNRA 2VKWA 4ONOA 4YDVB 5B21A 5HHVH 3IAQA 1BCIA 4K73A 2XQBL 4M3HA 2GJ6B 3BJ91 2WINA 4NHUA 4K8RL 3V6OC 3MRJB 4W4OA 3QHZH 3CH8A 3FCSA 4J4PD 4P46B 4MCYA 4BFOA 4FNTA 5HHMD 2CLVB 1M3IA 3PGCA 1HL8A 3ZYZA 4IDJH 2GI7A 2VE6B 1CK0H 2G60H 2EYSB 3OKOA 2DZEA 2FIKA 2NZ1A 4DCQA 4Y5VB 1BFVL 3HZKB 1XF3A 4CU8A 4MJ6B 1Z5YD 4HETA 5EWIH 3GQFA 3QI9A 2YAMA 1OSPL 2RFXA 2WQWA 3KGTA 4MAZA 4P23B 2W0FA 2HFFA 4GKNB 1A7PH 4TQIA 3GDCA 3VXUB 4CJ0A 5T1DH 3PXJA 1PSKH 4PWKA 1DBKH 1DEEA 2OCCB 4H8HA 3W56A 3K2UL 4HBQA 1L9MA 1MCPL 5AD0A 2FHCA 3W5MA 2VDRL 1MJ7L 2MTAA 5JQ6L 1E0OB 5EA0L 5HI4D 3UEZA 4JM2B 2EZ0D 1KXVC 5AALA 2VW6A 4KMTH 2RGSA 1I9IL 1KBKA 1F8TH 1O9WA 2BNRE 1U8IB 3RWFA 1KFAL 4GQ9L 4JL2A 4MZ2A 4YHOL 3VXTB 4ZPVA 1KJ2A 4ZSOE 3IK2A 4ZTEA 1X5AA 1CFQA 2EE3A 5EZPA 1P9MC 3WTTA 5AEAA 4V11A 4NKOB 3TZVC 1MOEA 2SEBB 1OAXL 4JN2B 4MD0A 4I7ZC 4HKZA 2BFVH 4WFED 4ANVA 3QNZB 3DSFL 1E28A 1FE8H 3UTSE 5FC9A 4Z7NB 1CFBA 1MCJA 2P5WD 3GK8H 3TJPA 1IARB 4N3TA 4P2OD 5TE7H 3NRQA 1JPST 4PJGF 4J27A 4OLWH 3TJEL 3MLYL 4QTFA 5TPWH 4DGIH 1QASA 5I6LA 2B0SL 3P0YL 4JCMA 1U8MA 3N43F 4CSTA 4PWFA 3BP6A 4NHCH 2XG5B 4OZGE 1ZT7B 3ZKND 4QF1B 2VN7A 1IM9A 3GFUA 5E2TL 3X17A 5GGTL 1F90H 5C0AA 2BOBA 4WV1C 1CI3M 3UAJA 3VFRA 5DGRA 4RGMB 5DZAA 4XVTL 1IAIH 2MCG1 1DN2A 1L9TA 2D3JA 4JZJB 4A38A 2ZSWB 3H42H 2QHRH 1ZVHA 2H3XC 4P9HC 1UYWL 3PXHA 4ZXBA 1KUMA 2F5AL 4PJIF 1KEGL 3EH4B 3EDJA 2KZ1B 5M7QA 1RIVH 1U8LA 4FQ2H 3CDYA 4M1GL 2XA3A 4IBVA 3BO8A 1JI2A 4OCRH 3EJRA 4HV8B 2QEJA 1HEZA 2Y5TA 3ULVE 1J5DA 5BJTA 1QUPA 4NC0B 3SQBB 2XV0A 1SFHA 4GUOA 2BVPA 1KPVB 4YK4B 3WI9A 4G82A 3BIKA 3W0WB 3U9UA 4LDCA 3VTMA 4M62H 5A3ID 1ZSDB 2E8YA 3C9NB 1M9WA 3CH1A 3QUYA 4G6KH 2P80A 3MNVA 1QG3A 4HULB 1RH8A 3LPOA 3DX0A 4D9QE 3MV8E 2P47B 3L7EB 3SPJA 3UYPA 3WIIH 2VDQL 1MI5E 5I1LA 3QGVA 5FA4A 1A7QL 3PQYD 2DKSA 4S1DD 4JR9H 1R4XA 1CDBA 1SUHA 2EECA 1QSFA 2A5UA 3BAEH 1TETH 4YMPA 3T71A 2ZKXA 4IRJD 4AIOA 4CKQA 4PR5B 5I1IH 5J89A 2EH8L 4WENB 4MMZB 4XVUD 5EULV 3LEXA 3GMOB 4H8WH 3O41B 1R75A 1V8HA 4A66A 1RUKL 5KJRL 2N7SA 2XC8A 4ELME 5KEZA 2DQUH 3E8UH 2J56A 1YAIA 3R8BB 5MEQB 1WS8A 3ARYA 1KOAA 1X7QB 4RBPK 3E38A 3HC4H 2XBTA 1KV7A 5C3LD 5B38G 4TVSa 4JQVC 1GHFL 2A74B 4OZHB 2WUCH 5J9PB 1F00I 2BFGA 1U92B 4LHUA 4Y19D 2YUWA 2JCWA 4YFDB 4B0MB 5GRUL 1NTDA 2HKHL 3GMRA 4BFIA 4P4RA 4DETA 4HIJB 3V8OA 1BW8A 5DJDB 4U1NB 4N87A 2PCPA 1B9ZA 3UOAB 1ZXQA 4F2ME 1OOAA 4PUBL 3NFPB 3R7RA 2HB0A 2MWCA 4WO0A 5DJCB 1S78D 3DX6B 4TNVF 3OMAB 3D0VB 3O6FD 3FUNA 4JPIB 4X8XA 2UZYB 1FO0B 1FFOB 2FX9L 2HT4C 1JFQL 3HPJA 4LP8A 5KSBB 3KZ8A 3DXAD 4YHPB 2MCAA 4YPGA 2CHDA 4IMKC 3BPOC 2R2CA 2CKBL 3IDIB 3P4OB 5C0RL 4YAQB 1QBMH 3BGMB 1MJ8L 4M7LL 1JD7A 2QPUA 1REIA 1OTSC 5KYNA 2V5YA 2ZNWA 3T0EA 5GGQL 4UQ2A 1NCWL 1QVOA 4OGXL 2WSKA 3KPQA 3DO3A 3T0DA 1P53A 3AB0B 5E2UL 1E3ZA 3NJGA 4XXWC 4JQXA 4FOMA 5E9DD 2EE9A 1MWAL 3MLRL 5AZUA 2XQBH 2Z3FA 3RGVC 4X99B 2YUZA 3S3BB 2LU4A 4EMZA 1IEBB 3SE9H 5C08B 4K8RH 5E51A 6PAZA 2K4WA 5D71L 3TX4A 4DO6A 3GLZA 5EORH 2X1PA 5IFJB 3F5WA 4K55A 1TU2B 1AOZA 3D4CA 1UZ8A 5CEYA 2OMXA 5F7EL 3FO0L 1CIDA 4J12A 1WZLA 2XJKA 3QUXD 2HT3C 4GXFA 5AVQB 4AQ8A 4UV7L 4PY8I 4WTZG 5FECB 1BFVH 5INCA 2GIYA 2WLYA 5T3XL 3WTWA 1B0GA 3N91A 4PGBB 5DRZA 2GSMB 4P3WA 1QI5A 2FAUA 4XXCC 5D6CB 1F97A 4BSVB 2F8OA 1DUZA 1PKQE 5H35B 2P7TB 4JRXD 1IGFL 1WAAA 5B39B 3HN8A 3CSPA 4KTYA 3S48A 1MCPH 3BT2L 1VDGA 5JPNA 2L0DA 1B0RA 2QSCH 1XD1A 3SYPA 2VOTA 3KLDA 2B39A 3B43A 4F8QA 1XL6A 5JQ6H 2B77A 4IMLA 1EAJA 12E8H 1IZKA 1QYGL 1AQDB 3QT2A 3QEGL 4HEPA 4BELD 3OL2A 5KVGH 2FEEL 1FNEB 4NYLA 4ZYKA 1WFMA 4CW1B 4Q9QL 5SWSD 1KFAH 5F93C 1CDHA 3TT3H 2XFXA 3MOQA 1YUHA 1P6AB 2F68X 2YUXA 4FG2A 4WUUB 3U7YL 5DHVH 2VLRD 2OR8A 4HGWB 4K94L 4RIRA 4ZDHA 1NCCL 3BH4A 4K15A 2ZXBA 4MAYB 5SWZE 4MXQC 5LLIC 3HR6A 4DOHE 4FN0A 4X98B 1BOYA 2R56L 3MLTB 2FEJA 3QUZC 2ADGB 5E1IA 1TQBC 4YC2C 1WDAA 4BFJA 5IW3A 2ED9A 3S4SA 3NZ8A 2VXQL 3MLYH 1N12A 2KZWA 1ODAA 2F54A 2FLRT 3LNIA 4JX0A 4KI5D 3BVDB 4KK8C 4P5KB 4PJ9B 3P0YH 4WW2C 3T6ZA 4JZOA 4Y1AB 4CN6A 5E8OB 2K7PA 1NFDF 5TK2A 2BP0A 3DJSA 4X6DF 2E9JA 2ZAIA 3JUZA 4PJFA 1ZLDA 3FPXA 4KJWD 4UQEA 1EHXA 3HHMA 3LKOB 1U8QB 4NOFA 5D1XA 1G9NC 4Y5YA 2EDDA 4XVTH 5DQ9B 3L1GA 1WC7B 1U3HA 3VD7A 4YNYA 3CXFA 2GC4C 3MO1A 4E9QA 4MD4B 2P43B 4PI2A 1UYWH 3LMJL 1MZZA 2WQAA 4MZIA 1LEKA 3VFTB 5IR1B 5ACMA 1T20A 2AS5M 4RMVA 2R4RL 3ARVA 3PDGA 5GS0D 4B9JA 4HDIA 2VQTA 2VDKL 3HG4A 4M1GH 5JHDE 3F7VA 4P48A 4ATWA 2HX7A 2BHZA 5EN2B 1FVDB 2WKOA 1OAQL 4GSDL 1UB5A 2NY1C 4Q58C 3VG9B 4JM0A 1DBML 3HKZA 4TM9A 1Q9LB 1JPGB 4QI3A 5BZWB 4ZUWA 4TQ8A 3X2QB 2HVBA 5KG9B 2J88L 4W6WB 4PJCA 3AFLA 1NCJA 5FGCB 4APQD 3L4YA 4GRLB 2PCFB 4CSSA 4OD1H 1ES0A 1Q1JL 4X9HA 3L7FB 1G43A 2ESVD 3NCWA 4ZUTB 4PG9B 4LO9A 1DE4B 4WSGA 2FO4A 4PCKA 1U8KB 3DI2B 4WVRA 4UDTB 2VDQH 1LE9A 3QFGA 5D2NC 3BKCL 4HJUA 3GMMA 4Z7UB 4F20A 1QSEB 5CD3A 2LAAA 5IESH 3E6HB 3L3GB 4MA7L 4G9FA 3GIZL 4LCVA 3P4MA 4FQXB 3FTVA 2EH8H 3A6CH 1HESA 2IFFL 4J8QA 2BDNH 3PF2A 1S9YA 5KJRH 1RUKH 5CD5C 1HNGA 2IOOA 2YQ2A 2R1WA 4JL1A 4ZFZA 2DS4A 1GC1C 3SPIA 4I77L 3FQUA 1A6ZA 5KSVA 4JG9A 3BLBA 4Q9CA 3FYEB 5E56A 2C9VA 5ENWA 4L29B 2ZUXA 3GLDA 3RZCD 4R7XA 3MN8A 1YNTF 4L2YA 5SV4A 3ZKMD 5GRUH 2HKHH 4AYDC 3VI4A 2IALB 1CU4L 4PSPA 4PUBH 5DUBA 1FC1A 2OMWB 4QAWA 5FUCC 1LK2A 2NXYC 4DGUA 1QA9A 3LIZH 5F1IB 3GBML 5T5FL 3GKWL 1K4CA 4LOFA 1VSCA 1T7YA 1NEUA 3NTCL 1HQRA 1HJBC 2FX9H 1JZ8A 1JFQH 2DQTH 3BPCB 1B0WA 2ARWA 4S1RL 1UATA 4FQ1H 4BQCA 1WWCA 3D4GA 3F8UB 4JJOA 2R69A 3C60A 4XWGL 1N6QL 3AQZA 4ODUA 5C0RH 1MJ8H 1LEGA 4M7LH 4MHHI 4WO4B 4B60A 5DO8A 5I1AB 3AREA 1NFKA 3VFUB 1YYLH 5DRXB 1I1AC 3L4TA 1NCWH 1J8HB 1EHLL 1MVUB 4OGXH 4QHPA 4UWQB 3T0AA 5EC2A 5IJKC 3VXQB 3QIWC 4ODWA 1WFUA 1G7QB 4X9GA 2WXHA 1MWAH 5ABAA 2FQFA 1GKOA 2YPLD 5HYJD 2VQ4A 5JXED 1RAMA 2WYIA 3DX8B 4WW1B 4MDRA 4DSYA 4HJSA 5C2BL 2AW2A 1AQKL 5B3SB 1ET8A 1QR1B 2J1WA 3H9SA 1CF8L 1GIGH 5FO7B 3BZDA 1EZVX 5DK0A 5JNYB 2TRYA 5F7EH 1YN7A 1DTUA 3FO0H 3FF7A 4U49A 3QDAA 3BH9B 4DK5A 3ZOAA 2BVTA 5IEHB 2XVLA 3NSCA 1A6UL 3G04B 4UV7H 5JO5B 3ZHLA 5K5YA 4RBPH 1XBRA 1TTUA 5FYLE 4A55A 2OFQA 1FHNA 1GOHA 1J7VR 3EXLA 3HC0A 2PYED 2X89D 2HUHA 1YA5A 5PCYA 2P3YA 1IGFH 2O5YL 3BT2H 3JVGA 2DBLH 4NENA 2EDHA 1QLFB 1IVTA 3NN8B 1Z5LA 3V0WH 4HHAA 5ETUB 3V79C 5J8OA 1J9RA 2WYTA 3PDDA 4OCMC 1HYSD 3DC0A 3QEGH 4OLUL 4YDLB 5IBUB 1OQXA 5LG1A 4LVNC 3TA3C 4M8QB 1JWMB 2AANA 4Q9QH 1H3XA 5I71B 3QQ4B 5C0BB 4EAEA 2EXTA 3CN4A 3K72B 4FTVE 3Q5TA 4CUCA 3DJZA 3KCPB 2NDGA 3U7YH 3JBG7 4RDQG 2ZUTA 1HILA 3C8KB 1NBZB 3CV5A 4J3TA 4BSWA 3DETC 4MJJA 5DMGC 3WFDH 5CP7A 5GZOA 4E41A 1YJDC 2AV1B 1XZ0B 4X5RA 4H26A 4N2HA 3TH4T 4BKTC 1ORQA 1NCCH 2OMVA 4EIBA 3DV4A 5K1VA 4GJTB 3CHXA 4WWKA 1RZKC 2B2XL 3Q6GL 3MCG1 5CZVL 1N59A 2Q8AL 1RHFA 2R56H 4KRNA 3N1MC 4TF4A 5HYIA 2N7BA 2ZONA 1G9HA 4IU3B 3I02B 4XBPB 4WEMB 2VXQH 4XNZC 4FI7A 2AQSA 3OKKA 1OZTG 2IH3B 3K8LA 4RAVB 2QQKH 2ZXWB 1E5CA 2JB6A 4GAAA 1I1FB 1CDYA 4GH7B 5IMMB 3OKEB 4C56B 3LKNA 4ES8A 3W11C 4Z3GA 2AFNA 1BFOA 1KTDB 1XGTB 3OKLB 1A4JA 1FWXA 4Y5XB 2Q10A 1THCA 2H2PC 4YDVA 4TNWK 3T2OA 4JVPA 4MCZB 4LU5L 2DWSA 4YHYC 2R2BB 1MNNA 2P8LA 1X6LA 4GRWF 2CO2A 1G6RA 3I6SA 4P46A 4AGMA 4KVNH 1KACB 4XMTA 4LKCA 4JGUA 3LMJH 4L1TA 1T6VN 5GS1C 5FIEA 2VE6A 3QK0A 4KTDL 2EYSA 4B9CA 5I73B 2V2WA 4AQAB 4LCYB 2VDKH 1I8LC 3LRKA 4J2QA 4D0DA 5FWQA 3FW6A 4M8RA 2N4IA 3FT3B 5MEPB 3ILQD 1J0JA 2G5BB 2WJ5A 5L9DL 5F9DC 1OAQH 1X5IA 4JHZA 3IRZA 2YA1A 3ABMB 5ISZB 1KCLA 4E5XA 5I0YA 1FLRH 1O7DE 5IM7B 1ASOA 3T65B 2YKKA 3VXUA 4RISL 4XNYL 3UPCA 3G6JF 4XOAA 4G43A 4X6BA 1QRND 1TFHA 2Y07L 3BLKA 3FK3A 4PBVC 1MG2C 1Q1JH 1P7QD 3BHBA 4OIIL 2IAAC 3JV4A 1ZE3C 1QHQA 4AIZB 2P9RA 4IKKA 2Q3AA 2NLJB 4OFYA 1NANI 3BGFC 3DX7B 4UNUA 3U0WL 4HIHB 2DDQL 3MRHA 3TO4D 5ITBL 3CN2A 3BKCH 1BXXA 1GA2A 1LJMA 1LP9F 2H32H 2H3KA 3P3RA 4OGQC 1U8IA 2YOAA 3TVMD 5CCJA 4PP1D 4FULA 4DPBX 4X4YB 1MHPL 2DM7A 3GB7B 3HC3L 5HP5A 4Z76A 1ZGLB 1KCKA 4JFYB 4MA7H 4JN1L 4I1NB 5EEYA 4ZO9A 1EGJL 1CZ8L 2VWEC 5FUOL 2W9EL 1LWJA 2IFFH 2G2NA 4B5EA 4CAGA 5DZ9A 4OV6F 2RHEA 1E5ZA 3KNBB 4OSUL 5D72L 3HBPA 2WD0A 4YSRA 1R9FA 1EO8H 1HOCA 2SEBA 5F7DB 1FGNL 4CSZA 4WU7A 4HUKB 4N8UA 4PJGB 4GFTB 3RTQB 3F58H 5HDBE 3R0MA 2C26A 4I77H 1INDL 2J2ZB 2EKSB 4HHGA 2ZF8A 4EIGB 2CUAA 3W82A 3QO0B 1ET5A 3N43B 4YVUA 2KH2B 3B4NA 3SDAB 3NJMA 3VYPA 3GRGA 1MQ8A 1SMDA 2V0AA 2A6JB 4KKBD 4MDJB 4O58L 5FAAA 3WHXB 4PSRA 2W59A 4D2NA 3RIFF 1CICD 2DI7A 1AP2B 4N26A 3RLSA 1T1ZB 5ESAB 3K6IA 4CC0A 2XG5A 1XVSA 1CU4H 2XA8H 4J4PC 4QF1A 1PTZA 15C8L 2KT6A 3OKMB 1J18A 2Z35B 4M9OA 4NRYA 5AW0B 2BIQA 1RPUA 1CDUA 2EP6A 3ZTDC 4Y9CA 5T5FH 9PCYA 3GKWH 1GZQA 1QI3A 2AJ3B 1KXTA 4R96B 3BSZH 4PJIB 3W9DB 4JRYD 4U7MA 2ZSWA 1N6QH 1AS8A 3UZEA 1JXGA 4XWGH 2WZ0A 1ONQB 5CBAB 3T9WA 2J7LA 3Q01A 1IKNC 1NC4B 4GB9A 4F58L 1WZ1L 3QXTA 1JVKA 3QP3A 5I8CB 3A24A 3EH1A 2BWDA 1QAWA 1EHLH 3WTSA 1BSIA 3FMGL 4J6RL 4Y2OA 3SCMD 5E2WL 3T6XA 5KVMC 3JWOC 3GF8A 4XMWA 1YMMD 2CO3A 3FU7B 4J3OD 3EOAA 4X5WB 1DJIA 2IGLA 5HI4C 4AH2B 2EZ0C 5AW8B 1BQHB 3SQBA 1KGJA 1O5PA 3CSTA 3EO9L 5C2BH 4K9JA 1KPVA 3RNKB 3W0WA 1RUQL 2IDCA 1J1OH 1KB9K 2VM4A 4AEEA 4EKXA 1ZSDA 2NQCA 3QZWB 2CR0A 2X4TB 2XKSA 1A6UH 1I1YB 1ZS8B 5KUMA 1OD9A 1TT6A 2GIMA 1ZA6B 3O2DA 1EBPA 4K9EL 5AW9B 3L7EA 4OLYL 2X7LB 4M93C 1C5DB 3B9KB 3F6LA 1F3DJ 2V3FA 3IJ7A 5EN3A 3HI6H 3T6WA 3B3IA 2W0LA 4FQLH 4PR5A 3E1F1 2XPYA 1KELL 2DWYA 1MELA 1TQUA 2Z31A 4MMZA 4P2OC 4Z7QE 2ZWSA 4NP9A 3NCCB 3T3PE 2EKJA 5FXCH 2CO7A 3NCEB 3KPOA 1I8KA 3ZE2F 3DPDA 3QDGE 3WXWL 1JZIA 4Y4HB 2JSFA 3U30B 1KLUB 1T2JA 3P30H 4QRPA 5DD3L 3SDYH 1RURL 3N50A 4W6YB 5CZRA 5MEQA 4KDTC 1Q9OA 2FJSA 3GSWB 4OQTL 3ZKNC 5E94A 1DLHA 2NNFA 4OZHA 5BVJB 5J9PA 2ZXDA 1U92A 4QXUH 2VT0A 3DX3A 3KLAB 2A1WL 2CRMA 3GXUB 5DJZA 5C0AE 3ZSSA 4QTHB 1W15A 2CUIA 2XBZA 3SDCB 1E9OA 2JCCB 4QAMB 3DOSA 3FO2B 3MMEA 3TNMA 3FT1A 2B2XH 1QLEB 3NFPA 3MBXL 4I0CC 1MCNA 1P4BH 2VZTA 2JQAA 5FEBA 5CZVH 1FO0L 2D03L 3NSFA 3DX6A 2DQHL 3D0VA 3FCBA 4HT1L 4JPIA 1OO2A 3MJ9H 4WI4A 1JZ3A 2UZYA 4HUUA 5CJ5A 2P44B 1YEKL 1FFOA 4UYQA 2CA3A 2P8PB 5KSBA 5E4OA 1OPGH 2N56A 2YRZA 1LDPH 2XZCL 3K5SA 4HEPG 4YDIL 5KAQG 1YQVH 5EOCL 1IFHH 3QULB 2IMMA 1FC2D 1T6BX 2V17H 2LU7A 2ATPB 1LO4H 3VQ2C 1TJHH 5E6YA 2CDGA 2BZDA 3N40P 1JGEB 3ZRFC 2Y36L 1NA8A 4TVPE 3K71A 1FGVL 2H0EA 5E70A 1N64L 5A3IC 3LKPB 2FE0A 4NP4L 1HWGB 3DRQA 4LU5H 2MQGA 5C08A 3WJLA 2F7RA 1KY6A 1JDDA 1R5VB 3HE6D 4AEIL 5IFAL 3LX9A 1BZOA 3MNMA 5IFJA 3X1GA 4OD2A 2F1BA 4S1DC 1NDGB 1QEXA 5GRYA 2EE2A 5LAXB 2D7PA 2WGXA 5E6SB 1DBBH 4KTDH 5HYQB 4K07A 4E9WA 1N67A 1PNCA 2VLJD 4KNTA 5GRWA 1QSFE 4IRJC 3EOTL 5C3IA 4BGDA 3H7BA 5FECA 1CE6A 2Z91B 2JV6A 4NLHA 5I74C 3U6RB 4XVUC 4JFFD 2UV3A 5E9AA 2ODHA 3BEWA 4TL4A 2APVA 4QKTA 3WN5B 2KDYA 3WGUB 5IFHH 5EIIB 5D6CA 4BSVA 3TC9A 4HS6A 1FV1B 5H35A 5E00B 2P7TA 2CA4A 1ZJAA 1AYRA 1BVKB 4RISH 4GXUM 2P49B 4IRZA 5DJ6A 2WZ6A 2OI9B 1HHIB 4AC2A 1NCDL 4FNRA 4OIIH 4PIBA 1A7RH 1B9KA 5AKTA 5J1TC 2OW7A 1KXHA 4UZGA 5E5MA 1OW0C 3QZPA 1RUPL 3U0WH 1AQDA 3LZFL 5D7SL 4KGJA 4AW4A 1YNLH 4CVZA 4A2HA 3MZGB 1KTBA 4DGYL 4OLEA 3CFJA 2MMXA 1MHPH 2IQ9L 1RMFL 3MV7D 1CL7I 4L4TA 4N0RA 4JN1H 2BNQD 4XC1H 5H4ZA 1S78C 4EKJA 5LDSA 1EGJH 3O6FC 1SXAA 1CZ8H 5FUOH 2X9YA 3MRPB 3DV6B 1OSYA 4GO9A 5D72H 4OSUH 4F2FA 5L7XL 1T21B 1CXFA 3GMLA 1FGNH 1ULVA 4M7KL 4MAYA 3K8KA 4MSWB 2I7OA 4M5ZH 1A21A 1INDH 1DL7L 4Y2NA 3MLTA 3T0EE 2VR4A 3P3YA 1NFDB 1S9XA 5KN5B 4FZ8L 4F7PB 4LLAA 3MLXH 3TH2T 4KXBA 5K9QG 4X6DB 2RTTA 5HPMB 2Q3XA 4QD2E 4P5KA 4PJ9A 2OYPA 3EGSB 2CH8A 2YAPA 3CUPA 3LEYH 3N0PB 5E8OA 4KX9A 3D8MA 4EDXB 1KBVA 3ULVH 15C8H 3TZVB 2XV2A 4Y9BA 3OTTA 4D7PA 3LKOA 3QUXC 1H19A 2OP4L 43CAB 1R3JB 5BMFH 2BY3A 2FBOJ 2G9HB 4TQPA 3RB5A 5K9OB 5DQ9A 2BIHA 1WC7A 2AF2A 4JFXA 5DR5L 2AEOA 5LB1A 4NN6B 1YUKB 3CDZA 4GO6B 2JKIS 2VQ1A 2Z92B 4C47A 3WEAA 1QR4A 4HU2A 1X5LA 3VFTA 5IR1A 1WZ1H 2VMFA 4K5OA 3RU8L 4BK8A 3WU1A 5DVKA 3H53A 1HL9A 3T8XA 4NPKA 4YJZL 1Z9MA 2QMJA 5T3XE 4FJ6A 1Z3GL 2CJSA 1WAAE 3FMGH 4J6RH 5E5LA 4GG6A 5A2CA 2VERA 1MCOL 3BC9A 5GRJL 3B8YA 4I1RA 1FVDA 2EO1A 4Z8FH 3PUUA 1B0IA 1F2QA 4ZPTB 3A22A 3TCTA 4JG0L 5BZWA 3KVQA 3GNML 1DQQB 1GY1A 2VABB 3BISA 4GRLA 2E59A 5F1NB 1I7TB 1YEWA 3FTUA 3KXFD 3ML9A 3WXVL 3FT2A 2EXYD 4JFED 1U93A 2LLGA 1DE4A 4BH8B 1OK0A 4K9EH 1PIFA 1U8KA 4NIYE 4BJLA 3LKRA 3N2JA 2O5XL 3TEZA 4HK3J 3N85L 2FJGB 3CIAA 4HG4J 1Z6JT 2OXGB 1J87A 4JPVL 5DCCA 1Y18A 5JTWA 3BVWA 1J48A 4IJTA 2MPAH 1V3JA 4GINA 1EDYA 4PP2B 3VWKA 1KELH 3U1PA 4AMKL 2AJUL 2VB5A 4LNRB 1VZGA 3HE7D 4F57H 4KI5C 4AM0B 2F54E 2YMOA 5DD3H 4LLDB 1WK0A 1RURH 4FG6D 1YNTB 4N0FB 3QNYA 3U4EB 4OQTH 5JR1L 1HKFA 4PJFE 1W91A 1M7UA 3OKDB 1MHHA 1RSYA 4R4FL 4CN4A 4KJWC 1JGUL 1OB1B 3KEHA 4CKVX 2ZXQA 5K9KA 1NMCC 2A1WH 3IXTB 3J7HA 1H3UA 5D1XE 4WEBL 2R83A 4LKXA 3W57A 2B3RA 3STBA 3MBXH 4NQCB 4JRLA 1KSRA 2D03H 4D9RD 3OWEA 5F1IA 3V5KA 2DQHH 4HT1H 5GS0C 1FIGL 1SOXA 2XY2A 1B4TA 1YEKH 2R1XA 3ARWA 4F8TA 3BPCA 3GHEL 3MBWA 5M94B 4GYBA 2XZCH 4EVNB 5EOCH 3MLPA 4WO4A 4XPFH 3JT0A 4NKQB 3W9EB 2FD6L 2ZYSA 4HH8A 5DRXA 3FFCB 4JAMB 1BZEA 5I15L 1J8HA 1MVUA 4P2YA 5HTSA 1J5HA 1R3HA 1D5IL 5FYJU 2GB2A 4UTCA 2X4RA 4ZT1A 4APQC 1N64H 3QXAA 4PJCE 3O6LH 1G7QA 4NP4H 3WKYA 3L9BA 2IAMD 1QW9A 2YPVA 4W9HC 1M42A 3L2LA 4WW1A 5I2IA 1FL3B 3PP3K 1B4JH 2FUQA 5BW7A 1JK8B 2IQAB 3BAYA 1QR1A 4AEIH 4AJYV 1N0XL 3D51A 3DURB 3KDMB 5JNYA 2MQ0A 3BPOB 1ZJBA 1O6SA 3AWGA 2FJFA 3O2WL 3PNRB 4UT6A 5IEHA 1T22A 1FLTX 3EOTH 4EXPX 1RZGB 5JO5A 4G9FE 3K3QA 4HC1L 3C5ZB 2A6KA 1QFWL 2WXKA 2CNZA 4L8SB 3RGVB 1Z66A 3CZKA 4XBGB 3CJJA 4JDVA 5FKPB 3MACH 1AVAA 2P48B 4X4ZA 4NPYB 3WL9B 1NCDH 3H85A 4BFRA 3NN8A 3EBHA 5ETUA 2OCJA 4H20L 1E30A 1DO5A 3W5NA 4I18C 5L88L 3RZCC 2WP3O 1ZTXE 2WBJA 4NQDD 2HG5B 3ZKMC 1ASQA 4X6FA 4JQIA 4HSQA 2DWDA 4PCSA 1K5NB 3PL6B 1JWMA 3WEOA 4DGYH 3U9PL 3GO1L 3VI4E 3QQ4A 1RMFH 4FMKA 4PLJD 1TZGH 3FU0A 3KCPA 1JOIA 2PCXA 2MCMA 1NBZA 1QQDA 5DD1H 3IGAB 4UYPA 3VTAA 3UBHA 2XPGB 1XZ0A 4NO0A 5L7XH 5JORB 3QORD 4KJYB 4UZSA 4LSDA 4E5XG 5EUOA 2PTVA 1XDTT 4LQFL 4OAWA 3V55A 4M7KH 2VDMB 2IG2H 2QKIC 1LILA 3ARZA 5IJBC 2I85A 1X9RA 5ADPL 3O4LD 4N2FA 1JVLA 2GPZA 1GW6A 3NGBC 2OTUB 4Y8DC 2CMRH 3H8NA 1TDQA 1W6WA 1ZHNB 4C54A 1C9SA 3HB3D 4IU3A 4XBPA 4ABQA 2MNJB 3HS0C 4FZ8H 2IH8A 1IGCL 2BH0A 1SXSA 5E6ZA 5TF0A 4RAVA 5E23A 4N1EA 5KVDL 4EI6A 4GOSA 2AQPA 5HVHC 2X40A 1KTDA 4Y5XA 3OAZK 2B9BA 3H9SE 3GXIA 2PW1B 1URLA 3EO1B 4GRWB 4WGWB 2H8PA 1AQMA 1OM3L 2OP4H 1D9KD 4EQ3A 5C0CD 4MCZA 1SYVA 1UJ3B 1P1ZA 2FX7L 4WEEA 5I1HL 1HVXA 1JS4A 2J3SA 2R2BA 4KTEL 3QUZB 3MCLL 5IROA 5C0JA 4HZAA 4NEHB 3BP5B 1L3WA 4A6YL 3G3LA 4OD3L 4Z7WF 1I9RL 4HIIB 4X4MA 1UOVA 1DJGA 4A67A 2ZJSL 2DIAA 3ARRA 1YPZA 4LCYA 3VXRA 4AQAA 1GZPA 1SEBB 3QZMA 3UBFA 5LGKA 5GRJH 1MCOH 5MEPA 3BRFA 5TK4A 5IQ7H 3G6JB 1SY6A 4LSPL 4I5BA 3MUGA 2ZT9C 5AENA 5ISZA 2BOLA 4A2DA 3TN0D 3L4XA 1HYSC 5IM7A 3CFCL 4JG0H 5EC1A 5F2FA 3T65A 3GNMH 4Z7AA 1R3IH 3K81A 4Z0XA 4XO8A 3WXVH 3ATFA 1LP9B 1AKJA 4XVOA 2D0HA 2YK1L 2NLJA 3BZ4A 2QBWA 2W5PA 4KQ4H 2FZ3B 4QUOA 2C1OB 3DX7A 1A1MB 1XX9C 3MLVH 4FLSA 1MKFA 3BP7B 4MJ5A 4E41E 4Z7IA 2O5XH 4XX1E 5J56B 5KS9F 3V6ZA 4X4YA 3X3GL 1BQLL 2VITA 3GB7A 1DR9A 5EU4A 1ZGLA 5IB3B 5AAMC 3ECQA 4JFYA 2NY1B 1PYWA 1BYNA 3FQ4A 4B6ZA 5CR1A 2VJXA 3WDHA 3S5LB 4LVOB 1RJCA 4AIEA 5FDWB 2AJUH 3V0VA 3KNBA 4AMKH 2GYSA 2WZ5A 4MB5A 1XAKA 4ZMOA 2MTPA 4ATTA 3OKNA 5F7DA 4ZD3L 3D39A 5CSBA 1J0ZA 2B7DT 4O51A 1SMOA 1BQRA 3RTQA 3E6FB 3HBGA 4FHKA 1TJMA 3FB6B 4JM4L 4NKMA 3ERXA 4U1JA 5JHMA 2EKSA 3OF6A 2K1MA 4OM0L 5JR1H 3S5ZA 5BNXD 3OJDB 5D2NB 2GTWB 4R4FH 5EU6B 3WLBB 4FI8A 1JGUH 3KJ6L 4H0GA 1RZ8A 2JF1A 1TVDA 3B7UX 2VN5A 3MRDA 1A6TB 3GMPA 1E5AA 2ARJQ 1T1ZA 3NCXA 2C9XA 4PRIB 5ESAA 5AW4B 4WJ5B 5J3HD 1V7NH 4WEBH 1R47A 5K59F 1D2PA 4NDMA 5D1ZD 3AQDA 5DQDL 3OKMA 1J0YA 2PUQT 2Z35A 3UBXI 2XT1B 2FHFA 3VD0A 2ZUSA 1RXLA 1U95A 5D6DC 4PCYA 3D85D 1FIGH 2AJ3A 3L48A 3FQXB 2BHUA 2Z9TA 3CDGB 3NH7L 1ZV9A 4J3UA 3M1BB 3FAXA 2J6EL 2YBRB 3ILQC 2F5BH 2ZD0A 4MCMA 1M2VB 4JFPB 3BSGA 1NC4A 5DMKB 5FYLH 1NOAA 4O4YL 3RY4A 3MLUH 5C2UB 2FD6H 4NO5B 4GBXA 5I8CA 4CU6A 1LL1A 2PTTB 5I15H 3X14B 1U91A 5T1KD 1D5IH 2KYIA 4RGNB 4PRPD 3VXUE 1MCRA 2O6CA 1EFXB 2CGRH 1I31A 3P9LA 2YRPA 4HH9B 5KYXA 3FU7A 4ZFGL 3NIGB 4AH2A 4ZW3A 1AO7D 1QSVA 3CTTA 1PS3A 1R34A 1BQHA 1TLMA 5CN1A 3RNKA 1NFIA 5IB5A 2YKLL 1T1WB 3MYZA 4JHWL 3GRWL 4LSUL 4PP1C 2Q6WB 3RI5F 1HXYB 2XG4B 3T08A 1UXLA 3MCKA 3V4VL 4OIBA 1CFSB 5ABZA 5ACZA 1I1YA 1WFTA 1ZS8A 5HD8D 3FU3A 1U2CA 1I1AB 3IGUA 3KPNA 1ZVSB 1C5DA 1KJMB 3RVVC 1QFWH 1FYHB 3L5IA 1TJIL 4YE0A 3TF7C 1DZ0A 4AGOA 2WXGA 3B9DA 3BQUA 1CFMA 4KUZL 4FFTA 3ZE2B 4HJEA 2ZCHH 1MLBB 3ZGIA 5HGBB 5HHOD 2R0LL 4U0RB 4F5CA 2A4EA 4UM8B 4Z7NE 1OHQA 4OLZH 2GC7C 2OSLB 4H20H 5I5JA 4B0MM 3WG7B 4KK6C 4KKBC 3GJFB 1HIMH 3ZLQC 4Z95L 3SPGA 1CICC 2UYLB 3P40A 2CO6A 1KLUA 4Y4HA 1GGCH 2DJMA 4N2DA 2I25N 5D7LD 1RK0B 3KD4A 4NQVB 4L4VD 2ZIDA 3U9PH 3GO1H 4EN2A 5FB8B 4XAWL 3C2AL 4MA3B 3EJQA 3K6OA 3AS1A 3BAIA 3PPSA 3WBDA 5BVJA 3SE6A 2MSPA 4XO5A 3TM6A 3KLAA 3BEVB 5L4FA 4HUXB 3TA4D 1IBFA 3D7PA 5G55A 3SO3C 3CU1A 3EJPA 1BYPA 5I1CL 2AEIT 2NUTB 1QLEL 2FUTA 3NJIA 4LQFH 3D9AL 2E7LC 2R8SL 3FO2A 3ELAT 2PR4L 2A3TA 3REVB 4GUQA 5CEZE 5SX5K 1QEWB 3K5RA 5ADPH 1S8DA 1ED3B 3RFZC 3ZL2A 2N01B 3G5VB 3PFQA 4LSTH 3LXUX 1CI5A 2DYRB 3GHPA 2BW5A 1FVCA 3PP3H 1KIPA 1X9LA 4KJPD 4UIMB 2P8MB 1Z3RA 4L3EA 1ILSA 4LVNB 4XOBA 3SCMC 4EDWH 1Q8MA 4R7NA 1NUGA 2Y24A 4PJ7A 4GIAA 4GPVA 4R97C 5FV1L 1XMEB 3HC2A 3GKZA 4V1DD 4YUEH 3SKNB 2OKMA 1E7UA 5CJQL 1UB6A 5CIPB 3ES6B 3W0WE 1BOGB 3MGAA 4N2CA 3GIVB 3LCYA 3VRJA 1J5IA 1OM3H 2WB1A 3EKCA 2FX7H 3ZR5A 5IY5B 1FUNA 3KH4A 3BKYL 4KTEH 2VN4A 2R29L 2IH1B 1XO8A 1JXJA 2EDFA 3AG2B 3SGEI 5A2IH 3C5SA 4Y4KD 5F0JB 4JFSA 4PJEF 5LAXA 1OCOB 3EDEA 1F4YL 4A6YH 4XNZB 4OD3H 2Q87A 4EI5D 1I9RH 1AKPA 3FT0A 5HYQA 4JE4B 1U8OB 2CXKA 2ZJSH 3B7TA 4DGWC 3MXVL 5F6HI 1C16A 3U25A 4R5TA 2HA1A 1AGFB 4HSAC 2CCLA 4LSPH 1PJWA 1WUZA 1WISA 5CR8A 5AVWB 4IGBA 3WN5A 2NNAA 4PY8J 5B1AB 5EIIA 2NTFB 4YSAA 1FV1A 2FK9A 5KYWB 5HYSG 2XIBA 1BVKA 2OZNA 1RJYA 1VPOL 3ARGB 2GHWB 1J10A 1TSHA 2V2XB 3MROB 1AHKA 2QFPA 4UQ3B 4HMCA 4BCXA 4YHYB 1TUPA 1HHIA 4JFVA 4XB7A 4NAMA 4OZHE 5HDLA 5AAPA 1XXFC 1JUFA 3M7FB 5F21B 1K9TA 2Q8BL 2VDPB 1JF1B 5DS2A 3CSBA 3K7UA 3QFJD 5FO8B 2JI2A 3GYRA 4DN4L 5KW9L 3F7KA 1CCZA 1V55B 4IBLT 5I6MA 4H40A 4HWBL 1XCQB 5DRWA 5I0VA 3MRMA 3DV6A 1MCIA 3US0A 5KSBE 1DVQA 4WNSA 3NP4A 3UFIA 4MSWA 1E42A 3VACA 4YWGL 3BN9D 1X4XA 3CFIC 2XIIA 4JM4H 4ABWA 4FGMA 5AWNL 4PRHA 3WJMB 1YEJL 1TJGL 4HOWA 3IDNB 4H8QA 5EU5A 1N19A 3VXSB 1NFDA 2C5DC 2IDTA 5KN5A 5DVMA 4E9XA 4NJ9L 2EC8A 1R1CA 3KJ6H 4X6DA 4KOCA 4Z7VA 1T0OA 1KN4L 3EGSA 2QADD 4XOCA 4KKQA 2Z4QA 3FUHA 1EH9A 1G4RA 1SLVA 1S7WB 5C08E 1IM3A 3PREA 4LXFA 3HE6C 5DQDH 3VSVA 2D7MA 4DN3L 3L1OH 5DYOB 4OQ1A 2A73A 3GUTB 2YZ1A 2G5RA 4QOKD 3VXPA 5D96B 2Q86B 4I9XA 3HR5B 3ARTA 3DMMA 1R3JA 2EILB 5K9OA 3LVTA 1XB8A 3QUKA 2NW2A 4G8FB 1IO4C 2J6EH 1YLBB 2OYKA 2XVBA 1KJ2H 4U1MB 3EXJA 4DAGL 4O4YH 3OZKA 1AIFA 2ZUVA 3WEMA 3KR3H 4WK0B 2F2HA 3UG5A 3ARBB 2FATH 3V0IA 3FQRB 1P6FA 2R0ZL 3B2UD 3BVNB 3I75B 4XR8C 4F2EA 1JGIA 2YARA 3S35H 3WNLA 4PJ8D 1EJ8A 1NCBL 1OLZA 5HHMB 4ZFGH 3RY6C 3WTVA 2DM2A 1Y6MR 4KFZC 4G59C 4Q9BA 1A4BA 4H2CA 4ADIA 4P9HL 2VABA 3IJYA 4LSUH 3WFBL 3GRWH 5F1NA 1UZ6F 2F7PA 3KGUA 3V4VH 1XV8A 2PO6B 1JK9B 2BINA 2Z0UA 5IOKA 3MFFB 1CLCA 1S6NA 2NUPB 1W6LA 1F5WA 1JWUB 1XTMA 5C07A 4WI0A 3OXSB 4P5TA 3D5OF 2FJGA 3WFHB 1TJIH 2GJZB 4HJJL 4PLKC 4KUZH 2R4SL 3T2LA 4LAQL 4HEMA 3QWOB 4BDVA 4PP2A 1JP5A 3ETBJ 2BSSA 3UDWA 3QDJB 4MNQB 2GAZA 1UH2A 3QEHB 4Z95H 4AM0A 5CM1A 3MUJA 3O11B 3GI8L 3P54A 5LN4A 4Y16D 4Y1AE 2A2QT 1CTMA 3U4EA 3DHPA 4XAWH 2Z8RA 4M93B 3OKDA 1F56A 4OZFB 4TVPH 4IHBA 3BZEB 1WEJL 2WGNB 4JANB 4KO9A 4XB8A 1YZZA 4DO4A 3LQZA 2JJVA 3QBTB 5CGBA 4G3YL 3D9AH 4M5YH 2P5WB 2R8SH 5DGQA 3U6XS 4HIXH 1F6AA 2P1YA 3L17A 4P2OB 1K8DB 4NQCA 1RZ7H 3F64A 3ZL1A 4LZKA 3MBED 1TG8A 4M8VA 5J11C 3SKOA 4PRNA 3N40F 4P5MB 1WTGT 3VI3F 5G5DB 4EVNA 5DZJA 1VGEL 5FYKL 1H3WM 3UTSD 3CWGA 4RFEB 1RPKA 3W9EA 5BRPA 4YBLB 1NCTA 4JAMA 4XWOD 3I85A 2V7HA 4OIAA 3VH8A 1OM9A 2H6UA 1E65A 2ZG3A 3OAWA 1G6VK 5AVVB 2F9BT 5C8JA 1AXSB 2J44A 3BZ5A 4K71C 3AS3A 3VE0B 3TBTB 1NL0L 2EXYC 1J5OL 1XTLA 3MODL 2K9UA 2VDNB 2BP8B 1T2QH 2CZNA 3BKYH 1ERNA 1Z9LA 2OMZA 1JK8A 2IQAA 1SJHB 3VCLB 3VFVA 5CKGA 4YZFE 3KDMA 2QGDA 5EUKB 1F4YH 2OJ1A 5F97E 4K5PA 1XSIA 2BRRL 4DP0X 2R2HB 1RZGA 1VFAB 4O2CB 5ALBH 4HCRA 1AACA 3P2BA 2IPUK 4IOSD 4PRAB 3C5ZA 4J3OF 5F0MB 2B1HL 2YD0A 3HE7C 3OHXC 1L5GB 4Z7OE 4L8SA 3FTSA 3LZOA 5IHZB 4F93B 4HZLB 4XNBA 5HJ3B 2CHZA 4KBPA 5CLXA 5JIQA 3VWJD 2YD6A 3RG1C 1HKLL 3GM0A 5FKPA 1CE1H 2F08A 4OFDA 4OFQA 3ZT7A 3CGTA 1M1XB 3DO4A 3FUKA 4YHKL 7PCYA 2AAVA 2A9AA 3ULVD 1SXCA 3PQYB 3LS5L 3WELA 3K6DA 5K33A 4F8LA 1ACCA 1PJ9A 4XZUB 3T77A 4LSQH 3HCVB 3VDBA 4EXKA 1E43A 4IRJB 4OTXH 5E99L 5HHXL 1K5NA 3FC8A 3PL6A 3QWRD 1FFPB 2BHFA 2Z64C 4D9QD 1YEGH 4KQ0A 2G30A 8FABB 4HFUL 4DN4H 1FF5A 2HLFD 1MI5D 2Y7MA 4UIKL 3KPMB 4MMXB 1I53A 5IMOA 3ZZLA 3LSOB 4HWBH 4QNPE 4TSBH 2CUHA 2I9LA 2XPGA 3ZPDA 5A16B 2VDML 5JORA 1XBDA 2P26A 3IFNL 1BVOA 3I6KA 4W4NA 1P84J 2VYRE 1CPUA 1EZUA 1MW1A 4K3DL 2NY0D 5GGUB 4F9PA 1QABA 4DPCX 1S7RB 1L0QA 1HS6A 4Y19B 1WD8A 2IXQB 2C3VB 4HXAL 2IMNA 5DJ0B 1ZHNA 3CFBB 1J8HE 5F8RC 1B6UA 1TCRB 4W9KC 1PLBA 3IYLW 4KXZH 4NJ9H 4WAFA 2NY3D 3AS0A 2IAMC 1KPUB 4P57B 1KN4H 4JFOB 4N24A 5BCAA 5C6PB 4NZTL 3AT9A 2Y22A 4BWTA 3O6FB 5DMIH 4ZUVA 3ISYA 2EYTB 1X5JA 1CFNB 3D2UD 3D2TA 2WMPB 5ICZB 4WK4B 3EO1A 1GGIL 1TMCB 3CXDL 3TCXA 1UJ3A 4UV4L 4UOJA 4A2LA 4Z7WB 3MRLB 5IBLD 1NZRA 3TO2B 1T7ZA 5T1MB 1PCXA 3QQDB 3WFEL 5DTFB 5D5MA 4Z3TA 3ZZSA 1TQVA 1ZA3B 3U36B 1YDPA 3OLDA 4DGVL 5LKNA 2EAEA 1B4LA 3E1ZA 1OAKL 4DUXA 4OKVB 2ADFL 2V9RA 2HRPH 3I9GL 1XCXA 1LO0L 4DZ8A 4KY1L 4KH2A 1IBGL 4KRPB 4FA8A 1U9KA 4XNQA 3X1NA 4N2NA 1D6EA 5E0QA 1VACB 1M9SA 1IAKB 3QUXB 5BPPA 1ZGLM 5ESVB 2VM3A 3BD5A 2WZPA 2K9FB 3WFBH 4Z9KB 4HOXA 3FQTA 5FPIA 3R8QA 4PLJC 2VZ1A 3HN3A 1MH5A 2R2EB 3RWHA 4TLUA 4X8GA 5KS9B 3P73B 4NSKA 4KMQA 4YOKA 1A1MA 5KZCD 3TIEA 3LXAA 1TITA 2YD4A 1KN2H 3BP7A 3Q2WA 1OIOA 3KPTA 3QORC 3R1GL 1BQUA 2DQIL 3CC5B 3TV3L 1M05A 2HP4A 4QMEA 3REWB 5JPMB 4MDIB 1LO5A 3PWUB 3TEYA 1MG3C 5KJ7E 4TLKA 2R4SH 3POCA 4LAQH 4HUVA 4OF7A 4NC1E 3WUWG 2FEDD 1C08B 1AHMA 4AWJC 5GGVY 1TTFA 3GBEA 3BKJL 4IKNA 3HB3C 5FDWA 1N7ML 3KG5A 4MS6A 1WS7A 3FT4A 3QEQA 5SWSB 3A4DA 3LRSA 2O5NA 3UTQB 1NAML 3GI8H 4FNSA 4DKEL 3FB6A 2FO8A 1CBVL 4B97A 3G7TA 2X88A 5IGXH 1SF5A 2VLRB 2OXHB 4C56E 3DVGB 3ARXA 2DD8H 2ODIA 3OJDA 4GEIA 1MRDL 2GTWA 2EVIA 3S2CA 1S3RA 4JJ5B 3EFOB 1WEJH 1A6TA 5TDNB 1DUYB 1D9KC 5ANMB 1U58B 3CFTA 1MREL 4UM9D 3FT9A 4JKPL 4WJ5A 4DHLA 1I82A 2KQNA 4G3YH 5H94B 3QCTL 4J8RA 3VD4A 2VDOB 3PWLB 4R7LA 1M3JA 3K6SB 5BVPL 1YC8A 2GY5A 1GC1L 2GUYA 1AG6A 1E8ZA 1L9PA 3PABB 5DXWA 4HPHA 4EZJA 5IB2B 4MQTB 4LCCC 4X4ME 5E4AA 2J25A 5IEKA 2A9NL 4F37F 1TF4A 4HS3B 5SWZD 3VXRE 1YPZE 1CD1B 3GGWB 3M1BA 3WKQA 1XIWD 1FDLH 2YBRA 2JXMA 2QSVA 3DOIA 1IGIH 1UKQA 1VGEH 1M2VA 4NQUA 2IGTA 2FECL 2NMSA 3MV9A 3UZQA 3TN0C 3B5TA 2M8XA 4GLRI 4ELDA 4NO5A 1DJYA 3Q2VA 5ISZE 4MHHG 3RL2B 2PTTA 3DTXB 4P5RA 1ZLWK 4HX1A 2L4OA 2G3ZA 5CUSL 5DHMC 3II3A 3C12A 2ICWI 1AH1A 1WIPA 1NL0H 5CP3H 4PJAA 3MODH 3AABA 2YFNA 1IC1A 4CGTA 3QUMB 4JFQB 2NDFA 2N0KA 4AITA 4YL4A 4JUSA 1SNRA 3LEVH 1YY8B 1CR9L 1WBYB 3BP4B 3NIDF 4ONFL 4NUJB 1UWGH 1SXBA 1CFSA 2A38A 2WTOA 2EDMA 2ID5A 3J2PA 5E2VL 4NUMA 2LFEA 3B2DC 1I75A 2JELL 2JB5L 2B1HH 3L1FA 4MASA 4APQB 3K2IA 3D39E 1MCSA 3BCFA 5JHDD 5BV7B 2R69H 4G1MA 4PJGE 1HKLH 1FPTL 4BE5A 1OCWL 4PJHF 5F6IC 2FWOA 4YHKH 1N18A 4P2RA 4MXVF 3JXAA 3F65A 3B3BA 1E6OL 3G6AA 3LS5H 3WLWD 3JUYA 3VSTA 3TPUA 4KKNA 1HC1A 3WNMA 5E99H 5HHXH 3GSXB 5FO2A 5J3HC 4NQVA 5DD5L 1OP9A 2JK5A 4KVPA 3UP1A 1XCTA 2XNAB 4L8BB 1ROCA 2FJUB 5D1ZC 3SE3A 5FB8A 4M48H 1VADB 3JTTA 3MRIB 2CG9X 4HFUH 1M71B 2NR6A 1MFVA 4QLRA 1XSOA 2E46A 1HH6B 4MJ4A 4HUXA 2KPNA 4AGQA 1Z0NA 2NUTA 4NO3A 3QZBA 2YEVB 2BY0A 3L4VA 2APTA 3U82B 1JV5B 2IDSA 4G42B 1BZ7A 1A6PA 3RKPA 4Q0XL 4K3DH 3NQIA 3REVA 3UH8A 3ZTJG 1UD6A 3OB0K 4WHDA 3TESA 3ZE1F 2AEWA 1ED3A 2J6WA 3V5DB 2DRUA 1ZY9A 3G5VA 4GNKB 1F1DA 1JNHA 1HSBB 1ZIBA 4I18B 3RZCB 4YSEA 3EDDA 2WQ8A 5FLVA 3SBWC 1WF5A 3IFPB 4WNQA 2X1OA 1QLRB 5I30L 2V2TA 3GTNA 2XYCA 4NM8H 4YSTA 4NZTH 1PZ3A 3KYMB 2OR9L 3RHWK 4YXLL 1YJDL 3PWPA 2F53D 2UWEF 1TXKA 3IWUA 5T1LD 3ARDB 5CSGA 1RZKL 1UM4L 1INQB 1N0LB 2D8KA 2BMKA 3IJ8A 1GGIH 5GSVB 3GIVA 1VF5C 4RFNC 2QKIB 3GMNA 4RMBA 4Y7OC 5LBSA 3CXDH 4GMSL 4U6VL 3NGBB 1T1YB 4RLDA 3MJ7B 5HD8C 5LXVA 2XWXA 4V2BA 4XGZB 3SYQA 1A5FL 2IH1A 4XCCL 5CGYD 4UBDD 3LXCA 5CEXB 4RCAA 2XRAL 1AD9B 3HS0B 2AK1L 2VZUA 4I8DA 1RU9H 1T83A 1PLGH 3T6VA 4LSVH 4TTGA 2HWZH 1YHPA 1OSZB 3L3IA 2EO7A 3IB4A 4Z0BL 5EO0B 4M43L 4E68A 4UNVA 3FAWA 4ZG1A 1AGFA 5HVHB 3I9GH 2LVEA 4F5CE 4FABL 2AI0L 4LEXH 3SGJC 1FRGL 1IBGH 4WY7L 4BQ9A 4LGRB 2NTFA 5IG7B 2CM5A 5KYWA 1TFPA 2EEXA 3ARGA 3MROA 2EEBA 3OB8A 4ZQKA 3NA9L 3FONA 2DMHA 2Y69B 4R4NC 4HISA 4IBSA 4MAUL 1PCSA 3BESR 3R1GH 1WVZA 3MLWH 1L7TL 1D5ZB 3TV3H 2O5ZL 4DVRL 5JA8B 4AIXA 1S7XB 1KIRB 2DQCL 5H37A 1G6RH 1JYXA 5FYLD 1HQ4B 3BAJA 3MRQA 4D7BA 4PWHA 3BKJH 1Z0MA 4G8GD 4KJPC 2HRLA 3V6FB 4ZFOB 1IL1B 5F7AA 2JLPA 1UUSA 1PZUB 4DKFL 4LLMA 2BK8A 1UASA 3H4FA 1NAMH 3K8MA 4PJ7E 1INEH 2WBXA 4R83A 5F9JB 1CBVH 1PFCA 3WJMA 1QOKA 2ZKYA 2DQ6A 3VXSA 2J8UF 4B9IA 4PU2A 1BEYH 1BF5A 1GS8A 3IJHB 1MRDH 3CFMA 3A3YB 4ZTPL 5KVEL 3O9WD 2YD2A 3MC0A 1WYJA 3FRUA 3G6DH 1MREH 4JO5A 4JKPH 2UZXB 4IJ3C 4WI7A 2EDKA 1S7WA 5D1QB 5CBEA 1X4ZA 4ZAKC 1MRFH 4Y4KC 3GUTA 2EDOA 4IK7A 2Q86A 1GC1H 4EI5C 3HR5A 5CU9A 5AVTB 2DQEH 3QQ3A 2A9NH 4FQJL 4XMXA 2VAJA 4XNUL 1CQYA 1UD4A 2D0GA 4ODBD 4QWWD 2QT6A 4BXVA 3NIFB 3CC1A 3GSOB 1H8SA 4ZJ9A 2ORBL 3LYRA 3BW9B 5G4MA 2OK0L 4PGDB 3ARBA 3VFGL 3QJUB 1TTRA 3FQRA 3AQYA 3RB7A 3QIBB 1FNAA 3QNFA 1PZAA 3KPRB 3SY0B 4FADA 1B90A 5KYYA 4HPYL 1UWEL 3EH2A 4I4WA 3ULSB 3T0VA 4B41A 2R9HD 3SDDD 4Y2DA 1IIIA 3UJJL 1HCYA 1CR9H 3CFEB 4ONFH 5D93C 3BIBX 3HRZC 4LESA 2PO6A 1OAUH 4IRSD 2LAGB 1L9OA 1ORSB 4P3DA 1FL6A 1NGYB 3EO0B 3MFFA 1ID5I 2Z1PA 4LF3B 2RQ8A 3JWOL 2X4UB 1JWUA 2NX5A 2NY6D 5D7JD 4PY7B 3OXSA 1QFUL 1V3KA 4WCYL 1QRNB 5B1JC 2GJZA 4ODXB 2W9DH 3VH8G 4EN3C 4RFOL 2ICEA 3D0LB 3BN9C 5CEZH 1TVBB 1HFUA 5CS7A 2CLZB 1FPTH 3QWOA 3UBXA 3TO4B 2WSDA 3QDJA 4MNQA 1NFDE 1E6OH 3U1QA 4H1LA 5I9QC 3TVMB 4N0CC 3BLPX 4X6DE 1DEDA 1S7QB 2UUDK 3QEHA 3QPXL 4BFEA 1GGUA 4GKZB 3R19A 2QADC 4YSSA 5DD5H 1MWOA 1ZT4B 2ED8A 3SGKA 2BNUB 3WFZA 5LGHL 2BWQA 2ADJB 2VR5A 3BZEA 2XVKA 2PYFA 5HVFB 5F7NC 2EDTA 2JIXD 4GP4B 4N9GB 2JJSC 4ZMPA 4JANA 3C6SA 2FT7A 3EJUA 3N5AA 4MA8L 5HHNB 4YL9A 3P2TA 1QSZA 4RZCA 5DJ2A 3T8VA 1JE6A 4PVNA 4G7YL 3VI3B 3EJTA 2YRBA 5JHBA 4NUGH 4AEHL 4U1HB 5E1AA 1PEWA 3SDXF 3LB6D 2VSDA 3BVXA 4J3WA 4CMMB 4LCUB 1D6VH 4JZNA 1XGRB 3OR7A 4X50A 3X11A 2F8VA 3B2UC 1QTPA 5G5DA 3B7SA 3DHUA 3Q6FB 3BWAB 4PJ8C 1RJZB 4AVIA 5EPMA 3ZHDA 4WFFE 2OR9H 2OMBA 1YJDH 3RVXC 4R7DB 3SO3B 1D5XB 1WICA 3OJVC 1F6LL 1U36A 4FFZA 5FF6B 1RZKH 2EXWD 3EFFB 2KQMA 4JRYB 4TUKL 2AQ1A 3TBTA 2NXZD 4U6VH 3U0TA 4PV8A 1H15B 4J5VA 1BX2B 2FRGP 3FFDA 2YO3A 1KJVA 5J7CC 2IEPA 2UX7A 3ULUE 2G75B 1KT2B 1M6OB 1R19A 1T7VA 4U3SB 4XCCH 4ZX6A 2HSIA 4UTAL 2XRAH 2AK1H 4O02B 1W72B 3RX8A 1LXMA 4AZ8B 3HAEG 5EF1A 1ZXKA 4UNIA 4L9LC 5BO1L 4Z0BH 4JG1L 4R97B 4M43H 1H6FA 3QI9D 2E56A 4DTGH 2UVFA 2VCOA 4FABH 1L9SA 1RQ5A 1E4HA 1L5GA 1FYTB 2VLKB 4U0QB 3S3DB 3V4PB 4ORGB 1EEZB 5IHZA 1AAJA 2P5PA 4URKA 4HZLA 2DLIA 4Y16C 3GD1C 2E6JA 2OBGA 4F15B 4C59B 3K0WA 3Q9QA 5DJAB 1DQVA 3MLZH 1CBJA 5DSCA 4RA0C 4YX2L 4NJAH 2DMBA 3NEEA 5GHWL 4C8XA 1LTXA 3DO7B 4MA1C 3FXIC 1BBJB 1IC4L 3MYJB 1XH2A 5DEJA 4RMRA 2BY2A 4JGMA 2M1KA 2B16A 4AL8C 1L7TH 1FFPA 2O5ZH 3QDMD 4F7EA 1I1CA 3CFNA 4G6JL 4LBEA 2DQCH 4NQCE 3QYNA 4J1UB 3GRBA 3KPMA 2D7TH 3NJXA 4MMXA 3VD9A 1HHKB 1OAZL 2VMDA 3HG2A 3OLEA 4N28A 5A16A 3RWJB 5GS2H 5JDSA 3H2WA 4B9KC 3K46A 1ZE3H 2UXTA 3ASWA 5JOFB 2MRYA 3SQRA 5GGUA 3WO4B 4DKFH 3MRBB 2ZICA 1TEFA 1VFOA 3VNZA 2FX8H 3W81A 3WIHL 1KGIA 4JG5A 2IXQA 1RFDH 2C3VA 4XWOC 5DJ0A 3OX8B 3FFCE 2HFTA 2E76C 1UKSA 3IGLA 1TCRA 3JV5A 3NCYP 4W9LC 4ZTPH 1DJHA 3H6JA 4XBEH 4E42B 1AXTL 4UCFA 4QR7A 4IRZH 4UMGA 3FTZA 3I50L 1KPUA 4P57A 5LCVL 3RP1A 4FNLH 4KK9D 4MB1A 2ZPKL 3T2NL 3EF7A 3H55A 5CZKA 2ERJC 1IM9D 3KGSA 5DS8B 5I1EH 3M46A 2AQTA 2KL6A 3NZHH 1SDYA 5C0AD 2WMPA 3WUZA 4I0PA 4KFMA 4TS6A 3QC5X 3S96B 1KF9B 5ERWA 1KG0A 4K7PL 4Q6IA 4Z7WA 4FQJH 4OZIF 5I6XB 3AMLA 4UQAA 3D87B 2PKDA 3QQDA 2OW6A 3LKQB 4ZXBD 3SYOA 5DTFA 4PYGA 4X83A 2ORBH 3PDOA 5C09A 3TFKD 1AGDB 1ZA3A 1NCAH 3DGGB 2OK0H 1QWNA 4LK4A 3VWJC 4F92B 1NUDA 1FNFA 4OKVA 1SF3A 2MOVA 4N6QA 3PV6B 1ID2A 3HE6B 1X6NA 4O00A 3ULVC 3OVUB 5K69A 1J12A 3VD2A 5IQOA 3DGCR 4TVPD 3DRTB 1HHHB 4HPYH 4NBZB 1VACA 3PHOB 2VLJB 4DEUA 4OFVA 5ESVA 3WS3B 1TTAA 3UJJH 4MJIB 1NAKL 1DZBA 3QUYD 2P80D 3U4BL 2BXYA 5KS9A 2H0FA 2R2EA 2CBQA 2HLFC 3P73A 4KNQA 1SRDA 3QFDA 2ZZUT 1DQIA 1HHJB 1EUUA 2J12B 3UTTD 4Y1TA 3ZMEA 5HGHB 3A6BL 3JWOH 4HOMA 2MIZA 1DN0B 5EB9A 3JV6B 1HINH 1QFUH 3DPBB 4WCYH 2DI8A 5EBLB 3MKKA 1A4AA 4YHLL 5JPMA 5LN8A 1QSFD 3GMQB 2NY0C