1W7MA

Crystal structure of human kynurenine aminotransferase i in complex with l-phe
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
418
structure length
415
Chain Sequence
b'QLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPLIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KYNURENINE--OXOGLUTARATE TRANSAMINASE I
publication title Crystal Structure of Human Kynurenine Aminotransferase I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 138
structure length 415
sequence length 418
ec nomenclature ec 2.6.1.64: Glutamine--phenylpyruvate transaminase.
pdb deposition date 2004-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1w7mA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1w7mA01
1BQDA 4A0RA 2VI8A 3EI7A 2GSAA 3AENB 1TOJA 1X28A 3TATA 3JWBA 2D63A 3EZSA 3M5UA 1G7XA 3FVUA 1S07A 2HP2A 4WYFA 4Y0IA 1W7LA 1AY5A 1JS3A 3DODA 4IXZA 1UU2A 4EFFA 3UE8A 1KKJA 2DKBA 2VMPA 5DB5A 1M4NA 3N75A 1AICA 4W8IA 3QGUA 1IAYA 2WK9A 1YJSA 1D7SA 3GBXA 4PVFA 2R0TA 2ZP7A 2YKXA 4CBRA 1LC8A 1BS0A 2OGEA 3A9XA 1LS3A 3D6KA 1YJZA 4BHDA 3AEMC 3LVJA 3B1EA 3L8AA 1CZEA 2ZY2A 2BI9A 1S09A 4WYCA 4H51A 4ZM3A 1N31A 2YHKA 3COGA 3FZ6A 2AY4A 4TMRA 5G09A 4AZJA 4F5HA 4WXBA 4A6RA 1E5EA 2EGYA 8AATA 1GC3A 1MDZA 2FM1A 2OATA 2CTZA 1WKGA 4LNMA 1SPAA 1N2TA 3WKRA 2D65A 3PDBB 1XI9A 2W7LA 3G7QA 1QISA 1MLZA 3F0HA 1D7RA 1M7YA 3MC6C 3RI6A 2O0RA 5EUNA 1ARSA 3QHXA 5EAVA 2BWPA 2GQNA 1Y4IA 3GZDC 5I92A 2AY6A 4F5KA 4WP0A 2VGZA 2ZUKA 3DYDA 1S06A 3LG0A 3MAFA 2GB3A 1C7GA 2PB2A 4F5IA 1AMSA 1PMOA 1W7NA 1ASNA 2VGVA 4F5LA 5JAYA 2E7IA 4GE7A 3PD6B 5F8VA 2W7IA 2EO5A 3F9TA 1E5FA 5DJ9A 1LW4A 3FVSA 2V1PA 4IYOA 4W1XA 4IY7A 4Q31A 2O7CA 4K2IA 1WYVA 1DGDA 2YCPA 1GEXA 1W3UA 5TF5A 1BJNA 1VP4A 1CQ7A 1AJRA 1C9CA 2VMUA 1N8PA 2CANA 2W7DA 4DQ6A 1LK9A 3A9YA 3KGXA 3BWOA 3VP6A 2ZY5A 1CQ8A 5FT5A 1AY4A 4JEXA 1ZODA 1GBNA 4PIWA 2WK7A 5M4BA 1GEYA 4DGTA 2E7JA 1ASAA 3K28A 4N0WA 3FZ7A 4RAEA 1BJ4A 4U2HA 3VK4A 5D5SA 7AATA 1W23A 1DFOA 4JE5D 1ECXA 3AEMA 5G4JA 3HT4A 1I29A 3BCAA 1X2AA 1C0NA 3EI5A 2R5EA 4WYDA 4KXKA 3HVYA 3MAUA 4ZASA 4EU1A 1CJ0A 2BI5A 2VGWA 4WB0A 1TPLA 4OT8A 4A0FA 3L44A 3AV7A 1PFFA 1ASGA 1TARA 1AMRA 1PMMA 3EI6A 4E3QA 2W7EA 3QI6A 1I41A 3EIAA 5HDMA 1WYTB 3EIBA 2QB3A 4TV7A 4W1VA 1TOEA 1VEFA 1GDEA 2EZ1A 1I48A 2BIEA 3MC6A 3NYSA 4W1WA 1QGNA 3LV2A 1CL1A 2JG2A 3JTXA 1M0OA 4XQ2A 1OATA 2VIBA 1B5OA 1MLYA 2QB2A 4JEZA 2ZY3A 3GZDA 3B1DA 3EZ1A 4IXSA 2JJEA 4LNJA 3A2BA 4ITGA 1ARHA 2W8WA 4RKCA 2W7GA 2DGMA 3JZLA 5HHYA 2FYFA 3DC1A 3RBFA 4A00A 1M6SA 2BIAA 4ISYA 2ZYJA 3BV0A 4Q6RA 4O6ZA 3N5MA 1EQBA 1CQ6A 5EFSA 3DZZA 2VGSA 3II0A 4R5FA 4JE5A 1AHXA 2Z9UA 3E2FA 5F9SA 3W1IA 3F6TA 2TPLA 3G0TA 2FQ6A 4HF8A 3I16A 2AATA 4R8DA 2HUIA 1M0NA 2VYCA 4P7YA 2GMUA 2BHXA 4UQVA 1D7VA 2W7FA 4XJMA 1QJ5A 1AY8A 3QN6A 5FT6A 3R9AA 2DGLA 4GEBA 4F4EA 1GD9A 2Z1YA 2CJHA 2F8JA 3BWNA 1U08A 3HDOA 4WYAA 5J8QA 1RV3A 1SF2A 2C7TA 4WLHA 4QGRA 1AKCA 3TFUA 1DJEA 1UKJA 3BC8A 1MDOA 5EIGA 4CBSA 4R5ZA 5G4IA 2AY7A 1TATA 3NNKA 4OTLA 4UOYA 4XAUA 4A6UA 3NDNA 1GC4A 2E54A 1UU1A 1ASLA 1C7OA 3KGWA 4OCAA 4XEWA 1M0QA 2VMZA 3FVXA 4ADEA 1J32A 3WKSA 1ZC9A 4I8AA 4RM1A 3ASBA 3GZCA 4ZSYA 3H7FA 3OKSA 2AEUA 2QMAA 3NRAA 1OXOA 2VMOA 2VMSA 3BB8A 4WXFA 4KYOA 4BA5A 1MGVA 3FCRA 4LC3A 2W8VA 1AAMA 1IJIA 3RBLA 3RQ1A 2YOBA 1IAXA 1WYUA 2ZSLA 4AZKA 4WYGA 3CAIA 1WKHA 3EI9A 4W5KA 2O1BA 1JG8A 1AHYA 2AY3A 3JU7A 4EB7A 4EB5A 1O61A 1VJOA 1LC7A 2W7MA 3AOVA 2RFVA 4FFCA 3CQ4A 2JJHA 1YIYA 2VMRA 1YIZA 3OP7A 3E2ZA 1ASMA 4AO4A 3MAFB 2OKJA 4AOAA 4FL0A 2QBTA 2ZC0A 3ISLA 1TOIA 4BMKA 5HXXA 2AY8A 1H0CA 3KKIA 3NUBA 4GDYA 2D7ZA 4F5MA 2GMSA 1GC2A 2OKKA 2DGKA 2CB1A 2BWNA 2HZPA 2W7KA 1ASEA 2C44A 4TN4A 2CFBA 4PFFA 3FKDA 4PFNA 1M0PA 1QIRA 2VI9A 4IYOB 2EPJA 1BJWA 2BIGA 4M2MA 2DKJA 1IX7A 1OHWA 5AX8A 1WYVB 2W8UA 2HORA 4J8LA 4JF0A 3LVKA 1DJUA 3HLMA 3PAAA 3HMUA 4B98A 1ELQA 2VMXA 3KE3A 3ZZJA 1IVRA 2FNIA 4ZDPA 1X0MA 3AELA 1D2FA 3UAKA 1DJ9A 3PGYA 2G6WA 3HBXA 1DTYA 3VOMA 4OBVA 2OGAA 3NU7A 3WCOA 4ADBA 1I43A 1ARGA 2YKYA 2R2NA 3E9KA 2VMNA 4MKJA 1KMKA 1BKGA 4WD2A 3B8XA 3CQ5A 3ATHA 2VMYA 3FDDA 1QITA 4M2KA 4F5GA 1AHEA 4AH3A 3EUCA 4WB0B 5G2PA 3Q8NA 1RV4A 2VIAA 1EG5A 1S08A 1AIAA 3W1HA 2AEVA 3PDXA 3ELPA 3W1JA 1O69A 1PG8A 3NYTA 3DXWA 3N0LA 2W7JA 3FFRA 2VLFA 1TASA 3BCXA 1W7MA 2BI1A 2R5CA 3VK2A 1AMAA 4F5FA 1V2EA 2YRIA 1QZ9A 2YRRA 1YNUA 3E6GA 2Z61A 3PJ0A 3R4TA 3ECDA 1IUGA 1G4XA 1S0AA 3ACZA 3ASAA 3B1CA 1FC4A 4A0HA 1IBJA 1SFFA 1LKCA 2XBNA 3BN1A 3PPLA 4WYEA 4GE9A 3AEJC 1B4XA 5M46A 3A8UX 1ARTA 3AOWA 4RJ0A 4A0GA 1BT4A 2AY2A 4JEYA 3G8MA 3NTJA 2FN6A 3FQ7A 5D95A 3HQTA 3IHJA 1GC0A 1B9HA 5G0AA 1RVYA 2BWOA 2FNUA 4OBUA 4UHOA 4UHNA 3RCHA 1IX6A 1AJSA 1BJOA 1DKAA 2VMWA 2YKUA 4IXOA 5E4ZA 2AY1A 2CH1A 4ZDOA 4ZM4A 1C4KA 2BI3A 2EZ2A 1BW0A 3CBFA 1P3WA 3GSBA 4R2NA 2ZSMA 2HOZA 2VMVA 1KL1A 3DRDA 5EIGB 1ASDA 2W8TA 5LHAA 5K8BA 1B9IA 4WLJA 3DR7A 3MEBA 4LNLA 4Q76A 1AKAA 4WXGA 1ELUA 5DJ1A 1O62A 3DU4A 3FTBA 3FQAA 2CINA 3FRKA 2BYJA 4JF1A 2ORDA 1V2FA 1T3IA 4P3MA 2CJDA 3LVMA 1TOKA 2Z20A 3FDBA 2BKWA 2D7YA 4IX8A 4MQRA 4MQPA 5LH9A 2AY9A 3LY1A 1SVVA 3JWAA 1AX4A 3I4JA 1KMJA 1QJ3A 1ASBA 1C7NA 3TQXA 2Z1ZA 4Q75A 1AHGA 1SZUA 2PO3A 4ZWVA 4CXQA 2PB0A 1WYUB 4W91A 3K7YA 3FFHA 3AENA 2CH2A 4BA4A 3QPGA 2Z9XA 2C0RA 2X3LA 3HL2A 3RUYA 3LWSA 1IX8A 4RJYA 3PA9A 4E1OA 1OHVA 4MQQA 3DXVA 3WCNA 1AHFA 3IF2A 4K2BA 4B9BA 3NU8A 3A9ZA 3E2ZB 1V72A 3QM2A 3AEJA 1ARIA 1ORDA 2VLHA 5BJ3A 1CS1A 4M2JA 1SZSA 4JEWA 2YKVA 1AMQA 1Z7DA 3WY7A 4L0OA 9AATA 4ZLVA 2HP1A 2ZJGA 3QBOA 3LVLB 2CJGA 4IW7A 2CSTA 3I5TA 3NX3A 4U1TA 1MAQA 3B46A 5DX5A 5EQCA 2YCNA 2C81A 3MADA 2JGTA 3FQ8A 1CL2A 3FZ8A 5EUDA 4F5JA 2CY8A 3H14A 4MSOA 4DBCA 3ZZKA 3TCMA 1J04A 2D5YA 4CXRA 1M32A 2D61A 4JEVA 4CVQA 1MAPA 2OQXA 4GE4A 5E3KA 3NYUA 2D66A 4WBTA 3JW9A 1CZCA 3AEOA 5EAAA 1XEYA 4J5UA 5FT8A 4AO9A 4Y0DA 1G4VA 2E7UA 1AKBA 1GCKA 1TOGA 3PDBA 4MKKA 4OC9A 1BQAA 1ZOBA 3MKJA 1B5PA 1KL2A 1YAAA 3FD0A 2VMQA 4UHMA 4HVKA 1B8GA 2BYLA 3DR4A 4ZAHA 2X5DA 3K40A 3UWCA 5E5IA 4RKDA 3WLXA 2HOXA 2VMTA 5BJ4A 5IWQA 3AATA 4MY5A 4GRXA 3BS8A 1JF9A 5EUEA 3WX9A 3PD6A 3PIUA 4KAMA 5M4DA 2V0YA 2HUUA 3VK3A 4ADCA 2DOUA 3GR9A 4XK1A 2Z9VA 3BWNC 1LW5A 2BI2A 2R5CB 2HOYA 2WKAA 2AY5A 1UU0A 2DR1A 1AAWA 3AEPA 3FSLA 5G2QA 1GEWA 4EMYA 4ADDA 3T32A 2ZY4A 1G7WA 4E3RA 2D64A 5M49A 1OHYA 2NMPA 4MGRA 4XJPA 1FG3A 3E77A 4N0BA 3P6KA 2WK8A 3CQ6A 1YJYA 4BQ0A 1V2DA 3GJUA 4ZDLA 4K2MA 3EI8A 3MBBA 3WZFA 4ATPA 3E2YA 1JS6A 2X5FA 1ASFA 4Y0HA 3TFTA 5C6UA 2Z67A 1H1CA 1MDXA 3NUIA 3RCHB 1AJSB 1AIBA 1BJOB 1EJIA 3ZRPA 4LW4A 1D7UA 2Q7WA 1YOOA 4OYTA 4ZWMA 3GETA 1OXPA 4A6TA 2JJFA 1WYTA 4RITA 2HUFA 3WGBA 3VAXA 1SZKA 4RLGA 1O4SA 1KKPA 3ZRRA 1FG7A 1LC5A 4GSAA 2X8UA 2YCTA 3BCBA 3WGCA 2XH1A 2W7HA 3GWPA 4ITXA 5FT4A 4RIZA 1WSTA 4LW2A 4A72A 2VGTA 4XJLA 1Z3ZA 4E77A 1ASCA 1X29A 3USFA 2W8JA 4XJOA 4ATQA 4OMAA 1DGEA 2VGUA 2QLRA 1RVUA 2JJGA 4ZSWA 2JISA 3P1TA 3ELEA 2EH6A 3ZRQA 2QA3A 4NOGA 2Z9WA
chains in the Genus database with same CATH superfamily
1BQDA 4A0RA 2VI8A 3EI7A 2GSAA 3AENB 1TOJA 1X28A 3TATA 3JWBA 2D63A 3EZSA 3M5UA 1G7XA 3FVUA 1S07A 2HP2A 4WYFA 4Y0IA 1W7LA 1AY5A 1JS3A 3DODA 4IXZA 1UU2A 4EFFA 3H9XA 3UE8A 1KKJA 2DKBA 2VMPA 5DB5A 1M4NA 3N75A 1AICA 4W8IA 3QGUA 1IAYA 2WK9A 1YJSA 1D7SA 3GBXA 4PVFA 2R0TA 2ZP7A 2YKXA 4CBRA 1LC8A 1BS0A 2OGEA 3A9XA 1LS3A 3D6KA 1YJZA 4BHDA 3AEMC 3LVJA 3B1EA 3L8AA 1CZEA 2ZY2A 2BI9A 1S09A 4WYCA 4H51A 4ZM3A 1N31A 2YHKA 3COGA 3FZ6A 2AY4A 4TMRA 5G09A 4AZJA 4F5HA 4WXBA 4A6RA 1E5EA 2EGYA 8AATA 1GC3A 1MDZA 2FM1A 2OATA 2CTZA 1WKGA 4LNMA 1SPAA 1N2TA 3WKRA 2D65A 3PDBB 1XI9A 2W7LA 3G7QA 1QISA 1MLZA 3F0HA 1D7RA 1M7YA 3MC6C 3RI6A 2O0RA 5EUNA 1ARSA 3QHXA 5EAVA 2BWPA 2GQNA 1Y4IA 3GZDC 5I92A 2AY6A 4F5KA 2KFPA 4WP0A 2VGZA 2ZUKA 3DYDA 1S06A 3LG0A 3MAFA 2GB3A 1C7GA 2PB2A 4F5IA 1AMSA 1PMOA 1W7NA 1ASNA 2VGVA 4F5LA 5JAYA 2E7IA 4GE7A 3PD6B 5F8VA 2W7IA 2EO5A 3F9TA 1E5FA 5DJ9A 1LW4A 3FVSA 2V1PA 4IYOA 4W1XA 4IY7A 4Q31A 2O7CA 4K2IA 1WYVA 1DGDA 2YCPA 1GEXA 1W3UA 5TF5A 1BJNA 1VP4A 1CQ7A 1AJRA 1C9CA 2VMUA 1N8PA 2CANA 2W7DA 4DQ6A 1LK9A 3A9YA 3KGXA 3BWOA 3VP6A 2ZY5A 1CQ8A 5FT5A 1AY4A 4JEXA 1ZODA 1GBNA 4PIWA 2WK7A 5M4BA 1GEYA 4DGTA 2E7JA 1ASAA 3K28A 4N0WA 3FZ7A 4RAEA 1BJ4A 4U2HA 3VK4A 5D5SA 7AATA 1W23A 1DFOA 4JE5D 1ECXA 3AEMA 5G4JA 3HT4A 1I29A 3BCAA 1X2AA 1C0NA 3EI5A 2R5EA 4WYDA 4KXKA 3HVYA 3MAUA 4ZASA 4EU1A 1CJ0A 2BI5A 2VGWA 4WB0A 1TPLA 4OT8A 4H63Q 4A0FA 3L44A 3AV7A 1PFFA 1ASGA 1TARA 1AMRA 1PMMA 3EI6A 4E3QA 2W7EA 3QI6A 1I41A 3EIAA 5HDMA 1WYTB 3EIBA 2QB3A 4TV7A 4W1VA 1TOEA 1VEFA 1GDEA 2EZ1A 1I48A 2BIEA 3MC6A 3NYSA 4W1WA 1QGNA 3LV2A 1CL1A 2JG2A 3JTXA 1M0OA 4XQ2A 1OATA 2VIBA 1B5OA 1MLYA 2QB2A 4JEZA 2ZY3A 3GZDA 3B1DA 3EZ1A 4IXSA 2JJEA 4LNJA 3A2BA 4ITGA 1ARHA 2W8WA 4RKCA 2W7GA 2DGMA 3JZLA 5HHYA 2FYFA 3DC1A 3RBFA 4A00A 1M6SA 2BIAA 4ISYA 2ZYJA 3BV0A 4Q6RA 4O6ZA 3N5MA 1EQBA 1CQ6A 5EFSA 3DZZA 2VGSA 3II0A 4R5FA 4JE5A 1AHXA 2Z9UA 3E2FA 5F9SA 3W1IA 3F6TA 2TPLA 3G0TA 2FQ6A 4HF8A 3I16A 2AATA 2WB6A 5KTBA 4R8DA 2HUIA 1M0NA 2VYCA 4P7YA 2GMUA 2BHXA 4UQVA 1D7VA 2W7FA 4XJMA 1QJ5A 1AY8A 3QN6A 5FT6A 3R9AA 2DGLA 4GEBA 4F4EA 1GD9A 2Z1YA 2CJHA 2F8JA 3BWNA 1U08A 3HDOA 4WYAA 5J8QA 1RV3A 1SF2A 2C7TA 4WLHA 4QGRA 1AKCA 3TFUA 1DJEA 1UKJA 3N7NA 3BC8A 1MDOA 5EIGA 4CBSA 4R5ZA 5G4IA 2AY7A 1TATA 3NNKA 4OTLA 4UOYA 4XAUA 4A6UA 3NDNA 1GC4A 2E54A 1UU1A 1ASLA 1C7OA 3KGWA 4OCAA 4XEWA 1M0QA 2VMZA 3FVXA 4ADEA 1J32A 3WKSA 1ZC9A 4I8AA 4RM1A 3ASBA 3GZCA 4ZSYA 3H7FA 3OKSA 2AEUA 2QMAA 3NRAA 1OXOA 2VMOA 2VMSA 3BB8A 4WXFA 4KYOA 4BA5A 1MGVA 3FCRA 4LC3A 2W8VA 1AAMA 1IJIA 3RBLA 3RQ1A 2YOBA 1IAXA 1WYUA 2ZSLA 4AZKA 4WYGA 3CAIA 1WKHA 3EI9A 4W5KA 2O1BA 1JG8A 1AHYA 2AY3A 3JU7A 4EB7A 4EB5A 1O61A 1VJOA 1LC7A 2W7MA 3AOVA 2RFVA 4FFCA 3CQ4A 2JJHA 1YIYA 2VMRA 1YIZA 3OP7A 3E2ZA 1ASMA 4AO4A 3MAFB 2OKJA 4AOAA 4FL0A 2QBTA 2ZC0A 3ISLA 2A1VA 1TOIA 4BMKA 5HXXA 2AY8A 1H0CA 3KKIA 3NUBA 4GDYA 2D7ZA 4F5MA 2GMSA 1GC2A 2OKKA 2DGKA 2CB1A 2BWNA 2HZPA 2W7KA 1ASEA 2C44A 4TN4A 2CFBA 4PFFA 3FKDA 4PFNA 1M0PA 1QIRA 2VI9A 4IYOB 2EPJA 1BJWA 2BIGA 4M2MA 2DKJA 1IX7A 1OHWA 5AX8A 1WYVB 2W8UA 2HORA 4J8LA 4JF0A 3LVKA 1DJUA 3HLMA 3PAAA 3HMUA 4B98A 1ELQA 2VMXA 3KE3A 3ZZJA 1IVRA 2FNIA 4ZDPA 1X0MA 3AELA 1D2FA 3UAKA 1DJ9A 3PGYA 2G6WA 3HBXA 1DTYA 3VOMA 4OBVA 2OGAA 3NU7A 3WCOA 4ADBA 1I43A 1ARGA 2YKYA 2R2NA 3E9KA 2VMNA 4MKJA 1KMKA 1BKGA 4WD2A 3B8XA 3CQ5A 3ATHA 2VMYA 3FDDA 1QITA 4M2KA 4F5GA 1AHEA 4AH3A 3EUCA 4WB0B 5G2PA 3Q8NA 1RV4A 2VIAA 1EG5A 1S08A 1AIAA 3W1HA 2AEVA 3PDXA 3ELPA 3W1JA 1O69A 1PG8A 3NYTA 3DXWA 3N0LA 2W7JA 3FFRA 2VLFA 1TASA 3BCXA 1W7MA 2BI1A 2R5CA 3VK2A 1AMAA 4F5FA 1V2EA 2YRIA 1QZ9A 2YRRA 1YNUA 3E6GA 2Z61A 3PJ0A 3R4TA 3ECDA 1IUGA 1G4XA 1S0AA 3ACZA 3ASAA 3B1CA 1FC4A 4A0HA 1IBJA 1SFFA 1LKCA 2XBNA 3BN1A 3PPLA 4WYEA 2FKIA 4GE9A 3AEJC 1B4XA 5M46A 3A8UX 1ARTA 3AOWA 4RJ0A 4A0GA 1BT4A 2AY2A 3N4SA 4JEYA 3G8MA 2G7JA 3NTJA 2FN6A 3FQ7A 5D95A 3HQTA 3IHJA 1GC0A 1B9HA 5G0AA 1RVYA 2BWOA 2FNUA 4OBUA 4UHOA 4UHNA 3RCHA 1IX6A 1AJSA 1BJOA 1DKAA 2VMWA 2YKUA 4IXOA 5E4ZA 2AY1A 2CH1A 4ZDOA 4ZM4A 1C4KA 2BI3A 2EZ2A 1BW0A 3CBFA 1P3WA 3GSBA 4R2NA 3N4RA 2ZSMA 2HOZA 2VMVA 1KL1A 3DRDA 5EIGB 1ASDA 2W8TA 5LHAA 5K8BA 1B9IA 4WLJA 3DR7A 3MEBA 4LNLA 4Q76A 1AKAA 4WXGA 1ELUA 5DJ1A 1O62A 3DU4A 3FTBA 3FQAA 2CINA 3FRKA 2BYJA 4JF1A 2ORDA 1V2FA 1T3IA 4P3MA 2CJDA 3LVMA 1TOKA 2Z20A 3FDBA 2BKWA 2D7YA 4IX8A 4MQRA 4MQPA 5LH9A 2AY9A 3LY1A 1SVVA 3JWAA 1AX4A 3I4JA 1KMJA 1QJ3A 1ASBA 1C7NA 3TQXA 2Z1ZA 4Q75A 1AHGA 1SZUA 2PO3A 4ZWVA 4CXQA 2PB0A 1WYUB 1KAFA 4W91A 3K7YA 3FFHA 3AENA 2CH2A 4BA4A 3QPGA 2Z9XA 2C0RA 2X3LA 3HL2A 3RUYA 3LWSA 1IX8A 4RJYA 3PA9A 4E1OA 1OHVA 4MQQA 3DXVA 3WCNA 1AHFA 3IF2A 4K2BA 4B9BA 3NU8A 3A9ZA 3E2ZB 1V72A 3QM2A 3AEJA 1ARIA 1ORDA 2VLHA 5BJ3A 1CS1A 4M2JA 1SZSA 4JEWA 2YKVA 1AMQA 1Z7DA 3WY7A 4L0OA 9AATA 4ZLVA 2HP1A 2ZJGA 3QBOA 3LVLB 2CJGA 4IW7A 2CSTA 3I5TA 3NX3A 4U1TA 1MAQA 3B46A 5DX5A 5EQCA 2YCNA 2C81A 3MADA 2JGTA 3FQ8A 1CL2A 3FZ8A 5EUDA 4F5JA 2CY8A 3H14A 4MSOA 4DBCA 3ZZKA 3TCMA 1J04A 2D5YA 4CXRA 1M32A 2D61A 4JEVA 4CVQA 1MAPA 2OQXA 4GE4A 5E3KA 3NYUA 2D66A 4WBTA 3JW9A 1CZCA 3AEOA 5EAAA 1XEYA 4J5UA 5FT8A 4AO9A 4Y0DA 1G4VA 2E7UA 1AKBA 1GCKA 1TOGA 3PDBA 4MKKA 4OC9A 1BQAA 1ZOBA 3MKJA 1B5PA 1KL2A 1YAAA 3FD0A 2VMQA 4UHMA 4HVKA 1B8GA 2BYLA 3DR4A 4ZAHA 2X5DA 3K40A 3UWCA 5E5IA 4RKDA 3WLXA 2HOXA 2VMTA 5BJ4A 5IWQA 3AATA 3N4XA 4MY5A 4GRXA 3BS8A 1JF9A 5EUEA 3WX9A 3PD6A 3PIUA 4KAMA 5M4DA 2V0YA 2HUUA 3VK3A 4ADCA 2DOUA 3GR9A 4XK1A 2Z9VA 3BWNC 1LW5A 2BI2A 2R5CB 2HOYA 2WKAA 2AY5A 1UU0A 2DR1A 1AAWA 3AEPA 3FSLA 5G2QA 1GEWA 4EMYA 4ADDA 3T32A 2ZY4A 1G7WA 4E3RA 2D64A 5M49A 1OHYA 2NMPA 4MGRA 4XJPA 1FG3A 3E77A 4N0BA 2EYQA 3P6KA 2WK8A 3CQ6A 1YJYA 4BQ0A 2QSRA 1V2DA 3GJUA 4ZDLA 4K2MA 3EI8A 3MBBA 3WZFA 4ATPA 3E2YA 1JS6A 2X5FA 1ASFA 4Y0HA 3TFTA 5C6UA 2Z67A 1H1CA 1MDXA 3NUIA 3RCHB 1AJSB 1AIBA 1BJOB 1EJIA 3ZRPA 4LW4A 1D7UA 2Q7WA 1YOOA 4OYTA 4ZWMA 3GETA 1OXPA 4A6TA 2JJFA 1WYTA 4RITA 2HUFA 3WGBA 4K05A 3VAXA 1SZKA 4RLGA 1O4SA 1KKPA 3ZRRA 1FG7A 1LC5A 4GSAA 2X8UA 2YCTA 3BCBA 3WGCA 2XH1A 2W7HA 3GWPA 4ITXA 5FT4A 4RIZA 1WSTA 4LW2A 4A72A 2VGTA 4XJLA 1Z3ZA 4E77A 1ASCA 1X29A 3USFA 2W8JA 4XJOA 4ATQA 4OMAA 1DGEA 2VGUA 2QLRA 1RVUA 2JJGA 4ZSWA 2JISA 3P1TA 3ELEA 2EH6A 3ZRQA 2QA3A 4NOGA 2Z9WA
chains in the Genus database with same CATH topology
1BQDA 4A0RA 2VI8A 3EI7A 2GSAA 3AENB 1TOJA 1X28A 3TATA 3JWBA 2D63A 3EZSA 3M5UA 1G7XA 3FVUA 1S07A 2HP2A 4WYFA 4Y0IA 1W7LA 1AY5A 1JS3A 3DODA 4IXZA 1UU2A 4EFFA 3H9XA 3UE8A 1KKJA 2DKBA 2VMPA 5DB5A 1M4NA 3N75A 1AICA 4W8IA 3QGUA 1IAYA 2WK9A 1YJSA 1D7SA 3GBXA 4PVFA 2R0TA 2ZP7A 2YKXA 4CBRA 1LC8A 1BS0A 2OGEA 3A9XA 1LS3A 3D6KA 1YJZA 4BHDA 3AEMC 3LVJA 3B1EA 3L8AA 1CZEA 2ZY2A 2BI9A 1S09A 4WYCA 4H51A 4ZM3A 1N31A 2YHKA 3COGA 3FZ6A 2AY4A 4TMRA 5G09A 4AZJA 4F5HA 4WXBA 4A6RA 1E5EA 2EGYA 8AATA 1GC3A 1MDZA 2FM1A 2OATA 2CTZA 1WKGA 4LNMA 1SPAA 1N2TA 3WKRA 2D65A 3PDBB 1XI9A 2W7LA 3G7QA 1QISA 1MLZA 3F0HA 1D7RA 1M7YA 3MC6C 3RI6A 2O0RA 5EUNA 1ARSA 3QHXA 5EAVA 2BWPA 2GQNA 1Y4IA 3GZDC 5I92A 2AY6A 4F5KA 2KFPA 4WP0A 2VGZA 2ZUKA 3DYDA 1S06A 3LG0A 3MAFA 2GB3A 1C7GA 2PB2A 4F5IA 1AMSA 1PMOA 1W7NA 1ASNA 2VGVA 4F5LA 5JAYA 2E7IA 4GE7A 3PD6B 5F8VA 2W7IA 2EO5A 3F9TA 1E5FA 5DJ9A 1LW4A 3FVSA 2V1PA 4IYOA 4W1XA 4IY7A 4Q31A 2O7CA 4K2IA 1WYVA 1DGDA 2YCPA 1GEXA 1W3UA 5TF5A 1BJNA 1VP4A 1CQ7A 1AJRA 1C9CA 2VMUA 1N8PA 2CANA 2W7DA 4DQ6A 1LK9A 3A9YA 3KGXA 3BWOA 3VP6A 2ZY5A 1CQ8A 5FT5A 1AY4A 4JEXA 1ZODA 1GBNA 4PIWA 2WK7A 5M4BA 1GEYA 4DGTA 2E7JA 1ASAA 3K28A 4N0WA 3FZ7A 4RAEA 1BJ4A 4U2HA 3VK4A 5D5SA 7AATA 1W23A 1DFOA 4JE5D 1ECXA 3AEMA 5G4JA 3HT4A 1I29A 3BCAA 1X2AA 1C0NA 3EI5A 2R5EA 4WYDA 4KXKA 3HVYA 3MAUA 4ZASA 4EU1A 1CJ0A 2BI5A 2VGWA 4WB0A 1TPLA 4OT8A 4H63Q 4A0FA 3L44A 3AV7A 1PFFA 1ASGA 1TARA 1AMRA 1PMMA 3EI6A 4E3QA 2W7EA 3QI6A 1I41A 3EIAA 5HDMA 1WYTB 3EIBA 2QB3A 4TV7A 4W1VA 1TOEA 1VEFA 1GDEA 2EZ1A 1I48A 2BIEA 3MC6A 3NYSA 4W1WA 1QGNA 3LV2A 1CL1A 2JG2A 3JTXA 1M0OA 4XQ2A 1OATA 2VIBA 1B5OA 1MLYA 2QB2A 4JEZA 2ZY3A 3GZDA 3B1DA 3EZ1A 4IXSA 2JJEA 4LNJA 3A2BA 4ITGA 1ARHA 2W8WA 4RKCA 2W7GA 2DGMA 3JZLA 5HHYA 2FYFA 3DC1A 3RBFA 4A00A 1M6SA 2BIAA 4ISYA 2ZYJA 3BV0A 4Q6RA 4O6ZA 3N5MA 1EQBA 1CQ6A 5EFSA 3DZZA 2VGSA 3II0A 4R5FA 4JE5A 1AHXA 2Z9UA 3E2FA 5F9SA 3W1IA 3F6TA 2TPLA 3G0TA 2FQ6A 4HF8A 3I16A 2AATA 2WB6A 5KTBA 4R8DA 2HUIA 1M0NA 2VYCA 4P7YA 2GMUA 2BHXA 4UQVA 1D7VA 2W7FA 4XJMA 1QJ5A 1AY8A 3QN6A 5FT6A 3R9AA 2DGLA 4GEBA 4F4EA 1GD9A 2Z1YA 2CJHA 2F8JA 3BWNA 1U08A 3HDOA 4WYAA 5J8QA 1RV3A 1SF2A 2C7TA 4WLHA 4QGRA 1AKCA 3TFUA 1DJEA 1UKJA 3N7NA 3BC8A 1MDOA 5EIGA 4CBSA 4R5ZA 5G4IA 2AY7A 1TATA 3NNKA 4OTLA 4UOYA 4XAUA 4A6UA 3NDNA 1GC4A 2E54A 1UU1A 1ASLA 1C7OA 3KGWA 4OCAA 4XEWA 1M0QA 2VMZA 3FVXA 4ADEA 1J32A 3WKSA 1ZC9A 4I8AA 4RM1A 3ASBA 3GZCA 4ZSYA 3H7FA 3OKSA 2AEUA 2QMAA 3NRAA 1OXOA 2VMOA 2VMSA 3BB8A 4WXFA 4KYOA 4BA5A 1MGVA 3FCRA 4LC3A 2W8VA 1AAMA 1IJIA 3RBLA 3RQ1A 2YOBA 1IAXA 1WYUA 2ZSLA 4AZKA 4WYGA 3CAIA 1WKHA 3EI9A 4W5KA 2O1BA 1JG8A 1AHYA 2AY3A 3JU7A 4EB7A 4EB5A 1O61A 1VJOA 1LC7A 2W7MA 3AOVA 2RFVA 4FFCA 3CQ4A 2JJHA 1YIYA 2VMRA 1YIZA 3OP7A 3E2ZA 1ASMA 4AO4A 3MAFB 2OKJA 4AOAA 4FL0A 2QBTA 2ZC0A 3ISLA 2A1VA 1TOIA 4BMKA 5HXXA 2AY8A 1H0CA 3KKIA 3NUBA 4GDYA 2D7ZA 4F5MA 2GMSA 1GC2A 2OKKA 2DGKA 2CB1A 2BWNA 2HZPA 2W7KA 1ASEA 2C44A 4TN4A 2CFBA 4PFFA 3FKDA 4PFNA 1M0PA 1QIRA 2VI9A 4IYOB 2EPJA 1BJWA 2BIGA 4M2MA 2DKJA 1IX7A 1OHWA 5AX8A 1WYVB 2W8UA 2HORA 4J8LA 4JF0A 3LVKA 1DJUA 3HLMA 3PAAA 3HMUA 4B98A 1ELQA 2VMXA 3KE3A 3ZZJA 1IVRA 2FNIA 4ZDPA 1X0MA 3AELA 1D2FA 3UAKA 1DJ9A 3PGYA 2G6WA 3HBXA 1DTYA 3VOMA 4OBVA 2OGAA 3NU7A 3WCOA 4ADBA 1I43A 1ARGA 2YKYA 2R2NA 3E9KA 2VMNA 4MKJA 1KMKA 1BKGA 4WD2A 3B8XA 3CQ5A 3ATHA 2VMYA 3FDDA 1QITA 4M2KA 4F5GA 1AHEA 4AH3A 3EUCA 4WB0B 5G2PA 3Q8NA 1RV4A 2VIAA 1EG5A 1S08A 1AIAA 3W1HA 2AEVA 3PDXA 3ELPA 3W1JA 1O69A 1PG8A 3NYTA 3DXWA 3N0LA 2W7JA 3FFRA 2VLFA 1TASA 3BCXA 1W7MA 2BI1A 2R5CA 3VK2A 1AMAA 4F5FA 1V2EA 2YRIA 1QZ9A 2YRRA 1YNUA 3E6GA 2Z61A 3PJ0A 3R4TA 3ECDA 1IUGA 1G4XA 1S0AA 3ACZA 3ASAA 3B1CA 1FC4A 4A0HA 1IBJA 1SFFA 1LKCA 2XBNA 3BN1A 3PPLA 4WYEA 2FKIA 4GE9A 3AEJC 1B4XA 5M46A 3A8UX 1ARTA 3AOWA 4RJ0A 4A0GA 1BT4A 2AY2A 3N4SA 4JEYA 3G8MA 2G7JA 3NTJA 2FN6A 3FQ7A 5D95A 3HQTA 3IHJA 1GC0A 1B9HA 5G0AA 1RVYA 2BWOA 2FNUA 4OBUA 4UHOA 4UHNA 3RCHA 1IX6A 1AJSA 1BJOA 1DKAA 2VMWA 2YKUA 4IXOA 5E4ZA 2AY1A 2CH1A 4ZDOA 4ZM4A 1C4KA 2BI3A 2EZ2A 1BW0A 3CBFA 1P3WA 3GSBA 4R2NA 3N4RA 2ZSMA 2HOZA 2VMVA 1KL1A 3DRDA 5EIGB 1ASDA 2W8TA 5LHAA 5K8BA 1B9IA 4WLJA 3DR7A 3MEBA 4LNLA 4Q76A 1AKAA 4WXGA 1ELUA 5DJ1A 1O62A 3DU4A 3FTBA 3FQAA 2CINA 3FRKA 2BYJA 4JF1A 2ORDA 1V2FA 1T3IA 4P3MA 2CJDA 3LVMA 1TOKA 2Z20A 3FDBA 2BKWA 2D7YA 4IX8A 4MQRA 4MQPA 5LH9A 2AY9A 3LY1A 1SVVA 3JWAA 1AX4A 3I4JA 1KMJA 1QJ3A 1ASBA 1C7NA 3TQXA 2Z1ZA 4Q75A 1AHGA 1SZUA 2PO3A 4ZWVA 4CXQA 2PB0A 1WYUB 4W91A 3K7YA 3FFHA 3AENA 2CH2A 4BA4A 3QPGA 2Z9XA 2C0RA 2X3LA 3HL2A 3RUYA 3LWSA 1IX8A 4RJYA 3PA9A 4E1OA 1OHVA 4MQQA 3DXVA 3WCNA 1AHFA 3IF2A 4K2BA 4B9BA 3NU8A 3A9ZA 3E2ZB 1V72A 3QM2A 3AEJA 1ARIA 1ORDA 2VLHA 5BJ3A 1CS1A 4M2JA 1SZSA 4JEWA 2YKVA 1AMQA 1Z7DA 3WY7A 4L0OA 9AATA 4ZLVA 2HP1A 2ZJGA 3QBOA 3LVLB 2CJGA 4IW7A 2CSTA 3I5TA 3NX3A 4U1TA 1MAQA 3B46A 5DX5A 5EQCA 2YCNA 2C81A 3MADA 2JGTA 3FQ8A 1CL2A 3FZ8A 5EUDA 4F5JA 2CY8A 3H14A 4MSOA 4DBCA 3ZZKA 3TCMA 1J04A 2D5YA 4CXRA 1M32A 2D61A 4JEVA 4CVQA 1MAPA 2OQXA 4GE4A 5E3KA 3NYUA 2D66A 4WBTA 3JW9A 1CZCA 3AEOA 5EAAA 1XEYA 4J5UA 5FT8A 4AO9A 4Y0DA 1G4VA 2E7UA 1AKBA 1GCKA 1TOGA 3PDBA 4MKKA 4OC9A 1BQAA 1ZOBA 3MKJA 1B5PA 1KL2A 1YAAA 3FD0A 2VMQA 4UHMA 4HVKA 1B8GA 2BYLA 3DR4A 4ZAHA 2X5DA 3K40A 3UWCA 5E5IA 4RKDA 3WLXA 2HOXA 2VMTA 5BJ4A 5IWQA 3AATA 3N4XA 4MY5A 4GRXA 3BS8A 1JF9A 5EUEA 3WX9A 3PD6A 3PIUA 4KAMA 5M4DA 2V0YA 2HUUA 3VK3A 4ADCA 2DOUA 3GR9A 4XK1A 2Z9VA 3BWNC 1LW5A 2BI2A 2R5CB 2HOYA 2WKAA 2AY5A 1UU0A 2DR1A 1AAWA 3AEPA 3FSLA 5G2QA 1GEWA 4EMYA 4ADDA 3T32A 2ZY4A 1G7WA 4E3RA 2D64A 5M49A 1OHYA 2NMPA 4MGRA 4XJPA 1FG3A 3E77A 4N0BA 2EYQA 3P6KA 2WK8A 3CQ6A 1YJYA 4BQ0A 2QSRA 1V2DA 3GJUA 4ZDLA 4K2MA 3EI8A 3MBBA 3WZFA 4ATPA 3E2YA 1JS6A 2X5FA 1ASFA 4Y0HA 3TFTA 5C6UA 2Z67A 1H1CA 1MDXA 3NUIA 3RCHB 1AJSB 1AIBA 1BJOB 1EJIA 3ZRPA 4LW4A 1D7UA 2Q7WA 1YOOA 4OYTA 4ZWMA 3GETA 1OXPA 4A6TA 2JJFA 1WYTA 4RITA 2HUFA 3WGBA 4K05A 3VAXA 1SZKA 4RLGA 1O4SA 1KKPA 3ZRRA 1FG7A 1LC5A 4GSAA 2X8UA 2YCTA 3BCBA 3WGCA 2XH1A 2W7HA 3GWPA 4ITXA 5FT4A 4RIZA 1WSTA 4LW2A 4A72A 2VGTA 4XJLA 1Z3ZA 4E77A 1ASCA 1X29A 3USFA 2W8JA 4XJOA 4ATQA 4OMAA 1DGEA 2VGUA 2QLRA 1RVUA 2JJGA 4ZSWA 2JISA 3P1TA 3ELEA 2EH6A 3ZRQA 2QA3A 4NOGA 2Z9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQD A;  4A0R A;  2VI8 A;  3EI7 A;  2GSA A;  3AEN B;  1TOJ A;  1X28 A;  3TAT A;  3JWB A;  2D63 A;  3EZS A;  3M5U A;  1G7X A;  3FVU A;  1S07 A;  2HP2 A;  4WYF A;  4Y0I A;  1W7L A;  1AY5 A;  1JS3 A;  3DOD A;  4IXZ A;  1UU2 A;  4EFF A;  3UE8 A;  1KKJ A;  2DKB A;  2VMP A;  5DB5 A;  1M4N A;  3N75 A;  1AIC A;  4W8I A;  3QGU A;  1IAY A;  2WK9 A;  1YJS A;  1D7S A;  3GBX A;  4PVF A;  2R0T A;  2ZP7 A;  2YKX A;  4CBR A;  1LC8 A;  1BS0 A;  2OGE A;  3A9X A;  1LS3 A;  3D6K A;  1YJZ A;  4BHD A;  3AEM C;  3LVJ A;  3B1E A;  3L8A A;  1CZE A;  2ZY2 A;  2BI9 A;  1S09 A;  4WYC A;  4H51 A;  4ZM3 A;  1N31 A;  2YHK A;  3COG A;  3FZ6 A;  2AY4 A;  4TMR A;  5G09 A;  4AZJ A;  4F5H A;  4WXB A;  4A6R A;  1E5E A;  2EGY A;  8AAT A;  1GC3 A;  1MDZ A;  2FM1 A;  2OAT A;  2CTZ A;  1WKG A;  4LNM A;  1SPA A;  1N2T A;  3WKR A;  2D65 A;  3PDB B;  1XI9 A;  2W7L A;  3G7Q A;  1QIS A;  1MLZ A;  3F0H A;  1D7R A;  1M7Y A;  3MC6 C;  3RI6 A;  2O0R A;  5EUN A;  1ARS A;  3QHX A;  5EAV A;  2BWP A;  2GQN A;  1Y4I A;  3GZD C;  5I92 A;  2AY6 A;  4F5K A;  4WP0 A;  2VGZ A;  2ZUK A;  3DYD A;  1S06 A;  3LG0 A;  3MAF A;  2GB3 A;  1C7G A;  2PB2 A;  4F5I A;  1AMS A;  1PMO A;  1W7N A;  1ASN A;  2VGV A;  4F5L A;  5JAY A;  2E7I A;  4GE7 A;  3PD6 B;  5F8V A;  2W7I A;  2EO5 A;  3F9T A;  1E5F A;  5DJ9 A;  1LW4 A;  3FVS A;  2V1P A;  4IYO A;  4W1X A;  4IY7 A;  4Q31 A;  2O7C A;  4K2I A;  1WYV A;  1DGD A;  2YCP A;  1GEX A;  1W3U A;  5TF5 A;  1BJN A;  1VP4 A;  1CQ7 A;  1AJR A;  1C9C A;  2VMU A;  1N8P A;  2CAN A;  2W7D A;  4DQ6 A;  1LK9 A;  3A9Y A;  3KGX A;  3BWO A;  3VP6 A;  2ZY5 A;  1CQ8 A;  5FT5 A;  1AY4 A;  4JEX A;  1ZOD A;  1GBN A;  4PIW A;  2WK7 A;  5M4B A;  1GEY A;  4DGT A;  2E7J A;  1ASA A;  3K28 A;  4N0W A;  3FZ7 A;  4RAE A;  1BJ4 A;  4U2H A;  3VK4 A;  5D5S A;  7AAT A;  1W23 A;  1DFO A;  4JE5 D;  1ECX A;  3AEM A;  5G4J A;  3HT4 A;  1I29 A;  3BCA A;  1X2A A;  1C0N A;  3EI5 A;  2R5E A;  4WYD A;  4KXK A;  3HVY A;  3MAU A;  4ZAS A;  4EU1 A;  1CJ0 A;  2BI5 A;  2VGW A;  4WB0 A;  1TPL A;  4OT8 A;  4A0F A;  3L44 A;  3AV7 A;  1PFF A;  1ASG A;  1TAR A;  1AMR A;  1PMM A;  3EI6 A;  4E3Q A;  2W7E A;  3QI6 A;  1I41 A;  3EIA A;  5HDM A;  1WYT B;  3EIB A;  2QB3 A;  4TV7 A;  4W1V A;  1TOE A;  1VEF A;  1GDE A;  2EZ1 A;  1I48 A;  2BIE A;  3MC6 A;  3NYS A;  4W1W A;  1QGN A;  3LV2 A;  1CL1 A;  2JG2 A;  3JTX A;  1M0O A;  4XQ2 A;  1OAT A;  2VIB A;  1B5O A;  1MLY A;  2QB2 A;  4JEZ A;  2ZY3 A;  3GZD A;  3B1D A;  3EZ1 A;  4IXS A;  2JJE A;  4LNJ A;  3A2B A;  4ITG A;  1ARH A;  2W8W A;  4RKC A;  2W7G A;  2DGM A;  3JZL A;  5HHY A;  2FYF A;  3DC1 A;  3RBF A;  4A00 A;  1M6S A;  2BIA A;  4ISY A;  2ZYJ A;  3BV0 A;  4Q6R A;  4O6Z A;  3N5M A;  1EQB A;  1CQ6 A;  5EFS A;  3DZZ A;  2VGS A;  3II0 A;  4R5F A;  4JE5 A;  1AHX A;  2Z9U A;  3E2F A;  5F9S A;  3W1I A;  3F6T A;  2TPL A;  3G0T A;  2FQ6 A;  4HF8 A;  3I16 A;  2AAT A;  4R8D A;  2HUI A;  1M0N A;  2VYC A;  4P7Y A;  2GMU A;  2BHX A;  4UQV A;  1D7V A;  2W7F A;  4XJM A;  1QJ5 A;  1AY8 A;  3QN6 A;  5FT6 A;  3R9A A;  2DGL A;  4GEB A;  4F4E A;  1GD9 A;  2Z1Y A;  2CJH A;  2F8J A;  3BWN A;  1U08 A;  3HDO A;  4WYA A;  5J8Q A;  1RV3 A;  1SF2 A;  2C7T A;  4WLH A;  4QGR A;  1AKC A;  3TFU A;  1DJE A;  1UKJ A;  3BC8 A;  1MDO A;  5EIG A;  4CBS A;  4R5Z A;  5G4I A;  2AY7 A;  1TAT A;  3NNK A;  4OTL A;  4UOY A;  4XAU A;  4A6U A;  3NDN A;  1GC4 A;  2E54 A;  1UU1 A;  1ASL A;  1C7O A;  3KGW A;  4OCA A;  4XEW A;  1M0Q A;  2VMZ A;  3FVX A;  4ADE A;  1J32 A;  3WKS A;  1ZC9 A;  4I8A A;  4RM1 A;  3ASB A;  3GZC A;  4ZSY A;  3H7F A;  3OKS A;  2AEU A;  2QMA A;  3NRA A;  1OXO A;  2VMO A;  2VMS A;  3BB8 A;  4WXF A;  4KYO A;  4BA5 A;  1MGV A;  3FCR A;  4LC3 A;  2W8V A;  1AAM A;  1IJI A;  3RBL A;  3RQ1 A;  2YOB A;  1IAX A;  1WYU A;  2ZSL A;  4AZK A;  4WYG A;  3CAI A;  1WKH A;  3EI9 A;  4W5K A;  2O1B A;  1JG8 A;  1AHY A;  2AY3 A;  3JU7 A;  4EB7 A;  4EB5 A;  1O61 A;  1VJO A;  1LC7 A;  2W7M A;  3AOV A;  2RFV A;  4FFC A;  3CQ4 A;  2JJH A;  1YIY A;  2VMR A;  1YIZ A;  3OP7 A;  3E2Z A;  1ASM A;  4AO4 A;  3MAF B;  2OKJ A;  4AOA A;  4FL0 A;  2QBT A;  2ZC0 A;  3ISL A;  1TOI A;  4BMK A;  5HXX A;  2AY8 A;  1H0C A;  3KKI A;  3NUB A;  4GDY A;  2D7Z A;  4F5M A;  2GMS A;  1GC2 A;  2OKK A;  2DGK A;  2CB1 A;  2BWN A;  2HZP A;  2W7K A;  1ASE A;  2C44 A;  4TN4 A;  2CFB A;  4PFF A;  3FKD A;  4PFN A;  1M0P A;  1QIR A;  2VI9 A;  4IYO B;  2EPJ A;  1BJW A;  2BIG A;  4M2M A;  2DKJ A;  1IX7 A;  1OHW A;  5AX8 A;  1WYV B;  2W8U A;  2HOR A;  4J8L A;  4JF0 A;  3LVK A;  1DJU A;  3HLM A;  3PAA A;  3HMU A;  4B98 A;  1ELQ A;  2VMX A;  3KE3 A;  3ZZJ A;  1IVR A;  2FNI A;  4ZDP A;  1X0M A;  3AEL A;  1D2F A;  3UAK A;  1DJ9 A;  3PGY A;  2G6W A;  3HBX A;  1DTY A;  3VOM A;  4OBV A;  2OGA A;  3NU7 A;  3WCO A;  4ADB A;  1I43 A;  1ARG A;  2YKY A;  2R2N A;  3E9K A;  2VMN A;  4MKJ A;  1KMK A;  1BKG A;  4WD2 A;  3B8X A;  3CQ5 A;  3ATH A;  2VMY A;  3FDD A;  1QIT A;  4M2K A;  4F5G A;  1AHE A;  4AH3 A;  3EUC A;  4WB0 B;  5G2P A;  3Q8N A;  1RV4 A;  2VIA A;  1EG5 A;  1S08 A;  1AIA A;  3W1H A;  2AEV A;  3PDX A;  3ELP A;  3W1J A;  1O69 A;  1PG8 A;  3NYT A;  3DXW A;  3N0L A;  2W7J A;  3FFR A;  2VLF A;  1TAS A;  3BCX A;  1W7M A;  2BI1 A;  2R5C A;  3VK2 A;  1AMA A;  4F5F A;  1V2E A;  2YRI A;  1QZ9 A;  2YRR A;  1YNU A;  3E6G A;  2Z61 A;  3PJ0 A;  3R4T A;  3ECD A;  1IUG A;  1G4X A;  1S0A A;  3ACZ A;  3ASA A;  3B1C A;  1FC4 A;  4A0H A;  1IBJ A;  1SFF A;  1LKC A;  2XBN A;  3BN1 A;  3PPL A;  4WYE A;  4GE9 A;  3AEJ C;  1B4X A;  5M46 A;  3A8U X;  1ART A;  3AOW A;  4RJ0 A;  4A0G A;  1BT4 A;  2AY2 A;  4JEY A;  3G8M A;  3NTJ A;  2FN6 A;  3FQ7 A;  5D95 A;  3HQT A;  3IHJ A;  1GC0 A;  1B9H A;  5G0A A;  1RVY A;  2BWO A;  2FNU A;  4OBU A;  4UHO A;  4UHN A;  3RCH A;  1IX6 A;  1AJS A;  1BJO A;  1DKA A;  2VMW A;  2YKU A;  4IXO A;  5E4Z A;  2AY1 A;  2CH1 A;  4ZDO A;  4ZM4 A;  1C4K A;  2BI3 A;  2EZ2 A;  1BW0 A;  3CBF A;  1P3W A;  3GSB A;  4R2N A;  2ZSM A;  2HOZ A;  2VMV A;  1KL1 A;  3DRD A;  5EIG B;  1ASD A;  2W8T A;  5LHA A;  5K8B A;  1B9I A;  4WLJ A;  3DR7 A;  3MEB A;  4LNL A;  4Q76 A;  1AKA A;  4WXG A;  1ELU A;  5DJ1 A;  1O62 A;  3DU4 A;  3FTB A;  3FQA A;  2CIN A;  3FRK A;  2BYJ A;  4JF1 A;  2ORD A;  1V2F A;  1T3I A;  4P3M A;  2CJD A;  3LVM A;  1TOK A;  2Z20 A;  3FDB A;  2BKW A;  2D7Y A;  4IX8 A;  4MQR A;  4MQP A;  5LH9 A;  2AY9 A;  3LY1 A;  1SVV A;  3JWA A;  1AX4 A;  3I4J A;  1KMJ A;  1QJ3 A;  1ASB A;  1C7N A;  3TQX A;  2Z1Z A;  4Q75 A;  1AHG A;  1SZU A;  2PO3 A;  4ZWV A;  4CXQ A;  2PB0 A;  1WYU B;  4W91 A;  3K7Y A;  3FFH A;  3AEN A;  2CH2 A;  4BA4 A;  3QPG A;  2Z9X A;  2C0R A;  2X3L A;  3HL2 A;  3RUY A;  3LWS A;  1IX8 A;  4RJY A;  3PA9 A;  4E1O A;  1OHV A;  4MQQ A;  3DXV A;  3WCN A;  1AHF A;  3IF2 A;  4K2B A;  4B9B A;  3NU8 A;  3A9Z A;  3E2Z B;  1V72 A;  3QM2 A;  3AEJ A;  1ARI A;  1ORD A;  2VLH A;  5BJ3 A;  1CS1 A;  4M2J A;  1SZS A;  4JEW A;  2YKV A;  1AMQ A;  1Z7D A;  3WY7 A;  4L0O A;  9AAT A;  4ZLV A;  2HP1 A;  2ZJG A;  3QBO A;  3LVL B;  2CJG A;  4IW7 A;  2CST A;  3I5T A;  3NX3 A;  4U1T A;  1MAQ A;  3B46 A;  5DX5 A;  5EQC A;  2YCN A;  2C81 A;  3MAD A;  2JGT A;  3FQ8 A;  1CL2 A;  3FZ8 A;  5EUD A;  4F5J A;  2CY8 A;  3H14 A;  4MSO A;  4DBC A;  3ZZK A;  3TCM A;  1J04 A;  2D5Y A;  4CXR A;  1M32 A;  2D61 A;  4JEV A;  4CVQ A;  1MAP A;  2OQX A;  4GE4 A;  5E3K A;  3NYU A;  2D66 A;  4WBT A;  3JW9 A;  1CZC A;  3AEO A;  5EAA A;  1XEY A;  4J5U A;  5FT8 A;  4AO9 A;  4Y0D A;  1G4V A;  2E7U A;  1AKB A;  1GCK A;  1TOG A;  3PDB A;  4MKK A;  4OC9 A;  1BQA A;  1ZOB A;  3MKJ A;  1B5P A;  1KL2 A;  1YAA A;  3FD0 A;  2VMQ A;  4UHM A;  4HVK A;  1B8G A;  2BYL A;  3DR4 A;  4ZAH A;  2X5D A;  3K40 A;  3UWC A;  5E5I A;  4RKD A;  3WLX A;  2HOX A;  2VMT A;  5BJ4 A;  5IWQ A;  3AAT A;  4MY5 A;  4GRX A;  3BS8 A;  1JF9 A;  5EUE A;  3WX9 A;  3PD6 A;  3PIU A;  4KAM A;  5M4D A;  2V0Y A;  2HUU A;  3VK3 A;  4ADC A;  2DOU A;  3GR9 A;  4XK1 A;  2Z9V A;  3BWN C;  1LW5 A;  2BI2 A;  2R5C B;  2HOY A;  2WKA A;  2AY5 A;  1UU0 A;  2DR1 A;  1AAW A;  3AEP A;  3FSL A;  5G2Q A;  1GEW A;  4EMY A;  4ADD A;  3T32 A;  2ZY4 A;  1G7W A;  4E3R A;  2D64 A;  5M49 A;  1OHY A;  2NMP A;  4MGR A;  4XJP A;  1FG3 A;  3E77 A;  4N0B A;  3P6K A;  2WK8 A;  3CQ6 A;  1YJY A;  4BQ0 A;  1V2D A;  3GJU A;  4ZDL A;  4K2M A;  3EI8 A;  3MBB A;  3WZF A;  4ATP A;  3E2Y A;  1JS6 A;  2X5F A;  1ASF A;  4Y0H A;  3TFT A;  5C6U A;  2Z67 A;  1H1C A;  1MDX A;  3NUI A;  3RCH B;  1AJS B;  1AIB A;  1BJO B;  1EJI A;  3ZRP A;  4LW4 A;  1D7U A;  2Q7W A;  1YOO A;  4OYT A;  4ZWM A;  3GET A;  1OXP A;  4A6T A;  2JJF A;  1WYT A;  4RIT A;  2HUF A;  3WGB A;  3VAX A;  1SZK A;  4RLG A;  1O4S A;  1KKP A;  3ZRR A;  1FG7 A;  1LC5 A;  4GSA A;  2X8U A;  2YCT A;  3BCB A;  3WGC A;  2XH1 A;  2W7H A;  3GWP A;  4ITX A;  5FT4 A;  4RIZ A;  1WST A;  4LW2 A;  4A72 A;  2VGT A;  4XJL A;  1Z3Z A;  4E77 A;  1ASC A;  1X29 A;  3USF A;  2W8J A;  4XJO A;  4ATQ A;  4OMA A;  1DGE A;  2VGU A;  2QLR A;  1RVU A;  2JJG A;  4ZSW A;  2JIS A;  3P1T A;  3ELE A;  2EH6 A;  3ZRQ A;  2QA3 A;  4NOG A;  2Z9W A; 
#chains in the Genus database with same CATH topology
 1BQD A;  4A0R A;  2VI8 A;  3EI7 A;  2GSA A;  3AEN B;  1TOJ A;  1X28 A;  3TAT A;  3JWB A;  2D63 A;  3EZS A;  3M5U A;  1G7X A;  3FVU A;  1S07 A;  2HP2 A;  4WYF A;  4Y0I A;  1W7L A;  1AY5 A;  1JS3 A;  3DOD A;  4IXZ A;  1UU2 A;  4EFF A;  3H9X A;  3UE8 A;  1KKJ A;  2DKB A;  2VMP A;  5DB5 A;  1M4N A;  3N75 A;  1AIC A;  4W8I A;  3QGU A;  1IAY A;  2WK9 A;  1YJS A;  1D7S A;  3GBX A;  4PVF A;  2R0T A;  2ZP7 A;  2YKX A;  4CBR A;  1LC8 A;  1BS0 A;  2OGE A;  3A9X A;  1LS3 A;  3D6K A;  1YJZ A;  4BHD A;  3AEM C;  3LVJ A;  3B1E A;  3L8A A;  1CZE A;  2ZY2 A;  2BI9 A;  1S09 A;  4WYC A;  4H51 A;  4ZM3 A;  1N31 A;  2YHK A;  3COG A;  3FZ6 A;  2AY4 A;  4TMR A;  5G09 A;  4AZJ A;  4F5H A;  4WXB A;  4A6R A;  1E5E A;  2EGY A;  8AAT A;  1GC3 A;  1MDZ A;  2FM1 A;  2OAT A;  2CTZ A;  1WKG A;  4LNM A;  1SPA A;  1N2T A;  3WKR A;  2D65 A;  3PDB B;  1XI9 A;  2W7L A;  3G7Q A;  1QIS A;  1MLZ A;  3F0H A;  1D7R A;  1M7Y A;  3MC6 C;  3RI6 A;  2O0R A;  5EUN A;  1ARS A;  3QHX A;  5EAV A;  2BWP A;  2GQN A;  1Y4I A;  3GZD C;  5I92 A;  2AY6 A;  4F5K A;  2KFP A;  4WP0 A;  2VGZ A;  2ZUK A;  3DYD A;  1S06 A;  3LG0 A;  3MAF A;  2GB3 A;  1C7G A;  2PB2 A;  4F5I A;  1AMS A;  1PMO A;  1W7N A;  1ASN A;  2VGV A;  4F5L A;  5JAY A;  2E7I A;  4GE7 A;  3PD6 B;  5F8V A;  2W7I A;  2EO5 A;  3F9T A;  1E5F A;  5DJ9 A;  1LW4 A;  3FVS A;  2V1P A;  4IYO A;  4W1X A;  4IY7 A;  4Q31 A;  2O7C A;  4K2I A;  1WYV A;  1DGD A;  2YCP A;  1GEX A;  1W3U A;  5TF5 A;  1BJN A;  1VP4 A;  1CQ7 A;  1AJR A;  1C9C A;  2VMU A;  1N8P A;  2CAN A;  2W7D A;  4DQ6 A;  1LK9 A;  3A9Y A;  3KGX A;  3BWO A;  3VP6 A;  2ZY5 A;  1CQ8 A;  5FT5 A;  1AY4 A;  4JEX A;  1ZOD A;  1GBN A;  4PIW A;  2WK7 A;  5M4B A;  1GEY A;  4DGT A;  2E7J A;  1ASA A;  3K28 A;  4N0W A;  3FZ7 A;  4RAE A;  1BJ4 A;  4U2H A;  3VK4 A;  5D5S A;  7AAT A;  1W23 A;  1DFO A;  4JE5 D;  1ECX A;  3AEM A;  5G4J A;  3HT4 A;  1I29 A;  3BCA A;  1X2A A;  1C0N A;  3EI5 A;  2R5E A;  4WYD A;  4KXK A;  3HVY A;  3MAU A;  4ZAS A;  4EU1 A;  1CJ0 A;  2BI5 A;  2VGW A;  4WB0 A;  1TPL A;  4OT8 A;  4H63 Q;  4A0F A;  3L44 A;  3AV7 A;  1PFF A;  1ASG A;  1TAR A;  1AMR A;  1PMM A;  3EI6 A;  4E3Q A;  2W7E A;  3QI6 A;  1I41 A;  3EIA A;  5HDM A;  1WYT B;  3EIB A;  2QB3 A;  4TV7 A;  4W1V A;  1TOE A;  1VEF A;  1GDE A;  2EZ1 A;  1I48 A;  2BIE A;  3MC6 A;  3NYS A;  4W1W A;  1QGN A;  3LV2 A;  1CL1 A;  2JG2 A;  3JTX A;  1M0O A;  4XQ2 A;  1OAT A;  2VIB A;  1B5O A;  1MLY A;  2QB2 A;  4JEZ A;  2ZY3 A;  3GZD A;  3B1D A;  3EZ1 A;  4IXS A;  2JJE A;  4LNJ A;  3A2B A;  4ITG A;  1ARH A;  2W8W A;  4RKC A;  2W7G A;  2DGM A;  3JZL A;  5HHY A;  2FYF A;  3DC1 A;  3RBF A;  4A00 A;  1M6S A;  2BIA A;  4ISY A;  2ZYJ A;  3BV0 A;  4Q6R A;  4O6Z A;  3N5M A;  1EQB A;  1CQ6 A;  5EFS A;  3DZZ A;  2VGS A;  3II0 A;  4R5F A;  4JE5 A;  1AHX A;  2Z9U A;  3E2F A;  5F9S A;  3W1I A;  3F6T A;  2TPL A;  3G0T A;  2FQ6 A;  4HF8 A;  3I16 A;  2AAT A;  2WB6 A;  5KTB A;  4R8D A;  2HUI A;  1M0N A;  2VYC A;  4P7Y A;  2GMU A;  2BHX A;  4UQV A;  1D7V A;  2W7F A;  4XJM A;  1QJ5 A;  1AY8 A;  3QN6 A;  5FT6 A;  3R9A A;  2DGL A;  4GEB A;  4F4E A;  1GD9 A;  2Z1Y A;  2CJH A;  2F8J A;  3BWN A;  1U08 A;  3HDO A;  4WYA A;  5J8Q A;  1RV3 A;  1SF2 A;  2C7T A;  4WLH A;  4QGR A;  1AKC A;  3TFU A;  1DJE A;  1UKJ A;  3N7N A;  3BC8 A;  1MDO A;  5EIG A;  4CBS A;  4R5Z A;  5G4I A;  2AY7 A;  1TAT A;  3NNK A;  4OTL A;  4UOY A;  4XAU A;  4A6U A;  3NDN A;  1GC4 A;  2E54 A;  1UU1 A;  1ASL A;  1C7O A;  3KGW A;  4OCA A;  4XEW A;  1M0Q A;  2VMZ A;  3FVX A;  4ADE A;  1J32 A;  3WKS A;  1ZC9 A;  4I8A A;  4RM1 A;  3ASB A;  3GZC A;  4ZSY A;  3H7F A;  3OKS A;  2AEU A;  2QMA A;  3NRA A;  1OXO A;  2VMO A;  2VMS A;  3BB8 A;  4WXF A;  4KYO A;  4BA5 A;  1MGV A;  3FCR A;  4LC3 A;  2W8V A;  1AAM A;  1IJI A;  3RBL A;  3RQ1 A;  2YOB A;  1IAX A;  1WYU A;  2ZSL A;  4AZK A;  4WYG A;  3CAI A;  1WKH A;  3EI9 A;  4W5K A;  2O1B A;  1JG8 A;  1AHY A;  2AY3 A;  3JU7 A;  4EB7 A;  4EB5 A;  1O61 A;  1VJO A;  1LC7 A;  2W7M A;  3AOV A;  2RFV A;  4FFC A;  3CQ4 A;  2JJH A;  1YIY A;  2VMR A;  1YIZ A;  3OP7 A;  3E2Z A;  1ASM A;  4AO4 A;  3MAF B;  2OKJ A;  4AOA A;  4FL0 A;  2QBT A;  2ZC0 A;  3ISL A;  2A1V A;  1TOI A;  4BMK A;  5HXX A;  2AY8 A;  1H0C A;  3KKI A;  3NUB A;  4GDY A;  2D7Z A;  4F5M A;  2GMS A;  1GC2 A;  2OKK A;  2DGK A;  2CB1 A;  2BWN A;  2HZP A;  2W7K A;  1ASE A;  2C44 A;  4TN4 A;  2CFB A;  4PFF A;  3FKD A;  4PFN A;  1M0P A;  1QIR A;  2VI9 A;  4IYO B;  2EPJ A;  1BJW A;  2BIG A;  4M2M A;  2DKJ A;  1IX7 A;  1OHW A;  5AX8 A;  1WYV B;  2W8U A;  2HOR A;  4J8L A;  4JF0 A;  3LVK A;  1DJU A;  3HLM A;  3PAA A;  3HMU A;  4B98 A;  1ELQ A;  2VMX A;  3KE3 A;  3ZZJ A;  1IVR A;  2FNI A;  4ZDP A;  1X0M A;  3AEL A;  1D2F A;  3UAK A;  1DJ9 A;  3PGY A;  2G6W A;  3HBX A;  1DTY A;  3VOM A;  4OBV A;  2OGA A;  3NU7 A;  3WCO A;  4ADB A;  1I43 A;  1ARG A;  2YKY A;  2R2N A;  3E9K A;  2VMN A;  4MKJ A;  1KMK A;  1BKG A;  4WD2 A;  3B8X A;  3CQ5 A;  3ATH A;  2VMY A;  3FDD A;  1QIT A;  4M2K A;  4F5G A;  1AHE A;  4AH3 A;  3EUC A;  4WB0 B;  5G2P A;  3Q8N A;  1RV4 A;  2VIA A;  1EG5 A;  1S08 A;  1AIA A;  3W1H A;  2AEV A;  3PDX A;  3ELP A;  3W1J A;  1O69 A;  1PG8 A;  3NYT A;  3DXW A;  3N0L A;  2W7J A;  3FFR A;  2VLF A;  1TAS A;  3BCX A;  1W7M A;  2BI1 A;  2R5C A;  3VK2 A;  1AMA A;  4F5F A;  1V2E A;  2YRI A;  1QZ9 A;  2YRR A;  1YNU A;  3E6G A;  2Z61 A;  3PJ0 A;  3R4T A;  3ECD A;  1IUG A;  1G4X A;  1S0A A;  3ACZ A;  3ASA A;  3B1C A;  1FC4 A;  4A0H A;  1IBJ A;  1SFF A;  1LKC A;  2XBN A;  3BN1 A;  3PPL A;  4WYE A;  2FKI A;  4GE9 A;  3AEJ C;  1B4X A;  5M46 A;  3A8U X;  1ART A;  3AOW A;  4RJ0 A;  4A0G A;  1BT4 A;  2AY2 A;  3N4S A;  4JEY A;  3G8M A;  2G7J A;  3NTJ A;  2FN6 A;  3FQ7 A;  5D95 A;  3HQT A;  3IHJ A;  1GC0 A;  1B9H A;  5G0A A;  1RVY A;  2BWO A;  2FNU A;  4OBU A;  4UHO A;  4UHN A;  3RCH A;  1IX6 A;  1AJS A;  1BJO A;  1DKA A;  2VMW A;  2YKU A;  4IXO A;  5E4Z A;  2AY1 A;  2CH1 A;  4ZDO A;  4ZM4 A;  1C4K A;  2BI3 A;  2EZ2 A;  1BW0 A;  3CBF A;  1P3W A;  3GSB A;  4R2N A;  3N4R A;  2ZSM A;  2HOZ A;  2VMV A;  1KL1 A;  3DRD A;  5EIG B;  1ASD A;  2W8T A;  5LHA A;  5K8B A;  1B9I A;  4WLJ A;  3DR7 A;  3MEB A;  4LNL A;  4Q76 A;  1AKA A;  4WXG A;  1ELU A;  5DJ1 A;  1O62 A;  3DU4 A;  3FTB A;  3FQA A;  2CIN A;  3FRK A;  2BYJ A;  4JF1 A;  2ORD A;  1V2F A;  1T3I A;  4P3M A;  2CJD A;  3LVM A;  1TOK A;  2Z20 A;  3FDB A;  2BKW A;  2D7Y A;  4IX8 A;  4MQR A;  4MQP A;  5LH9 A;  2AY9 A;  3LY1 A;  1SVV A;  3JWA A;  1AX4 A;  3I4J A;  1KMJ A;  1QJ3 A;  1ASB A;  1C7N A;  3TQX A;  2Z1Z A;  4Q75 A;  1AHG A;  1SZU A;  2PO3 A;  4ZWV A;  4CXQ A;  2PB0 A;  1WYU B;  1KAF A;  4W91 A;  3K7Y A;  3FFH A;  3AEN A;  2CH2 A;  4BA4 A;  3QPG A;  2Z9X A;  2C0R A;  2X3L A;  3HL2 A;  3RUY A;  3LWS A;  1IX8 A;  4RJY A;  3PA9 A;  4E1O A;  1OHV A;  4MQQ A;  3DXV A;  3WCN A;  1AHF A;  3IF2 A;  4K2B A;  4B9B A;  3NU8 A;  3A9Z A;  3E2Z B;  1V72 A;  3QM2 A;  3AEJ A;  1ARI A;  1ORD A;  2VLH A;  5BJ3 A;  1CS1 A;  4M2J A;  1SZS A;  4JEW A;  2YKV A;  1AMQ A;  1Z7D A;  3WY7 A;  4L0O A;  9AAT A;  4ZLV A;  2HP1 A;  2ZJG A;  3QBO A;  3LVL B;  2CJG A;  4IW7 A;  2CST A;  3I5T A;  3NX3 A;  4U1T A;  1MAQ A;  3B46 A;  5DX5 A;  5EQC A;  2YCN A;  2C81 A;  3MAD A;  2JGT A;  3FQ8 A;  1CL2 A;  3FZ8 A;  5EUD A;  4F5J A;  2CY8 A;  3H14 A;  4MSO A;  4DBC A;  3ZZK A;  3TCM A;  1J04 A;  2D5Y A;  4CXR A;  1M32 A;  2D61 A;  4JEV A;  4CVQ A;  1MAP A;  2OQX A;  4GE4 A;  5E3K A;  3NYU A;  2D66 A;  4WBT A;  3JW9 A;  1CZC A;  3AEO A;  5EAA A;  1XEY A;  4J5U A;  5FT8 A;  4AO9 A;  4Y0D A;  1G4V A;  2E7U A;  1AKB A;  1GCK A;  1TOG A;  3PDB A;  4MKK A;  4OC9 A;  1BQA A;  1ZOB A;  3MKJ A;  1B5P A;  1KL2 A;  1YAA A;  3FD0 A;  2VMQ A;  4UHM A;  4HVK A;  1B8G A;  2BYL A;  3DR4 A;  4ZAH A;  2X5D A;  3K40 A;  3UWC A;  5E5I A;  4RKD A;  3WLX A;  2HOX A;  2VMT A;  5BJ4 A;  5IWQ A;  3AAT A;  3N4X A;  4MY5 A;  4GRX A;  3BS8 A;  1JF9 A;  5EUE A;  3WX9 A;  3PD6 A;  3PIU A;  4KAM A;  5M4D A;  2V0Y A;  2HUU A;  3VK3 A;  4ADC A;  2DOU A;  3GR9 A;  4XK1 A;  2Z9V A;  3BWN C;  1LW5 A;  2BI2 A;  2R5C B;  2HOY A;  2WKA A;  2AY5 A;  1UU0 A;  2DR1 A;  1AAW A;  3AEP A;  3FSL A;  5G2Q A;  1GEW A;  4EMY A;  4ADD A;  3T32 A;  2ZY4 A;  1G7W A;  4E3R A;  2D64 A;  5M49 A;  1OHY A;  2NMP A;  4MGR A;  4XJP A;  1FG3 A;  3E77 A;  4N0B A;  2EYQ A;  3P6K A;  2WK8 A;  3CQ6 A;  1YJY A;  4BQ0 A;  2QSR A;  1V2D A;  3GJU A;  4ZDL A;  4K2M A;  3EI8 A;  3MBB A;  3WZF A;  4ATP A;  3E2Y A;  1JS6 A;  2X5F A;  1ASF A;  4Y0H A;  3TFT A;  5C6U A;  2Z67 A;  1H1C A;  1MDX A;  3NUI A;  3RCH B;  1AJS B;  1AIB A;  1BJO B;  1EJI A;  3ZRP A;  4LW4 A;  1D7U A;  2Q7W A;  1YOO A;  4OYT A;  4ZWM A;  3GET A;  1OXP A;  4A6T A;  2JJF A;  1WYT A;  4RIT A;  2HUF A;  3WGB A;  4K05 A;  3VAX A;  1SZK A;  4RLG A;  1O4S A;  1KKP A;  3ZRR A;  1FG7 A;  1LC5 A;  4GSA A;  2X8U A;  2YCT A;  3BCB A;  3WGC A;  2XH1 A;  2W7H A;  3GWP A;  4ITX A;  5FT4 A;  4RIZ A;  1WST A;  4LW2 A;  4A72 A;  2VGT A;  4XJL A;  1Z3Z A;  4E77 A;  1ASC A;  1X29 A;  3USF A;  2W8J A;  4XJO A;  4ATQ A;  4OMA A;  1DGE A;  2VGU A;  2QLR A;  1RVU A;  2JJG A;  4ZSW A;  2JIS A;  3P1T A;  3ELE A;  2EH6 A;  3ZRQ A;  2QA3 A;  4NOG A;  2Z9W A; 
#chains in the Genus database with same CATH homology
 1BQD A;  4A0R A;  2VI8 A;  3EI7 A;  2GSA A;  3AEN B;  1TOJ A;  1X28 A;  3TAT A;  3JWB A;  2D63 A;  3EZS A;  3M5U A;  1G7X A;  3FVU A;  1S07 A;  2HP2 A;  4WYF A;  4Y0I A;  1W7L A;  1AY5 A;  1JS3 A;  3DOD A;  4IXZ A;  1UU2 A;  4EFF A;  3H9X A;  3UE8 A;  1KKJ A;  2DKB A;  2VMP A;  5DB5 A;  1M4N A;  3N75 A;  1AIC A;  4W8I A;  3QGU A;  1IAY A;  2WK9 A;  1YJS A;  1D7S A;  3GBX A;  4PVF A;  2R0T A;  2ZP7 A;  2YKX A;  4CBR A;  1LC8 A;  1BS0 A;  2OGE A;  3A9X A;  1LS3 A;  3D6K A;  1YJZ A;  4BHD A;  3AEM C;  3LVJ A;  3B1E A;  3L8A A;  1CZE A;  2ZY2 A;  2BI9 A;  1S09 A;  4WYC A;  4H51 A;  4ZM3 A;  1N31 A;  2YHK A;  3COG A;  3FZ6 A;  2AY4 A;  4TMR A;  5G09 A;  4AZJ A;  4F5H A;  4WXB A;  4A6R A;  1E5E A;  2EGY A;  8AAT A;  1GC3 A;  1MDZ A;  2FM1 A;  2OAT A;  2CTZ A;  1WKG A;  4LNM A;  1SPA A;  1N2T A;  3WKR A;  2D65 A;  3PDB B;  1XI9 A;  2W7L A;  3G7Q A;  1QIS A;  1MLZ A;  3F0H A;  1D7R A;  1M7Y A;  3MC6 C;  3RI6 A;  2O0R A;  5EUN A;  1ARS A;  3QHX A;  5EAV A;  2BWP A;  2GQN A;  1Y4I A;  3GZD C;  5I92 A;  2AY6 A;  4F5K A;  2KFP A;  4WP0 A;  2VGZ A;  2ZUK A;  3DYD A;  1S06 A;  3LG0 A;  3MAF A;  2GB3 A;  1C7G A;  2PB2 A;  4F5I A;  1AMS A;  1PMO A;  1W7N A;  1ASN A;  2VGV A;  4F5L A;  5JAY A;  2E7I A;  4GE7 A;  3PD6 B;  5F8V A;  2W7I A;  2EO5 A;  3F9T A;  1E5F A;  5DJ9 A;  1LW4 A;  3FVS A;  2V1P A;  4IYO A;  4W1X A;  4IY7 A;  4Q31 A;  2O7C A;  4K2I A;  1WYV A;  1DGD A;  2YCP A;  1GEX A;  1W3U A;  5TF5 A;  1BJN A;  1VP4 A;  1CQ7 A;  1AJR A;  1C9C A;  2VMU A;  1N8P A;  2CAN A;  2W7D A;  4DQ6 A;  1LK9 A;  3A9Y A;  3KGX A;  3BWO A;  3VP6 A;  2ZY5 A;  1CQ8 A;  5FT5 A;  1AY4 A;  4JEX A;  1ZOD A;  1GBN A;  4PIW A;  2WK7 A;  5M4B A;  1GEY A;  4DGT A;  2E7J A;  1ASA A;  3K28 A;  4N0W A;  3FZ7 A;  4RAE A;  1BJ4 A;  4U2H A;  3VK4 A;  5D5S A;  7AAT A;  1W23 A;  1DFO A;  4JE5 D;  1ECX A;  3AEM A;  5G4J A;  3HT4 A;  1I29 A;  3BCA A;  1X2A A;  1C0N A;  3EI5 A;  2R5E A;  4WYD A;  4KXK A;  3HVY A;  3MAU A;  4ZAS A;  4EU1 A;  1CJ0 A;  2BI5 A;  2VGW A;  4WB0 A;  1TPL A;  4OT8 A;  4H63 Q;  4A0F A;  3L44 A;  3AV7 A;  1PFF A;  1ASG A;  1TAR A;  1AMR A;  1PMM A;  3EI6 A;  4E3Q A;  2W7E A;  3QI6 A;  1I41 A;  3EIA A;  5HDM A;  1WYT B;  3EIB A;  2QB3 A;  4TV7 A;  4W1V A;  1TOE A;  1VEF A;  1GDE A;  2EZ1 A;  1I48 A;  2BIE A;  3MC6 A;  3NYS A;  4W1W A;  1QGN A;  3LV2 A;  1CL1 A;  2JG2 A;  3JTX A;  1M0O A;  4XQ2 A;  1OAT A;  2VIB A;  1B5O A;  1MLY A;  2QB2 A;  4JEZ A;  2ZY3 A;  3GZD A;  3B1D A;  3EZ1 A;  4IXS A;  2JJE A;  4LNJ A;  3A2B A;  4ITG A;  1ARH A;  2W8W A;  4RKC A;  2W7G A;  2DGM A;  3JZL A;  5HHY A;  2FYF A;  3DC1 A;  3RBF A;  4A00 A;  1M6S A;  2BIA A;  4ISY A;  2ZYJ A;  3BV0 A;  4Q6R A;  4O6Z A;  3N5M A;  1EQB A;  1CQ6 A;  5EFS A;  3DZZ A;  2VGS A;  3II0 A;  4R5F A;  4JE5 A;  1AHX A;  2Z9U A;  3E2F A;  5F9S A;  3W1I A;  3F6T A;  2TPL A;  3G0T A;  2FQ6 A;  4HF8 A;  3I16 A;  2AAT A;  2WB6 A;  5KTB A;  4R8D A;  2HUI A;  1M0N A;  2VYC A;  4P7Y A;  2GMU A;  2BHX A;  4UQV A;  1D7V A;  2W7F A;  4XJM A;  1QJ5 A;  1AY8 A;  3QN6 A;  5FT6 A;  3R9A A;  2DGL A;  4GEB A;  4F4E A;  1GD9 A;  2Z1Y A;  2CJH A;  2F8J A;  3BWN A;  1U08 A;  3HDO A;  4WYA A;  5J8Q A;  1RV3 A;  1SF2 A;  2C7T A;  4WLH A;  4QGR A;  1AKC A;  3TFU A;  1DJE A;  1UKJ A;  3N7N A;  3BC8 A;  1MDO A;  5EIG A;  4CBS A;  4R5Z A;  5G4I A;  2AY7 A;  1TAT A;  3NNK A;  4OTL A;  4UOY A;  4XAU A;  4A6U A;  3NDN A;  1GC4 A;  2E54 A;  1UU1 A;  1ASL A;  1C7O A;  3KGW A;  4OCA A;  4XEW A;  1M0Q A;  2VMZ A;  3FVX A;  4ADE A;  1J32 A;  3WKS A;  1ZC9 A;  4I8A A;  4RM1 A;  3ASB A;  3GZC A;  4ZSY A;  3H7F A;  3OKS A;  2AEU A;  2QMA A;  3NRA A;  1OXO A;  2VMO A;  2VMS A;  3BB8 A;  4WXF A;  4KYO A;  4BA5 A;  1MGV A;  3FCR A;  4LC3 A;  2W8V A;  1AAM A;  1IJI A;  3RBL A;  3RQ1 A;  2YOB A;  1IAX A;  1WYU A;  2ZSL A;  4AZK A;  4WYG A;  3CAI A;  1WKH A;  3EI9 A;  4W5K A;  2O1B A;  1JG8 A;  1AHY A;  2AY3 A;  3JU7 A;  4EB7 A;  4EB5 A;  1O61 A;  1VJO A;  1LC7 A;  2W7M A;  3AOV A;  2RFV A;  4FFC A;  3CQ4 A;  2JJH A;  1YIY A;  2VMR A;  1YIZ A;  3OP7 A;  3E2Z A;  1ASM A;  4AO4 A;  3MAF B;  2OKJ A;  4AOA A;  4FL0 A;  2QBT A;  2ZC0 A;  3ISL A;  2A1V A;  1TOI A;  4BMK A;  5HXX A;  2AY8 A;  1H0C A;  3KKI A;  3NUB A;  4GDY A;  2D7Z A;  4F5M A;  2GMS A;  1GC2 A;  2OKK A;  2DGK A;  2CB1 A;  2BWN A;  2HZP A;  2W7K A;  1ASE A;  2C44 A;  4TN4 A;  2CFB A;  4PFF A;  3FKD A;  4PFN A;  1M0P A;  1QIR A;  2VI9 A;  4IYO B;  2EPJ A;  1BJW A;  2BIG A;  4M2M A;  2DKJ A;  1IX7 A;  1OHW A;  5AX8 A;  1WYV B;  2W8U A;  2HOR A;  4J8L A;  4JF0 A;  3LVK A;  1DJU A;  3HLM A;  3PAA A;  3HMU A;  4B98 A;  1ELQ A;  2VMX A;  3KE3 A;  3ZZJ A;  1IVR A;  2FNI A;  4ZDP A;  1X0M A;  3AEL A;  1D2F A;  3UAK A;  1DJ9 A;  3PGY A;  2G6W A;  3HBX A;  1DTY A;  3VOM A;  4OBV A;  2OGA A;  3NU7 A;  3WCO A;  4ADB A;  1I43 A;  1ARG A;  2YKY A;  2R2N A;  3E9K A;  2VMN A;  4MKJ A;  1KMK A;  1BKG A;  4WD2 A;  3B8X A;  3CQ5 A;  3ATH A;  2VMY A;  3FDD A;  1QIT A;  4M2K A;  4F5G A;  1AHE A;  4AH3 A;  3EUC A;  4WB0 B;  5G2P A;  3Q8N A;  1RV4 A;  2VIA A;  1EG5 A;  1S08 A;  1AIA A;  3W1H A;  2AEV A;  3PDX A;  3ELP A;  3W1J A;  1O69 A;  1PG8 A;  3NYT A;  3DXW A;  3N0L A;  2W7J A;  3FFR A;  2VLF A;  1TAS A;  3BCX A;  1W7M A;  2BI1 A;  2R5C A;  3VK2 A;  1AMA A;  4F5F A;  1V2E A;  2YRI A;  1QZ9 A;  2YRR A;  1YNU A;  3E6G A;  2Z61 A;  3PJ0 A;  3R4T A;  3ECD A;  1IUG A;  1G4X A;  1S0A A;  3ACZ A;  3ASA A;  3B1C A;  1FC4 A;  4A0H A;  1IBJ A;  1SFF A;  1LKC A;  2XBN A;  3BN1 A;  3PPL A;  4WYE A;  2FKI A;  4GE9 A;  3AEJ C;  1B4X A;  5M46 A;  3A8U X;  1ART A;  3AOW A;  4RJ0 A;  4A0G A;  1BT4 A;  2AY2 A;  3N4S A;  4JEY A;  3G8M A;  2G7J A;  3NTJ A;  2FN6 A;  3FQ7 A;  5D95 A;  3HQT A;  3IHJ A;  1GC0 A;  1B9H A;  5G0A A;  1RVY A;  2BWO A;  2FNU A;  4OBU A;  4UHO A;  4UHN A;  3RCH A;  1IX6 A;  1AJS A;  1BJO A;  1DKA A;  2VMW A;  2YKU A;  4IXO A;  5E4Z A;  2AY1 A;  2CH1 A;  4ZDO A;  4ZM4 A;  1C4K A;  2BI3 A;  2EZ2 A;  1BW0 A;  3CBF A;  1P3W A;  3GSB A;  4R2N A;  3N4R A;  2ZSM A;  2HOZ A;  2VMV A;  1KL1 A;  3DRD A;  5EIG B;  1ASD A;  2W8T A;  5LHA A;  5K8B A;  1B9I A;  4WLJ A;  3DR7 A;  3MEB A;  4LNL A;  4Q76 A;  1AKA A;  4WXG A;  1ELU A;  5DJ1 A;  1O62 A;  3DU4 A;  3FTB A;  3FQA A;  2CIN A;  3FRK A;  2BYJ A;  4JF1 A;  2ORD A;  1V2F A;  1T3I A;  4P3M A;  2CJD A;  3LVM A;  1TOK A;  2Z20 A;  3FDB A;  2BKW A;  2D7Y A;  4IX8 A;  4MQR A;  4MQP A;  5LH9 A;  2AY9 A;  3LY1 A;  1SVV A;  3JWA A;  1AX4 A;  3I4J A;  1KMJ A;  1QJ3 A;  1ASB A;  1C7N A;  3TQX A;  2Z1Z A;  4Q75 A;  1AHG A;  1SZU A;  2PO3 A;  4ZWV A;  4CXQ A;  2PB0 A;  1WYU B;  4W91 A;  3K7Y A;  3FFH A;  3AEN A;  2CH2 A;  4BA4 A;  3QPG A;  2Z9X A;  2C0R A;  2X3L A;  3HL2 A;  3RUY A;  3LWS A;  1IX8 A;  4RJY A;  3PA9 A;  4E1O A;  1OHV A;  4MQQ A;  3DXV A;  3WCN A;  1AHF A;  3IF2 A;  4K2B A;  4B9B A;  3NU8 A;  3A9Z A;  3E2Z B;  1V72 A;  3QM2 A;  3AEJ A;  1ARI A;  1ORD A;  2VLH A;  5BJ3 A;  1CS1 A;  4M2J A;  1SZS A;  4JEW A;  2YKV A;  1AMQ A;  1Z7D A;  3WY7 A;  4L0O A;  9AAT A;  4ZLV A;  2HP1 A;  2ZJG A;  3QBO A;  3LVL B;  2CJG A;  4IW7 A;  2CST A;  3I5T A;  3NX3 A;  4U1T A;  1MAQ A;  3B46 A;  5DX5 A;  5EQC A;  2YCN A;  2C81 A;  3MAD A;  2JGT A;  3FQ8 A;  1CL2 A;  3FZ8 A;  5EUD A;  4F5J A;  2CY8 A;  3H14 A;  4MSO A;  4DBC A;  3ZZK A;  3TCM A;  1J04 A;  2D5Y A;  4CXR A;  1M32 A;  2D61 A;  4JEV A;  4CVQ A;  1MAP A;  2OQX A;  4GE4 A;  5E3K A;  3NYU A;  2D66 A;  4WBT A;  3JW9 A;  1CZC A;  3AEO A;  5EAA A;  1XEY A;  4J5U A;  5FT8 A;  4AO9 A;  4Y0D A;  1G4V A;  2E7U A;  1AKB A;  1GCK A;  1TOG A;  3PDB A;  4MKK A;  4OC9 A;  1BQA A;  1ZOB A;  3MKJ A;  1B5P A;  1KL2 A;  1YAA A;  3FD0 A;  2VMQ A;  4UHM A;  4HVK A;  1B8G A;  2BYL A;  3DR4 A;  4ZAH A;  2X5D A;  3K40 A;  3UWC A;  5E5I A;  4RKD A;  3WLX A;  2HOX A;  2VMT A;  5BJ4 A;  5IWQ A;  3AAT A;  3N4X A;  4MY5 A;  4GRX A;  3BS8 A;  1JF9 A;  5EUE A;  3WX9 A;  3PD6 A;  3PIU A;  4KAM A;  5M4D A;  2V0Y A;  2HUU A;  3VK3 A;  4ADC A;  2DOU A;  3GR9 A;  4XK1 A;  2Z9V A;  3BWN C;  1LW5 A;  2BI2 A;  2R5C B;  2HOY A;  2WKA A;  2AY5 A;  1UU0 A;  2DR1 A;  1AAW A;  3AEP A;  3FSL A;  5G2Q A;  1GEW A;  4EMY A;  4ADD A;  3T32 A;  2ZY4 A;  1G7W A;  4E3R A;  2D64 A;  5M49 A;  1OHY A;  2NMP A;  4MGR A;  4XJP A;  1FG3 A;  3E77 A;  4N0B A;  2EYQ A;  3P6K A;  2WK8 A;  3CQ6 A;  1YJY A;  4BQ0 A;  2QSR A;  1V2D A;  3GJU A;  4ZDL A;  4K2M A;  3EI8 A;  3MBB A;  3WZF A;  4ATP A;  3E2Y A;  1JS6 A;  2X5F A;  1ASF A;  4Y0H A;  3TFT A;  5C6U A;  2Z67 A;  1H1C A;  1MDX A;  3NUI A;  3RCH B;  1AJS B;  1AIB A;  1BJO B;  1EJI A;  3ZRP A;  4LW4 A;  1D7U A;  2Q7W A;  1YOO A;  4OYT A;  4ZWM A;  3GET A;  1OXP A;  4A6T A;  2JJF A;  1WYT A;  4RIT A;  2HUF A;  3WGB A;  4K05 A;  3VAX A;  1SZK A;  4RLG A;  1O4S A;  1KKP A;  3ZRR A;  1FG7 A;  1LC5 A;  4GSA A;  2X8U A;  2YCT A;  3BCB A;  3WGC A;  2XH1 A;  2W7H A;  3GWP A;  4ITX A;  5FT4 A;  4RIZ A;  1WST A;  4LW2 A;  4A72 A;  2VGT A;  4XJL A;  1Z3Z A;  4E77 A;  1ASC A;  1X29 A;  3USF A;  2W8J A;  4XJO A;  4ATQ A;  4OMA A;  1DGE A;  2VGU A;  2QLR A;  1RVU A;  2JJG A;  4ZSW A;  2JIS A;  3P1T A;  3ELE A;  2EH6 A;  3ZRQ A;  2QA3 A;  4NOG A;  2Z9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...