1W6WA

3d structure of cota incubated with sodium azide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6wA02
4GP5B 4M4RB 4A2GA 1BXUA 1NIAA 3EH3B 1L9PA 1AACA 1XB6A 3EH4B 2FWLB 3QQXA 3PLYA 2CALA 2UXTA 5I26A 1SDDB 2EIMB 1DZ0A 2UXVA 1ZIBA 4BXSV 5B7MA 1PLCA 4DP6X 4KOCA 1NIDA 4CSPA 3CG8A 3IEAA 1HAUA 4E9RA 1V54B 1SFDA 2X87A 1BQKA 2H3XC 1ET7A 2IH8A 3FQ2A 1IKOP 1AR1B 3SBRA 2CJ3A 2QT6A 4JKNA 4DPCX 1E5ZA 2AFNA 3CVDA 2WSDA 1A4BA 1ILUA 1WS8A 4YVNA 2BHFA 2XXGA 2GBAA 3FQ1A 6PAZA 1ZIAA 1M9WA 3JTBA 3NT0A 4ZK8A 1HFUA 2YAHA 4AKPA 3IE9A 4KO6A 3TA4D 4TXVB 3ABMB 4JHVA 3ZDWA 1KV7A 1NIEA 5TK4A 2GHZA 2PP8A 1ZDSA 1NTDA 3AG2B 2HRGA 1W8EA 1WA0X 3S8FB 3T9WA 3IBOA 1OF0A 1JXDA 2GC4C 1PCSA 3X2QB 5I6PA 4DP9X 4YL4A 1OV8A 5D4HA 3NSCA 2VSMB 3V9CA 3EH5B 2HX8A 1HAWA 2QPEB 4YSOA 4DP7X 3AG4B 1N70A 4DP1X 1ASQA 2UX7A 4PAZA 3TASA 2XX1A 3X1BA 1PAZA 2FQGA 1AZUA 1TEGA 2IDFA 3DIVA 2R7EA 1ZDQA 1GR7A 3FS9A 4G70B 2BO0A 1B3IA 1NWOA 2ZOOA 4N4YB 4X4KA 5EHFA 4A2HA 1AQ8A 2FQFA 1GW0A 3OD3A 2TSBA 1ID2A 1NDTA 3N2JA 3WIAA 3X1NA 3OMNB 3N55A 4WKXA 3T71A 3L45A 2IWFA 4PCYA 2XXFA 1BQRA 5I6LA 1UATA 1ET8A 3FSAA 4A68A 3HB3B 1AZBA 4Q8BA 4E9XA 2GIMA 2W88A 3ABLB 1W6LA 2W8CA 4MFHA 2EIJB 2N0MA 2DWSA 1CYXA 2IAAC 1X9RA 4QKTA 5IY5B 2HX9A 2AZAA 4A67A 8PAZA 1XB8A 2P80D 2A3TA 1MZYA 2YAOA 3H4HA 1FA4A 4JHUA 4M3HA 1JZHA 2BP0A 2XX0A 1L9RA 3V9EA 5B1JC 3FYIB 1E65A 1GYCA 2YAMA 3NJFA 1IBZA 2VW4A 3T6XA 2VM3A 1OCZB 7PCYA 1M57B 4A66A 1ADWA 2PP9A 3OQRA 5A7EA 1ZV2A 3GDCA 4E9VA 4YSSA 5ANHA 4DPBX 1NPJA 2IWKA 4A2DA 2MTAA 1GY2A 4E9YA 1KGYE 3UGEA 3PAUA 2FTAA 2CBPA 3QJSB 2IDSA 3NP3A 2WO3B 1SF3A 3FU7A 1BXVA 1JOIA 1IBYA 3ZX1A 1PY0A 1TU2A 1CURA 2HLEB 1J9QA 1J5DA 5PCYA 1JZGA 4W1TA 3NYKA 2CAKA 5FC9A 2CUAA 1KCWA 3H56A 1AAJA 4E9QA 1OCRB 3QJQB 4F2FA 2PPAA 2PPDA 1EHKB 1A8ZA 2UX6A 3FU8A 2LLNA 5TK2A 2XV0A 1JERA 1PZBA 2Y1AA 1RCYA 3DKHA 5I6KA 1IC0A 4WTQA 3SBPA 4W9ZA 3ZBMA 1SNRA 3EHBB 2FNWA 2I7SA 4E9SA 1IUZA 4NAJA 4DP8X 1A3ZA 1AS6A 2FQDA 3T6ZA 4BDVB 4F2EA 2E86A 2IDTA 4FAAB 4ENZA 3AY2A 3X1GA 4BXVA 2PLTA 2J57A 5I5MA 2X88A 2IDUA 5F7BA 3X1EA 3QJRB 1ASPA 3CVCA 4G7RB 3BQVA 1SDDA 2GC7C 4E9WA 1SHXA 1WAEA 1GSKA 1RZPA 2HX7A 5D4IA 4DP0X 2DY2A 3FSWA 3PAVA 1MZZA 2PPFA 1AIZA 1BEXA 1PNCA 3FPXA 2BZCA 3PPSA 4UF7C 3NJHA 1BYPA 4NB7A 1BQ5A 2P80A 1URIA 1J5CA 1OOWA 2ZXWB 1AOZA 1ILSA 4GXFA 1J9RA 3S3CB 2YAPA 2VMJA 1GS6X 2HRHA 4QLWA 2WO2B 2JXMA 1CC3A 1N68A 4UAHA 1NICA 4KOBA 4L0PB 3QPKA 3ERXA 4GP4B 5F7AA 1KDIA 5AFAA 5I6NA 3U25A 4UANA 3NJJA 4YSRA 4BDVA 1DYZA 1WS7A 2FT8A 2I7OA 1RKRA 2PP7A 1TKWA 1GS7A 4Q89A 1WA1X 1ET5A 3RYMA 3UAEA 1BYOA 3NJMA 3X1FA 3CDZB 1CYWA 3FQYA 1MG2C 2H5UA 2YXVA 3OMAB 2XU9A 2VN3A 3WKQA 1XMEB 3C75A 1XB3A 4AKOA 2AZUA 2XLLA 4RH4A 4KO5A 2XV3A 2MRYA 3ZIYA 1OE2A 4GY4A 1PZAA 4YSTA 3AW5A 1NZRA 1OCOB 3WNIA 3S8GB 4P5RA 1ASOA 1E5YA 4AKQA 4A2FA 1F56A 1L9QA 2GI0A 4HAKA 2IDQA 2RACA 2XYBA 2FQEA 3S3DB 4DP2X 4F7KA 3QJUB 1VLXA 2PCYA 4KNTA 5I5IA 4BWWA 1RZQA 5B7EA 4AX3A 2J55A 1SHWA 2VSKB 2QDWA 2BP8B 2ZWNA 3PCYA 4G7SB 4YSEA 4GP8B 2B3IA 2XVBA 4BWUA 1L9OA 1JXGA 1JVOA 2QDVA 3AG3B 1E30A 3FSZA 1NIFA 1PNDA 3QJVB 4KNSA 3OMIB 1L9SA 1OE1A 2H47C 2JFCA 4K9JA 4YSQA 1MG3C 5PAZA 2PPCA 3TU6A 2YQBA 1ETJA 2DV6A 3AG1B 5AKRA 2DWTA 5E9NA 3CZUB 4YSPA 3MX0B 1JVLA 3IN0A 4YVUA 2TSAA 4DPAX 1PMYA 1X9UA 3T6WA 1AZRA 2UXFA 4G71B 3DTUB 1SJMA 2BWIA 2BZ7A 1W6WA 1TEFA 1OE3A 2YXWA 3FYEB 3NJGA 2GB2A 2HZHA 5LDUA 4YSDA 2DYRB 1GY1A 1I53A 5I5JA 9PCYA 1CUOA 3EF4A 5B1JA 3TBCA 3S3BB 1EZLA 2HXAA 4HHGA 3ASOB 2BP8A 3WG7B 4KO9A 2R7EB 2YAFA 2QPDB 2IWEA 4HCIA 4DP4X 1JXFA 3FPYA 2VM4A 1A4CA 3PAZA 2XUWA 3OM3B 1OCCB 2I85A 2BWDA 4E9TA 4HHWA 2AVFA 1AS7A 3GXUB 5I28A 5I6OA 1PZCA 2OCCB 3FT0A 3UAAA 2NRDA 2BW5A 6PCYA 4BWTA 1V10A 3KW8A 2FJSA 2YARA 1MDAA 3GYRA 3PXLA 3NJNA 3JT2A 1AZNA 3WNJA 3T6VA 1J9TA 1R1CA 3NJIA 4FA7B 4GYBA 2EINB 3TBBA 1PF3A 1GS8A 3NJKA 2PPEA 7PAZA 3AZUA 3HEIB 3IN2A 3FU9A 1BAWA 2PCFA 2VW6A 2B08A 1SF5A 2CCWA 2J56A 1JZIA 2YAQA 3UABA 4G72B 1AG0A 1AS8A 1PLAA 4YSUA 1JZJA 2BP0B 2FT6A 1WA2X 4HCGA 1QHQA 3KW7A 2DYSB 2VW7A 1QNIA 4HIPA 4KNUA 5AZUA 2OV0A 3NSDA 3NJLA 3ABGA 1BXAA 2YAEA 1ZPUA 1NIBA 2JKWA 1FWXA 2BW4A 1YLBB 4CSZA 5B3SB 5I6MA 3MBWB 1KBVA 2EILB 5B7FA 3BVDB 2ZONA 4EF3A 3NP4A 2OJ1A 1L9TA 4BK5C 3SBQA 4DP5X 3UACA 1KYAA 1J9SA 1NINA 4YSAA 1FFTB 3FU7B 3D12B 1KDJA 1AANA 2XWZA 2Y69B 2EIKB 1A65A 3SQRA 1V55B 1AG6A 2GSMB 5B1BB 4HZ1A 1T5KA 4YSCA 1E67A 1KCBA 1JZEA 1QLEB 2Q5BA 2IH9A 2Q9OA 1AZCA 5B1KA 3WI9A 1JZFA 3H4FA 5B1AB 3NSFA 2AANA 4N8UA 4KO7A 3CVBA 4AZUA 5D4JA 2FT7A 1NPNA 1KBWA 2UXGA 3CDZA 4HCFA 2XV2A 3NSYA 4HALA 4G7QB 1SFHA 3ABKB 1NWPA 1A4AA 3WKPA 3QJTB 2J5WA 4AI7A 3ASNB 4A2EA 3G5WA 3UADA 1PLBA 1M56B 4NERA 4P5SA 3FSVA
chains in the Genus database with same CATH superfamily
2DZEA 4PRPA 4M7KL 4PV9B 4X6DA 3EJUA 3Q6GL 4Y2DD 4AGOA 2D0GA 1WAAF 1TYEB 2BSBA 4L3AA 3SD5A 3CUPA 2EIMB 1DZ0A 1CLYH 1RULH 3EO1B 1ZA6B 1VSCA 3E2HB 4YJZL 4KOCA 3QAZB 1CF8L 2WCPA 4NGHL 3STLA 5L88H 1TQUA 2QSCH 1MCPH 2IH8A 1HHIB 3SYOA 5L8LB 3SBRA 4I13B 3RKPA 4JKNA 3L3DA 3ES6B 3RIKA 2J88L 2E8ZA 4HIXL 4HBCH 4NSKA 3LKNB 2XY2A 5JA9A 1EJOL 5ESVA 2VN6A 1CICD 3NT0A 1LO2L 1ESOA 2H6PB 2R0ZL 4LBEB 1QNZH 2J8UB 1JN6A 4OD3L 3WCYA 4K3DL 3DX9B 1ZT1B 3B37A 4PYGA 3KCPB 3DOIA 3MRNB 1XZWA 3FTUA 4G7VL 5FUZH 3NCJL 3TBVB 2HG5B 3N44B 3G9VA 2OL3H 1C08B 5CD5D 3ISYA 1OGAE 2O30A 3D50A 3LNDA 4IRJC 4HV8A 3ARWA 4OD2B 4OVUA 1KLGB 1KY6A 3QJHB 3FONA 4ALAL 1NDMA 3O3DB 3ZTNH 1XO8A 4D0CB 1QRNB 1KGWA 4FQXA 5IBTH 3L5IA 4EIUA 3O8XC 4YDNA 1JFQH 4YHKL 1HHIA 3QQDB 1A1NB 1I7RA 1NGWB 3OJ2C 1QFUH 1Y0LA 1YNTA 1JZ3A 4EKXA 1ASQA 4KK8D 2XIDA 1INQB 4BH7B 2N59A 5AOMA 5FCUL 1IM3B 5GS2H 4ZPTB 2VUOA 2VDRH 1KTDB 2G0LA 3I6LE 2IDFA 4U1LB 3B9KC 2HA1A 4NZJA 5ADOL 1MCIA 3IRPX 4ISVB 2ZXEB 5F0LB 2DIEA 2FGZA 4IIQB 2H6PA 1FAIH 2FQFA 3DX9A 1F18A 1ZT1A 4HJJH 3KCPA 4HK3N 4MXWH 4WO4C 3MRNA 3WMSA 4YLCA 2HKFH 1B9ZA 4TNWK 2WMPA 3HB3C 3GRWH 5B4MD 4HS3B 2FATL 3N55A 1S9XB 2AJSH 3T71A 3QUMH 3QEQA 3NIGE 2VLKD 1CDYA 2XWXA 4PJHB 3DYMA 3OR6A 3V0JA 3EYVB 4ODHH 1I4FB 3MYJB 4PJ5E 4X42A 4ZI8A 3C8KB 4UI2A 5C0AD 2DL2A 5T1KD 1TZIA 4BQCA 4MFHA 1INDL 2C9QA 3KHQA 1CIUA 1AR1D 2IAAC 3AT8A 1X9RA 1QKZH 3P3TA 5I73C 1LLAA 2HX9A 3QQDA 5F6IC 3FCGA 1IC4L 3PWPD 4QHLB 2JTDA 1DJIA 2L7UA 2Z91A 2GCYA 4S1RL 4Z3HA 4PTUA 1BBDH 2BVPB 5JW5B 4NOBA 4GG6B 5HGBA 3RTQB 4U1LA 1D5ZB 3OC8A 3UTTB 5IJKA 1GYAA 3GJFK 2OSLB 1U6AL 4QO1A 4L37B 4AM0Q 4ZTOH 4EIBA 3R7QA 4HD5A 1BG1A 2CE6A 5E6RB 4F33B 1YECH 1DSYA 3IBEA 3BKYL 1EH9A 1LP9B 1WGOA 4LDCA 1ZV2A 3LN4B 5AB1A 4NQED 5CNHA 4OJDH 4PJFB 1HU8A 3FKUS 1QX1A 5CCKL 4XN4A 1KXQA 3G6AA 1T2XA 4PJHA 3AWFA 3SPGA 3AITA 3MYJA 4OF6A 3BI9X 3GPSA 1YQVL 1AOHA 4Y9EA 5TH2A 5MENE 4P2QD 3MJ8B 4KJWD 1QFWM 4GSDH 1DN0B 2HTLC 4MA1B 2VDQB 5CN2A 1NCCL 1HI6A 4N2IA 5BW7C 1BECA 2C3XA 2NNXA 3FTWA 4MBOA 5C6WH 3K6FA 4XPAL 3SJVB 3RVUD 1X5XA 5CD3B 5EDSA 3QQ4B 2OBGA 1W0WA 4N20A 1COBA 4UQAA 4QHLA 1MFCL 4GG6A 3IDGB 4EOWH 5CJXA 3T08A 1MWAA 4B27A 2K70A 1IB5A 1G9NH 1HEZB 1ZAGA 2HWZL 4JY6B 2NY7H 3F62A 5C0CB 4JNXA 3KWWA 4I3RH 3FT3B 1DVFB 4G8EB 2FNWA 5I66B 1ZCRA 5I1DA 3WIHA 2WOBA 3NACL 3DX8A 3LN4A 3FUEA 5GS1B 4C8XA 2WVUA 4GINA 1I31A 4PJFA 5D5MF 1VFMA 1A5FH 5K39B 2X88A 1JGDB 2G75B 5L2KD 3U0WL 3QJRB 2Q76B 2P5WD 5A43C 1UA3A 3MJ8A 2J44A 1DN0A 1QPXA 3S5ZA 3CFNA 1F3JB 1QFWH 1MPAH 2NY0C 2X28A 5DLLA 1QVOA 4LLYB 4JQIL 5T3XH 4XP9L 5I9QC 1LEIB 3UTSB 1UQSB 1U3HA 3UG3A 3IMUA 4GI9A 3PWVB 1ZS8A 1S7XB 1WV7T 1Q0YH 3EDKA 3ZDYE 1BQ5A 4FA6A 1ZVSB 3CDCA 3IDGA 4OJFL 2YPLD 4FNPA 3RLSA 1OPGL 1NAMA 1ITCA 2M1KA 3N42F 1Y07A 1ZS2A 5C0CA 3MXVL 4TNVF 1SXCA 3BWAA 1JL8A 3B5GA 3U0PB 4G8EA 4HS6A 3GBLA 1SYVA 4KOBA 5I66A 3QPKA 4N2MA 2J8HA 5E8DL 1YEEH 1KDIA 2KLTA 2Y07L 2CO2A 1AGEA 2PO6C 4IIZA 4KKQA 3VXPB 3TV8A 3LKRB 4OJYA 2BS8A 2NY1C 3BT0A 3GXDA 4YHPB 5F1NB 2YA1A 5K39A 3RYMA 1CFQA 3UAEA 3E6FB 4AUYA 1JGDA 2G75A 3PQYA 2XN2A 3LB6C 4TNVK 1BJ1H 1DQDH 2DWEB 4NWUL 4HKBA 4G7YH 5FDYA 1GOFA 1KN2L 1FO0B 1XMEB 5AOZA 1F3JA 5ABDE 2EXWC 1DUZB 4QF1B 4N2EA 5BCAA 3SEPA 1LEIA 4M1DH 1XX9C 2ATKB 4TLKA 4G6AC 4F9PC 3KWXA 3A6BL 3ZIYA 1OE2A 4W68A 2HVBA 3UOAB 4YSTA 1GKOA 3GINA 4D3CL 2VDOB 2OZNA 4FQIH 2FJGA 4XNMB 5EO9B 3U7WL 4KZDH 1JD7A 4NHUA 4KFMA 3O3AA 4JVPA 4AENA 1LEGA 1Z3RA 3WD5L 5A16B 3GT6A 1KULA 3FTGA 4G42B 4YXLL 1A14L 1QYGL 2MQ0A 5I2IA 1J1XH 5GRWA 1A9VA 5DJAB 2EDMA 2YS4A 3U0PA 4BRJA 3OLIA 4JE4B 5D2LE 5DFAA 5CWSB 5FYLD 3AAZB 2QVKA 2PR4L 4GAFB 1L0XA 1VFBB 3VXPA 2D2CC 5F1NA 3HOGA 3VGDA 4GP8B 4NOFA 2AEQH 3E6FA 2ROXA 3OKEB 3FBQA 1R24A 5D2NE 4FNRA 5CJBA 1NIFA 1MFEH 3BHBA 5FHBL 5BZDA 5KVFL 1FO0A 1T21B 4KH9A 4HIJB 4CUCA 3RY6A 3CLFH 2Q10A 1DUZA 4NC0B 3VXSB 1KPRA 3QUZD 2PPCA 4JDVB 5B1CA 3FB8B 3LQMA 2YQBA 4MAYC 3H9SE 3TU6A 3BWSA 5I30H 2Y7SA 3LEYH 3HHRB 3T0BA 4J7RA 4G8GE 5M7QA 4NNXB 3QO0B 4WY7H 2JJTA 5FOJA 5JXEA 2NY4D 5EO9A 3FAXA 1CS6A 2HAZA 1AMXA 4HAFA 2ZKWA 1P4BL 2YXWA 1CGYA 5A16A 1UZ8B 3EYOB 4G42A 3VXOA 3N06B 3JTTB 2KHAA 1U42A 3B34A 3B3BA 3P40A 5I5JA 5J7CC 2E76C 2F0CA 4RMQA 3DURA 1VFBA 1A3LL 2Z31B 3FHEA 3GSVB 2HXAA 2ZX5A 1NGXB 4HHGA 4M62H 5I8OH 1TG8A 5DRZA 3RNQA 3RWCA 4P4RA 1YYLH 2YC1A 5BJTA 1N59B 3GXTA 2W0PA 5FYJE 4UZUA 4YWGL 3RKDC 4EZKA 2FNBA 1W72H 4UV4L 3UBFA 4HIJA 2VDPB 2BSSA 4R84A 3S96B 5IHHA 4YHLH 2QQKH 4WEBH 5C0IA 3VXSA 4OB5H 3O9WA 1BQLH 3KLQA 2PW2A 4JDVA 2OCCB 4HF5H 4I9XA 2W5PA 2NXYB 4FN0A 5DZLA 4ODTL 1MFBL 2I60L 3WNOA 1JWSB 1KYFA 1IT9L 3B5HA 4HCRH 1FH2A 4F8LA 3RVWC 1I3GL 1AQDA 3QIUD 5CXPA 4PR5B 3JT2A 3KCWA 4XO3A 4Q2ZB 4PYHA 5DFWH 1JYVA 3ARTA 4XP4L 1ZGLB 1HXYA 2XV6B 3DXAB 4PMFA 2AAAA 2KLSA 3QARA 5GJSH 2FO4B 2IBBA 1RLWA 1CD1B 4G6ML 4TVSa 3JV4A 5IFJB 2JKJA 3I3BA 4WNJA 2XTJD 3DVGA 3VXRA 3HBZA 4KJPD 5I1GL 2DQGL 2ETWA 3GS0A 4AEFA 1XL6A 3O11B 5JNYB 2WQRA 3IJSA 4QJ4B 2Z31A 2WNGA 4DSYA 2K1MA 2VLJE 2WCSA 4Q6IB 4X4ZA 3D30A 4J28A 1JYNA 4Z6AT 4JFSA 3IFNH 3LRSA 2G4EA 1HZKA 1DLHB 3BAXA 4NO0B 5CD5C 4RBPK 4ZAKB 3S96A 1LVEA 4JZJB 1G7LB 5L4IA 2ADFH 2PABA 2ZXCA 4JW3A 4A6YB 5C07B 1YLBB 5EULV 3F12B 3MV9A 5ALCH 3ECVA 2CJSA 1JWSA 2FVNA 4AEIH 2YA0A 2DI7A 4LRIA 4MKMA 4JDTL 3OJMB 2EH8H 2OJ1A 2P9RA 5BOJA 2B1AL 2BK8A 2DEXX 3PHQA 5I18H 5J57B 3DI2B 1GHFL 4X7CC 3PHOB 4YXHH 4HC1L 3EO0B 3EYFB 4K94L 4KK8C 5IFJA 2D3VA 4X4MA 2ZOLB 1FL3A 4JN1L 2XFXB 5JPMB 3PF2A 1E4HA 4QRTB 3TPUB 4N28A 2OS7A 1UGKA 2EEXA 2JJVA 3ZUNC 4U6XA 1X7TA 1N0LA 4EUPA 1BAGA 5BRZB 3H9ZA 4W9DC 3I6KB 2EKJA 3PJSB 1NWPA 1QFHA 5B4MC 1PZUB 1P6WA 3G5ZB 4KUZH 4ZW8A 3FO2A 2MNUA 4ZOBA 3LS4H 4K23L 3POCA 3HBQA 4FNLH 2GK0A 4ZAKA 4JB9L 5A7BA 1G7LA 4PRPE 4YR6A 1E27A 1FE8H 3LYRA 4OAWB 4X6DE 5IK3B 1CI3M 5C07A 1EA9C 2IGLA 3F12A 4MDIB 1Q9WB 4JQXA 4FEIA 5EBWA 4LCWD 1L7TL 4DEPC 4Q9RL 5E99H 3VFTB 1M7UA 5F71A 2PNDA 2UXVA 3C60B 3DBXA 4BZ2A 1I9JH 5GS0L 5KOVC 4R4FL 4A55A 1YN6B 2BNRA 2WXNA 1J0HA 4IDJH 3VFWA 2V9QA 1J18A 2BVQB 2X87A 5HJDA 2QQLH 4XBPB 7TAAA 3VD9A 4R90L 4LRNL 4HUXA 3UGXA 3PY9A 5KS9F 1CLOH 1HYRC 1RIHL 4QRTA 3M1CA 3TPUA 2C34A 2K3HA 4Q7DA 15C8H 3A24A 2WLZA 2OP4L 5KZCB 3HI5H 1DBKL 4XCEB 2BHFA 4ES8A 1S5IH 4ZD3L 1IARB 2EXYD 2XN1A 3UO1L 1C8QA 3V8CA 3I6KA 3TV3H 2PTUA 3MROB 4PV8A 3G5ZA 2ESVD 2GSGA 3IE9A 5JHMA 2OW7A 3DVIA 4TXVB 4B0MM 4QLRA 3B9AA 1N5YH 2F54B 4CSSA 3FC8A 3HAEB 3QG7L 2H0FA 3AREB 5IK3A 3H3KA 3SY0B 1KLFB 5DO2D 3JWNC 2JKRM 4JRLA 3TWCH 5DHDA 1Q9WA 1D9KA 4GRWE 4OJAA 2A6IB 2BOCB 2CBMA 2E6QA 3QFJA 2V2XA 5IR1A 4LEOB 5JDJA 3O2WL 4FFYH 3CHXA 4LCIH 3M46A 4QY8B 3C60A 4L3EB 3RVUC 1EBPA 4B9YA 4ZMZA 4RFNC 1YN6A 1HAWA 2BVQA 2F8OA 1KBGH 4XMZA 1QW9A 1X3DA 2P5EB 4WJKB 3X11A 3AG4B 5JOFB 2ZP9A 2KS0A 3DA0A 1V7NH 2XIBA 43C9B 4KKBC 4LHUB 3IVKA 1KIPA 3TASA 4LOUD 1JPFA 1WH0A 3CBJB 2FQGA 3IDXL 4GKLA 4PJDB 2FO1A 1HNFA 3BH8B 4XCEA 1VF5C 1KC5L 1UYWH 1ZDQA 1JV2A 3MRBA 3X3GH 3KYMA 4JFZH 4OZIB 3UIYA 4NQDB 4IHOA 2XHNA 1B0RA 4XXWC 5IVXF 4WDIA 1F1DA 3MODH 4XNZB 4R26H 5DQDL 3QYCA 4P9ML 5DWUL 4A39A 2V33A 3KPSA 1RSFA 3ALPA 5KYYB 2DQIL 1ROWA 2BOCA 3CSFA 3AWEA 4LEOA 3N41B 3ZL2A 2X3BA 1QRNE 3IMBA 5KVEL 1SRDA 1LDPL 4HWBH 4QY8A 4L3EA 1CWVA 3GM0A 3TT1L 1MAML 4EN2A 5EBMB 1L4IA 3KPOA 2PMZA 2X4QA 4FTVB 5IBLC 5CGYD 5TQ0H 1A3QA 5JOFA 4PRIA 2Y5TA 4BH8A 4OCRH 4AIXA 2MEJB 2XWTB 4JG1L 5MP6L 43C9A 4AW7A 1WEJL 3FT9A 1XV8A 2Y1ZA 2H26B 3I6LD 4IK6A 4L18A 5B3NA 4JFHE 3FYIB 1Q8MA 1E65A 1VB9A 3HG1D 4NHCH 2VW4A 4OZIA 4TPRL 2CR6A 4N2AA 2EVFA 4Y1TA 2YQ3A 4A66A 1J0KA 5EO1A 5E08L 4UMGA 2I5YH 4PJHE 3ML8A 5J4MA 3VX1A 2IWKA 4G5ZL 3CZKA 4YL9A 1OSYA 3P9LA 3QQNA 1OSPH 1EERB 2YK1L 4LIQE 4PJ5D 1Z9SB 4BFNA 3RP1A 2FCBA 1FLRL 4ORZC 4GBXA 2XQYA 3IFPA 4F5CE 3CBRA 1SF3A 3L3KB 3II2A 3QRGL 3HMWH 1HKLH 1O9ZA 3QQ3B 4K2UL 3E38A 4H0HB 2EQDA 3FN9A 3O2DH 5ANMB 2IPUG 2FD6H 2DQFA 4FTVA 5LG1A 2NZ9D 1AHWA 4GG6E 3S9DB 3MJ6A 4U7MA 3B7RL 3UTTE 1GCFA 2V5RA 1IBBA 1YRKA 1UUNA 4DKTA 2IOOA 1KG0A 5DK2A 2WLIA 1FIGH 1PZBA 5DUJA 5I1JL 5E23A 1LP9E 3U7AA 3W11C 3IDUA 3US1A 1HESA 4PJFE 4KJYB 3TBTB 3CHPA 5D70H 3W9EA 4AVHA 2O61B 3P9MB 4RGNB 5F1SA 1J48A 3FT2B 3L48A 4RRPA 4AYDC 4JFDB 3X1GA 1PYWA 2H2SC 3ESNA 4DGVL 2AABH 1GZQA 5I5MA 3TBWB 3TO4C 4O5LH 4M5YH 3SOTA 2Y6SD 4B9KC 3FTXA 4HSQA 1Z9SA 3P2DA 1NLDH 4N5UA 3IJ9A 4PHZA 4FQJH 3T2LA 1OAUH 5J12C 5AVSB 1JF6A 2APFA 4P04A 4YE4L 3QQ3A 5IKCB 3BSZA 4YBHA 1SJEB 2NY4C 5FXCH 5ADPH 2ORBH 4IGBB 2H45A 3NFPB 4HUWA 5DFVC 1JYXA 4WI8A 1UA6H 1V7ML 2ZXWB 3E8UL 5TF0A 5C0CE 3UBGA 5FYKE 2AEWA 4Q97A 1A4KA 3SPCA 2QFRA 4WK2B 1QBMH 2EH7H 2O4EA 3CFUA 4L0PB 3S5LB 5JZ7D 5HJ3A 5AFAA 1AYOA 3P9MA 4FC3E 1JPTL 3FT2A 4LPCA 3PQYE 3PNWA 3GZKA 1DR9A 2EE2A 2ZAIA 4JGJA 4HPHA 5BO0D 3TBWA 4WUKL 4ZUUA 1MFDH 4NO3B 3TL5A 4Y4KC 4IRSA 1MH5B 3MNMA 1AZVA 2W9EL 4G8FB 4ODXB 3PGCB 5FYKU 5C0JA 4ELDA 2FJHB 4NZUL 1RI8A 1BZOA 4MSWB 4OIIL 5DR5H 4KI5E 3QIUC 3SZ6A 3HC2A 4KDVA 35C8L 3ZHFA 3BUYA 3LNGA 1RV6X 5GRJH 1SJEA 1R5IA 4IGBA 4Y5YB 1MF2H 3BUQA 4NQVB 5DD6B 2WJ7A 3NFPA 4WTZA 2HPTA 4BZYA 1B3JA 4XMPH 2WIMA 3ZHNA 1NCBL 5DMKB 4J3OD 3LQZB 1T83A 2XTJC 3MKKA 4KJPC 4UOW0 3H2PA 1KIRA 4EI5D 4LNVA 5IESL 2RACA 1AP2B 3GJEB 4UYPA 3HE7B 5AW0B 3S3DB 1KGCD 5F7NC 2I9LB 4LSUL 5DJ0B 1XGPA 4JM4L 4Y4FB 1J8RA 3O4LB 3LPOA 4NUPA 4X98A 1AD9A 3ATAA 1AGDB 2VSKB 3TONA 4G7SB 3FUKA 1OALA 3K8KA 1OHQA 4JQVA 4G8FA 4BUGA 2DH2A 5TE4L 5J11B 5E4IA 3PGCA 3BDYL 1ZSDA 1L9SA 4WI2A 5IHZB 3DPBA 3JWNH 4MSWA 3MUGB 1HZHH 1R75A 5HHXH 3N3EA 1M2OA 4A7VA 1C8PA 1KB3A 3ULVH 5IB5B 1LE5A 3BIAX 1B2WL 3CK0L 3QPQD 1F58L 1Z5HA 4LLAA 1T6WA 3HA0A 4M1CD 5IW6B 2VR5A 5GGQH 1SJMA 5LBVA 3S6CA 1W6WA 3OKLA 4AG4L 4NCDA 1GCYA 3UZEA 3RWGB 2HH0L 1AP2A 4J3XA 5E2JA 3HE7A 4L4JA 1OB1B 1YEFL 1GY1A 4DETA 4CC1A 1IQDA 3V5HA 3W0WD 4XAKE 4FP8H 2I9LA 2BFGA 2J8OA 2VXTL 4TYUA 4XPBL 4OCWH 2D9CA 3VFGL 3BPNC 4PLNC 4URKA 3VFNA 1EZLA 5T5FL 4G43B 1K4DB 1TLKA 2XZQH 2R7EB 2IAMC 4JJOA 1NFDB 3A6CH 3FPYA 3PAZA 3B56A 4OLUL 3CMOH 4GMSH 4WF7A 5DRXB 2L04A 4U1IB 3VXSE 3VD5A 5C0RL 2EEBA 1M1SA 5IHZA 1RZKL 3V9FA 2DOCA 1MAKA 5AVUB 3GMQA 2OQJB 3G9AB 3P3UA 1A7NL 3FB5B 4G6FB 1MELA 1G4MA 3S88L 1IVLA 1YEIL 3LXUX 1WGVA 1MW3A 2CHNA 5IB5A 3CWGA 3FSOA 4Y5XC 5J06A 4DWHA 1AQHA 1ZTMA 3G6DL 2MIZA 3F58H 1LO0H 5F7LB 4OGYL 5D7SL 1QHOA 3GIVB 2E7LA 2FJFB 4FXGA 3L3OA 4OKDA 3RWGA 1TTFA 2J1ZA 2XWEA 3IRCA 6CGTA 3RVVD 4JG0H 1KENL 3L4YA 1LO3H 2UZYB 1DSWA 2OMVB 4BFGA 2FB4H 3V0EA 2V9TA 1K4DA 1PLAA 3LH8A 1VENA 5LGHL 4P5TD 3B9EA 3MLYL 1I1CA 4O4YL 3JT0A 4PGDB 1GIGL 3WNMA 3KYKL 4XZUA 1OAKH 3NJLA 5DRXA 4FCAA 5HGHB 3IAPA 3MV9E 5LGJB 4S1QH 1XT5A 1H6EA 1KXVC 4NRYA 4AGPA 4YC2C 4BQBA 3RZWA 2B1HH 3MRLB 3QZMA 3FB5A 5F97E 5SWZD 1PGRB 3BAIA 5CSZB 2JIXA 3RIAK 1E6OL 2WNKA 4EE2A 4NPYB 4ZJ9A 4R96A 4BK5C 4L9LC 3EFDH 1K3ZA 2NY6B 5C6TH 1NINA 3GIVA 3FDWA 3FU7B 5DUML 4WTZG 4DN3L 1AC0A 1F90H 1RHHA 1R3IH 3WIIH 4ANWA 4ERSL 3ZIMA 1KTBA 3RWIA 4XNXL 2F8XC 3V52L 5I1KH 5ESAB 1Z9LA 1N26A 3NSFA 5HHPA 4U6VH 5D4JA 2VLJD 2FT7A 3S5LG 3SOBH 3I3DA 2EO1A 1BMGA 1RZIB 3P2TA 4PGDA 4U1JB 5C2BH 3WKPA 3UROR 3QJTB 3ZQXA 4QT5A 5C07E 5JPNB 5DEJA 8FABB 3MA9L 4XP6L 5HDBF 4RX4D 3FZUC 5GRXG 4H13C 2NMSA 5JW4M 2EE0A 2DBJA 3GXIA 5DVOA 3HG0A 4DK5A 4M4RB 2V2TA 4OCLC 5D72H 5CSZA 2WZAA 3OGOE 1XB6A 3RWHA 3FQUA 2GUYA 3I9IA 3T0AA 1REIA 3W81A 1T1ZA 3GI8L 5CGYC 3KWTA 5AG8A 1KYOK 1I9EA 4ZFQA 3UJJH 5JIQA 1S6NA 1JZ5A 2WTOA 1V54B 4L4VB 2ED9A 1E5BA 4UT9H 3V4UH 4XBEH 1CLYL 1RULL 4A7GF 5L88L 1VIWA 5BRZE 3PFQA 1MCPL 3I6SA 2VZVA 2XVLA 2ZCLH 4G6KH 4HBCL 1WG3A 4FZ8H 1FLTX 4Q14A 4WFEE 3TA4D 2O5ZH 5E6ID 5JPNA 4XN8A 3FUDA 3BAWA 1QNZL 1C5DB 3QEGL 2V4LA 4PRPD 1SOKA 4AY0A 1BD2B 4DZ8A 2GHZA 4GFTB 3QDMB 3S8FB 1M2VA 4JY4B 4IKKA 2OL3L 3L4VA 4UB0H 1AJ7H 3ZT7A 3P3YA 2HFFB 2D4DA 1T7VA 4ADGA 1BAFL 1KB5A 5J1TC 4NWTH 5BQDA 2C4FT 2NZ9C 4JVWA 5D93B 5E8NB 1WC7B 3BE1H 4P23D 4C83B 4QWWD 1BZ8A 4NZTL 5C0GB 5CMAB 3ZTNL 3AY4C 3FRPA 4KKLC 5EC1A 5GISH 4DP1X 1KTLB 5MERA 1EHNA 4QYAA 3ECUA 4FZEH 4JKPH 3X1BA 3ZYIA 3MJ9A 1JFQL 3PGDA 2WAQA 3S4SA 3VG0H 4CC4C 4JLRB 3FHAA 1QFUL 3JWDC 1MCJA 4ZFZA 2GJRA 5HYQB 1I8AA 4A2HA 2ZSVB 2F54E 2R1WA 2VDRL 3QK0A 4I0PB 4UT7L 3IMTA 5ICYB 3CZSA 4HJGB 3DWTA 7CGTA 3KPSE 1Z0NA 3O3UN 3N2JA 4Q9BA 1FAIL 1C5DA 1MHCB 2V17H 5J9PB 4HJJL 1BD2A 4MXWL 1OEZW 3VSVA 3L45A 1GTNA 2PTVA 3QIBC 3T4YA 2HKFL 4UINH 2JCCB 4M61B 2XQYK 3GRWL 1ET8A 1YEGH 5D9SB 4LCCC 2EO7A 3L6FA 1PIGA 4JY4A 1NAKL 4L3EE 2AJSL 5ICXA 3LZFH 3D2UB 1JD9A 3QUML 4JHZA 4NUGH 2OMZB 2GW5A 2HFFA 5IQLA 3P4NA 4GRMB 4P3WA 3VWJA 2P5EE 4I18C 4C83A 1MHEA 3BP5B 2WYIA 2A74A 2X38A 4UOQA 5CLYA 4W9GC 3F7RA 3C9NB 1R5WA 4PJDE 2AZAA 1KTLA 4OM1H 4EVNA 1E43A 4Z8FH 3KG5A 2QR0A 2OR9H 2NNAB 1S3KH 4NAMA 5DJZB 1WE5A 1FA4A 4R4BA 4W4OC 4OZIE 3CFKB 2J3SA 1L9RA 3H6JA 2EC9U 1T89C 5LXVA 4IMLA 1BBDL 1BEYL 2ZSVA 3X3FH 1J7VR 4LOEA 4I0PA 4CAGA 4MB5A 5E5MA 1M57B 2NYYC 2BZDA 2DL9A 4ZTOL 1O5DT 2HT3D 2LR4A 3B8YA 3TEUA 4XO8A 3D52A 4ABVA 4K15A 2Z8SA 4DKFH 1EV2E 1DTUA 2MTAA 4M61A 4MZRA 1UD5A 5E2WL 5I0XA 3GGWA 5D9SA 3Q5OA 1KELH 3MNWB 3O3EB 3LDBC 5I0ZA 2H6UA 2JLLA 2AEPH 1QRND 2OMZA 2X5PA 3ELQA 3IKCB 4G1MB 4X6CB 2OMWB 1I7ZA 5F9WB 4KZ0A 4AVKA 1QSFA 1XBDA 5CF3A 2PYEB 4FTVE 3P30L 2VB5A 1PY0A 3BP5A 1J9QA 5PCYA 1FL5A 3NYKA 1MNNA 3QJXA 3CE1A 1JFHA 2VH5H 3KEHA 1IM3D 1TFHA 4LDEB 1IL1B 4LPXA 3D09A 2H1PH 4FLQA 4EI5C 5HSFA 1JJUA 4F15C 3DUSB 5DJZA 1F4XL 2W59A 4FHBD 1OARH 2O5YH 1YN7B 2X2JA 3PXHA 3DKHA 2FYVA 1IC0A 3W37A 2ZUQC 3BKML 4N6RB 3ZBMA 5JIDA 4GG8B 1OP3H 1LO5A 3BFWA 4P48A 3T5WA 4EOWL 4ELMA 2I7SA 4Y9FA 4XMXA 4DP8X 2VQ1A 3KL5A 4LSQH 4I3RL 2DW5A 4ODUB 3KL0A 4ZUSB 4PSRA 5C2UB 1TTUA 1IMHC 1N12A 3O0RH 5DJYB 3T2PA 3CVCA 3IAQA 2B39A 1A5FL 5E2TH 4X6CA 3QCUH 3IKCA 1MY5A 4G1MA 5FECA 2WZ5A 4PU2A 4QRPA 3HFML 4H88H 4R5TA 3T2QA 5K9JH 3N43B 2PYEA 3DROA 3F00A 3MRPB 1M4KA 5IQ7H 2GHWB 5ENWA 1HWGB 1A7PH 1QTYT 3QPQC 1SEQH 5HPOA 3VI4F 1QFWL 1MPAL 4J1UA 3V6BR 5T3XL 3RTQD 3UTTD 1TCMA 1X5ZA 5B3JE 3WNLA 4Z7QB 3REVA 1YMMA 3DUSA 1HWHB 3TF4A 4PTTB 1T4KB 4RFEA 1XH2A 3FRPG 2V0AA 3H9YA 2EUVA 4PG9A 3MLVL 3U2SB 1Q0YL 2BVOA 4DQAA 1U8KB 3HCVA 4H20H 4MQ7B 1AD0A 4AJWA 3ARDB 4EPSA 1VACB 4LGSB 2JJSA 3KGTA 4JFDE 2IFFL 1RU9H 3ARZA 3BMVA 4L8DA 1E5UI 5EU5B 1WS7A 3CPLB 2NUPB 2WSPA 1CD0A 2VXUH 4IS6B 4NN7B 1BQSA 5D2NC 3AS2A 4UTCA 5F72S 3S34H 5A2FA 3PDOB 4WIQA 1YEEL 3C87A 1MIEL 3CQQA 5HHVL 5DJYA 1I7TA 5I1LA 4K3HA 4KVCH 1EEZA 5DURB 4UIKL 3QW9A 1YEHH 4MJIA 4PJEF 4AQ1B 3SJVD 4H4NA 4FJ6A 3HNTL 5CEYB 3WO4C 4OLZH 3O6KH 2XLLA 4G7YL 5KN5B 2P3YA 3GTVA 2K4AA 2XWRA 4FQCH 5L0QC 1ROCA 1EO8L 5BQ7A 4KY2A 3FFCA 4MDRA 4Z7IA 4HJIA 4M1DL 2MOQA 1JP5A 3FH7A 3IYLW 3MC0A 4YGVB 3RL1A 1ASOA 3RVVC 5C0CD 3KPTA 5FYKD 4PJ6A 3HKFA 1IO4C 1BPLB 1DVFD 1PLGH 3V5KA 2XYBA 1HXMB 1PW3A 2Y22A 4FQIL 4OGXL 3AUWB 3HUJB 3ARDA 1A2YB 4FQ1H 2MNJB 2SEBA 2JH2A 3G5VB 3CDYA 4P5TC 3U83A 5L4MA 1RZQA 3VM5A 2IOMA 3I50L 5EU5A 1OZUA 4P2OB 5ETUA 4EXPX 4IRZH 1J1XL 1SHWA 4YSEA 3CZFA 3KD4A 4J2QA 1N4XH 4QNPF 5AUMA 1UXSB 2Y36H 3W9DB 1C16A 1OF2B 3ZE1E 1E30A 4AYID 4PJCB 2DWDB 1LMIA 4WAFA 1N3NB 2AEQL 4AQ1A 1NL0H 2JFCA 3UTSD 3ZE0E 5CEYA 4L8CA 4D7PA 2MSPA 5DHVA 1D2PA 1MFEL 4LQFH 5KTEL 4EQ3A 2YFOA 4CMHC 1KGIA 5EO0A 1I8KA 5DGQA 1JK8A 2ZCKH 3IN0A 4DPAX 1P1ZA 5J0BA 4QTIL 1U36A 4HMDA 4YGVA 4L48A 5I30L 4AIOA 4LDOB 5D8JH 3LEYL 3NGBB 5BV7B 5C0DB 3Q8BA 5DZVA 4TULH 2R2HB 1HXMA 4L8BA 2JNZA 1WIOA 2XZAL 3KNBA 1A2YA 3O4LE 5JW4Q 4Y0GA 3O81A 3AU1B 3ET9F 3G5VA 1Q94B 4MDJB 4PRNB 2G60L 2E6PA 3JWDH 1ZXQA 1UWGH 2YRPA 3PABB 4RDQG 2DB8A 2O6PA 4RZKA 5HHOB 4AE1A 1ZKAA 4OLXL 2ZOWA 3ZMEA 5I8OL 4Y5VC 2LABA 1N3NA 2WBKA 1SN0A 3T8XB 1YYLL 2VR4A 4JHWH 1XCTB 4JK0D 2YEZB 3RGVA 1R3LB 1IRAY 1HQRA 4HJ0D 4Y16C 2NYZA 3LZRA 2B3RA 2OTUB 1T0PB 3K0YA 2N56A 2BCKA 1E4WH 3MZTA 4YHLL 1CFTB 5ACZB 4WEBL 3ARXA 3I9PA 1BQLL 2RQ8A 4X9HA 3UZVB 1YPZF 2FX8H 4HF5L 3WDJA 2YBRA 4WHCA 5I71B 3QWQB 3OF6A 4HCRL 3GXFA 4AM0B 1HE8A 4FFVD 3ZL4H 1EZVY 2EEFA 3DOSA 2DYPA 3L2LA 1L7IH 4PUBH 2R0KH 1A9EB 3PYCA 1TZOA 3ZYZA 1RZFH 3CVIH 4E9LA 4GFXA 3FU9A 1NBZB 2X2HA 1R5VB 4XAKD 1ZANH 3QS2A 3AU1A 5GJSL 4H1LB 4CNIB 4C57C 3GJFH 5DUBB 1Q94A 1TCRA 1TVBA 2B08A 3LH2L 1OLZA 2CJUL 1MCQA 2H7WA 4OFYD 1RP8A 5E6IC 5HHOA 2Z4TA 5L4FA 3LEVH 2CO3A 3UC0L 3TCTA 1U8HB 1R3JB 4MA8H 3NESA 3FT1A 5KVFE 4KRNA 2JB6A 1XCTA 3GK8H 4BA8A 1QATA 3BUPA 1ZPUA 4RGMB 3DO4A 4ORGB 4Z18A 5AB9A 2OTUA 3VGGA 1J5IA 3BVNB 3RZCB 1QR4A 4L3CA 1CFTA 1OAQH 1MJ7H 3UZVA 1T1XA 3F05A 3D18A 5ALCL 1EO7A 2FWSA 4D9RD 2ITEA 4PJ7A 1KYAA 1FFNB 1P6FA 1HDMA 3NZ8B 3PPEA 3SODB 4PS8A 1G6RH 5I76B 3QR2A 2CUHA 5LCVL 5I18L 2WBJA 1T5KA 4FHKA 1R5VA 4CNIA 2Z31D 1ZJAA 4QHMB 1IAKB 1SM3H 2YQGA 5DUBA 1EAPB 1X5HA 3WI9A 5GZOA 4M7LT 2OFQA 4PJ8A 2YGNA 3ATDA 3MCKB 1BZQK 5DJXA 3L9BA 4J3OF 3FU3A 1MEXH 1U8HA 1R3JA 2K6ZA 1UJ3B 3MRDB 4ZO6A 3LZNA 2IV9A 2OR7A 3QE5A 1PLBA 2NXYD 5HGGS 2H41A 5F7EL 5IUSA 3OHMB 4UCFA 3ATEA 2VE6B 4XMKH 3EOTL 2QHRH 2A6DB 5JQ6H 2P47B 4M02A 3CFCL 3BVNA 3LS4L 3E2HC 5E4AA 4FNLL 3RZCA 1BXXA 3QAZC 3HBGA 3FFDB 3RX5A 3DXAD 2Y2YA 3BP6B 2IADB 5LNGA 5I26A 4ZZFA 4AK2A 1FFNA 3NZ8A 3ZKQD 3BKCH 4JE0A 2HB0A 2OMUB 5E99L 1TQSA 2G5BA 4WSJA 3MJWA 3UAJD 1MI5A 3QIWB 2AFNA 2IALB 3CVDA 1DBMH 3D8MA 3HHMA 3JSSA 3MRJA 4WW2B 3QWRA 5ELIA 1E3ZA 4EO5A 3E7JA 4M7JH 4NO0D 4JHBA 4X7SH 3RIFF 5BVJB 4ZAKD 3MRDA 1ZGLP 1RUPH 2HT3C 3HI5L 3MR9B 2ENYA 3MAWA 3ABMB 4ZFFA 1S5IL 5C07D 3ZJAA 4FQQB 5GRZA 3TV3L 2VE6A 3WMQA 3RDTB 5T3ZE 2ITDB 1CCZA 4GT0A 2A6DA 3T3MB 1PBYA 1AKPA 4LCYB 3WKYA 1H3WM 3OPUA 3MX0A 4J12A 3WY1A 5C0FA 4OLYL 2EACA 5KANG 4PVBA 4WKZB 3BP6A 4UAOC 5BO1L 3ULAB 3TWCL 2ZXGA 4OFPA 5LB1A 3MCYA 1L0PA 1QD0A 3RGHA 3DDGA 1IC1A 2APVA 2X2UA 4CGUB 2DDQH 2VC2L 3C6LB 4P5MB 3BN3B 4CN4A 1U33A 1FAKT 2EVJA 2A6KB 3GBMH 4FFYL 1V3MA 3BPCB 5IJKC 4LCIL 5DJ8A 1CTNA 4IIQC 1IEAB 3BWUF 1MNUH 1E8WA 3QIWA 5D55A 4LKCA 2IALA 1B0GB 3UL4A 4LGRB 2GK2A 1KBGL 4WW2A 4YIQA 5BRZD 1MIMH 3MBXH 1HT6A 1WQVT 2JI2A 5F9AC 1V7NL 5MI0B 2IIJA 2DQHL 4N68A 1TIUA 4LVEA 2J2ZB 3V10A 3SDAB 4NC1C 4DUVA 4GEJA 1SEBB 1QPPA 2R83A 1ZHKB 4WFED 1BD2E 4Z5RA 3L3JA 1MDTA 5D1ZA 2V8MA 3X3GL 1CLZH 3OXSB 4JFZL 1SJVA 4Z7OF 5FYJH 3RPIA 3AGVA 5H35B 1L5GB 4J8RB 4U1GC 2YD8A 1CFVH 4BSWB 2IV8A 2GIMA 3P73A 1R0AL 3RE0A 3WE1A 3O6LH 5EWIH 5A2IH 5DEZA 2OL3B 3C6LA 4P5MA 3E3QE 5IEKA 5C0ND 3RTQC 1Q0EA 2J1XA 3BPCA 5CJXC 2D7TL 3MRIB 4B9ZA 4ONFH 1IEAA 3F5WA 1HSAA 5J3HD 5KZCD 4ZS7L 2A3TA 5CIPH 1A1MB 2APWA 5F7DB 1RH8A 2LAGB 2WINA 4QUOA 1QWUA 3VFMA 2NNCA 1DUYA 2AV7B 2E74C 4OCRL 1UZGA 1F41A 4H1LG 1MCKA 3TTSA 3EOBA 5KWYC 5HHME 2QELA 3QISA 3SDAA 3K91A 2F54D 7PCYA 1JF5A 2K3TA 3ZT6A 1U8JB 3ARED 1QQDB 3G3LA 2PP9A 1E9OA 2P5PA 3GWJA 3OXSA 4NHCL 4DERA 1MCOH 4ZT1A 2VDRB 5HHNB 5FA3A 5KBPA 1ITBB 3N0AA 1NPJA 1ZLVK 4RFOL 5IJBC 1L5GA 2RCSL 4NENB 2ATAA 1VADA 2C5DC 4JO2H 3L1EA 2I5YL 3FW6A 2ZPKL 3PAUA 1U3HC 4BSWA 5ESQB 2WXGA 4MCZB 2GUOB 5G5DB 4ABUA 2IDSA 4FXTA 2GABA 2WGNB 1UD6A 3AADB 2Z35B 3LRGA 3RGBA 4AGMA 3HZMA 3MGTA 3QORA 1BXVA 2P5ED 3QUMB 1OSPL 1IBYA 4K9EC 4YLQT 3V6FA 3ZW3A 3D34A 2XI9A 3MRIA 4LHUD 3Q3GB 1JNHB 4I5BB 4WVRA 3BGAA 3DV4B 1R3KB 1HKLL 4UQ2B 1N8ZB 3IS1X 3CDGB 3QHFH 3WUWB 1A8ZA 1DVFC 1IEBA 1A1MA 2IGFH 5F7DA 5D7JA 2FD6L 5TK2A 4M1GH 4NQDD 2HUHA 5GS1C 4ELME 2VJXA 2VQUA 4TNGA 4LAQH 3Q6FB 5GGVY 3VFPB 5F3HA 4E9SA 2Z7UA 1JS4A 1V27A 3T6ZA 3MRMB 2VDLL 4HXAH 1CE6B 4ENZA 4PD4J 1UENA 3RI5F 4BZ1H 1IAMA 4ZMXA 2QGCA 4HFWB 2Y23A 4FQHB 4X6CE 5D70L 4B96A 2WB7A 4YHOH 1WSST 4RBPH 4JM2B 4QRPE 4E36A 2Z3FA 2PYEE 5ESQA 1ANUA 4MCZA 5G5DA 4AQ8C 4KI5C 5E1AB 4ZS6D 4B9JA 5KVEE 4M6OH 4P4KA 4M5YL 3ARVA 4DP0X 2LFGA 1K8DB 6FABL 4FTVD 3PAVA 2PPFA 1MZZA 1NLDL 3RI5K 1JF1B 4DQOH 4KK5D 1YMME 4M7LL 1KCSL 4MJ5B 3WXVL 4NLAA 4A7TA 3I2CH 4UQ2A 1BFSA 1ETZB 1QLEH 3WUWA 1JK9B 1BGXH 4GO9A 4MQSB 4RMSA 1KPVB 5ADPL 1YEJH 2DKSA 3JWOC 1JVKA 2GITB 5DD0H 4ELKB 1BFOB 2VMDA 3QC6X 1UA6L 4PMEA 1PD0A 4U0RB 3VFPA 3MUJA 2X0WA 3UTOA 4BE6A 4MXVF 2VLRB 4ZSOB 1S7SB 2J1KA 4BV1A 1KZQA 5KVMC 2I7OA 1CE6A 1J88A 2PP7A 2VGLM 4JZNA 1G7HB 2XN0A 2BJMH 5EA0H 3RY6C 3ZYJA 2Z0BA 5GGSY 2EUZA 5CZXC 3VQ2C 1QACA 4GQZA 4XE0A 1S7UB 3CXHK 5F7YC 3TH2T 4WEMB 3ZDZB 3TIDA 3FQYA 2HRPH 4YDKH 3OMAB 4HJ0C 4PCSA 1EDYA 3ALWA 4GRWH 1NLBH 1M05B 5F2FA 1CE1H 1JTOA 1YUHB 2QKIB 3OPZL 1K8DA 2AHIA 3EOYG 3LTVA 4WI0B 1HINL 2JJTC 2X1XR 5JXEC 4M03A 1OANA 1EXUB 1JF1A 3UFIA 3FFCE 4Z78B 5AD0A 2XV3A 4OCYL 4Z7QE 1TZGL 4Q0XH 4TUJB 5CS7A 4GAAA 4JN2B 4P2YA 2DEWX 3V2AR 1JK9A 3QH3B 2IG2H 4KKAD 4U1NB 2OMBA 1INEH 2EAEA 1A22B 1KPVA 1XR9B 4U7SA 4Y2OB 5DTFB 1MF2L 4X6FB 2GITA 3DBSA 4LEXH 3WFCH 4ELKA 4AJVA 4XMPL 5FIEA 2UWEF 4BM7A 3HZYB 4J3WA 1QSZA 1CBVH 3FQRA 5IB4A 1BQUA 4RGND 1A3RH 4LDLB 4F9LA 5C9KA 2VLRA 3FRUB 4JFDD 4ZSOA 3SGJA 2EE6A 2APTA 2ID5A 2HKHL 4LCVA 4FNUA 4NPJA 1IKFL 4NYLA 2BP8B 1XIWB 5IMMA 4J3UA 5J1SC 3FUJA 1S7UA 4K3JL 2DD8L 2J8UF 3NEXA 1IQWH 1OTTC 2MKLC 3Q8CA 4DUWA 2QKIA 5DWPA 1I1YA 3FF7A 4WZ9A 3IWUA 3N44F 1PD6A 4KBPA 3EUUA 3I9GH 1IM9B 4IGBD 4Z78A 1YNLH 4TVPL 5AKRA 2YOAA 3KE0A 4LPWA 3FCTA 2ADJB 3P4OB 4NQSB 3AQZA 1XGUA 1U8IB 3HMXA 5AVXB 4AVIA 1HIMH 2UXFA 2YLHA 5IHWA 3L7EB 1TEFA 5DTFA 5IMKA 3TNNB 2Z31C 2CKBA 1RUAL 3ULVL 2VQ4A 3FYEB 2GB2A 1EJ6A 4BQ8A 4XNAA 5GGTA 3MLSH 5GGQL 2HT4C 2CM5A 4IU2B 4HK3J 1I9RL 2CA4A 3FRUA 4S1DD 5LUMA 4CW1B 2MPAL 2OXGB 1FFPA 3VXNB 1RXLA 2OXHB 4Z3TA 4F7MA 5LDSA 2VDNH 3ASOB 3ZZ1A 2BP8A 4FP8L 2NQ3A 2CO4A 4OCWL 2GFBA 3ATBA 1UZ6F 4PJ7F 3NAAH 2NXYC 4HEMA 4ANUA 3EJTA 1H5BA 2AMUA 3COOA 4RAVB 4R7DA 1HSBA 4KX8A 4PJAA 5FO8B 2R56H 4O2FB 3A6CL 1YA5A 2CA3A 2FLRT 2YUVA 4LIQH 1ED3B 4GMSL 1XEDA 2C9PA 4B97A 3X13B 4XPFL 4D2NA 1ICTA 1IM9A 1KJ2L 4JRYB 5T1LB 6PCYA 3OKOA 5HVWA 3GI9H 3P4OA 2ADJA 4NQSA 2AI0L 3P9WB 1EWHA 1U8IA 1OZTG 2Z7ZA 4AC4A 5CP7A 2NX5A 3G5XB 5C0EB 1CGVA 1TFPA 4CC0A 1EEYB 1TENA 3VGBA 1GC1C 3HE7D 3TNNA 4Z0BL 3A5VA 3WUWG 1D7BA 2DI9A 4IRJB 1LO0L 4JGMA 4Y4FD 4Y88A 4NCC2 1WICA 2BNQB 2B4CC 3O4LD 2G2PA 2XZCH 1PJ9A 2AK1H 2VW6A 2OXGA 5B22A 4Z7UF 2OXHA 4GLRH 2DIBA 2P44B 3WIHH 4AGLA 5HHOE 4EN3B 2WWMD 5D7IF 4ZAKC 4JRXA 3O8XB 4JZJC 1X7SA 1GZPB 5A3IC 1QHQA 2FB4L 4OF8A 2D9QB 5CFHA 1QBBA 5EBGA 4JQXC 3UYRH 2ZF8A 1XR8B 3IWVA 1Z9NA 5FO8A 2RH0A 4PJ9B 5EIIA 1D5MB 3BD5A 1LP9F 1URZA 2AK4A 4W70A 1OAKL 1CGXA 4I2XB 3BRGC 3MBWB 4JRYA 5T1LA 1E9QB 4PFEA 2X42A 1T3FA 3MOQA 5JPMC 4N86A 2P24B 2O93L 4K9EH 4CKQA 3BJ91 1U3JA 5E8OA 3STZA 3BAJA 2OYKA 1HWWA 3K6OA 3NH7H 1V55B 3EFDL 1T6VN 1PZ5B 5C6TL 5FYKH 1TVHB 3UGUA 4LLVA 5EZIL 1OLLA 1F90L 3GKWH 3VJ6A 3KMDA 1R3IL 3WIIL 1J8HB 2YRZA 2UZIH 1X5LA 1UD2A 1CQKA 3KM1A 3LV3A 4P05A 5L6YH 3DC0A 3WN5A 4R4ND 2GJPA 5KYXB 4YHIB 5F6IB 5I1KL 4FI6A 2Q1EA 3OKDB 4RNRA 1D9KC 2EDXA 5DD1L 3SOBL 2X12A 2OTWB 4PJ9A 1D5MA 3LRLA 1JGIA 2IXQB 4G6FD 2Y2TA 1JZ4A 4FG2A 4NDMB 1EQWA 2V2WB 3C60C 1JI2A 3E6HB 4KMTH 4YPGB 3MBWA 5B39A 2QMKA 2F53B 3R4RA 3IJYB 3NRFA 2HVKA 5J1AB 2BIMA 1HQ4A 4YHNB 3CTTA 1E50A 4APXA 3LMJL 3DMMB 2COQA 3T8MA 2C7FA 2K6WA 1DANT 1XVSA 4AOFA 5J3HC 3GO1L 3V4VB 1OD7A 4NKIH 1SFDA 1XGRB 5AVRB 2D7NA 4GW4B 5A2KH 3ABZA 2ZAHA 4DFHA 2EECA 4W9FC 4ZW6A 1NBCA 3UJJL 4DPCX 1E40A 1PKQB 2JKLA 3FQXB 2IBZX 5E6YA 1JPGB 2KZBA 4CADA 5BS0B 2EICA 4UT9L 3V4UL 4LE8A 3JWOH 1CB4A 1UVQB 5AYQA 3AREC 4XPGH 5IM7A 2A1WH 3FTVA 4YHIA 3NEEA 4LU5H 3ZK0A 2EDOA 3GSRB 4DO4A 3K4DA 4R7NA 1FDLH 4KO6A 3D85A 3GBNH 3DTXB 2ZCLL 5C3LD 1QASA 3HI6H 3MMEB 4G6KL 1TVDA 2VMCA 1FO0H 3QHZL 1WF5A 3O6FA 4OZGA 1UB6B 4GKSB 2V2WA 5K93A 4TTDD 4RVBA 4YPGA 2YD3A 4KXZI 4MCYB 4MX7B 2F53A 3AG2B 4KI1A 3N1QC 2HRGA 2V8LA 3T9WA 5J1AA 2NY6D 4KXBA 4YHNA 2AXFB 3UC2A 3BT2H 1UOLA 3KPQA 2H3NA 4F8TA 3CZEA 1JSYA 3SKOA 5HI3C 3O3BA 2HJLB 3V4VA 2HX8A 4UB0L 3WSQH 3MACL 1M7IB 3II1A 4GI8A 1XF5A 1H9DA 3AMKA 2DEYX 4NWTL 1JXKA 1S8DB 2P43B 4Z77A 2Y0SA 5T1DH 3BE1L 4PP2B 5LCVA 2YKKA 1D7CA 4O51B 3DUHA 1JPGA 3F01A 5BS0A 4XNZC 4P2RB 1K4CB 5I9QB 1UVQA 4G11A 1AGBA 4AMKH 1QSVA 3Q1EA 1AQ8A 4FZEL 1EHAA 2BH0A 3GSRA 3VFVA 1P69B 1DDHB 3ILQD 4PJXA 5EUOB 1N19A 3DTXA 1UWEH 2AJZA 4A37A 5IV2A 3T3ME 2B2XH 4MRBA 2NW2A 1A1OA 5DRWB 4OVVA 2WLHA 1UB6A 1U21A 2FSEB 3IFLH 4GKSA 5D1XB 5KAQG 1PZDA 4MX7A 5BPPA 2QBWA 3GXMA 3KH3A 4ALAC 2V17L 3LEXB 1OCWH 2Z0UA 3QEUB 4NZ8A 4TS6A 1M71B 3DJTA 3MQIA 4KRLB 3UG4A 1NBYA 4GW1B 1RK1A 4UINL 3ABLB 1TNMA 4L4VD 1YEGL 5C3IA 2LLGA 1FHNA 3DRTB 5C8JB 5TGBB 1NBVL 3LZFL 2KZ1B 2Y7NA 4M56A 3ZDXB 1H8LA 2LOEA 4AZ8B 4X8XA 3WTVA 3RNKB 3G5YB 2VC2B 8CGTA 4HU8A 1S8DA 3SB3A 4GXVH 2O6CA 1MFUA 2JTYA 1MCRA 1YMHB 3EGSA 5B1JC 3HR6A 2W0FA 3EYSL 5D1QB 2V3EA 3CMGA 5KBNC 4X6BB 1MQKL 1G0DA 3KYNB 1ZRUA 4A2LA 3U2IA 3UEQA 1PFCA 2X3CA 4CDGC 1DDHA 1G7MB 5EUOA 5CBEA 1BD2D 2EYSA 1DZBA 5IOPA 3QDMD 3A4FA 4IYKA 4PEEA 2VDPH 3D05A 5D1XA 4NM4H 2WQAA 2Q8BH 1KGYE 3EBIA 5LLIC 3LEXA 3QEUA 3VCLA 1XD1A 4KQ0A 4WFFE 3QEHB 4GT7A 4WLCA 4DKFL 4GW1A 1F11B 5I1HH 5J6HA 4QIRA 5E8PA 4B0MB 2G9HB 5ICZB 1ZV9A 3RX7A 3PRZA 3SDCA 5KEZA 3DRTA 5TGBA 5GS0D 1DQJA 3HRZB 4NRZB 2CAKA 3RNKA 1PVHA 3G5YA 1TNNA 5ECJE 4XP5H 2A83B 5FKAB 3W82A 3QJQB 4JGNA 3H9HA 1TDQA 2PPAA 3CIQA 1EHKB 3NSXA 3FU0A 1GC1H 2LLNA 1LWRA 1EVUA 3NMEA 3ZE2F 1MSPA 2X89A 1YEDB 3KWVA 5D1QA 3RPKA 2HUEA 3SBPA 4X6BA 2OTPA 5M95B 3C2SA 2IH1B 3N91A 3WE6B 2B4CH 4XTRC 4GQQA 2WXMA 1OARL 4NAJA 1K6QH 1OGTB 3SKUD 2PCFB 4MJ6B 3WEBA 1T0MA 5GGRB 2R29L 1ZT7B 4C47A 12E8H 1T1YB 3D2UD 5AKTA 2IC2A 2HN7A 2D7QA 3MZGB 5I0YA 4GS7C 3RWFA 1Z5LB 5LVEA 3KBHE 5HD8D 4DGWC 1F11A 3TS8A 3K6DA 4XWOD 4IGBC 4LVOC 5ICZA 2B9BA 2WXPA 1E2ZA 4GH7B 3O0RL 2BHUA 3BFQG 4BZ2H 3DVNA 5E2TL 3L4TA 1T83C 3QCUL 3VXMA 4NRZA 4D0DA 1QG3A 3UMNA 5FKAA 1Z9MA 1JAEA 5IQ7L 1A7PL 2Y7QB 1VCAA 3VSTA 2CDFA 1J12A 1YEDA 1PZ3A 4HEPA 3FQNB 3VMPA 5DEFB 2IH1A 3B7SA 1N68A 3GMRB 1NM4A 4X5RA 1MLBB 3FU5A 3EJZD 4XGZB 3OAZK 3JXAA 5DCCA 3BUBA 3HHSB 4JQVC 4H20L 1BMZA 4P8QA 4JCLA 3VVWA 4Q89A 1ZT7A 1S7QB 3K2MC 3UDWA 2VDLB 4K5LA 3TBYA 4POUB 1UB5B 2AJ3A 4NFDA 1MG2C 2EE3A 2VXUL 3ZOAA 2PYED 5JR1H 4KQ3L 1TMQA 4MS8D 1ZT4B 1QA9A 5DS8A 2BSTA 2Z7WA 1ES0A 1MW0A 3GSOB 2FHBA 3PWUB 5BXFA 1S7TA 3RU8L 2GIYA 2O6EA 3QZBA 5BZZA 3ZPDA 3QCTH 4NKDA 1ZHBB 1YEHL 3UZEC 5JHDA 3QUXB 3HE7C 4KJQD 4OLZL 3O6KL 2HTKC 1A4JA 3FO1B 1WZ1H 3QNZB 1UEYA 1W80A 5DJ2B 2RHEA 3FQNA 4JR9H 3RDJA 3BLKA 2VLRE 4ZSOE 3GMRA 3B2UD 3TOPA 4X9GA 2EYRB 1I1AA 1LWJA 3D0AA 4OFDA 1PLGL 4JPVL 4WWID 5J11C 3BUIA 1MHPH 1ZWIB 3ZDZE 1MJUH 3LPFA 4DH2A 1IAOB 2ZOKA 1LD9A 5FX3A 4DTGH 4IRZL 2QDVA 2ZD0A 2F74A 3APMA 4XT1C 5KSVB 3GMLB 1MG3C 2Y36L 3Q6GH 1T0OA 2FEEL 3JVGC 1MLCA 3KDMB 3NSJA 3A23A 3OQ3B 4E5XB 4CGTA 2E7LC 3AG1B 2DRUA 4FXGC 3DGGB 3L17A 1NL0L 2DLFL 3L3OC 5EIQA 2FIKB 4N6QA 1F45A 3RAJL 4P46A 3MRCA 4NGHH 1AZRA 3IT8D 4G71B 3LKSB 2EZ0C 1KTCA 2M8XA 1H6TA 5DJ2A 1UD4A 2ZCKL 3ARDD 1AQMA 1RVFH 5FWQA 2AJUL 3CZGA 2I07B 5D8JL 4YE0A 3D51A 2Q6WA 1LO2H 3S3BB 4RRPM 1JNLH 2W94A 4KK9C 1ZWIA 4U4IA 4MQXD 4WV1B 3ZTCC 3QUYB 4G7VH 4KHXL 3L9RA 4ONHA 5BMFL 3NCJH 4FOMA 5DURD 5GRYA 1DHKA 2X1OA 2KQNA 2HJFB 3WMPA 5C6PB 4IOFD 1OCCB 1FJ1B 3VFRB 4CSTA 5GXBB 3GMLA 5KSVA 3GB7B 3JVFC 5SV3A 2NDGA 1N9PA 3G6JB 2CK0H 1PZCA 3L3GA 4WSGA 4WJG3 3U9WA 1S78C 5A2AA 1V5JA 5I8CA 4BWTA 1L3NA 2FUTA 4KV5E 3DGGA 2YSSB 4HSCX 4JHWL 5EZJB 5C09B 2FIKA 3A22A 3EOAB 1NCWH 3D1MC 3BZEB 2YJLA 1E4WL 1R1CA 4NO5A 3LKSA 3NJIA 4YHKH 1SHMA 3Q5TA 3I3EA 1OOAA 4MBRA 2FX8L 3T0EA 2NY3B 5HYFA 2LT9A 1CDBA 3EBAA 2YR3A 2I07A 3O41B 1H6FA 4P2OD 3LKOA 2DQUL 4HEPG 4N2FA 3PE9A 3Q0HA 1L7IL 5HDQL 2R0KL 4RAHA 4RFNB 1RZFL 3CVIL 3WTTA 4WV1A 2V7HB 3P3SA 1ZANL 3QUYA 2ZWSA 4IU3B 4N0RA 3WLWD 2WVVB 4HCGA 5JORB 5HY9B 4ZRGA 1BZEA 2AK4E 1SXNA 4Y4HB 1FJ1A 1NCHA 3A4DA 1S7VB 3HLAB 4PJGF 3C5JA 2R27A 4XMLL 2DQCH 3LEVL 4JRYE 4F1ZA 5I6MA 4CSZA 3TN0B 3TA3A 4PJBA 4DCQA 5EZJA 5C09A 4PS3A 1MUJB 3GK8L 2JSFA 1QOKA 1KJ2B 3EOAA 4LLQB 1JZ8A 2CNZA 2ZSWB 4DPRA 4HIEA 4PRBA 3UACA 4TQIA 4NO2B 3IDJA 4NP4H 1MJ7L 2BNQE 2E75C 2PCPA 1FP5A 2XN9A 2YZ8A 2ZWKA 4B5EA 3O41A 1Q1JH 1X9QA 2C4FU 2Q5BA 2YRBA 4I4WA 1BM7A 1GGIH 1P2CB 1MOEA 1U6AH 2XSKA 5EF2A 4JVUA 1U92B 4HH9A 5JPNC 4V1DB 2V7HA 2C7UB 3ILQC 1NC4B 2UXGA 2QVFB 3ILDA 4XVJL 3UERA 2WVVA 2GJZB 4MMYA 3NSYA 5E8EB 3PV6A 1SFHA 5HY9A 1A4AA 1OY3B 2GY7B 5EU3B 1U8LA 1GYUA 1NANI 2GTWA 2ZZUT 5JHLA 2DBLH 3DTDA 3HLAA 3HJEA 5CCKH 2X6BA 5D4QA 4I2XE 2KERA 4KXZH 1MEXL 4X8CA 3SKNA 1YQVH 4DOHB 1JTPA 1PAMA 5F1IB 4L05A 5IB1B 3TN0A 3KPRA 1OT2A 5F21B 4KKZA 2QSTA 4XMVA 2EDQA 3QQXA 3FTZA 4LLQA 2QHRL 3SE9L 5JQ6L 4K94C 3CDFA 4EZMA 4DP6X 1NEUA 4H0GA 1HHKB 4Y2OA 2R1XA 3GBDA 5EH1A 5KSAD 1B4LA 1D3CA 3BGMA 3FT4A 2BXZA 3AJ7A 4X7EC 5E9AA 2DKMA 3UBXA 1BIIA 3RURA 3U9UB 1LILA 4MD5B 1CXLA 4MJ4A 3MKGA 5DS1A 5CFAA 3TC9A 1NFIB 2C7UA 2OKMA 6PAZA 2VR7A 1IGYB 4KTGA 1A6UL 2ZXAA 3P11H 2QL1A 5I5RA 3DJSA 3NACH 4P3CH 3SSGA 3VTMA 5EU3A 1DVUA 1ZHLA 4DESA 3SDYH 3SN6N 5F96H 4K5MA 5A6LA 1N2RB 3CHRA 1W8OA 2EO9A 2Z1KA 3EFFB 2IJ0C 3C5ZA 5DQJB 3QFGA 2Q7YA 3X12A 2F53E 2EUWA 3U0WH 1RUPL 1FL6A 5F1IA 5TK4A 3PHSA 4FJYA 3WL9A 1KXTA 3A3YB 3OB0K 4TSBH 3ALXA 4Z0XB 3TVMB 4MJHA 5D93C 2WLMA 2WYTA 3ARRA 1BV8A 1DFBL 2A74C 1YYCA 4NT6A 4C56A 4HULB 5I6PA 4E5XG 4CVWA 4U3CA 5SWSA 3GZQA 1JGEB 1JXJA 3CC1A 4N0FB 1HHKA 4PJIB 2XWBA 3TO4B 5HYSA 5JO5B 2WLKA 2XKSA 1PKQE 3U9UA 4QJ3B 1P7KA 5I23A 5DS2A 3AS1A 4MD5A 3P0YL 1AO7A 5BS0E 3BMWA 4LSTH 1CXHA 5DJ6B 3QXDA 4I0PC 1OPGH 2PCXA 3GBML 1PD1A 4XX1G 5FWRA 1A6ZB 2J5LB 4UM9A 4M00A 1AR2A 4URTB 4YO0B 3UTQA 3GFUA 1IGYA 4PJXE 5E8DH 2M83A 2Y07H 3VI3A 1MIML 3MBXL 5CILH 1KCVH 1FNEA 1WBYB 1YY9D 1Z2KA 2DF3A 3HZVA 2CIKB 2WWNA 4JO3H 2CLVB 4NI6A 3EFFA 3RVXD 1SDYA 4WWKA 4P5KB 3FQ4A 3A6OA 4NWUH 3GSXA 2XXFA 3TVMA 5ID0B 1Y1DA 5DJDB 1V05A 1BVLB 1IIKA 5I1AB 4Z7AA 1I8UA 5FYJL 4WNSA 3WIFB 2ZG1A 2HLAA 3HIZA 3WFHB 2ZCZA 3ISWA 3WEXB 1BCIA 1CYXA 3H7LA 1CFVL 2X4RB 2CD0A 1T2QH 2VO8A 1U8MB 2IPTH 5I8EA 2WXOA 5EWIL 1SYSA 4AT6B 2LLLA 1GZHA 3R4DA 5DJ6A 4ZPVB 4RSYA 1NM9A 4PV1C 3RY4A 5IWLA 3JYCA 4YXLH 1QYGH 4ONFL 4OI7A 1JRHL 4JFOA 4YO0A 1ZTXL 2IANA 5F89B 5EUOE 3EJZC 2VZTA 5AW6B 3VO0A 4LKXA 1F86A 3O45B 4AITA 2EDRA 1AFVH 2NT1A 4LMQE 4JO5A 1WBYA 2CIKA 5D1XE 3RDTD 5AAMA 25C8L 2CLVA 3TURA 4GKZB 1QO3B 3UTTA 3VB9A 5JA8B 4WFHD 5EUKA 4MXQD 5ANHA 2P4AB 1FFOB 5F9WC 4Z7VF 1FN4A 5FHBH 4BK8A 1QWHA 1Z9PA 5ID0A 4E9YA 4R0LA 5KVFH 4HYTB 4C59B 1MCOL 3MLTB 5EDXA 4DEUA 1NFDF 1B4JH 1O9WA 3WIFA 5KANI 3WKNA 1JHTB 2VITB 3C6LD 2WO3B 2D4FA 3CC5B 3ZDXE 2PXYA 3V0FA 3K3QA 4YAQA 2OX5A 4N5EC 2VABB 3LKPB 5SV4A 1QI3A 2UVFA 3H56A 2YXMA 4CMMA 5HTSA 3BJLA 4V2CB 2F19L 5LAPA 1XXDC 5D1QE 2JJSC 5I0VA 3UBXG 3MFFA 1JERA 1M6OB 1NC2B 2J20A 2C8NA 3BW9B 3B2UC 5EEYA 5F89A 2AP2A 3GMPA 5DD3H 3H2WA 3O45A 3TEYA 1CFMA 4M1GL 2X6AA 5E70A 4RA3A 4LLDA 3M17A 3QFDA 5TDOA 4LHJB 1HYSD 2IDTA 3KYOB 2X0UA 1FFOA 3I02B 4YWGH 2WC7A 1J87A 1T66D 2IDUA 4L4TD 1Q1PA 3MLTA 5JW4R 2HFEA 4JRFA 4HXAL 2MQGA 1X5GA 1O7SA 2AQPA 2CCVA 2VO5A 1SDDA 4WFFD 3UYPB 4BQ9A 3SYQA 5IB3B 5FDWB 2ZYIA 1MFBH 2I60H 3L4ZA 2VXQA 2UY6B 4YHOL 1IT9H 2DY2A 1HVXA 2XWJB 5HGAA 3FSWA 1I3GH 2J6EL 2Q7AA 1E42A 3QDHA 1OAYL 3BLPX 4BKTC 1AKJA 2JELH 4XP4H 1NPUA 4M6OL 3LKPA 2VZ3A 1XH3B 4PWEA 3MGOA 2Y06L 4G6MH 5F7UA 3ARDC 5HYSG 1AOZA 4DQOL 4WGVB 1M6OA 3E0GA 3V6OA 1NC2A 5JYLA 5I1GH 1NGQH 1PDKB 2DQGH 4J3SA 3I2CL 4AQAB 4QLWA 4NN7C 4CU8A 1OKEA 2B15A 2JXMA 5CEZL 4AH2B 5GS2D 4Y5XB 2WZPA 4RMVA 3S48A 1YEJL 5DD0L 3DJ9A 4UANA 2EDWA 3NJJA 1BZ7A 1K3IA 4PRAB 4KMLB 5CSGA 3KYOA 3ZTJG 4EI6A 4AQ1C 3HZKA 2AW2A 1GGBH 2BC4B 3ETTA 2APSA 4OZFB 4ES9A 4DZBB 3VWKA 3KJ6L 1EJ8A 5CGBA 1CDUA 5T3ZH 1IKNA 2G2RA 5EA0L 5IB3A 1XB3A 3TJHC 3QG6A 2UY6A 5JHDE 5GSRA 5EOCJ 4XXCA 4NPKA 3ZL1A 2B1AH 1YC7A 2B5IB 2Y24A 1NCUA 1MCDA 1NLBL 3ARBA 1XH3A 2GT9B 1TXKA 5C08B 2JCWA 4K94H 1RJLB 1UFGA 4YC2B 4D7BA 2A9MH 1I75A 2NTSP 4Q0XL 1FORL 4BGDA 1OK8A 3DX4A 3MJ9H 4P2OC 2AEIT 1MFVA 4Y7MA 5FO2A 1SOXA 4AIEA 3BQUA 4H8UA 3PWJA 5C7ZA 4PLJD 2PCYA 3HNSH 3EG9B 3F7VB 3TBSB 4YFLF 3WFCL 3WLWC 4PRAA 3L1OH 3TP4A 4BFFA 4JM2D 3MRQB 4IOIB 3RGVC 4H8WL 1DQTA 1L9OA 2R29A 4BFOA 1JVOA 2L8AA 5E1HB 5ERWA 3VXUA 3VD0A 1I1RA 4U05A 1AH1A 4NQCB 2RFXA 3HI1B 3OZLA 5HDLA 1JUFA 1UM6L 1IQWL 3TIEA 4OW6A 3LJ3A 3FCBA 3NGBC 5LAXB 1L7TH 5EZOH 5BV7C 4FFZL 4Q9RH 4YSPA 4OKVA 4YHMH 1S9YB 1UXMA 2GT9A 2Q3ZA 3NFNA 4HIIB 4AE0A 4UUJB 3L4XA 4FX5A 1OGAB 1ERNA 4L0ZA 5DVLA 1YNLL 3IJ8A 4R90H 5MEOA 3GMNB 1F00I 3ML9A 4PGJA 3NJGA 2HZHA 3OX8B 2X4SB 4OZ4B 5FAAA 1HIML 4UZSA 1OL0A 2NY2C 2OP4H 1DBKH 4EI0A 5KG9B 1S9KC 5KYUB 1GOHA 3RJQB 3K2KA 4KWUA 1A9BA 4QXWA 3MLSL 3G04B 2BP5M 4Y9CA 4IOIA 3FOLB 2Y1YA 4XNQB 4DP4X 5EFIB 5F9JB 2VLLB 3REWA 3QG7H 2MJWA 5I6XC 2VDNL 2I85A 5FKPA 2AV1B 3AMLA 3VXQB 5SX5K 4JFWA 2WQVA 4BFRA 1KCLA 4ETQA 3NAAL 3HI1A 4NQCA 2LFEA 5I71C 3SBWA 3FH5A 3O2WH 2ADIA 3QULB 4L5FE 2JCCF 2R56L 1CU4H 4PI0A 4AQEB 2A9CA 1S9YA 2FJSA 2V9RA 4HIIA 1IFRA 4B6ZA 4LIQL 4G3YL 4HG4J 5T3XD 1E28A 1J9TA 4LLMB 4DK6A 4FA7B 3HE6A 3GI9L 4XX1E 3GMNA 3V6ZB 4OZHA 2BXYA 2XG5A 2R9HC 4PW4A 3MBEB 3VH8A 3QZWB 2XCMC 2J1YA 3WHXA 1KC5H 1MWAL 3W2DH 5KYUA 4PG2A 4JPWL 1XIWD 2BVEA 1FYTA 3I6GB 2EDKA 3ZZSA 4G72B 4YSUA 3G04A 1WAAA 5IMOB 2XZCL 1MCLA 4NQTA 5BZXA 3LS5L 3FOLA 4LCUB 4XNQA 5DQDH 1Z32X 3WIHL 2VLLA 1QLFB 3RZCC 4IW4C 2F18A 1RZKC 4LLUB 2XIIA 1HEHC 1ZLVH 2DQIH 1IM9D 2CPCA 3ZKMD 2YAEA 1WWWX 2E27H 3M7OA 1Y6MR 3DUUB 1EZUA 5C09E 3V0DA 3UYRL 4WUUA 4MAZA 5KSBF 3GXPA 1KBVA 2EILB 3QULA 4Z7NF 4AMXA 4AQEA 3BVDB 3JV5A 4TVPE 5KVEH 3QWOA 4MD4B 4RWHA 4HK0B 1MAMH 3TT1H 2GSIB 3NUKA 5TJWK 4FL4C 3CFBA 4RQQA 3TX4A 4DP5X 2F7PA 2Z8VC 2JJWA 4OFQA 3C5SB 2OJZH 3QIBB 3TYFB 3V6ZA 5GJTL 5MENB 1P5UA 5BVPH 1N8OE 1NCJA 4JG1H 4U1HA 3ULVE 4NIKB 2HRLA 1MVYA 3MBEA 4CVZB 1TU2B 1WEJH 1HCFX 4LCCB 1R19A 3QZWA 5KBDA 3EGXA 4IKLA 4K9EL 1THCA 2BSRA 2ZWZA 3ESMA 3KJ4B 1UJ3C 3NH7L 4L1LA 2EDJA 1NAML 3PAYA 1ODAA 3SQOH 3D4ZA 3WV0A 5IMOA 1KBWA 4PGCA 4ZW7A 1KOAA 2UZIL 3PU7A 4OLWH 5L6YL 3HZ3A 4BIKA 3GJFB 1AGFA 4FD0A 1G7IA 4NERA 2EIDA 3KPRE 4OZFG 1T1WB 5CLXA 1I7UB 4HLEA 2D3NA 3D69B 2Z93B 4KVNL 4YZFE 2YK1H 2ZKMX 1CGWA 5DI8B 1QSEB 1D5IL 2VDKL 1NIAA 1AACA 1Z0MA 2G5RA 4DVBB 4W6WB 4KMTL 1GA2A 2LV4A 1F3RB 2PETA 3QIWC 3RJOA 3TYFA 1XDTT 4IRJD 3N43F 5CGTA 1TEYA 2YGVA 2VISB 4IHBA 4WW2C 3L5HA 2BNQD 3L5WB 4JUSA 3U48A 4QR7A 1V3JA 4BD4A 5JUEH 3FQ2A 1QI4A 3WKML 1CJYA 3LDBB 2QT6A 2ENSA 2YQ2A 1M7DB 4EN3D 4PWGA 4NKIL 5E03A 3O8XD 4AVJA 2A4EA 2P8MB 4Y1AA 2CIIA 1NOFA 3K4AA 1ILUA 2NTFB 4GKNA 3UO8B 3ZKXC 3LHPH 3BVXA 2FWUA 3ZDYB 4KDTA 3RDTC 3AS3A 4ZK8A 4BCZA 3MRKA 1HFUA 5LG6A 4NQXA 2YAHA 2K8MA 4AKPA 3TNMA 2F08A 3KXFB 4X7TB 2NSXA 2LE9A 2A1WL 1T7WA 4EDXB 1U9KA 1NIEA 1FDLL 3T04D 4UQ3B 1QSEA 1N6UA 1P4LB 4H0LC 4D8OA 3C6LC 3HB3D 5DHVH 4C56E 1E4XH 1FO0L 1BP3B 1WA0X 1A8JH 5SWSE 3S3JA 3T3PF 1F4WH 1YY8B 3APDA 3VMOA 1MW2A 1SLXA 2KC0A 3WFBH 2DMBA 4N8VA 4KX9A 1XF3A 2VISA 1AO7E 3BT2L 3L5WA 3NIDF 4K71B 2W0KA 4GPVA 4N90E 5MI0C 1FNAA 3E8UH 4GB9A 1J8HD 3WNPA 4FCHA 3SDAC 4NZFA 2XX1A 2L0DA 2P8MA 3BN9D 4QHPA 3VYOA 1T7ZA 5IQNA 3VH8G 2NTFA 3C6SB 4C4BA 3VI3E 3ZSTA 3L81A 3NTCL 4PHXA 5G4MA 3WU1A 4TM9A 2KPNA 4X4KA 5FGCE 3HUJF 3NN8A 3KXFA 2C3VB 4N9GB 3NDYE 1NDTA 2YD7A 3HVNA 4ZX6A 1J05B 3GHBH 3TJEH 2WKGA 5E94B 1BSIA 3GF8A 1I8MB 4GQ9L 2MCPH 2W9EH 1P4LA 3OKKA 3QORC 2WWOA 3PL6A 2B2XL 1W16A 1CD8A 3ESUF 3DMMD 3DK2A 4NZUH 2WWKT 4O02L 4QOKB 3IFLL 4S0TD 4KTDH 3UYOD 3D6GA 1QP1A 4PJCF 4X0KA 1Q9KA 35C8H 2N4IA 3N42B 1P1VA 2RQEA 2O6FA 3CFEB 4HUUA 4APQA 2DWSA 3ARGB 5BV7H 1MVUB 2Y3AA 4JREC 1NCBH 1BZ9B 2F1BA 1QFWI 2QLYA 3FUMA 3GZPA 1TF4A 2GY5A 4XCFL 2C1PB 1JZ2A 5BS0D 2YEVB 2C4XA 5D5MA 5DXWA 1ONQA 2IANE 1G9HA 1SN2A 2EIBA 2RD0A 2NR6D 2YAOA 4OGAC 1HH9B 5IESH 3QZWG 3B9DA 3C6SA 2ZXDA 2BP0A 3U79A 3SIKA 4LSUH 1GYCA 3FTYA 4HGWB 3T6XA 4HSAC 4KKRA 4G83A 2KUTA 4LSVH 3KAAA 1BWWA 2C3VA 2XA3A 4N9GA 5AW2B 4U6YB 5HVGB 4CU6A 3OXRA 3QWNA 1R3HB 4YDJB 1I8MA 4DPBX 3RBGA 5E0FA 1HHJB 1J8KA 5TDNA 1U3NA 5DZ9A 2W07B 4P4KC 5EOCH 5LXGL 4CU7A 1FGNH 1T20A 1KLUA 1L0QA 1A02N 5HYJB 3AUVA 1TMCB 4FYSA 1B0WA 1YJDC 3AABA 2Q8BL 3RY5A 3ULUF 5JOPE 3CFEA 3IGAB 4JKKA 1NCGA 3ARGA 4NUMA 1MVUA 1B2WH 2C9VA 1F58H 5FO9B 1BZ9A 1TTCA 3PDDA 1DEEB 1I3RA 2NY0D 2D7PA 2C1PA 2CLRB 4AG4H 3AROA 4P2RD 2N7AA 1XGTB 4RMWA 4Z3FA 1I8LC 3GM8A 1ECYA 3KPMB 4QRUB 4AL8C 3MLPA 3TF7C