1W7PB

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
199
structure length
182
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINSKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VPS22, YPL002C
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 40
structure length 182
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pB02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1w7pB01
2PFBA 2XGXA 1LDDA 2XROA 2VXZA 4XRFA 2EV5A 1KQ9A 3C1DA 1FX7A 1EH8A 2UZKA 2DFIA 4L0ZB 2QVOA 2IVMA 1QZYA 1KGSA 2K4JA 4U0WA 4KFCA 1FBUA 2G9WA 1XSVA 4NHJA 3V8KA 2VBWA 1SD7A 2EFPA 5FLXK 2FBHA 2RVCA 5CYVA 5E18F 4DNCA 3QAHA 1DUXC 3IRQA 5JR3A 2CO5A 4WCGA 3ZMVA 3EDPA 1D8JA 3ECHA 1T39A 2HKOA 1KYWA 3V4GA 4AVPA 2ZNZA 1XSXA 3R4KA 5A2QZ 2E7WA 2FU4A 4A6EA 4QWQA 1YW9A 3FWEA 1J2XA 2Q2EA 2ISZA 1U5TC 2K4BA 1HXDA 4WX9A 2E1NA 3RDIA 1KQ8A 3ZMSA 2VT2A 2FE3A 1SD4A 1K78B 4F7ZA 4EM1A 5IT9Z 2J5OA 1R22A 5L3FA 2V6CA 3GF2A 4G6QA 3ERED 1T0FA 2DBBA 1G3YA 4Q4ZF 3GFMA 3HSFA 4KN7X 3F8CA 2XKPA 4HA8A 3GZ5A 3TQNA 4IRGA 5K5RA 3KCCA 2X0LA 4G94A 2QZ8A 3BWGA 2PEXA 4FX4A 3WE3A 4A2UA 4EQQA 1ZLJA 4XBFA 3H3ZA 1TQIA 2HQNA 5FB2A 4ZZDA 4UUVA 4MQVA 1PP8F 4EGYA 4M6XA 1ZREA 3VODA 1ZAOA 1O3QA 1LNWA 1RUOA 2VN2A 2ZMEA 3QU6A 4EMSA 2ACJA 2DI3A 3O3KA 4L9TA 1W7PD 4M9SA 5KK1A 2NS0A 2BGCA 3SFZA 1KQ0A 2P6SA 3F8FA 1JE8A 2Z9OA 1FWZA 2MLGA 1FP1D 2IRFG 2H09A 1B4AA 3GFIA 2FSWA 4HF1A 1T2KA 2A3SA 2EFNA 3HRTA 5BPDA 2FQ3A 1W7PA 2P6TA 2RKHA 3BDDA 1F5TA 5HOOA 3CUQA 1ULYA 1USTA 3WGGA 1XDSA 1JXSA 2IA1A 5L3DA 1SFEA 5K1YA 4UVBA 2MH2A 4KN4X 4XLNF 3WTUC 5D4SA 5CJ9A 3AAFA 2XKOA 3F8NA 3LA7A 4UVAA 3I54A 2PN6A 2XAQA 2FOKA 4B8XA 4IF4A 2COMA 3LA2A 4IHTA 1STZA 2TDXA 3ISPA 4HLYA 1XB4A 5E8IA 4A0YA 2NRAC 4OIPF 1HSTA 2D2WA 4LJZF 1OR7A 3NQOA 4U0VA 4HBLA 4I0BA 2UXXA 4XSZF 5HDGA 4R1HA 2HGCA 1UHMA 2HS5A 3F8MA 1XCBA 2FNAA 2OZ6A 2CW0F 3K1MA 4GGGA 4I0AA 3F23A 3K2ZA 5IT3A 1SFXA 3ULQB 3LSTA 2WC2A 2PG4A 3F72A 2L3DA 2HOEA 2VONA 1LEAA 3GXOA 1MGTA 2ISYA 3V7SA 1R5HA 3WU1B 2A68F 3JSOA 2A5YB 3HUGA 3JAMK 2L01A 2P5VA 2RNJA 3FM5A 1R36A 1HW2A 4LLLA 5E17F 4IRIA 1F1ZA 1IXCA 3J81K 2D45A 2EA4A 1T98A 2DK8A 4IJAA 5BMZA 1QQIA 1S29A 1O3SA 2KIFA 1R00A 4RGRA 3DV8A 1WQ2A 4YFKF 2ZMEC 4B09A 1FPQA 1G6NA 1OMIA 2ZO4A 1R23A 3RYRA 4OIOF 2M87A 1H0MA 2IA2A 1YS7A 3QPTA 1IN4A 1ONVA 2FBKA 2V1DA 3R6SA 1QBJA 4EM2A 1MD0A 5D5UB 3PQJA 5FFZA 4NB5A 1MDMA 2O6GE 2CYYA 4OMYA 3G73A 2KIUA 5LHHA 4LK1F 1MJBA 5L3GA 3DP7A 1XMAA 1WKMA 2D1HA 1LB2A 1YTYA 1ZHFA 3F6VA 1CF7A 3GX4X 1U78A 1W4MA 5ICCA 4U7DA 4ZYEA 1ZGAA 2K27A 3DF8A 4KNYA 3ABTA 4HLXA 4Y15A 2ZXJA 2A6HF 1L3LA 3T8TA 3E6DA 5HLIA 1J7KA 1UB9A 4Y13A 3REOA 1W7PB 5DYMA 5LHIA 3MWMA 5HS8A 3CUQB 3KLNA 4LB6B 3P9IA 4MEXF 4CDGA 4HW0A 3IKTA 1MKMA 1UCRA 4I02A 5ILVA 2QENA 3WTZA 3RKYA 1KYZA 3QU3A 2YU3A 4AWXB 2V79A 2PQ8A 1HBXG 1YG2A 3FZVA 1K6OA 5D6EA 4D0PA 4A0ZA 2W85A 3R0AA 5E20A 2A6EF 3HSRA 4S04A 3E6CC 3BPVA 2HTJA 3K1PA 2HKXA 1XSDA 1H9GA 1U2WA 4KDPA 4LG0A 4CYDA 3FXQA 3CLOA 3KLOA 5LBQA 4LMYA 4OIQF 4GYGA 3TO7A 2CGPA 1YFHA 4RGSA 2IA0A 1AWCA 3M7GA 1ZRFA 2JSCA 4MTEA 3U2RA 2ZNYA 1GVJA 3O6BB 2ZJ2A 2RGVA 4RS8A 4PDKA 1TNTA 3LQQA 3R60A 3WTWC 1B9NA 1BOAA 1HKTA 3E5XA 3GO5A 4HX4A 2OU2A 1ZLKA 4A12A 3FF5A 2BV6A 1S7OA 1P6RA 3WGIA 3MFKA 1B1BA 4WK8F 3NRVA 1RZ4A 3CJNA 2M45A 4CICA 1P4XA 2DQRA 1I1SA 3I59A 2O3FA 1OYYA 4IRHA 2EK5A 4MHGA 2Y0MA 3L7WA 1FOKA 2VT3A 1KU9A 5HDNA 1KU3A 1CGPA 4ENJA 2EFOA 1YW7A 2UXNA 4KYWA 2QQAA 1L0OC 1DDNA 5LHGA 4EJUA 1A04A 1S8NA 1BI1A 2IJLA 1I1GA 3TKYA 1SAXA 1FC3A 5TRDA 3CO6C 5CVJA 3ZMTA 2P7CB 3E6BA 5AIQA 3L2CA 1OPCA 1FYMA 2PI0A 4YIIA 4WXDA 3T8RA 2M30A 3I4PA 4IHSA 1RNLA 1BBYA 1R5GA 5TJJA 3KETA 5ILUA 2ETHA 1HKQA 4M74A 3KEOA 4UXNA 2MLKA 3RPUA 2QBYB 1FBSA 4GXOA 4JQFA 4HOBA 3KP3A 1MDMB 1LDKB 1R1TA 1E2XA 4HAMA 5E8GA 4G8XA 1IXRC 3F22A 2RDPA 2XIGA 3SHFA 2IPQX 4EJTA 3ZN0A 2L4MA 5AONA 2VOPA 4YFNF 1CF7B 4NQWA 1GXPA 2W24A 1YYVA 1MJAA 3LFKA 3RYPA 3BJOA 4RGUA 3Q5FA 4ESFA 4N0BA 2BEOA 4L0YB 2AS5F 4RB3C 1ZH5A 4KMFA 4ON0A 5K5OA 2QQ9A 3IKVA 4ENKA 1KU7A 3I0TA 6PAXA 2YX7A 3E3VA 3IC7A 1U5TB 2M8EA 3K69A 5F6FA 5LGTA 1TQMA 1BJAA 2NAZA 2RC4A 5E1XA 4AIKA 1MJ9A 5HDKA 1Q1HA 3LA3A 2Y75A 2PMUA 4R79A 5FD5A 2FMYA 4MNUA 3RI4A 4ZYDA 3HTSB 1RUNA 3F21A 1Z6RA 2WTEA 2E7XA 2A07F 4BNCA 2R3SA 1SD5A 1ZRCA 4IXAA 2EB7A 5BQTA 4P55A 1U3EM 3BOQA 3GWZA 2G7HA 1Z7UA 2OQGA 3FMSA 2PBIA 5DD8A 3WTXC 1JHHA 3KZYA 3WGHA 3VOEA 1S7AA 4S05A 2H94A 2QM3A 1YQAA 3C18A 1Z9CA 1FY7A 4HX7A 3HYIA 4CO8A 1O57A 5DD4A 4LG0B 2NYXA 3U1DA 2E1CA 1W5SA 1LQ1A 5FGMA 4L9NA 2LDUA 2ZFWA 3C3WA 1TTYA 4ENMA 1G3TA 5CVUA 3PQKA 2EFWA 2H6BA 5F1RA 1LEBA 2JPCA 2NNYA 1B9MA 2C6YA 4BHBA 4PGGA 1XDUA 3QPHA 4Y17A 2V9VA 2DPDA 5ICGA 2ADUA 2H6CA 3J80Z 4JK1X 2GA2A 4HYEA 1EH6A 4MGRA 3G3ZA 3PFIA 4AIHA 1YLFA 5LRSA 1XN7A 2VBXA 2K86A 3SQNA 3M8FA 2YX4A 3I59B 5HS7A 2F2EA 2R7FA 4P9FA 4TV7A 5F64A 1P4AA 5BOXA 1XGNA 1LVAA 2VC1A 5LGNA 2MBFA 4N9IA 3JSPA 4M73A 2VC0A 2J5PA 4XLPF 1ZYRF 3ZMDA 4OMZA 3JAMZ 2DLLA 4LLGF 1C0WA 2ELHA 2IP2A 2EWNA 1BIBA 2AXLA 4I2OA 2RN7A 3VFZA 3L00A 1OKRA 1P2FA 5D4RA 3DEUA 4LLNA 2LF7A 3WTVC 2XAGA 3S2WA 5DCFA 1IN7A 3B02A 4WXCA 5D8LB 1FBQA 1IF1A 2ZCWA 3HRMA 1G3SA 2O03A 3LAPA 1NHAA 2XAJA 1ZN2A 3H92A 4BYYA 4ZYHA 2R7DA 5CVRA 2RV8A 4RAYA 2GQQA 2GAUA 4GO1A 5FD6A 4WF2A 5D8KB 5H20A 2DT5A 1UHWA 4M9ZA 2MC3A 4P9UA 2Z3YA 1D5VA 1BI2A 4R8HA 2Q0OA 1HKSA 5DEQA 1WRJA 1RI7A 1IN5A 3I5UA 4G7ZF 1DP7P 3W6JB 5HLHA 4G7OF 5K5QA 3V8JA 2GXGA 4KA4A 2QBYA 3L9FA 1DPUA 3T0YA 4WXHA 4PGHA 4Q48A 4HV5A 4MTDA 3VB2A 2HDCA 3DFGA 3ELKA 5LRRA 3HSEA 1W5TA 1V3FA 4UHTA 3N97A 1KU2A 1R7JA 3CUQC 3ROUA 3IWFA 1YW8A 5ED4A 5L3BA 3N4MA 4H0EA 2XUBA 4ETSA 1AOYA 3EQLF 5J6XA 2NNNA 2O61A 3E5QA 4HF2A 3FXUA 3D0SA 2HYFA 2CWEA 3TOAA 3E97A 5ICFA 2HTSA 1T38A 1H9TA 4ZZLA 5D5VB 1U5TA 4ASNA 1IN6A 4LD5A 4OU0A 1G3WA 5LEJA 3GLXA 2P5LC 5H6RA 3BY6A 4PZJA 2D1VA 3MCZA 3GFJA 3LQRA 4EV0A 1J5YA 2XAFA 3DPLC 1U6GA 3ZP5A 2K02A 3F6OA 4CGZA 3KFWX 3CTAA 2CG4A 4IPAA 5EEGA 1LDJA 4AD9A 2JRTA 4MQ9F 3V7RA 1ZG3A 1HSJA 3M9AA 4UV8A 4O5VA 1FLIA 3MZHA 1BM9A 1HQCA 2HR3A 4Q5SF 2KJCA 3E6MA 3P7NA 4G7HF 1GHCA 1I6XA 4YIFA 3COAC 3D5LA 3MQ0A 1RIOH 4PCQA 2GA1A 2FMLA 2DTRA 4KIFA 2KJBA 3E5UA 5D6FA 1Y0UA 1ODDA 2KRFA 2MD5A 4HDUA 1QNTA 3DXJF 1XGMA 1VTNC 4I98B 2WV0A 5JI6A 3M8EA 3L09A 3KP5A 1GXQA 3K9TA 3H3UA 4Q47A 4N9HA 4IVNA 2GIVA 1FSEA 4I7HA 3SZPA 1K79A 3WU0A 2VOOA 3O2PE 2VBYA 3CDHA 1YIOA 2L4AA 1I5ZA 2HQRA 1QO0D 3GVAA 3QOPA 1SMTA 5FLXZ 3HRUA 3KZZA 2DO7A 2IT0A 1HW5A 3WTYC 3WTSC 2EV6A 2L54A 3GFLA 4L5JA 3QP5A 4UVCA 2JPBA 5DUIA 3WODF 3ZQ7A 4KUMA 1SD6A 1OYWA 4A6DA 2PLYA 5JVTA 4EJVA 4XSXF 5CVVA 3GW2A 2F5EA 2GWRA 2GXBA 3TO9A 4BHPA 1ZGJA 4KT5C 3KE2A 2MH9A 4U88A 3F3XA 2V1XA 3WE2A 2BE5F 5HLGA 3ZN1A 1ZRDA 3MEXA 4Z2YA 2ZBKA 5ILSA 1XMKA 3I58A 2VE9A 3EYYA 4L5IA 1HW1A 4WWCA 3KP2A 4OINF 3HHHA 3GZ6A 3ABUA 2L02A 1QZZA 4ZYGA 4KIGA 2FXAA 5A2QK 3R0JA 3LAJA 1WWXA 3TGNA 4KMUX 4M6YA 3ZMZA 2XRNA 1IRFA 5DDGA 3V8LA 4DQ2A 4QLCU 1R1VA 1USSA 2QLZA 5LGUA 4I09A 4K2EA 4HQEA 2ZKZA 1ON2A 3ML6A 1D8KA 4LB5A 1O7FA 3GUDA 1IN8A 3KP6A 5IT9K 1E17A 2VBZA 2EA2A 3TDUC 1I27A 1J59A 3J7AO 1TBXA 3KEQA 3RKWA 2GZWA 2O8XA 2QWWA 4G9YA 2P8TA 2A61A 2DW4A 4A0XA 1XCVA 1DPRA 3BZ6A 3EYIA 1FSHA 4EJOA 2XAHA 3RPQA 3SZTA 3KP7A 4O3MA 4L9JA 2YPRA 2VODA 3I64A 2KKOA 1S3JA 4HDVA 2STTA 2OAZA 2JTVA 3JTHA 5LLQA 3GEZA 2G7UA 3SXYA 1YO5C 4OOIA 1IW7F 4EM0B 3KP4A 3FXRA 2YR2A 4FX0A 1V4RA 2LF8A 1XGSA 3RIRA 3BJ6A 2WWYA 5DUKA 4RGXA 2VE8A 5FFXA 3GYHX 1FNNA 3R61A 2HYGD 2W25A 3ZPLA 1FT9A 1SMYF 4FT8A 3T5XA 5D5WB 1ZARA 1QPMA 1QGPA 1ZG1A 2YSRA 3HRSA 4ESJA 1O7LA 2ESNA 1P4WA 3MZYA 4P96A 2FBIA 1D3YA 3EUHA 2XV4S 5EEHA 2FNPA 5CVIA 4HZFA 5ICEA 5DCMA 2B0LA 3P9CA 3U9GA 4RAZA 1FP2A 5BPIA 4E70A 1BC8C 4FHTA 1JHFA 2CSOA 4GYIA 3QRFF 2P5KA 2HEOA 1Z1DA 2P7VB 3TOBA 3Q9VA 1U8RA 2XASA 3BROA 5JHUA 3J80K 2BBYA 2P4WA 3RJPA 3QP6A 5D5XB 3IWZA 4YFXF 3MAJA 1Z6TA 1BIAA 5H6QA 3J81Z 3DKWA 1O3RA 2OD5A 3CO7C 3P9KA 1OYIA 3C7JA 4BXUA 4KIBA 2FEZA 3BPXA 2OZUA 3IL2A 1BC7C 5E1ZB 4RB0A 1EH7A 4AIJA 1S6LA 4BHCA 3HTUA 1TNSA 3NEUA 3FMQA 4U7BA 4HV6A 4BH9A 1TLHB 2DAOA 5J8FA 3K1NA 4M72A 4CHUA 3ECOA 1TW3A 1ZG5A 2FF4A 1TW2A 3DPTA 1IZ1A 2CFXA 1TQPA 4UV9A 5HS9A 4KICA 4CZZA 1K7AA 3W6KB 3OOPA 4ZH4F 4L18B 1YS6A 2Y48A 2XHKA 1Z05A 3RTRA 2F5CA 3IRRA 2LNBA 1P92A 2OQRA 1IRGA 4LGWA 2QQBA 1T6SA 1EV7A 4MEYF 5LEKA 2OBPA 4JBAA 1B59A 2H27A 4U0YA 2V1UA 3VEPA 2LSOA 2MA3A 2HZTA 1WI9A 2DK5A 3FHZA 2LKPA 2OA4A 3ZMUA 2EJRA 2QUFA 3RKXA 1K78A 2ESHA 5BS6A 1R1UA 2HFHA 4BQAA 2Z5UA 1Z91A 4RB1A 2K7LA 3HOTA 4HF0A 1LJ9A 2ZMEB 3FM3A 2F5FA 1REPC 1WSUA 1UFMA 4BAYA 1PUEE 1PP7U 1J9IA 3F8BA 5AIPA 1FYLA 2EV0A 2UWMA 1JGSA 1PDNC 3EETA 4L9VA 1ON1A 2F5DA 3JTGA 4M71A 5L3CA 4A5NA 5J8CA 2STWA 1FZPB 2RQPA 5KVRA 3FMRA 4CXFA 2W57A 4I01A 2JT1A 4HX8A 4G6DA 3B73A 2DQLA 1X3UA 3Q9SA 4OIRF 2FA5A 4LFUA 5ERIA 4GCVA 3HOSA 3M1EA 1J0RA 2X4HA 4HQMA 3OV8A 4LK0F 2HWVA 5L3EA 1B6AA 3HHGA 4UNOA 1FYKA 2QYOA 2CQKA 3LWFA 2DU9A 3FX3A 3CUOA 2M1BA 1G4DA 3I53A 2XVCA 4RB2C 1KA8A 4A5MA 5DCMB 3V7CA 2W84A 1IUYA 3BJAA 4YG2F 1F9NA 5DV5A 2PJPA 3IHUA 2A69F 5CLSA 4M9XA 1MZBA 1SFUA 1IXSB 3TO6A 1F4KA 2Z99A 3DQVC 3TDZC 2JZYA 1IAWA 5HVQC 2M5WA 4O6JA 3I71A 2O0YA 4ESBA 4P5OA 4EJWA 3T1BA 1BN5A 4EGZA 2PMHA 5E1WA 3K0LA 3WTTC 2Z33A 5FO5A 1XGOA 4ENNA 3JW4A 2BYVE 3BP8A 4EVIA 3WG9A 2DPUA 1R58A 1J75A 3HIFA 5JFRA 2EFQA 2FRHA 1BI3A 1XD7A 2KIMA 2Q8KA 1O3TA 1BI0A 2IW5A
chains in the Genus database with same CATH superfamily
2PFBA 2XGXA 2DTZA 1LDDA 3AKZA 2XROA 2VXZA 2R7QA 4X1EA 2EV5A 1OLTA 4XRFA 3CF5F 1VQPI 4B4CA 2E2JJ 1F43A 4N4OB 1KQ9A 4HSRA 3C1DA 2VJIA 2E5ZA 2HPIA 1FX7A 1EH8A 1RESA 2UZKA 4IOAF 1IG7A 2DFIA 4L0ZB 2QVOA 1MW7A 3B6CA 2IVMA 1PUFB 1QZYA 2CUEA 1KGSA 2K4JA 4U0WA 1XPXA 4KFCA 1FBUA 2LTPA 3MKLA 2LH9A 1MBFA 3DWLE 2G9WA 2IAIA 1XSVA 4YELA 4NHJA 3V8KA 1X1DA 2VBWA 2R7ZJ 1SD7A 3KZIC 2IS4A 2I5UA 1BW5A 2EFPA 5FLXK 1XTAA 1K4SA 2BZTA 2FBHA 2RVCA 2QA4I 5CYVA 3G4SI 3FIWA 3I9V2 5E18F 4A3MJ 4DNCA 3QAHA 4XMYA 4FE7A 3IRQA 1DUXC 1SEUA 2MSYA 4C2MJ 5JR3A 2CO5A 4WCGA 1F36A 1RKWA 2F5VA 3ZMVA 3EDPA 4J01A 1D8JA 2LRDA 3ECHA 3RPUD 4HNVA 1T39A 2HKOA 2XB0X 4A3LJ 1KYWA 3A2KA 3V4GA 3VWBA 4AVPA 2ZNZA 1XSXA 1D1CA 3R4KA 3OYBA 3GMEA 5A2QZ 5E79C 3P5JA 3GTLJ 2E7WA 2DA6A 4KISA 2FU4A 1WCMJ 4A6EA 4QWQA 3ZCOA 1Z67A 3OIOA 1YW9A 3FWEA 3IAS2 4RBOA 1J2XA 2L0KA 1TL8A 2Q2EA 2RNGA 2ISZA 1D0YA 3E7LA 3MKWB 1U5TC 1IV6A 5F0HA 3DKXA 3K4LA 2K4BA 1HXDA 4WX9A 1I50J 4XRMA 2E1NA 3RDIA 1KQ8A 1TWFJ 3OOUA 3ZMSA 2EINH 2VT2A 4E7KA 1UG2A 2FE3A 1SD4A 1K78B 4F7ZA 4EM1A 5IT9Z 2J5OA 3Q3SA 1R22A 3BTCA 1SC7A 5L3FA 3IH4A 1YJWI 2IXSA 3JRDA 2LP0A 3BTIA 3JCUC 2V6CA 3GF2A 4G6QA 3ERED 2NOJB 1T0FA 2DBBA 3CMEI 1G3YA 4Q4ZF 4HSTA 3GFMA 3HSFA 4KN7X 3F8CA 2RAEA 1V55H 1UZCA 2XKPA 4HA8A 2HYJA 3S93A 3GZ5A 4E7HA 3TQNA 1S9HA 4IRGA 5K5RA 5J4YA 3KCCA 2X0LA 4G94A 5GAGJ 3WHCA 2QZ8A 3CJTB 3GCMA 2OUMA 1YHQI 1ACIA 3BWGA 2PEXA 4FX4A 3WE3A 4XLHA 5KAFC 4A2UA 4EQQA 4N4NB 1V5FA 1ZLJA 4XBFA 3H3ZA 1YI2I 1TQIA 2HQNA 5FB2A 4XR6A 4ZZDA 3W6VA 4UUVA 4MQVA 1PP8F 3HJEA 3L2VA 1EKEA 1P9QC 4EGYA 4M6XA 1ZREA 1YITI 3H5RA 3VODA 2M2EA 1ZAOA 1O3QA 1LNWA 1RUOA 1HF0A 3HOXJ 1PJRA 4GFBA 1DP3A 4OWRB 2XPVA 2XF7A 5CQEA 3D1NI 2VN2A 2ZMEA 3BTLA 3FKJA 3QU6A 1DGRM 4EMSA 4DYQA 4CCKA 2ACJA 2DI3A 2WAQA 3O3KA 1MH4A 4L9TA 4E7JA 4BKXA 1W7PD 1NTCA 4M9SA 4NNJA 4AU7A 3LMMA 5KK1A 2NS0A 2BGCA 4M3FA 3SFZA 3CC4I 1KQ0A 1K4TA 4XKBA 2P6SA 3F8FA 1JE8A 2Z9OA 2VKDA 1VQOI 1FWZA 4BXXJ 3ZQGA 3BG3A 3SDBA 2MLGA 1D1BA 1FP1D 4BY7J 4B43A 2IRFG 4DBQA 2H09A 2VJ4A 1B4AA 3GFIA 2FSWA 2QEXI 4HF1A 3LSKA 1T2KA 2A3SA 2EFNA 3HRTA 5BPDA 2FQ3A 2JN6A 2HVQA 2HVSA 3IH2A 1YX3A 1DQUA 4IHWA 2W7NA 1W7PA 3HEFA 3OYEA 3G2BA 2P6TA 2KDZA 2JUCA 2RKHA 3BDDA 1IC8A 5HOOA 1F5TA 3CUQA 2OF7A 2K9SA 1ULYA 1USTA 3WGGA 1DU6A 1XDSA 4XOTA 3FHNA 1JXSA 2IA1A 4FCYA 3IAM2 4FETA 5L3DA 2JA6J 2O7OA 4AM3A 1SFEA 4BU2A 2Y0SN 5K1YA 4UVBA 2MH2A 2DDBA 2M4KA 4B3XA 3O8GA 2HZDA 4KN4X 3S1MJ 4XLNF 3WTUC 5D4SA 5CJ9A 2CFOA 2Y9YA 2XKOA 3AAFA 1VF9A 3BG5A 3F8NA 3HB9A 3LA7A 4UVAA 3QPLA 1VQLI 3I54A 2PN6A 2XAQA 2FOKA 3S15J 1MNMC 2KPMA 4B8XA 4IF4A 4X6AJ 2DYRH 1JKOC 2COMA 3DCFA 3VSLA 5C4JJ 3PIPF 1FEXA 2HQ5A 3CJQB 2QSFX 3KX2A 1HLVA 3LA2A 4B48A 2EZLA 4IHTA 4DYRA 3CZ6A 1STZA 2LYCA 4DJAA 2TDXA 3ISPA 2VJJA 4D1QA 4HLYA 3LL7A 1XB4A 1AKHB 1I3QJ 1V54H 5E8IA 4A0YA 5E3LA 3S1QJ 2NRAC 4OIPF 2JK3A 1JT0A 3OYHA 1HSTA 2DMTA 2JA5J 3EPZA 2D2WA 3M1CA 1U9OA 4LJZF 3HKZA 4LIUA 2R7VA 1OR7A 3NQOA 1YJNI 5CPRB 4U0VA 1WFXA 1WHUA 4HBLA 4I0BA 2UXXA 4RAFA 3H3VK 3E1SA 4PSXA 4XSZF 5IP7J 5HDGA 4R1HA 2HGCA 3HM5A 1WJCA 2N8GA 1UHMA 2HS5A 3F8MA 1XCBA 1Y8QB 2FNAA 3BG6A 2OZ6A 2CW0F 1PVEA 1W0UA 2W00A 3K1MA 2KZVA 4GGGA 4I0AA 3F23A 3K2ZA 5IT3A 2H1LA 1SFXA 4M6VA 3ULQB 3LSTA 2WC2A 2IGMA 2PG4A 1RPWA 4IZZA 3CMYA 3OY9A 3F72A 2L3DA 2HOEA 2VONA 1T0FC 4BJTA 3OIPA 1LEAA 3GXOA 3AL0B 2MYSA 1MGTA 2ISYA 3V7SA 1R5HA 4Z6YA 3WU1B 2A68F 3OYDA 3JSOA 2A5YB 5FJ8J 3HUGA 1MBKA 3JAMK 1WH7A 3S8PA 4DZPA 2L01A 2L9NA 2P5VA 2RNJA 3FM5A 3QODA 1R36A 1PUFA 3OYFA 2BY2A 2Q2EB 1HW2A 1OFCX 1WPKA 2VPRA 4PFOA 4V2GA 4LLLA 2XGDA 5E17F 4IRIA 2DA5A 1F1ZA 1IXCA 2Z16A 3X2QH 3J81K 2IS1A 2D45A 2WADA 1W0TA 2DA3A 2EA4A 1T98A 2DK8A 1VQ4I 4IJAA 5BMZA 2AQFA 1QQIA 3HZJA 2EPFA 1S29A 9ANTA 1O3SA 2KIFA 4F3QA 1R00A 4RGRA 3DV8A 3FISA 1XS9A 3ABKH 4P1WA 5EEAA 1WQ2A 4YFKF 1MBGA 4UY8I 2ZMEC 3LSPA 4B09A 1FPQA 1G6NA 1OMIA 1VQ7I 4Y3OA 2ZO4A 4BEHA 4AYBN 1R23A 3OYAA 1BOBA 2MGQA 1WJEA 2NVXJ 3GBGA 3RYRA 4I76A 2PJRA 2XAUA 4OIOF 2M87A 1H0MA 2IA2A 4UUSA 1Z3XA 1YS7A 3QPTA 3PNTA 1IN4A 1ONVA 2FBKA 2V1DA 2IGOA 3R6SA 1QBJA 4EM2A 1MD0A 2DFFA 3CCRI 2LREA 4PJMA 5D5UB 3PQJA 5FFZA 3H0DA 3UKGA 4NB5A 1MDMA 2O6GE 2Y30A 2NVTJ 2CYYA 2K3PA 4IX7A 4OMYA 3RQ4A 1V5EA 3G73A 3S17J 1I6HJ 2KIUA 5LHHA 4LK1F 1MJBA 2BY0A 5L3GA 3DP7A 1HCRA 1E3PA 1EA3A 2V7FA 1XMAA 1GV5A 1WKMA 2D1HA 1EJ9A 1LB2A 2MFZA 2O9LA 1NG7A 1OCPA 5FKMA 4IO9F 1YTYA 1ZHFA 4F92B 3OYIA 3F6VA 4OAZA 1HDPA 2ZJPF 1CF7A 3AG2H 1SVLA 3HC7A 3GX4X 1U78A 3PUBA 1VQKI 4BBSJ 1W4MA 2LLKA 5M5YJ 5ICCA 4U7DA 1K6YA 4ZYEA 1ZGAA 2K27A 5GTIC 1N25A 3DF8A 4KITB 3EUHC 3ABTA 4HLXA 4DYCA 4KNYA 2R7TA 3K4MA 4Y15A 2ZXJA 2A6HF 1P7IA 4RDUA 1L3LA 3BZKA 2NVQJ 2CRGA 3T8TA 3E6DA 5HLIA 1J7KA 3V42A 2KLOA 2NOGA 1UB9A 4Y13A 2GOMA 3H9GA 1W7PB 3REOA 2HPMA 1JKQC 3UNGC 3KYDB 5DYMA 4D7MA 3GTKJ 1XMXA 3I56I 5LHIA 4Y33A 3MWMA 2ZC2A 5HS8A 1MMSA 2NS8A 3CUQB 3E0JB 3KLNA 3GTGJ 4LB6B 2K9NA 2ZXWH 1YIJI 3P9IA 2OCCH 4E4HA 1SFKA 4MEXF 4CDGA 5KCMA 4HW0A 3IKTA 4OAYA 3J7YJ 1MKMA 1UCRA 2WB1A 4I02A 3OYMA 3CCJI 4EATA 5ILVA 2IGNA 2M7BA 2QENA 3WTZA 3RKYA 3JRHA 1KYZA 3QU3A 2QGUA 2YU3A 4AWXB 2L7FP 1R71A 2V79A 4NUBA 2DA4A 2PQ8A 1MBJA 1RKTA 1HBXG 1YG2A 4A93J 2E71A 1WJDA 3FZVA 2COBA 1A6IA 1K6OA 5D6EA 3MZ8A 4BJ5C 4A0ZA 2W85A 3B6AA 4BQQA 4D0PA 3AFHA 3R0AA 5E20A 1QU3A 2A6EF 1E0EA 3OWTA 2DA1A 2ID6A 3HSRA 4S04A 1VI0A 3NAUA 1GVDA 3F0CA 4KJZA 3I4NJ 3E6CC 3BPVA 2HTJA 3K1PA 2HKXA 3OS0A 1XSDA 1H9GA 3S3MA 1RC9A 1U2WA 2X6WA 3PNVA 4KDPA 3L2UA 3M3YJ 4BJ6C 4II2A 4LG0A 4CYDA 4PFPA 3H0GJ 3FXQA 3CLOA 3KLOA 2ME0A 5FKOA 5LBQA 4LMYA 2R7WA 2E1MC 1ZKGA 4IHXA 4OIQF 4GYGA 3TO7A 4I99C 2CGPA 3K2AA 1YFHA 3K4BA 2IA0A 3CLQA 4RGSA 1S5LC 3M7GA 5F1JA 1AWCA 3A4CA 4MO7A 2FD5A 1ZRFA 2JSCA 4MTEA 3U2RA 2ZNYA 3S3OA 1GVJA 3O6BB 2ZJ2A 4RM3A 5J47A 2RGVA 3OL3A 4RS8A 3J7AY 3DLAA 4PDKA 1TNTA 3FXKA 4ZDPA 2VL8A 2QCOA 3LQQA 3R60A 3WTWC 1B9NA 1BOAA 2CU7A 2JA7J 2WY7Q 1HKTA 1WZ2A 4BL0B 2WAQN 3E5XA 3GO5A 4XOPA 5K7HA 4PJNA 3ZR8X 4HX4A 1LE8A 2OU2A 1ZLKA 4A12A 1AKHA 1TC3C 4IHVA 3HUGB 3FF5A 2BV6A 1S7OA 2XGEA 1P6RA 3WGIA 4C2TA 4B1RA 3MFKA 1UHSA 1B1BA 4WK8F 3NRVA 1RZ4A 3CJNA 2M45A 4CICA 3ZQQA 1P4XA 2DQRA 2LY2A 1I1SA 3I59A 2O3FA 5IY5H 1OYYA 4IRHA 3CCSI 2EK5A 4MHGA 2Y0MA 2ZJQF 3GTOJ 3L7WA 1FOKA 2VT3A 1KU9A 4BE0A 1RR7A 1VZ0A 1KU3A 5HDNA 3W2AA 2PMZA 1CGPA 1XC5A 2JA8J 4ENJA 2EFOA 1YW7A 2UXNA 5B1AH 4KYWA 2QQAA 1IO2A 4D5FA 4XM3A 1L0OC 4CZCA 1DDNA 5LHGA 4EJUA 1A04A 3BTJA 1S8NA 1BI1A 1QHGA 2ZFUA 4PJLA 2IJLA 1PYVA 3WU2C 1I1GA 2LVSA 3TKYA 1SAXA 1FC3A 5TRDA 3CO6C 2XSJC 2VQHA 2LR8A 5CVJA 2KISA 3ZMTA 2P7CB 2ID3A 3L2RA 3E6BA 2CMPA 5AIQA 3L2CA 2VPLA 1MH3A 1OPCA 1FYMA 2PI0A 4XIDA 4YIIA 1NG6A 4WXDA 3T8RA 3QOEA 4BEHB 2M30A 3I4PA 4IHSA 2ZXHA 1RNLA 2K5CA 3QQAA 4RAGA 3IUOA 3U1KA 1BBYA 1R5GA 5TJJA 4W97A 2PJRB 4HEA2 4B3AA 4B44A 3KETA 2V1NA 5ILUA 2ETHA 4UUSB 1HKQA 5F0CA 3G6EI 1OCZH 4M74A 3KEOA 3CCUI 4UXNA 2MLKA 3RPUA 2QBYB 4NC8A 1FBSA 4GXOA 4JQFA 1Z77A 3CMMA 4HOBA 2XB5A 2V9KA 4XICA 1SFOJ 1IDZA 3KP3A 1MDMB 1JKPC 1LDKB 1R1TA 5IYBJ 1E2XA 4HAMA 5E8GA 4G8XA 1U9NA 1IXRC 3F22A 4PK4A 2RDPA 1FOYA 4CCOA 2P0WA 2XSDC 2X9DA 2XIGA 3SHFA 3TW7A 3LFUA 4CH7A 2IPQX 3QWLA 4EJTA 3HKZN 4JOMA 2KIQA 2DDAA 2KT0A 4XKWA 3AG4H 3ZN0A 2L4MA 2QQ8A 3ABLH 5AONA 2FX0A 2LD5A 2VOPA 4YFNF 1CF7B 3QPSA 5IPAA 4NQWA 1GXPA 1JTYA 2W24A 1A35A 1YYVA 1MJAA 2BXZA 3JR9A 1ETKA 1X19A 3LFKA 3RYPA 3BJOA 4RGUA 3Q5FA 1FIAA 2CS3A 4ESFA 4N0BA 3A1YA 2JA2A 1MMGA 3OYJA 2BEOA 2YUSA 5E3OA 4L0YB 2Z2SB 2AS5F 4RB3C 1ZH5A 4KMFA 4ON0A 5K5OA 3KEYA 2QQ9A 2E2IJ 3IKVA 4ENKA 1Y6IA 1KU7A 3I0TA 4C2UA 6PAXA 2YX7A 3E3VA 3IC7A 1U5TB 2M8EA 3K69A 1QVUA 4YIRX 3PL8A 5F6FA 4BQOA 5LGTA 1TQMA 2XDVA 1BJAA 2XF5A 4LG3A 2NAZA 2WA0A 2RC4A 5E1XA 4AIKA 1MJ9A 5HDKA 2TCTA 2IBDA 1Y56A 1Q1HA 3LA3A 2Y75A 2PMUA 4R79A 3TP3A 3H36A 4A69C 2ELJA 4RMNA 5B3SH 5FD5A 2LBFB 2Z1DA 2FMYA 4MNUA 1WJAA 3RI4A 4ZYDA 3HTSB 1RUNA 3F21A 1Z6RA 4QSHA 1W36D 2WTEA 4CA0A 5GAHJ 2E7XA 2A07F 2R7OA 2R3SA 2LK2A 4BNCA 1SD5A 1ZRCA 4IXAA 4QPOA 2BOLA 1A5JA 3L1PA 2EB7A 1IV8A 1YJ9I 5BQTA 4P55A 2TRTA 5FROA 3BG7A 4BGDA 1GT0C 1U3EM 1FTTA 2LKXA 3BOQA 3GWZA 1X4PA 5M5XJ 1O4XA 2G7HA 1Z7UA 3NARA 2OQGA 1I39A 3FMSA 2M0CA 2PBIA 2EBIA 5DD8A 3WTXC 2F4IA 1JHHA 3KZYA 1S7EA 3WGHA 3VOEA 1S7AA 2L7KA 4S05A 4V19K 2H94A 1BR1A 2QM3A 1YQAA 3C18A 1Z9CA 3DKYA 1FY7A 2DXIA 4XQFA 3HOUJ 1Y1VJ 4HX7A 3HYIA 3K4KA 4CO8A 3EUAA 1BW6A 1H8AC 1O57A 3DU5A 3PIOF 1Y1WJ 1MBEA 2AO9A 5DD4A 2NYXA 3U1DA 2E1CA 4LG0B 1W5SA 2V6EA 1D5YA 2RREA 1LQ1A 5FGMA 4L9NA 2LDUA 3BLYA 3W2WA 2R5ZB 2ZFWA 1OCCH 2DA7A 3C3WA 3H5AA 4C3JJ 2JUGA 4Y7NJ 2XC7A 1TTYA 2L7MP 4ENMA 1G3TA 5CVUA 3PQKA 2EFWA 3S2DJ 1ERDA 2H6BA 3SZGA 2VUMJ 3MKZA 1U0JA 5F1RA 1T95A 2L9SA 1Y8RB 1LEBA 2JPCA 2NNYA 1B9MA 1IGNA 2KQRA 4XK4A 2C6YA 2NS7A 2HU9A 1ETYA 4BHBA 3PO2J 4PGGA 2XPUA 4BUPA 5JLWA 1XDUA 3QPHA 3GTMJ 4Y17A 2VQCA 1Q1VA 1R9TJ 2V9VA 2DPDA 3JRBA 2CQ7A 3HDDA 3CD6I 5ICGA 2ADUA 2H6CA 3J80Z 1LE8B 4JK1X 2L5QA 2GA2A 1YX5A 4HYEA 4IQ4A 1EH6A 3CCQI 4MGRA 3G3ZA 3PFIA 4PSWA 2K40A 3M07A 4YRVA 3AL0C 1G2HA 5TGTA 4AIHA 1YLFA 5LRSA 1XN7A 2VBXA 2O8KA 2X1EA 3OYKA 2WAFA 2JVHA 2K86A 2HDWA 1AHDP 3A01B 1VQ8I 2R7SA 3SQNA 3M8FA 2GOXB 2YX4A 3M8JA 3I59B 4IL6C 2F2EA 5HS7A 2R7FA 4MIMA 2QKLB 3DTEA 4CCNA 4P9FA 3SYTA 2VQGA 3BR3A 3OR2C 4TV7A 4XORA 5F64A 2B63J 1P4AA 5BOXA 1XGNA 1LVAA 2VC1A 5LGNA 3F9KA 2Q1ZB 2MBFA 4N9IA 5JVGF 3JSPA 3PUFA 2K85A 4M73A 2VC0A 1KZHA 1MNDA 1ZR2A 4W1UA 4ITVA 2J5PA 2DOFA 4XLPF 1B72A 3VPRA 1ZYRF 3ZMDA 4OMZA 3JAMZ 1JKRC 2DLLA 2L9VA 4A3CJ 3MVPA 4LLGF 1C0WA 1BR2A 3K7AJ 2DMPA 1HDDC 2ELHA 1TT5B 3KYCB 2IP2A 2EWNA 1BIBA 2AXLA 4I2OA 2RN7A 2WB1N 3VFZA 3L00A 1IDYA 1IUFA 3O8HA 4F55A 1OKRA 1P2FA 4CYCB 5D4RA 3DEUA 4LLNA 2LF7A 3WTVC 2R7UA 2X85A 2XAGA 3S2WA 5DCFA 1IN7A 4D9JA 3B02A 4WXCA 4XLCA 1TWGJ 2E5NA 5D8LB 1IRZA 5H2FC 2WY8Q 1FBQA 1IF1A 1ZTRA 5GADJ 2ZCWA 3OSGA 3HRMA 1G3SA 2O03A 3ABMH 3LAPA 1NHAA 2XAJA 1UJ8A 1ZN2A 3A0BC 5F08A 3H92A 4D7NA 3W3CA 4BYYA 4ZYHA 1Z3YA 1A31A 1YRNA 2EIJH 2R7DA 4XN3A 3GTQJ 5CVRA 2RV8A 4E7LA 4UUTA 4RAYA 1AU7A 3NWTA 3CC2I 2IEKA 2GQQA 2GAUA 3IH3A 4FQGA 4GO1A 3CCEI 1VQ6I 3OIQA 5FD6A 4WF2A 5D8KB 2X48A 5H20A 2DT5A 3PM1A 1UHWA 4M9ZA 2MC3A 4P9UA 2Z3YA 4IHYA 1D5VA 1BI2A 4R8HA 5IOYA 1UMQA 3RKQA 3RZDJ 3S1RJ 2Q0OA 1HKSA 5DEQA 1WRJA 4NQWB 1RI7A 3BG9A 1IN5A 3I5UA 2A05A 4G7ZF 1DP7P 3W6JB 2KL4A 3CDLA 5HLHA 4G7OF 5K5QA 3V8JA 2GXGA 3CP8A 4KA4A 2QBYA 3L9FA 4JX6A 1DPUA 3OYCA 2FUG2 1RR8C 5J3LA 4NDLA 3T0YA 4WXHA 2KFDA 3PSIA 4DGWB 2M4GA 4PGHA 4Q48A 4HV5A 4MTDA 3VB2A 2HDCA 4M3BA 3EUKL 3DFGA 2E36A 3ELKA 5LRRA 3HSEA 2R93J 1W5TA 2L9RA 1V3FA 4BE2A 1J09A 3ZXSA 3CQZJ 1X1CA 1R4MB 1ENHA 4UHTA 4A3IJ 3N97A 1KU2A 5C4XJ 1R7JA 3RSNA 2DFHA 3CUQC 5J1RA 3ROUA 3A03A 3IWFA 2VXDA 1YW8A 3TW6A 5ED4A 1X1BA 5L3BA 3ZQFA 1JGGA 2HDDA 2EIMH 3OS2A 2G0EA 3JRCA 3N4MA 4H0EA 3UR3C 2XUBA 4ETSA 1AOYA 5IYCJ 1T08B 1FMVA 3BZCA 3EQLF 5J6XA 5J1YA 2JQ7A 3S2HJ 1A36A 3CCVI 2LFBA 2NNNA 2O61A 4G6TB 4U87A 4ZTFA 2CUJA 3E5QA 2M34A 4HF2A 2Y2ZA 3FXUA 2B9SA 5TISC 1T33A 3MKYB 2I8DA 3D0SA 1ETXA 2DT7B 2CWEA 2HYFA 3TOAA 5IP9J 2VB6A 2PX9A 3E97A 2MC4A 5GAEJ 3FK7A 3FXOA 4E7SA 5ICFA 2HTSA 3AG1H 1T38A 1D0ZA 3J7ZI 1H9TA 1SAUA 1TP4A 2IGKA 2DCEA 4ZZLA 2ZSIB 4LITA 2EILH 5D5VB 1U5TA 2VKEA 3FBNB 5J4VA 1P7JA 4ASNA 1IN6A 4LD5A 4OU0A 1G3WA 5LEJA 4A3JJ 3L2WA 3LSGA 3CDIA 3GLXA 5H6RA 2P5LC 2ECBA 2HXIA 2LY1A 3BY6A 2D1VA 4PZJA 3MCZA 2Y69H 3GFJA 3LQRA 1NK2P 1SANA 5M3MJ 4EV0A 1J5YA 3GTPJ 5K7FA 5KHDA 2XAFA 4S0HB 3DPLC 1U6GA 2LBFA 3IP4B 3ZP5A 2K02A 4X0GA 3F6OA 2W4SA 1OR7C 2K9MA 5LFAA 4CGZA 3SEZA 2X1DA 4JX5A 4ABZA 5JLXA 2I10A 3JRIA 2XRLA 3KFWX 1A6QA 3K70C 1TWCJ 3CTAA 2CV0A 1D1AA 2CG4A 4GRIA 4IPAA 5EEGA 1LDJA 4AD9A 4QIWN 2LOOA 1MMDA 1YOVB 2HOSA 1BA5A 2CW7A 2JRTA 4XLAA 4DIQA 4MQ9F 2E60A 3V7RA 1ZG3A 1HSJA 3M9AA 4UV8A 4O5VA 3ZQLA 5EF6A 3MZHA 1FLIA 2BY1A 1VQNI 3ASNH 1BM9A 1HQCA 3OYLA 1FTZA 2HR3A 3ERMA 2KJCA 2ZXIA 3E6MA 5K7ZA 3P7NA 4Q5SF 4G7HF 1D0XA 1GHCA 3ZGKA 1I6XA 4YIFA 3COAC 1K83J 4RM2A 3HPHA 2MABA 3OL4A 2CJJA 2ZB9A 3D5LA 3MQ0A 1RIOH 2BY3A 4PCQA 5B5EC 2GA1A 2FMLA 2M8GX 2QSGX 2DTRA 3MN2A 3ZQHA 2R5ZA 4KIFA 1KONA 2KJBA 1FMWA 4KT6A 4J19A 1FOXA 3E5UA 3S14J 5D6FA 3S16J 1Y0UA 1ODDA 2KRFA 3N05A 2MD5A 3JRFA 4HDUA 1QNTA 2HXOA 4C3IJ 3DXJF 1YE9A 3BC8A 2CUFA 1XGMA 1VTNC 4I98B 3BR1A 1B72B 2WV0A 5JI6A 3M8EA 2RQQA 3L09A 2HOAA 5HODA 3KP5A 1GXQA 3K9TA 4H4KC 3H3UA 2DMNA 4AYBA 3PFYA 4N9HA 4Q47A 4UB6C 4IVNA 2GIVA 2DFEA 1FSEA 4I7HA 3SZPA 1K79A 1E3OC 3WU0A 2VOOA 4DW6A 2W48A 3O2PE 3OMYA 3FK6A 2VBYA 3CDHA 1YIOA 2L4AA 1I5ZA 2HQRA 3DBHB 2OJED 2VI6A 3C2BA 1QO0D 3HGYA 3GVAA 3QOPA 1ETVA 1SMTA 2BVMA 2OV7A 3H1CA 1X1PA 3Q0UA 2KZGA 4CCMA 5FLXZ 1X3WB 3HRUA 3KZZA 2V4JC 2DO7A 4E7ZA 1BR4A 2IT0A 3TP0A 1HW5A 1S72I 3WTYC 3WTSC 2EV6A 3DTIA 5CQGA 2L54A 3OYGA 3GFLA 4L5JA 4C9YA 3A01A 4JP0A 4C30A 3QP5A 3WHBA 1POGA 2R4GA 2X6XA 3DPUA 4UVCA 1MMAA 2JPBA 2LMDA 1X58A 5DUIA 3CCYA 1WJBA 3WG7H 2E19A 3WODF 1B8IA 4F91B 1G59A 3ZQ7A 4KUMA 1SD6A 2VIXA 2X1CA 1OYWA 4A6DA 2PLYA 5JVTA 4Y4RA 4EJVA 4XSXF 4QPQA 3HOWJ 3G1LA 1YRNB 5CVVA 2E1MB 3H5NA 3MD2A 1ZELA 3GW2A 1R4NB 2F5EA 2GWRA 2UV1A 2GXBA 3TO9A 4BHPA 4QTRA 1ZGJA 4KT5C 3KE2A 3FDYA 2MH9A 5M5WJ 4U88A 4JYKA 4E7IA 3ZQCA 3LSIA 3F3XA 2V1XA 3A0HC 4GDFA 2KRCA 3K10A 3WE2A 4BXFA 2BE5F 3FXLA 4B47A 5HLGA 1OCTC 3ZN1A 1ZRDA 3MEXA 4Z2YA 4CYCA 3Q0VA 2ZBKA 5ILSA 1XMKA 3RCOA 3OS1A 3I58A 1QZEA 3SJMA 2VE9A 2DODA 3EYYA 4L5IA 4CCLA 1ZK8A 2QSHX 1HW1A 2CUZA 1WI3A 4WWCA 2EQRA 1XG1A 3KPHA 3HG9A 1T8IA 3KP2A 4OINF 2JRMA 5HLTA 3HHHA 3GZ6A 3ABUA 1ORKA 2L02A 3LOCA 1QZZA 3HXLA 4ZYGA 4KIGA 5LD2C 4HNTA 2FXAA 4J00A 5A2QK 4L5EA 3R0JA 3LAJA 4XKVA 1SVMA 5EJCA 3L2QA 1WWXA 5HNHA 3TGNA 1VQ9I 4KMUX 5J40A 4M6YA 1R5ID 3ZMZA 1ITYA 2HNHA 4BQNA 2XRNA 3DEEA 5DS9A 3FKIJ 1IRFA 1VQ5I 2KMUA 5DDGA 2R7RA 3DU6A 2JWTA 4XL9A 3AG3H 3HBLA 3V8LA 4DQ2A 4QLCU 1HA8A 1R1VA 5GTHC 1USSA 2QLZA 5LGUA 4ZDOA 4I09A 5FRMA 4K2EA 3CC7I 1WH5A 1X2MA 4HQEA 2H8RA 4A3EJ 2ZKZA 2VQLA 1ON2A 2VKHA 3ML6A 1D8KA 3VYUB 3HL2A 2KP6A 4LB5A 3HPGA 1O7FA 3QYEA 1MMNA 3GUDA 1IN8A 3KP6A 3D5SC 3FBIB 1HOMA 4AVZA 5IT9K 1GDTA 2R5YB 1E17A 2VBZA 2W1OA 1MSEC 1RRJA 1JUPA 2EA2A 3TDUC 1I27A 4FE4A 1J59A 3J7AO 1TBXA 2DYSH 5EG0B 3KEQA 3RKWA 2GZWA 2MD0A 2O8XA 2QWWA 2BW3B 4G9YA 1LUJB 5J1UA 2BXYA 2P8TA 4HRIA 2A61A 2KDOA 2DW4A 2JSPA 1E3HA 2VASA 4A0XA 1XCVA 5IOZA 1ZR4A 1DPRA 4D5CA 3QYFA 3A02A 3BZ6A 2DOAA 3GZNB 3PSFA 1NH3A 3OYNA 3EYIA 1FSHA 4M3EA 4EJOA 5EZHA 4IOCF 3VYRB 2XAHA 4V2FA 3RPQA 2CH0A 3SZTA 3KP7A 1LFUP 2DN0A 4O3MA 2R92J 5FKLA 4A3DJ 3CJRB 2IS2A 4L9JA 2ZSHB 1VQMI 3C2GA 2YPRA 2VODA 4F52A 3I64A 2KKOA 1HC8A 1X2NA 3D5RC 1RETA 1EF4A 5FLVA 4XLEA 2EIKH 3S1NJ 1S3JA 4HDVA 5DTDA 2W82A 1N78A 2STTA 1OISA 1LFPA 3H9JA 2OAZA 2XGCA 4XRSA 1VNDA 2JTVA 2D5VA 3JTHA 5LLQA 2X6OA 3GEZA 2G7UA 3PJRA 2IS6A 1GUUA 2OC6A 3SXYA 1YO5C 4OOIA 1IW7F 5FKNA 4EM0B 4MFEA 3OR1C 2GXAA 1QRYA 2MG4A 3PO3J 3BR0A 3KP4A 3VYSB 4DBRA 3FXRA 4II3A 4NC6A 2YR2A 5F04A 4FX0A 1V4RA 2LF8A 1XGSA 5B1BH 1G8XA 1M1EB 1ETOA 3RIRA 1JT6A 1R49A 3G1OA 2DMQA 3BJ6A 2WWYA 3JRAA 3CMAI 3BT9A 5DUKA 3GTJJ 4RGXA 2VE8A 5FFXA 3U21A 1VFCA 4BACA 4A3BJ 3GYHX 3S3NA 1FNNA 3VSKA 2KRHA 2CV1A 1JI8A 3R61A 2HYGD 2W25A 3ZPLA 2Y31A 3SDGA 1FT9A 1SMYF 4FT8A 4M3DA 3T5XA 5D5WB 1ZARA 1QPMA 5EGOB 1QGPA 1ZG1A 2YSRA 3HRSA 3LSRA 3LSMA 4ESJA 2F4MB 3K4CA 1O7LA 2HOTA 2WBMA 2L2OA 4XKCA 2LKSA 2ESNA 1P4WA 3DBRB 3G1MA 3MZYA 4ZC3A 4P96A 2FBIA 1D3YA 3EUHA 1FIPA 2XV4S 5B66C 4BE1A 3TBIA 5EEHA 1LPQA 2F4OB 2FNPA 1BL0A 5CVIA 1MNEA 4HZFA 4NC7A 2YU9J 5ICEA 4EEFG 5F0FA 5DCMA 1H88C 2B0LA 1DU0A 2E1OA 3P9CA 2NXNB 5FLMJ 3U9GA 4RAZA 1FP2A 5BPIA 1JJ8C 3DBLB 2AXTC 3VDXA 4DZJA 2FOWA 4E70A 3K70D 1X3ZB 1QA6A 3FXMA 1BC8C 3W2VA 2DT6A 4FHTA 1B8IB 1JHFA 1Z0XA 2JJ7A 2V9PA 3RQIA 4ZJZA 2CSOA 2ME6A 2DOEA 1UELB 1GLNA 2P5KA 2YS9A 4GYIA 3DLLF 4HG2A 4JX4A 5M3FJ 3QRFF 2HEOA 1Z1DA 4AC0A 2P7VB 2B7EA 2BVLA 3LSHA 3Q9VA 3TOBA 3M4OJ 2NVUB 1U8RA 2XASA 3BROA 5JHUA 3J80K 2BBYA 3BCBA 2P4WA 4BY1J 3RJPA 2NVYJ 3QP6A 5D5XB 1N77A 2BHZA 3IWZA 2K9QA 4YFXF 3MAJA 3DEWA 4A3KJ 4LIVA 2K9LA 1ETQA 1Z6TA 1GV2A 3I3LA 1BIAA 5H6QA 3J81Z 3I55I 4CSWA 3GLLA 3DKWA 4CCJA 1O3RA 2H1KA 1UAAA 1K61A 2OD5A 3CO7C 2LG4A 3ZOBA 3P9KA 1OYIA 3JRGA 2K3FA 3C7JA 4BXUA 3HOZJ 1IRXA 3BR2A 4KIBA 4E6KG 3BPXA 2FEZA 1JJ6C 2WAEA 2CQQA 1WJFA 3SEQA 1OCOH 5GPAA 2OZUA 3IL2A 1BC7C 5E1ZB 4RB0A 4XN0A 1EH7A 4AIJA 3ASOH 1S6LA 1BJZA 4BHCA 1FJLA 3HTUA 1TNSA 2XPWA 1SVOA 3ESWB 3FMQA 3NEUA 4U7BA 4HV6A 4BH9A 2DMUA 4I6ZA 1TLHB 2E34A 2DAOA 5J8FA 3K1NA 1TWAJ 4M72A 3G71I 4CHUA 3ECOA 1TW3A 3HGGA 1ZG5A 4A3FJ 2ZJRF 2FF4A 3H35A 1TW2A 4PJJA 3DPTA 4XRSG 1IZ1A 2CFXA 2EZKA 2HVRA 1TQPA 5HNFA 4UV9A 3OSFA 3KIOA 5EZGA 5HS9A 3TMOA 2A6TA 2CQNA 4KICA 1DGWY 4CZZA 1K7AA 1QHHD 1XX5A 3BCAA 3W6KB 2HQAA 1ETWA 3OOPA 3BR5A 5FKKA 1I3AA 4ZH4F 4L18B 1YS6A 2Y48A 2XHKA 1Z05A 3QYBA 3RTRA 2F5CA 4G12A 1WGXA 4FASD 5JHFA 3IRRA 2LNBA 4IEJA 3KYLA 1Z7LA 1P92A 4RLFA 2JMWA 4F93B 2QKMB 5KAIC 2OQRA 3CCMI 1IRGA 2GBYA 4LGWA 4PUSA 2QQBA 2AQEA 5E3NA 5CKTA 4BS9A 1T6SA 4FISA 2P81A 1EV7A 3TL4X 2OCEA 1W1WE 4MLOA 4MEYF 4PJ0C 5LEKA 2OBPA 4JBAA 3BQZA 1B59A 1X4OA 4BDZA 2H27A 4ZTJA 4U0YA 5DM6F 2V1UA 4XLFA 3VEPA 1IJWC 2GM4A 1X1AA 1N75A 1JTXA 2LSOA 2MA3A 2Y0SA 1W36C 2JVGA 3ZQIA 2HZTA 1WI9A 2DK5A 3H9QA 3PNYA 3FHZA 2LKPA 2FJ1A 2OA4A 3ZMUA 4AIDA 2EJRA 2QUFA 2X51A 2M3AA 3RKXA 1K78A 1AA7A 2ESHA 5BS6A 4FTHA 1R1UA 2HFHA 3HOYJ 2A5WA 3CCLI 2GLOA 4ZYAA 4BQAA 3C2HA 2R0QC 2XF6A 3RZOJ 2QF7A 2Z5UA 4A3GJ 1Z91A 4RB1A 2K7LA 1FOWA 3HOTA 4HF0A 4NBQA 3IV5A 1LJ9A 2ZMEB 2MW8A 3FM3A 4MFDA 2PMZN 4IKFA 1TWHJ 2F5FA 1REPC 1WSUA 4IQJA 4C3HJ 2R5YA 1UFMA 4BAYA 4BDYA 1PUEE 2EH3A 1PP7U 5DM7F 1J9IA 3F8BA 2OTLI 2KHMA 4M3GA 5AIPA 5EG0A 1FYLA 2EV0A 1MIJA 1JGSA 2UWMA 4LOCA 1Z21A 1NK3P 1PDNC 5GP9A 1MBHA 2BW3A 3TEDA 3EETA 5F27A 3CP2A 4L9VA 1ON1A 1APLC 2F5DA 3JTGA 4M71A 5L3CA 1Y0NA 4A5NA 5J8CA 2STWA 2DA2A 2Y9ZA 1FZPB 2RQPA 1ZGWA 5KVRA 3FMRA 5IYDJ 4CXFA 4XNFA 2DJNA 2W57A 4RA2A 4I01A 2JT1A 2ECCA 2M0MA 3ZRGA 2ELKA 4HX8A 4G6DA 3B73A 2DQLA 1W5CC 3BQYA 1X3UA 2VJ5A 3Q9SA 2FA5A 4OIRF 3SFIA 4AUXA 4LFUA 4UB8C 2OTJI 5ERIA 3NWSA 4ZDLA 4GCVA 3HOSA 3M1EA 5EYRA 2VLAA 1TT0A 1J0RA 5IP6A 2CV2A 4CUGA 1OCRH 2X4HA 5E3MA 2V26A 4HQMA 1QPIA 1WVRA 3FXJA 3OV8A 3CF2A 1R6RA 4LK0F 2HWVA 2GIZA 2WV1A 5EDNA 5L3EA 1B6AA 3HHGA 4UNOA 2H8WA 1FYKA 2QYOA 4RLQA 2CQKA 4Y52J 3LWFA 2DU9A 3FX3A 2CW8A 3CUOA 2M9HA 3MMYB 3Q0WA 4YEJA 5BNGA 4BBRJ 1CQTA 2M1BA 1G4DA 2VKVA 1T56A 2DJIA 1MSFC 4XONA 4HPQA 3I53A 2XVCA 2ICWG 2E35A 3HOVJ 1V5GA 4HNUA 1UG0A 2M7AA 4RB2C 1KA8A 4DOZA 4A5MA 5DCMB 5C44J 1JUSA 1QVTA 1TZLA 3V7CA 2W84A 1Y39A 1IUYA 2O5RA 3BJAA 3JREA 4YG2F 1F9NA 5DV5A 2PJPA 3IHUA 2A69F 5CLSA 3VYTB 2UUZA 4M9XA 1MZBA 1SFUA 1IXSB 1OQYA 3K4NA 3TO6A 1JUMA 1F4KA 2HI3A 2Z99A 3DQVC 3TDZC 2FQ4A 5C3EJ 2E2HJ 2JZYA 1IAWA 5HVQC 1U8BA 1LKXA 2CQXA 2M5WA 4O6JA 3S32A 1H89C 2AHQA 1WJ5A 3I71A 5EGOA 3BR6A 5FRNA 2O0YA 4ESBA 3LNQA 2EZHA 4P5OA 2OPTA 2F6CA 2X6YA 4EJWA 1LFBA 5KNLA 3ONQA 3T1BA 1BN5A 4EGZA 2PMHA 5E1WA 3DTKA 3I4MJ 1LVKA 3K0LA 3WTTC 2F48A 2Z33A 5FO5A 1XGOA 4ENNA 3JW4A 2BYVE 3BP8A 4EVIA 3WG9A 3K4JA 4ANJA 2LY9A 3CESA 1R58A 3K6GA 1OJLA 2DPUA 2LC2A 1J75A 3LSJA 3HIFA 5JFRA 2EFQA 2EZIA 2FRHA 2R7XA 1BI3A 1XD7A 2KIMA 2Q8KA 1O3TA 1BI0A 2IW5A 1ZQ3P 5GPCA 2L7ZA 2BHYA
chains in the Genus database with same CATH topology
2PFBA 2XGXA 1LDDA 2XROA 2VXZA 4XRFA 2EV5A 1KQ9A 3C1DA 1FX7A 1EH8A 2UZKA 2DFIA 4L0ZB 2QVOA 2IVMA 1QZYA 1KGSA 2K4JA 4U0WA 4KFCA 1FBUA 2G9WA 1XSVA 4NHJA 3V8KA 2VBWA 1SD7A 2EFPA 5FLXK 2FBHA 2RVCA 5CYVA 5E18F 4DNCA 3QAHA 1DUXC 3IRQA 5JR3A 2CO5A 4WCGA 3ZMVA 3EDPA 1D8JA 3ECHA 1T39A 2HKOA 1KYWA 3V4GA 4AVPA 2ZNZA 1XSXA 3R4KA 5A2QZ 2E7WA 2FU4A 4A6EA 4QWQA 1YW9A 3FWEA 1J2XA 2Q2EA 2ISZA 1U5TC 2K4BA 1HXDA 4WX9A 2E1NA 3RDIA 1KQ8A 3ZMSA 2VT2A 2FE3A 1SD4A 1K78B 4F7ZA 4EM1A 5IT9Z 2J5OA 1R22A 5L3FA 2V6CA 3GF2A 4G6QA 3ERED 1T0FA 2DBBA 1G3YA 4Q4ZF 3GFMA 3HSFA 4KN7X 3F8CA 2XKPA 4HA8A 3GZ5A 3TQNA 4IRGA 5K5RA 3KCCA 2X0LA 4G94A 2QZ8A 3BWGA 2PEXA 4FX4A 3WE3A 4A2UA 4EQQA 1ZLJA 4XBFA 3H3ZA 1TQIA 2HQNA 5FB2A 4ZZDA 4UUVA 4MQVA 1PP8F 4EGYA 4M6XA 1ZREA 3VODA 1ZAOA 1O3QA 1LNWA 1RUOA 2VN2A 2ZMEA 3QU6A 4EMSA 2ACJA 2DI3A 3O3KA 4L9TA 1W7PD 4M9SA 5KK1A 2NS0A 2BGCA 3SFZA 1KQ0A 2P6SA 3F8FA 1JE8A 2Z9OA 1FWZA 2MLGA 1FP1D 2IRFG 2H09A 1B4AA 3GFIA 2FSWA 4HF1A 1T2KA 2A3SA 2EFNA 3HRTA 5BPDA 2FQ3A 1W7PA 2P6TA 2RKHA 3BDDA 1F5TA 5HOOA 3CUQA 1ULYA 1USTA 3WGGA 1XDSA 1JXSA 2IA1A 5L3DA 1SFEA 5K1YA 4UVBA 2MH2A 4KN4X 4XLNF 3WTUC 5D4SA 5CJ9A 3AAFA 2XKOA 3F8NA 3LA7A 4UVAA 3I54A 2PN6A 2XAQA 2FOKA 4B8XA 4IF4A 2COMA 3LA2A 4IHTA 1STZA 2TDXA 3ISPA 4HLYA 1XB4A 5E8IA 4A0YA 2NRAC 4OIPF 1HSTA 2D2WA 4LJZF 1OR7A 3NQOA 4U0VA 4HBLA 4I0BA 2UXXA 4XSZF 5HDGA 4R1HA 2HGCA 1UHMA 2HS5A 3F8MA 1XCBA 2FNAA 2OZ6A 2CW0F 3K1MA 4GGGA 4I0AA 3F23A 3K2ZA 5IT3A 1SFXA 3ULQB 3LSTA 2WC2A 2PG4A 3F72A 2L3DA 2HOEA 2VONA 1LEAA 3GXOA 1MGTA 2ISYA 3V7SA 1R5HA 3WU1B 2A68F 3JSOA 2A5YB 3HUGA 3JAMK 2L01A 2P5VA 2RNJA 3FM5A 1R36A 1HW2A 4LLLA 5E17F 4IRIA 1F1ZA 1IXCA 3J81K 2D45A 2EA4A 1T98A 2DK8A 4IJAA 5BMZA 1QQIA 1S29A 1O3SA 2KIFA 1R00A 4RGRA 3DV8A 1WQ2A 4YFKF 2ZMEC 4B09A 1FPQA 1G6NA 1OMIA 2ZO4A 1R23A 3RYRA 4OIOF 2M87A 1H0MA 2IA2A 1YS7A 3QPTA 1IN4A 1ONVA 2FBKA 2V1DA 3R6SA 1QBJA 4EM2A 1MD0A 5D5UB 3PQJA 5FFZA 4NB5A 1MDMA 2O6GE 2CYYA 4OMYA 3G73A 2KIUA 5LHHA 4LK1F 1MJBA 5L3GA 3DP7A 1XMAA 1WKMA 2D1HA 1LB2A 1YTYA 1ZHFA 3F6VA 1CF7A 3GX4X 1U78A 1W4MA 5ICCA 4U7DA 4ZYEA 1ZGAA 2K27A 3DF8A 4KNYA 3ABTA 4HLXA 4Y15A 2ZXJA 2A6HF 1L3LA 3T8TA 3E6DA 5HLIA 1J7KA 1UB9A 4Y13A 3REOA 1W7PB 5DYMA 5LHIA 3MWMA 5HS8A 3CUQB 3KLNA 4LB6B 3P9IA 4MEXF 4CDGA 4HW0A 3IKTA 1MKMA 1UCRA 4I02A 5ILVA 2QENA 3WTZA 3RKYA 1KYZA 3QU3A 2YU3A 4AWXB 2V79A 2PQ8A 1HBXG 1YG2A 3FZVA 1K6OA 5D6EA 4D0PA 4A0ZA 2W85A 3R0AA 5E20A 2A6EF 3HSRA 4S04A 3E6CC 3BPVA 2HTJA 3K1PA 2HKXA 1XSDA 1H9GA 1U2WA 4KDPA 4LG0A 4CYDA 3FXQA 3CLOA 3KLOA 5LBQA 4LMYA 4OIQF 4GYGA 3TO7A 2CGPA 1YFHA 4RGSA 2IA0A 1AWCA 3M7GA 1ZRFA 2JSCA 4MTEA 3U2RA 2ZNYA 1GVJA 3O6BB 2ZJ2A 2RGVA 4RS8A 4PDKA 1TNTA 3LQQA 3R60A 3WTWC 1B9NA 1BOAA 1HKTA 3E5XA 3GO5A 4HX4A 2OU2A 1ZLKA 4A12A 3FF5A 2BV6A 1S7OA 1P6RA 3WGIA 3MFKA 1B1BA 4WK8F 3NRVA 1RZ4A 3CJNA 2M45A 4CICA 1P4XA 2DQRA 1I1SA 3I59A 2O3FA 1OYYA 4IRHA 2EK5A 4MHGA 2Y0MA 3L7WA 1FOKA 2VT3A 1KU9A 5HDNA 1KU3A 1CGPA 4ENJA 2EFOA 1YW7A 2UXNA 4KYWA 2QQAA 1L0OC 1DDNA 5LHGA 4EJUA 1A04A 1S8NA 1BI1A 2IJLA 1I1GA 3TKYA 1SAXA 1FC3A 5TRDA 3CO6C 5CVJA 3ZMTA 2P7CB 3E6BA 5AIQA 3L2CA 1OPCA 1FYMA 2PI0A 4YIIA 4WXDA 3T8RA 2M30A 3I4PA 4IHSA 1RNLA 1BBYA 1R5GA 5TJJA 3KETA 5ILUA 2ETHA 1HKQA 4M74A 3KEOA 4UXNA 2MLKA 3RPUA 2QBYB 1FBSA 4GXOA 4JQFA 4HOBA 3KP3A 1MDMB 1LDKB 1R1TA 1E2XA 4HAMA 5E8GA 4G8XA 1IXRC 3F22A 2RDPA 2XIGA 3SHFA 2IPQX 4EJTA 3ZN0A 2L4MA 5AONA 2VOPA 4YFNF 1CF7B 4NQWA 1GXPA 2W24A 1YYVA 1MJAA 3LFKA 3RYPA 3BJOA 4RGUA 3Q5FA 4ESFA 4N0BA 2BEOA 4L0YB 2AS5F 4RB3C 1ZH5A 4KMFA 4ON0A 5K5OA 2QQ9A 3IKVA 4ENKA 1KU7A 3I0TA 6PAXA 2YX7A 3E3VA 3IC7A 1U5TB 2M8EA 3K69A 5F6FA 5LGTA 1TQMA 1BJAA 2NAZA 2RC4A 5E1XA 4AIKA 1MJ9A 5HDKA 1Q1HA 3LA3A 2Y75A 2PMUA 4R79A 5FD5A 2FMYA 4MNUA 3RI4A 4ZYDA 3HTSB 1RUNA 3F21A 1Z6RA 2WTEA 2E7XA 2A07F 4BNCA 2R3SA 1SD5A 1ZRCA 4IXAA 2EB7A 5BQTA 4P55A 1U3EM 3BOQA 3GWZA 2G7HA 1Z7UA 2OQGA 3FMSA 2PBIA 5DD8A 3WTXC 1JHHA 3KZYA 3WGHA 3VOEA 1S7AA 4S05A 2H94A 2QM3A 1YQAA 3C18A 1Z9CA 1FY7A 4HX7A 3HYIA 4CO8A 1O57A 5DD4A 4LG0B 2NYXA 3U1DA 2E1CA 1W5SA 1LQ1A 5FGMA 4L9NA 2LDUA 2ZFWA 3C3WA 1TTYA 4ENMA 1G3TA 5CVUA 3PQKA 2EFWA 2H6BA 5F1RA 1LEBA 2JPCA 2NNYA 1B9MA 2C6YA 4BHBA 4PGGA 1XDUA 3QPHA 4Y17A 2V9VA 2DPDA 5ICGA 2ADUA 2H6CA 3J80Z 4JK1X 2GA2A 4HYEA 1EH6A 4MGRA 3G3ZA 3PFIA 4AIHA 1YLFA 5LRSA 1XN7A 2VBXA 2K86A 3SQNA 3M8FA 2YX4A 3I59B 5HS7A 2F2EA 2R7FA 4P9FA 4TV7A 5F64A 1P4AA 5BOXA 1XGNA 1LVAA 2VC1A 5LGNA 2MBFA 4N9IA 3JSPA 4M73A 2VC0A 2J5PA 4XLPF 1ZYRF 3ZMDA 4OMZA 3JAMZ 2DLLA 4LLGF 1C0WA 2ELHA 2IP2A 2EWNA 1BIBA 2AXLA 4I2OA 2RN7A 3VFZA 3L00A 1OKRA 1P2FA 5D4RA 3DEUA 4LLNA 2LF7A 3WTVC 2XAGA 3S2WA 5DCFA 1IN7A 3B02A 4WXCA 5D8LB 1FBQA 1IF1A 2ZCWA 3HRMA 1G3SA 2O03A 3LAPA 1NHAA 2XAJA 1ZN2A 3H92A 4BYYA 4ZYHA 2R7DA 5CVRA 2RV8A 4RAYA 2GQQA 2GAUA 4GO1A 5FD6A 4WF2A 5D8KB 5H20A 2DT5A 1UHWA 4M9ZA 2MC3A 4P9UA 2Z3YA 1D5VA 1BI2A 4R8HA 2Q0OA 1HKSA 5DEQA 1WRJA 1RI7A 1IN5A 3I5UA 4G7ZF 1DP7P 3W6JB 5HLHA 4G7OF 5K5QA 3V8JA 2GXGA 4KA4A 2QBYA 3L9FA 1DPUA 3T0YA 4WXHA 4PGHA 4Q48A 4HV5A 4MTDA 3VB2A 2HDCA 3DFGA 3ELKA 5LRRA 3HSEA 1W5TA 1V3FA 4UHTA 3N97A 1KU2A 1R7JA 3CUQC 3ROUA 3IWFA 1YW8A 5ED4A 5L3BA 3N4MA 4H0EA 2XUBA 4ETSA 1AOYA 3EQLF 5J6XA 2NNNA 2O61A 3E5QA 4HF2A 3FXUA 3D0SA 2HYFA 2CWEA 3TOAA 3E97A 5ICFA 2HTSA 1T38A 1H9TA 4ZZLA 5D5VB 1U5TA 4ASNA 1IN6A 4LD5A 4OU0A 1G3WA 5LEJA 3GLXA 2P5LC 5H6RA 3BY6A 4PZJA 2D1VA 3MCZA 3GFJA 3LQRA 4EV0A 1J5YA 2XAFA 3DPLC 1U6GA 3ZP5A 2K02A 3F6OA 4CGZA 3KFWX 3CTAA 2CG4A 4IPAA 5EEGA 1LDJA 4AD9A 2JRTA 4MQ9F 3V7RA 1ZG3A 1HSJA 3M9AA 4UV8A 4O5VA 1FLIA 3MZHA 1BM9A 1HQCA 2HR3A 4Q5SF 2KJCA 3E6MA 3P7NA 4G7HF 1GHCA 1I6XA 4YIFA 3COAC 3D5LA 3MQ0A 1RIOH 4PCQA 2GA1A 2FMLA 2DTRA 4KIFA 2KJBA 3E5UA 5D6FA 1Y0UA 1ODDA 2KRFA 2MD5A 4HDUA 1QNTA 3DXJF 1XGMA 1VTNC 4I98B 2WV0A 5JI6A 3M8EA 3L09A 3KP5A 1GXQA 3K9TA 3H3UA 4Q47A 4N9HA 4IVNA 2GIVA 1FSEA 4I7HA 3SZPA 1K79A 3WU0A 2VOOA 3O2PE 2VBYA 3CDHA 1YIOA 2L4AA 1I5ZA 2HQRA 1QO0D 3GVAA 3QOPA 1SMTA 5FLXZ 3HRUA 3KZZA 2DO7A 2IT0A 1HW5A 3WTYC 3WTSC 2EV6A 2L54A 3GFLA 4L5JA 3QP5A 4UVCA 2JPBA 5DUIA 3WODF 3ZQ7A 4KUMA 1SD6A 1OYWA 4A6DA 2PLYA 5JVTA 4EJVA 4XSXF 5CVVA 3GW2A 2F5EA 2GWRA 2GXBA 3TO9A 4BHPA 1ZGJA 4KT5C 3KE2A 2MH9A 4U88A 3F3XA 2V1XA 3WE2A 2BE5F 5HLGA 3ZN1A 1ZRDA 3MEXA 4Z2YA 2ZBKA 5ILSA 1XMKA 3I58A 2VE9A 3EYYA 4L5IA 1HW1A 4WWCA 3KP2A 4OINF 3HHHA 3GZ6A 3ABUA 2L02A 1QZZA 4ZYGA 4KIGA 2FXAA 5A2QK 3R0JA 3LAJA 1WWXA 3TGNA 4KMUX 4M6YA 3ZMZA 2XRNA 1IRFA 5DDGA 3V8LA 4DQ2A 4QLCU 1R1VA 1USSA 2QLZA 5LGUA 4I09A 4K2EA 4HQEA 2ZKZA 1ON2A 3ML6A 1D8KA 4LB5A 1O7FA 3GUDA 1IN8A 3KP6A 5IT9K 1E17A 2VBZA 2EA2A 3TDUC 1I27A 1J59A 3J7AO 1TBXA 3KEQA 3RKWA 2GZWA 2O8XA 2QWWA 4G9YA 2P8TA 2A61A 2DW4A 4A0XA 1XCVA 1DPRA 3BZ6A 3EYIA 1FSHA 4EJOA 2XAHA 3RPQA 3SZTA 3KP7A 4O3MA 4L9JA 2YPRA 2VODA 3I64A 2KKOA 1S3JA 4HDVA 2STTA 2OAZA 2JTVA 3JTHA 5LLQA 3GEZA 2G7UA 3SXYA 1YO5C 4OOIA 1IW7F 4EM0B 3KP4A 3FXRA 2YR2A 4FX0A 1V4RA 2LF8A 1XGSA 3RIRA 3BJ6A 2WWYA 5DUKA 4RGXA 2VE8A 5FFXA 3GYHX 1FNNA 3R61A 2HYGD 2W25A 3ZPLA 1FT9A 1SMYF 4FT8A 3T5XA 5D5WB 1ZARA 1QPMA 1QGPA 1ZG1A 2YSRA 3HRSA 4ESJA 1O7LA 2ESNA 1P4WA 3MZYA 4P96A 2FBIA 1D3YA 3EUHA 2XV4S 5EEHA 2FNPA 5CVIA 4HZFA 5ICEA 5DCMA 2B0LA 3P9CA 3U9GA 4RAZA 1FP2A 5BPIA 4E70A 1BC8C 4FHTA 1JHFA 2CSOA 4GYIA 3QRFF 2P5KA 2HEOA 1Z1DA 2P7VB 3TOBA 3Q9VA 1U8RA 2XASA 3BROA 5JHUA 3J80K 2BBYA 2P4WA 3RJPA 3QP6A 5D5XB 3IWZA 4YFXF 3MAJA 1Z6TA 1BIAA 5H6QA 3J81Z 3DKWA 1O3RA 2OD5A 3CO7C 3P9KA 1OYIA 3C7JA 4BXUA 4KIBA 2FEZA 3BPXA 2OZUA 3IL2A 1BC7C 5E1ZB 4RB0A 1EH7A 4AIJA 1S6LA 4BHCA 3HTUA 1TNSA 3NEUA 3FMQA 4U7BA 4HV6A 4BH9A 1TLHB 2DAOA 5J8FA 3K1NA 4M72A 4CHUA 3ECOA 1TW3A 1ZG5A 2FF4A 1TW2A 3DPTA 1IZ1A 2CFXA 1TQPA 4UV9A 5HS9A 4KICA 4CZZA 1K7AA 3W6KB 3OOPA 4ZH4F 4L18B 1YS6A 2Y48A 2XHKA 1Z05A 3RTRA 2F5CA 3IRRA 2LNBA 1P92A 2OQRA 1IRGA 4LGWA 2QQBA 1T6SA 1EV7A 4MEYF 5LEKA 2OBPA 4JBAA 1B59A 2H27A 4U0YA 2V1UA 3VEPA 2LSOA 2MA3A 2HZTA 1WI9A 2DK5A 3FHZA 2LKPA 2OA4A 3ZMUA 2EJRA 2QUFA 3RKXA 1K78A 2ESHA 5BS6A 1R1UA 2HFHA 4BQAA 2Z5UA 1Z91A 4RB1A 2K7LA 3HOTA 4HF0A 1LJ9A 2ZMEB 3FM3A 2F5FA 1REPC 1WSUA 1UFMA 4BAYA 1PUEE 1PP7U 1J9IA 3F8BA 5AIPA 1FYLA 2EV0A 2UWMA 1JGSA 1PDNC 3EETA 4L9VA 1ON1A 2F5DA 3JTGA 4M71A 5L3CA 4A5NA 5J8CA 2STWA 1FZPB 2RQPA 5KVRA 3FMRA 4CXFA 2W57A 4I01A 2JT1A 4HX8A 4G6DA 3B73A 2DQLA 1X3UA 3Q9SA 4OIRF 2FA5A 4LFUA 5ERIA 4GCVA 3HOSA 3M1EA 1J0RA 2X4HA 4HQMA 3OV8A 4LK0F 2HWVA 5L3EA 1B6AA 3HHGA 4UNOA 1FYKA 2QYOA 2CQKA 3LWFA 2DU9A 3FX3A 3CUOA 2M1BA 1G4DA 3I53A 2XVCA 4RB2C 1KA8A 4A5MA 5DCMB 3V7CA 2W84A 1IUYA 3BJAA 4YG2F 1F9NA 5DV5A 2PJPA 3IHUA 2A69F 5CLSA 4M9XA 1MZBA 1SFUA 1IXSB 3TO6A 1F4KA 2Z99A 3DQVC 3TDZC 2JZYA 1IAWA 5HVQC 2M5WA 4O6JA 3I71A 2O0YA 4ESBA 4P5OA 4EJWA 3T1BA 1BN5A 4EGZA 2PMHA 5E1WA 3K0LA 3WTTC 2Z33A 5FO5A 1XGOA 4ENNA 3JW4A 2BYVE 3BP8A 4EVIA 3WG9A 2DPUA 1R58A 1J75A 3HIFA 5JFRA 2EFQA 2FRHA 1BI3A 1XD7A 2KIMA 2Q8KA 1O3TA 1BI0A 2IW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFB A;  2XGX A;  1LDD A;  2XRO A;  2VXZ A;  4XRF A;  2EV5 A;  1KQ9 A;  3C1D A;  1FX7 A;  1EH8 A;  2UZK A;  2DFI A;  4L0Z B;  2QVO A;  2IVM A;  1QZY A;  1KGS A;  2K4J A;  4U0W A;  4KFC A;  1FBU A;  2G9W A;  1XSV A;  4NHJ A;  3V8K A;  2VBW A;  1SD7 A;  2EFP A;  5FLX K;  2FBH A;  2RVC A;  5CYV A;  5E18 F;  4DNC A;  3QAH A;  1DUX C;  3IRQ A;  5JR3 A;  2CO5 A;  4WCG A;  3ZMV A;  3EDP A;  1D8J A;  3ECH A;  1T39 A;  2HKO A;  1KYW A;  3V4G A;  4AVP A;  2ZNZ A;  1XSX A;  3R4K A;  5A2Q Z;  2E7W A;  2FU4 A;  4A6E A;  4QWQ A;  1YW9 A;  3FWE A;  1J2X A;  2Q2E A;  2ISZ A;  1U5T C;  2K4B A;  1HXD A;  4WX9 A;  2E1N A;  3RDI A;  1KQ8 A;  3ZMS A;  2VT2 A;  2FE3 A;  1SD4 A;  1K78 B;  4F7Z A;  4EM1 A;  5IT9 Z;  2J5O A;  1R22 A;  5L3F A;  2V6C A;  3GF2 A;  4G6Q A;  3ERE D;  1T0F A;  2DBB A;  1G3Y A;  4Q4Z F;  3GFM A;  3HSF A;  4KN7 X;  3F8C A;  2XKP A;  4HA8 A;  3GZ5 A;  3TQN A;  4IRG A;  5K5R A;  3KCC A;  2X0L A;  4G94 A;  2QZ8 A;  3BWG A;  2PEX A;  4FX4 A;  3WE3 A;  4A2U A;  4EQQ A;  1ZLJ A;  4XBF A;  3H3Z A;  1TQI A;  2HQN A;  5FB2 A;  4ZZD A;  4UUV A;  4MQV A;  1PP8 F;  4EGY A;  4M6X A;  1ZRE A;  3VOD A;  1ZAO A;  1O3Q A;  1LNW A;  1RUO A;  2VN2 A;  2ZME A;  3QU6 A;  4EMS A;  2ACJ A;  2DI3 A;  3O3K A;  4L9T A;  1W7P D;  4M9S A;  5KK1 A;  2NS0 A;  2BGC A;  3SFZ A;  1KQ0 A;  2P6S A;  3F8F A;  1JE8 A;  2Z9O A;  1FWZ A;  2MLG A;  1FP1 D;  2IRF G;  2H09 A;  1B4A A;  3GFI A;  2FSW A;  4HF1 A;  1T2K A;  2A3S A;  2EFN A;  3HRT A;  5BPD A;  2FQ3 A;  1W7P A;  2P6T A;  2RKH A;  3BDD A;  1F5T A;  5HOO A;  3CUQ A;  1ULY A;  1UST A;  3WGG A;  1XDS A;  1JXS A;  2IA1 A;  5L3D A;  1SFE A;  5K1Y A;  4UVB A;  2MH2 A;  4KN4 X;  4XLN F;  3WTU C;  5D4S A;  5CJ9 A;  3AAF A;  2XKO A;  3F8N A;  3LA7 A;  4UVA A;  3I54 A;  2PN6 A;  2XAQ A;  2FOK A;  4B8X A;  4IF4 A;  2COM A;  3LA2 A;  4IHT A;  1STZ A;  2TDX A;  3ISP A;  4HLY A;  1XB4 A;  5E8I A;  4A0Y A;  2NRA C;  4OIP F;  1HST A;  2D2W A;  4LJZ F;  1OR7 A;  3NQO A;  4U0V A;  4HBL A;  4I0B A;  2UXX A;  4XSZ F;  5HDG A;  4R1H A;  2HGC A;  1UHM A;  2HS5 A;  3F8M A;  1XCB A;  2FNA A;  2OZ6 A;  2CW0 F;  3K1M A;  4GGG A;  4I0A A;  3F23 A;  3K2Z A;  5IT3 A;  1SFX A;  3ULQ B;  3LST A;  2WC2 A;  2PG4 A;  3F72 A;  2L3D A;  2HOE A;  2VON A;  1LEA A;  3GXO A;  1MGT A;  2ISY A;  3V7S A;  1R5H A;  3WU1 B;  2A68 F;  3JSO A;  2A5Y B;  3HUG A;  3JAM K;  2L01 A;  2P5V A;  2RNJ A;  3FM5 A;  1R36 A;  1HW2 A;  4LLL A;  5E17 F;  4IRI A;  1F1Z A;  1IXC A;  3J81 K;  2D45 A;  2EA4 A;  1T98 A;  2DK8 A;  4IJA A;  5BMZ A;  1QQI A;  1S29 A;  1O3S A;  2KIF A;  1R00 A;  4RGR A;  3DV8 A;  1WQ2 A;  4YFK F;  2ZME C;  4B09 A;  1FPQ A;  1G6N A;  1OMI A;  2ZO4 A;  1R23 A;  3RYR A;  4OIO F;  2M87 A;  1H0M A;  2IA2 A;  1YS7 A;  3QPT A;  1IN4 A;  1ONV A;  2FBK A;  2V1D A;  3R6S A;  1QBJ A;  4EM2 A;  1MD0 A;  5D5U B;  3PQJ A;  5FFZ A;  4NB5 A;  1MDM A;  2O6G E;  2CYY A;  4OMY A;  3G73 A;  2KIU A;  5LHH A;  4LK1 F;  1MJB A;  5L3G A;  3DP7 A;  1XMA A;  1WKM A;  2D1H A;  1LB2 A;  1YTY A;  1ZHF A;  3F6V A;  1CF7 A;  3GX4 X;  1U78 A;  1W4M A;  5ICC A;  4U7D A;  4ZYE A;  1ZGA A;  2K27 A;  3DF8 A;  4KNY A;  3ABT A;  4HLX A;  4Y15 A;  2ZXJ A;  2A6H F;  1L3L A;  3T8T A;  3E6D A;  5HLI A;  1J7K A;  1UB9 A;  4Y13 A;  3REO A;  1W7P B;  5DYM A;  5LHI A;  3MWM A;  5HS8 A;  3CUQ B;  3KLN A;  4LB6 B;  3P9I A;  4MEX F;  4CDG A;  4HW0 A;  3IKT A;  1MKM A;  1UCR A;  4I02 A;  5ILV A;  2QEN A;  3WTZ A;  3RKY A;  1KYZ A;  3QU3 A;  2YU3 A;  4AWX B;  2V79 A;  2PQ8 A;  1HBX G;  1YG2 A;  3FZV A;  1K6O A;  5D6E A;  4D0P A;  4A0Z A;  2W85 A;  3R0A A;  5E20 A;  2A6E F;  3HSR A;  4S04 A;  3E6C C;  3BPV A;  2HTJ A;  3K1P A;  2HKX A;  1XSD A;  1H9G A;  1U2W A;  4KDP A;  4LG0 A;  4CYD A;  3FXQ A;  3CLO A;  3KLO A;  5LBQ A;  4LMY A;  4OIQ F;  4GYG A;  3TO7 A;  2CGP A;  1YFH A;  4RGS A;  2IA0 A;  1AWC A;  3M7G A;  1ZRF A;  2JSC A;  4MTE A;  3U2R A;  2ZNY A;  1GVJ A;  3O6B B;  2ZJ2 A;  2RGV A;  4RS8 A;  4PDK A;  1TNT A;  3LQQ A;  3R60 A;  3WTW C;  1B9N A;  1BOA A;  1HKT A;  3E5X A;  3GO5 A;  4HX4 A;  2OU2 A;  1ZLK A;  4A12 A;  3FF5 A;  2BV6 A;  1S7O A;  1P6R A;  3WGI A;  3MFK A;  1B1B A;  4WK8 F;  3NRV A;  1RZ4 A;  3CJN A;  2M45 A;  4CIC A;  1P4X A;  2DQR A;  1I1S A;  3I59 A;  2O3F A;  1OYY A;  4IRH A;  2EK5 A;  4MHG A;  2Y0M A;  3L7W A;  1FOK A;  2VT3 A;  1KU9 A;  5HDN A;  1KU3 A;  1CGP A;  4ENJ A;  2EFO A;  1YW7 A;  2UXN A;  4KYW A;  2QQA A;  1L0O C;  1DDN A;  5LHG A;  4EJU A;  1A04 A;  1S8N A;  1BI1 A;  2IJL A;  1I1G A;  3TKY A;  1SAX A;  1FC3 A;  5TRD A;  3CO6 C;  5CVJ A;  3ZMT A;  2P7C B;  3E6B A;  5AIQ A;  3L2C A;  1OPC A;  1FYM A;  2PI0 A;  4YII A;  4WXD A;  3T8R A;  2M30 A;  3I4P A;  4IHS A;  1RNL A;  1BBY A;  1R5G A;  5TJJ A;  3KET A;  5ILU A;  2ETH A;  1HKQ A;  4M74 A;  3KEO A;  4UXN A;  2MLK A;  3RPU A;  2QBY B;  1FBS A;  4GXO A;  4JQF A;  4HOB A;  3KP3 A;  1MDM B;  1LDK B;  1R1T A;  1E2X A;  4HAM A;  5E8G A;  4G8X A;  1IXR C;  3F22 A;  2RDP A;  2XIG A;  3SHF A;  2IPQ X;  4EJT A;  3ZN0 A;  2L4M A;  5AON A;  2VOP A;  4YFN F;  1CF7 B;  4NQW A;  1GXP A;  2W24 A;  1YYV A;  1MJA A;  3LFK A;  3RYP A;  3BJO A;  4RGU A;  3Q5F A;  4ESF A;  4N0B A;  2BEO A;  4L0Y B;  2AS5 F;  4RB3 C;  1ZH5 A;  4KMF A;  4ON0 A;  5K5O A;  2QQ9 A;  3IKV A;  4ENK A;  1KU7 A;  3I0T A;  6PAX A;  2YX7 A;  3E3V A;  3IC7 A;  1U5T B;  2M8E A;  3K69 A;  5F6F A;  5LGT A;  1TQM A;  1BJA A;  2NAZ A;  2RC4 A;  5E1X A;  4AIK A;  1MJ9 A;  5HDK A;  1Q1H A;  3LA3 A;  2Y75 A;  2PMU A;  4R79 A;  5FD5 A;  2FMY A;  4MNU A;  3RI4 A;  4ZYD A;  3HTS B;  1RUN A;  3F21 A;  1Z6R A;  2WTE A;  2E7X A;  2A07 F;  4BNC A;  2R3S A;  1SD5 A;  1ZRC A;  4IXA A;  2EB7 A;  5BQT A;  4P55 A;  1U3E M;  3BOQ A;  3GWZ A;  2G7H A;  1Z7U A;  2OQG A;  3FMS A;  2PBI A;  5DD8 A;  3WTX C;  1JHH A;  3KZY A;  3WGH A;  3VOE A;  1S7A A;  4S05 A;  2H94 A;  2QM3 A;  1YQA A;  3C18 A;  1Z9C A;  1FY7 A;  4HX7 A;  3HYI A;  4CO8 A;  1O57 A;  5DD4 A;  4LG0 B;  2NYX A;  3U1D A;  2E1C A;  1W5S A;  1LQ1 A;  5FGM A;  4L9N A;  2LDU A;  2ZFW A;  3C3W A;  1TTY A;  4ENM A;  1G3T A;  5CVU A;  3PQK A;  2EFW A;  2H6B A;  5F1R A;  1LEB A;  2JPC A;  2NNY A;  1B9M A;  2C6Y A;  4BHB A;  4PGG A;  1XDU A;  3QPH A;  4Y17 A;  2V9V A;  2DPD A;  5ICG A;  2ADU A;  2H6C A;  3J80 Z;  4JK1 X;  2GA2 A;  4HYE A;  1EH6 A;  4MGR A;  3G3Z A;  3PFI A;  4AIH A;  1YLF A;  5LRS A;  1XN7 A;  2VBX A;  2K86 A;  3SQN A;  3M8F A;  2YX4 A;  3I59 B;  5HS7 A;  2F2E A;  2R7F A;  4P9F A;  4TV7 A;  5F64 A;  1P4A A;  5BOX A;  1XGN A;  1LVA A;  2VC1 A;  5LGN A;  2MBF A;  4N9I A;  3JSP A;  4M73 A;  2VC0 A;  2J5P A;  4XLP F;  1ZYR F;  3ZMD A;  4OMZ A;  3JAM Z;  2DLL A;  4LLG F;  1C0W A;  2ELH A;  2IP2 A;  2EWN A;  1BIB A;  2AXL A;  4I2O A;  2RN7 A;  3VFZ A;  3L00 A;  1OKR A;  1P2F A;  5D4R A;  3DEU A;  4LLN A;  2LF7 A;  3WTV C;  2XAG A;  3S2W A;  5DCF A;  1IN7 A;  3B02 A;  4WXC A;  5D8L B;  1FBQ A;  1IF1 A;  2ZCW A;  3HRM A;  1G3S A;  2O03 A;  3LAP A;  1NHA A;  2XAJ A;  1ZN2 A;  3H92 A;  4BYY A;  4ZYH A;  2R7D A;  5CVR A;  2RV8 A;  4RAY A;  2GQQ A;  2GAU A;  4GO1 A;  5FD6 A;  4WF2 A;  5D8K B;  5H20 A;  2DT5 A;  1UHW A;  4M9Z A;  2MC3 A;  4P9U A;  2Z3Y A;  1D5V A;  1BI2 A;  4R8H A;  2Q0O A;  1HKS A;  5DEQ A;  1WRJ A;  1RI7 A;  1IN5 A;  3I5U A;  4G7Z F;  1DP7 P;  3W6J B;  5HLH A;  4G7O F;  5K5Q A;  3V8J A;  2GXG A;  4KA4 A;  2QBY A;  3L9F A;  1DPU A;  3T0Y A;  4WXH A;  4PGH A;  4Q48 A;  4HV5 A;  4MTD A;  3VB2 A;  2HDC A;  3DFG A;  3ELK A;  5LRR A;  3HSE A;  1W5T A;  1V3F A;  4UHT A;  3N97 A;  1KU2 A;  1R7J A;  3CUQ C;  3ROU A;  3IWF A;  1YW8 A;  5ED4 A;  5L3B A;  3N4M A;  4H0E A;  2XUB A;  4ETS A;  1AOY A;  3EQL F;  5J6X A;  2NNN A;  2O61 A;  3E5Q A;  4HF2 A;  3FXU A;  3D0S A;  2HYF A;  2CWE A;  3TOA A;  3E97 A;  5ICF A;  2HTS A;  1T38 A;  1H9T A;  4ZZL A;  5D5V B;  1U5T A;  4ASN A;  1IN6 A;  4LD5 A;  4OU0 A;  1G3W A;  5LEJ A;  3GLX A;  2P5L C;  5H6R A;  3BY6 A;  4PZJ A;  2D1V A;  3MCZ A;  3GFJ A;  3LQR A;  4EV0 A;  1J5Y A;  2XAF A;  3DPL C;  1U6G A;  3ZP5 A;  2K02 A;  3F6O A;  4CGZ A;  3KFW X;  3CTA A;  2CG4 A;  4IPA A;  5EEG A;  1LDJ A;  4AD9 A;  2JRT A;  4MQ9 F;  3V7R A;  1ZG3 A;  1HSJ A;  3M9A A;  4UV8 A;  4O5V A;  1FLI A;  3MZH A;  1BM9 A;  1HQC A;  2HR3 A;  4Q5S F;  2KJC A;  3E6M A;  3P7N A;  4G7H F;  1GHC A;  1I6X A;  4YIF A;  3COA C;  3D5L A;  3MQ0 A;  1RIO H;  4PCQ A;  2GA1 A;  2FML A;  2DTR A;  4KIF A;  2KJB A;  3E5U A;  5D6F A;  1Y0U A;  1ODD A;  2KRF A;  2MD5 A;  4HDU A;  1QNT A;  3DXJ F;  1XGM A;  1VTN C;  4I98 B;  2WV0 A;  5JI6 A;  3M8E A;  3L09 A;  3KP5 A;  1GXQ A;  3K9T A;  3H3U A;  4Q47 A;  4N9H A;  4IVN A;  2GIV A;  1FSE A;  4I7H A;  3SZP A;  1K79 A;  3WU0 A;  2VOO A;  3O2P E;  2VBY A;  3CDH A;  1YIO A;  2L4A A;  1I5Z A;  2HQR A;  1QO0 D;  3GVA A;  3QOP A;  1SMT A;  5FLX Z;  3HRU A;  3KZZ A;  2DO7 A;  2IT0 A;  1HW5 A;  3WTY C;  3WTS C;  2EV6 A;  2L54 A;  3GFL A;  4L5J A;  3QP5 A;  4UVC A;  2JPB A;  5DUI A;  3WOD F;  3ZQ7 A;  4KUM A;  1SD6 A;  1OYW A;  4A6D A;  2PLY A;  5JVT A;  4EJV A;  4XSX F;  5CVV A;  3GW2 A;  2F5E A;  2GWR A;  2GXB A;  3TO9 A;  4BHP A;  1ZGJ A;  4KT5 C;  3KE2 A;  2MH9 A;  4U88 A;  3F3X A;  2V1X A;  3WE2 A;  2BE5 F;  5HLG A;  3ZN1 A;  1ZRD A;  3MEX A;  4Z2Y A;  2ZBK A;  5ILS A;  1XMK A;  3I58 A;  2VE9 A;  3EYY A;  4L5I A;  1HW1 A;  4WWC A;  3KP2 A;  4OIN F;  3HHH A;  3GZ6 A;  3ABU A;  2L02 A;  1QZZ A;  4ZYG A;  4KIG A;  2FXA A;  5A2Q K;  3R0J A;  3LAJ A;  1WWX A;  3TGN A;  4KMU X;  4M6Y A;  3ZMZ A;  2XRN A;  1IRF A;  5DDG A;  3V8L A;  4DQ2 A;  4QLC U;  1R1V A;  1USS A;  2QLZ A;  5LGU A;  4I09 A;  4K2E A;  4HQE A;  2ZKZ A;  1ON2 A;  3ML6 A;  1D8K A;  4LB5 A;  1O7F A;  3GUD A;  1IN8 A;  3KP6 A;  5IT9 K;  1E17 A;  2VBZ A;  2EA2 A;  3TDU C;  1I27 A;  1J59 A;  3J7A O;  1TBX A;  3KEQ A;  3RKW A;  2GZW A;  2O8X A;  2QWW A;  4G9Y A;  2P8T A;  2A61 A;  2DW4 A;  4A0X A;  1XCV A;  1DPR A;  3BZ6 A;  3EYI A;  1FSH A;  4EJO A;  2XAH A;  3RPQ A;  3SZT A;  3KP7 A;  4O3M A;  4L9J A;  2YPR A;  2VOD A;  3I64 A;  2KKO A;  1S3J A;  4HDV A;  2STT A;  2OAZ A;  2JTV A;  3JTH A;  5LLQ A;  3GEZ A;  2G7U A;  3SXY A;  1YO5 C;  4OOI A;  1IW7 F;  4EM0 B;  3KP4 A;  3FXR A;  2YR2 A;  4FX0 A;  1V4R A;  2LF8 A;  1XGS A;  3RIR A;  3BJ6 A;  2WWY A;  5DUK A;  4RGX A;  2VE8 A;  5FFX A;  3GYH X;  1FNN A;  3R61 A;  2HYG D;  2W25 A;  3ZPL A;  1FT9 A;  1SMY F;  4FT8 A;  3T5X A;  5D5W B;  1ZAR A;  1QPM A;  1QGP A;  1ZG1 A;  2YSR A;  3HRS A;  4ESJ A;  1O7L A;  2ESN A;  1P4W A;  3MZY A;  4P96 A;  2FBI A;  1D3Y A;  3EUH A;  2XV4 S;  5EEH A;  2FNP A;  5CVI A;  4HZF A;  5ICE A;  5DCM A;  2B0L A;  3P9C A;  3U9G A;  4RAZ A;  1FP2 A;  5BPI A;  4E70 A;  1BC8 C;  4FHT A;  1JHF A;  2CSO A;  4GYI A;  3QRF F;  2P5K A;  2HEO A;  1Z1D A;  2P7V B;  3TOB A;  3Q9V A;  1U8R A;  2XAS A;  3BRO A;  5JHU A;  3J80 K;  2BBY A;  2P4W A;  3RJP A;  3QP6 A;  5D5X B;  3IWZ A;  4YFX F;  3MAJ A;  1Z6T A;  1BIA A;  5H6Q A;  3J81 Z;  3DKW A;  1O3R A;  2OD5 A;  3CO7 C;  3P9K A;  1OYI A;  3C7J A;  4BXU A;  4KIB A;  2FEZ A;  3BPX A;  2OZU A;  3IL2 A;  1BC7 C;  5E1Z B;  4RB0 A;  1EH7 A;  4AIJ A;  1S6L A;  4BHC A;  3HTU A;  1TNS A;  3NEU A;  3FMQ A;  4U7B A;  4HV6 A;  4BH9 A;  1TLH B;  2DAO A;  5J8F A;  3K1N A;  4M72 A;  4CHU A;  3ECO A;  1TW3 A;  1ZG5 A;  2FF4 A;  1TW2 A;  3DPT A;  1IZ1 A;  2CFX A;  1TQP A;  4UV9 A;  5HS9 A;  4KIC A;  4CZZ A;  1K7A A;  3W6K B;  3OOP A;  4ZH4 F;  4L18 B;  1YS6 A;  2Y48 A;  2XHK A;  1Z05 A;  3RTR A;  2F5C A;  3IRR A;  2LNB A;  1P92 A;  2OQR A;  1IRG A;  4LGW A;  2QQB A;  1T6S A;  1EV7 A;  4MEY F;  5LEK A;  2OBP A;  4JBA A;  1B59 A;  2H27 A;  4U0Y A;  2V1U A;  3VEP A;  2LSO A;  2MA3 A;  2HZT A;  1WI9 A;  2DK5 A;  3FHZ A;  2LKP A;  2OA4 A;  3ZMU A;  2EJR A;  2QUF A;  3RKX A;  1K78 A;  2ESH A;  5BS6 A;  1R1U A;  2HFH A;  4BQA A;  2Z5U A;  1Z91 A;  4RB1 A;  2K7L A;  3HOT A;  4HF0 A;  1LJ9 A;  2ZME B;  3FM3 A;  2F5F A;  1REP C;  1WSU A;  1UFM A;  4BAY A;  1PUE E;  1PP7 U;  1J9I A;  3F8B A;  5AIP A;  1FYL A;  2EV0 A;  2UWM A;  1JGS A;  1PDN C;  3EET A;  4L9V A;  1ON1 A;  2F5D A;  3JTG A;  4M71 A;  5L3C A;  4A5N A;  5J8C A;  2STW A;  1FZP B;  2RQP A;  5KVR A;  3FMR A;  4CXF A;  2W57 A;  4I01 A;  2JT1 A;  4HX8 A;  4G6D A;  3B73 A;  2DQL A;  1X3U A;  3Q9S A;  4OIR F;  2FA5 A;  4LFU A;  5ERI A;  4GCV A;  3HOS A;  3M1E A;  1J0R A;  2X4H A;  4HQM A;  3OV8 A;  4LK0 F;  2HWV A;  5L3E A;  1B6A A;  3HHG A;  4UNO A;  1FYK A;  2QYO A;  2CQK A;  3LWF A;  2DU9 A;  3FX3 A;  3CUO A;  2M1B A;  1G4D A;  3I53 A;  2XVC A;  4RB2 C;  1KA8 A;  4A5M A;  5DCM B;  3V7C A;  2W84 A;  1IUY A;  3BJA A;  4YG2 F;  1F9N A;  5DV5 A;  2PJP A;  3IHU A;  2A69 F;  5CLS A;  4M9X A;  1MZB A;  1SFU A;  1IXS B;  3TO6 A;  1F4K A;  2Z99 A;  3DQV C;  3TDZ C;  2JZY A;  1IAW A;  5HVQ C;  2M5W A;  4O6J A;  3I71 A;  2O0Y A;  4ESB A;  4P5O A;  4EJW A;  3T1B A;  1BN5 A;  4EGZ A;  2PMH A;  5E1W A;  3K0L A;  3WTT C;  2Z33 A;  5FO5 A;  1XGO A;  4ENN A;  3JW4 A;  2BYV E;  3BP8 A;  4EVI A;  3WG9 A;  2DPU A;  1R58 A;  1J75 A;  3HIF A;  5JFR A;  2EFQ A;  2FRH A;  1BI3 A;  1XD7 A;  2KIM A;  2Q8K A;  1O3T A;  1BI0 A;  2IW5 A; 
#chains in the Genus database with same CATH topology
 2PFB A;  2XGX A;  2DTZ A;  1LDD A;  3AKZ A;  2XRO A;  2VXZ A;  2R7Q A;  4X1E A;  2EV5 A;  1OLT A;  4XRF A;  3CF5 F;  1VQP I;  4B4C A;  2E2J J;  1F43 A;  4N4O B;  1KQ9 A;  4HSR A;  3C1D A;  2VJI A;  2E5Z A;  2HPI A;  1FX7 A;  1EH8 A;  1RES A;  2UZK A;  4IOA F;  1IG7 A;  2DFI A;  4L0Z B;  2QVO A;  1MW7 A;  3B6C A;  2IVM A;  1PUF B;  1QZY A;  2CUE A;  1KGS A;  2K4J A;  4U0W A;  1XPX A;  4KFC A;  1FBU A;  2LTP A;  3MKL A;  2LH9 A;  1MBF A;  3DWL E;  2G9W A;  2IAI A;  1XSV A;  4YEL A;  4NHJ A;  3V8K A;  1X1D A;  2VBW A;  2R7Z J;  1SD7 A;  3KZI C;  2IS4 A;  2I5U A;  1BW5 A;  2EFP A;  5FLX K;  1XTA A;  1K4S A;  2BZT A;  2FBH A;  2RVC A;  2QA4 I;  5CYV A;  3G4S I;  3FIW A;  3I9V 2;  5E18 F;  4A3M J;  4DNC A;  3QAH A;  4XMY A;  4FE7 A;  3IRQ A;  1DUX C;  1SEU A;  2MSY A;  4C2M J;  5JR3 A;  2CO5 A;  4WCG A;  1F36 A;  1RKW A;  2F5V A;  3ZMV A;  3EDP A;  4J01 A;  1D8J A;  2LRD A;  3ECH A;  3RPU D;  4HNV A;  1T39 A;  2HKO A;  2XB0 X;  4A3L J;  1KYW A;  3A2K A;  3V4G A;  3VWB A;  4AVP A;  2ZNZ A;  1XSX A;  1D1C A;  3R4K A;  3OYB A;  3GME A;  5A2Q Z;  5E79 C;  3P5J A;  3GTL J;  2E7W A;  2DA6 A;  4KIS A;  2FU4 A;  1WCM J;  4A6E A;  4QWQ A;  3ZCO A;  1Z67 A;  3OIO A;  1YW9 A;  3FWE A;  3IAS 2;  4RBO A;  1J2X A;  2L0K A;  1TL8 A;  2Q2E A;  2RNG A;  2ISZ A;  1D0Y A;  3E7L A;  3MKW B;  1U5T C;  1IV6 A;  5F0H A;  3DKX A;  3K4L A;  2K4B A;  1HXD A;  4WX9 A;  1I50 J;  4XRM A;  2E1N A;  3RDI A;  1KQ8 A;  1TWF J;  3OOU A;  3ZMS A;  2EIN H;  2VT2 A;  4E7K A;  1UG2 A;  2FE3 A;  1SD4 A;  1K78 B;  4F7Z A;  4EM1 A;  5IT9 Z;  2J5O A;  3Q3S A;  1R22 A;  3BTC A;  1SC7 A;  5L3F A;  3IH4 A;  1YJW I;  2IXS A;  3JRD A;  2LP0 A;  3BTI A;  3JCU C;  2V6C A;  3GF2 A;  4G6Q A;  3ERE D;  2NOJ B;  1T0F A;  2DBB A;  3CME I;  1G3Y A;  4Q4Z F;  4HST A;  3GFM A;  3HSF A;  4KN7 X;  3F8C A;  2RAE A;  1V55 H;  1UZC A;  2XKP A;  4HA8 A;  2HYJ A;  3S93 A;  3GZ5 A;  4E7H A;  3TQN A;  1S9H A;  4IRG A;  5K5R A;  5J4Y A;  3KCC A;  2X0L A;  4G94 A;  5GAG J;  3WHC A;  2QZ8 A;  3CJT B;  3GCM A;  2OUM A;  1YHQ I;  1ACI A;  3BWG A;  2PEX A;  4FX4 A;  3WE3 A;  4XLH A;  5KAF C;  4A2U A;  4EQQ A;  4N4N B;  1V5F A;  1ZLJ A;  4XBF A;  3H3Z A;  1YI2 I;  1TQI A;  2HQN A;  5FB2 A;  4XR6 A;  4ZZD A;  3W6V A;  4UUV A;  4MQV A;  1PP8 F;  3HJE A;  3L2V A;  1EKE A;  1P9Q C;  4EGY A;  4M6X A;  1ZRE A;  1YIT I;  3H5R A;  3VOD A;  2M2E A;  1ZAO A;  1O3Q A;  1LNW A;  1RUO A;  1HF0 A;  3HOX J;  1PJR A;  4GFB A;  1DP3 A;  4OWR B;  2XPV A;  2XF7 A;  5CQE A;  3D1N I;  2VN2 A;  2ZME A;  3BTL A;  3FKJ A;  3QU6 A;  1DGR M;  4EMS A;  4DYQ A;  4CCK A;  2ACJ A;  2DI3 A;  2WAQ A;  3O3K A;  1MH4 A;  4L9T A;  4E7J A;  4BKX A;  1W7P D;  1NTC A;  4M9S A;  4NNJ A;  4AU7 A;  3LMM A;  5KK1 A;  2NS0 A;  2BGC A;  4M3F A;  3SFZ A;  3CC4 I;  1KQ0 A;  1K4T A;  4XKB A;  2P6S A;  3F8F A;  1JE8 A;  2Z9O A;  2VKD A;  1VQO I;  1FWZ A;  4BXX J;  3ZQG A;  3BG3 A;  3SDB A;  2MLG A;  1D1B A;  1FP1 D;  4BY7 J;  4B43 A;  2IRF G;  4DBQ A;  2H09 A;  2VJ4 A;  1B4A A;  3GFI A;  2FSW A;  2QEX I;  4HF1 A;  3LSK A;  1T2K A;  2A3S A;  2EFN A;  3HRT A;  5BPD A;  2FQ3 A;  2JN6 A;  2HVQ A;  2HVS A;  3IH2 A;  1YX3 A;  1DQU A;  4IHW A;  2W7N A;  1W7P A;  3HEF A;  3OYE A;  3G2B A;  2P6T A;  2KDZ A;  2JUC A;  2RKH A;  3BDD A;  1IC8 A;  5HOO A;  1F5T A;  3CUQ A;  2OF7 A;  2K9S A;  1ULY A;  1UST A;  3WGG A;  1DU6 A;  1XDS A;  4XOT A;  3FHN A;  1JXS A;  2IA1 A;  4FCY A;  3IAM 2;  4FET A;  5L3D A;  2JA6 J;  2O7O A;  4AM3 A;  1SFE A;  4BU2 A;  2Y0S N;  5K1Y A;  4UVB A;  2MH2 A;  2DDB A;  2M4K A;  4B3X A;  3O8G A;  2HZD A;  4KN4 X;  3S1M J;  4XLN F;  3WTU C;  5D4S A;  5CJ9 A;  2CFO A;  2Y9Y A;  2XKO A;  3AAF A;  1VF9 A;  3BG5 A;  3F8N A;  3HB9 A;  3LA7 A;  4UVA A;  3QPL A;  1VQL I;  3I54 A;  2PN6 A;  2XAQ A;  2FOK A;  3S15 J;  1MNM C;  2KPM A;  4B8X A;  4IF4 A;  4X6A J;  2DYR H;  1JKO C;  2COM A;  3DCF A;  3VSL A;  5C4J J;  3PIP F;  1FEX A;  2HQ5 A;  3CJQ B;  2QSF X;  3KX2 A;  1HLV A;  3LA2 A;  4B48 A;  2EZL A;  4IHT A;  4DYR A;  3CZ6 A;  1STZ A;  2LYC A;  4DJA A;  2TDX A;  3ISP A;  2VJJ A;  4D1Q A;  4HLY A;  3LL7 A;  1XB4 A;  1AKH B;  1I3Q J;  1V54 H;  5E8I A;  4A0Y A;  5E3L A;  3S1Q J;  2NRA C;  4OIP F;  2JK3 A;  1JT0 A;  3OYH A;  1HST A;  2DMT A;  2JA5 J;  3EPZ A;  2D2W A;  3M1C A;  1U9O A;  4LJZ F;  3HKZ A;  4LIU A;  2R7V A;  1OR7 A;  3NQO A;  1YJN I;  5CPR B;  4U0V A;  1WFX A;  1WHU A;  4HBL A;  4I0B A;  2UXX A;  4RAF A;  3H3V K;  3E1S A;  4PSX A;  4XSZ F;  5IP7 J;  5HDG A;  4R1H A;  2HGC A;  3HM5 A;  1WJC A;  2N8G A;  1UHM A;  2HS5 A;  3F8M A;  1XCB A;  1Y8Q B;  2FNA A;  3BG6 A;  2OZ6 A;  2CW0 F;  1PVE A;  1W0U A;  2W00 A;  3K1M A;  2KZV A;  4GGG A;  4I0A A;  3F23 A;  3K2Z A;  5IT3 A;  2H1L A;  1SFX A;  4M6V A;  3ULQ B;  3LST A;  2WC2 A;  2IGM A;  2PG4 A;  1RPW A;  4IZZ A;  3CMY A;  3OY9 A;  3F72 A;  2L3D A;  2HOE A;  2VON A;  1T0F C;  4BJT A;  3OIP A;  1LEA A;  3GXO A;  3AL0 B;  2MYS A;  1MGT A;  2ISY A;  3V7S A;  1R5H A;  4Z6Y A;  3WU1 B;  2A68 F;  3OYD A;  3JSO A;  2A5Y B;  5FJ8 J;  3HUG A;  1MBK A;  3JAM K;  1WH7 A;  3S8P A;  4DZP A;  2L01 A;  2L9N A;  2P5V A;  2RNJ A;  3FM5 A;  3QOD A;  1R36 A;  1PUF A;  3OYF A;  2BY2 A;  2Q2E B;  1HW2 A;  1OFC X;  1WPK A;  2VPR A;  4PFO A;  4V2G A;  4LLL A;  2XGD A;  5E17 F;  4IRI A;  2DA5 A;  1F1Z A;  1IXC A;  2Z16 A;  3X2Q H;  3J81 K;  2IS1 A;  2D45 A;  2WAD A;  1W0T A;  2DA3 A;  2EA4 A;  1T98 A;  2DK8 A;  1VQ4 I;  4IJA A;  5BMZ A;  2AQF A;  1QQI A;  3HZJ A;  2EPF A;  1S29 A;  9ANT A;  1O3S A;  2KIF A;  4F3Q A;  1R00 A;  4RGR A;  3DV8 A;  3FIS A;  1XS9 A;  3ABK H;  4P1W A;  5EEA A;  1WQ2 A;  4YFK F;  1MBG A;  4UY8 I;  2ZME C;  3LSP A;  4B09 A;  1FPQ A;  1G6N A;  1OMI A;  1VQ7 I;  4Y3O A;  2ZO4 A;  4BEH A;  4AYB N;  1R23 A;  3OYA A;  1BOB A;  2MGQ A;  1WJE A;  2NVX J;  3GBG A;  3RYR A;  4I76 A;  2PJR A;  2XAU A;  4OIO F;  2M87 A;  1H0M A;  2IA2 A;  4UUS A;  1Z3X A;  1YS7 A;  3QPT A;  3PNT A;  1IN4 A;  1ONV A;  2FBK A;  2V1D A;  2IGO A;  3R6S A;  1QBJ A;  4EM2 A;  1MD0 A;  2DFF A;  3CCR I;  2LRE A;  4PJM A;  5D5U B;  3PQJ A;  5FFZ A;  3H0D A;  3UKG A;  4NB5 A;  1MDM A;  2O6G E;  2Y30 A;  2NVT J;  2CYY A;  2K3P A;  4IX7 A;  4OMY A;  3RQ4 A;  1V5E A;  3G73 A;  3S17 J;  1I6H J;  2KIU A;  5LHH A;  4LK1 F;  1MJB A;  2BY0 A;  5L3G A;  3DP7 A;  1HCR A;  1E3P A;  1EA3 A;  2V7F A;  1XMA A;  1GV5 A;  1WKM A;  2D1H A;  1EJ9 A;  1LB2 A;  2MFZ A;  2O9L A;  1NG7 A;  1OCP A;  5FKM A;  4IO9 F;  1YTY A;  1ZHF A;  4F92 B;  3OYI A;  3F6V A;  4OAZ A;  1HDP A;  2ZJP F;  1CF7 A;  3AG2 H;  1SVL A;  3HC7 A;  3GX4 X;  1U78 A;  3PUB A;  1VQK I;  4BBS J;  1W4M A;  2LLK A;  5M5Y J;  5ICC A;  4U7D A;  1K6Y A;  4ZYE A;  1ZGA A;  2K27 A;  5GTI C;  1N25 A;  3DF8 A;  4KIT B;  3EUH C;  3ABT A;  4HLX A;  4DYC A;  4KNY A;  2R7T A;  3K4M A;  4Y15 A;  2ZXJ A;  2A6H F;  1P7I A;  4RDU A;  1L3L A;  3BZK A;  2NVQ J;  2CRG A;  3T8T A;  3E6D A;  5HLI A;  1J7K A;  3V42 A;  2KLO A;  2NOG A;  1UB9 A;  4Y13 A;  2GOM A;  3H9G A;  1W7P B;  3REO A;  2HPM A;  1JKQ C;  3UNG C;  3KYD B;  5DYM A;  4D7M A;  3GTK J;  1XMX A;  3I56 I;  5LHI A;  4Y33 A;  3MWM A;  2ZC2 A;  5HS8 A;  1MMS A;  2NS8 A;  3CUQ B;  3E0J B;  3KLN A;  3GTG J;  4LB6 B;  2K9N A;  2ZXW H;  1YIJ I;  3P9I A;  2OCC H;  4E4H A;  1SFK A;  4MEX F;  4CDG A;  5KCM A;  4HW0 A;  3IKT A;  4OAY A;  3J7Y J;  1MKM A;  1UCR A;  2WB1 A;  4I02 A;  3OYM A;  3CCJ I;  4EAT A;  5ILV A;  2IGN A;  2M7B A;  2QEN A;  3WTZ A;  3RKY A;  3JRH A;  1KYZ A;  3QU3 A;  2QGU A;  2YU3 A;  4AWX B;  2L7F P;  1R71 A;  2V79 A;  4NUB A;  2DA4 A;  2PQ8 A;  1MBJ A;  1RKT A;  1HBX G;  1YG2 A;  4A93 J;  2E71 A;  1WJD A;  3FZV A;  2COB A;  1A6I A;  1K6O A;  5D6E A;  3MZ8 A;  4BJ5 C;  4A0Z A;  2W85 A;  3B6A A;  4BQQ A;  4D0P A;  3AFH A;  3R0A A;  5E20 A;  1QU3 A;  2A6E F;  1E0E A;  3OWT A;  2DA1 A;  2ID6 A;  3HSR A;  4S04 A;  1VI0 A;  3NAU A;  1GVD A;  3F0C A;  4KJZ A;  3I4N J;  3E6C C;  3BPV A;  2HTJ A;  3K1P A;  2HKX A;  3OS0 A;  1XSD A;  1H9G A;  3S3M A;  1RC9 A;  1U2W A;  2X6W A;  3PNV A;  4KDP A;  3L2U A;  3M3Y J;  4BJ6 C;  4II2 A;  4LG0 A;  4CYD A;  4PFP A;  3H0G J;  3FXQ A;  3CLO A;  3KLO A;  2ME0 A;  5FKO A;  5LBQ A;  4LMY A;  2R7W A;  2E1M C;  1ZKG A;  4IHX A;  4OIQ F;  4GYG A;  3TO7 A;  4I99 C;  2CGP A;  3K2A A;  1YFH A;  3K4B A;  2IA0 A;  3CLQ A;  4RGS A;  1S5L C;  3M7G A;  5F1J A;  1AWC A;  3A4C A;  4MO7 A;  2FD5 A;  1ZRF A;  2JSC A;  4MTE A;  3U2R A;  2ZNY A;  3S3O A;  1GVJ A;  3O6B B;  2ZJ2 A;  4RM3 A;  5J47 A;  2RGV A;  3OL3 A;  4RS8 A;  3J7A Y;  3DLA A;  4PDK A;  1TNT A;  3FXK A;  4ZDP A;  2VL8 A;  2QCO A;  3LQQ A;  3R60 A;  3WTW C;  1B9N A;  1BOA A;  2CU7 A;  2JA7 J;  2WY7 Q;  1HKT A;  1WZ2 A;  4BL0 B;  2WAQ N;  3E5X A;  3GO5 A;  4XOP A;  5K7H A;  4PJN A;  3ZR8 X;  4HX4 A;  1LE8 A;  2OU2 A;  1ZLK A;  4A12 A;  1AKH A;  1TC3 C;  4IHV A;  3HUG B;  3FF5 A;  2BV6 A;  1S7O A;  2XGE A;  1P6R A;  3WGI A;  4C2T A;  4B1R A;  3MFK A;  1UHS A;  1B1B A;  4WK8 F;  3NRV A;  1RZ4 A;  3CJN A;  2M45 A;  4CIC A;  3ZQQ A;  1P4X A;  2DQR A;  2LY2 A;  1I1S A;  3I59 A;  2O3F A;  5IY5 H;  1OYY A;  4IRH A;  3CCS I;  2EK5 A;  4MHG A;  2Y0M A;  2ZJQ F;  3GTO J;  3L7W A;  1FOK A;  2VT3 A;  1KU9 A;  4BE0 A;  1RR7 A;  1VZ0 A;  1KU3 A;  5HDN A;  3W2A A;  2PMZ A;  1CGP A;  1XC5 A;  2JA8 J;  4ENJ A;  2EFO A;  1YW7 A;  2UXN A;  5B1A H;  4KYW A;  2QQA A;  1IO2 A;  4D5F A;  4XM3 A;  1L0O C;  4CZC A;  1DDN A;  5LHG A;  4EJU A;  1A04 A;  3BTJ A;  1S8N A;  1BI1 A;  1QHG A;  2ZFU A;  4PJL A;  2IJL A;  1PYV A;  3WU2 C;  1I1G A;  2LVS A;  3TKY A;  1SAX A;  1FC3 A;  5TRD A;  3CO6 C;  2XSJ C;  2VQH A;  2LR8 A;  5CVJ A;  2KIS A;  3ZMT A;  2P7C B;  2ID3 A;  3L2R A;  3E6B A;  2CMP A;  5AIQ A;  3L2C A;  2VPL A;  1MH3 A;  1OPC A;  1FYM A;  2PI0 A;  4XID A;  4YII A;  1NG6 A;  4WXD A;  3T8R A;  3QOE A;  4BEH B;  2M30 A;  3I4P A;  4IHS A;  2ZXH A;  1RNL A;  2K5C A;  3QQA A;  4RAG A;  3IUO A;  3U1K A;  1BBY A;  1R5G A;  5TJJ A;  4W97 A;  2PJR B;  4HEA 2;  4B3A A;  4B44 A;  3KET A;  2V1N A;  5ILU A;  2ETH A;  4UUS B;  1HKQ A;  5F0C A;  3G6E I;  1OCZ H;  4M74 A;  3KEO A;  3CCU I;  4UXN A;  2MLK A;  3RPU A;  2QBY B;  4NC8 A;  1FBS A;  4GXO A;  4JQF A;  1Z77 A;  3CMM A;  4HOB A;  2XB5 A;  2V9K A;  4XIC A;  1SFO J;  1IDZ A;  3KP3 A;  1MDM B;  1JKP C;  1LDK B;  1R1T A;  5IYB J;  1E2X A;  4HAM A;  5E8G A;  4G8X A;  1U9N A;  1IXR C;  3F22 A;  4PK4 A;  2RDP A;  1FOY A;  4CCO A;  2P0W A;  2XSD C;  2X9D A;  2XIG A;  3SHF A;  3TW7 A;  3LFU A;  4CH7 A;  2IPQ X;  3QWL A;  4EJT A;  3HKZ N;  4JOM A;  2KIQ A;  2DDA A;  2KT0 A;  4XKW A;  3AG4 H;  3ZN0 A;  2L4M A;  2QQ8 A;  3ABL H;  5AON A;  2FX0 A;  2LD5 A;  2VOP A;  4YFN F;  1CF7 B;  3QPS A;  5IPA A;  4NQW A;  1GXP A;  1JTY A;  2W24 A;  1A35 A;  1YYV A;  1MJA A;  2BXZ A;  3JR9 A;  1ETK A;  1X19 A;  3LFK A;  3RYP A;  3BJO A;  4RGU A;  3Q5F A;  1FIA A;  2CS3 A;  4ESF A;  4N0B A;  3A1Y A;  2JA2 A;  1MMG A;  3OYJ A;  2BEO A;  2YUS A;  5E3O A;  4L0Y B;  2Z2S B;  2AS5 F;  4RB3 C;  1ZH5 A;  4KMF A;  4ON0 A;  5K5O A;  3KEY A;  2QQ9 A;  2E2I J;  3IKV A;  4ENK A;  1Y6I A;  1KU7 A;  3I0T A;  4C2U A;  6PAX A;  2YX7 A;  3E3V A;  3IC7 A;  1U5T B;  2M8E A;  3K69 A;  1QVU A;  4YIR X;  3PL8 A;  5F6F A;  4BQO A;  5LGT A;  1TQM A;  2XDV A;  1BJA A;  2XF5 A;  4LG3 A;  2NAZ A;  2WA0 A;  2RC4 A;  5E1X A;  4AIK A;  1MJ9 A;  5HDK A;  2TCT A;  2IBD A;  1Y56 A;  1Q1H A;  3LA3 A;  2Y75 A;  2PMU A;  4R79 A;  3TP3 A;  3H36 A;  4A69 C;  2ELJ A;  4RMN A;  5B3S H;  5FD5 A;  2LBF B;  2Z1D A;  2FMY A;  4MNU A;  1WJA A;  3RI4 A;  4ZYD A;  3HTS B;  1RUN A;  3F21 A;  1Z6R A;  4QSH A;  1W36 D;  2WTE A;  4CA0 A;  5GAH J;  2E7X A;  2A07 F;  2R7O A;  2R3S A;  2LK2 A;  4BNC A;  1SD5 A;  1ZRC A;  4IXA A;  4QPO A;  2BOL A;  1A5J A;  3L1P A;  2EB7 A;  1IV8 A;  1YJ9 I;  5BQT A;  4P55 A;  2TRT A;  5FRO A;  3BG7 A;  4BGD A;  1GT0 C;  1U3E M;  1FTT A;  2LKX A;  3BOQ A;  3GWZ A;  1X4P A;  5M5X J;  1O4X A;  2G7H A;  1Z7U A;  3NAR A;  2OQG A;  1I39 A;  3FMS A;  2M0C A;  2PBI A;  2EBI A;  5DD8 A;  3WTX C;  2F4I A;  1JHH A;  3KZY A;  1S7E A;  3WGH A;  3VOE A;  1S7A A;  2L7K A;  4S05 A;  4V19 K;  2H94 A;  1BR1 A;  2QM3 A;  1YQA A;  3C18 A;  1Z9C A;  3DKY A;  1FY7 A;  2DXI A;  4XQF A;  3HOU J;  1Y1V J;  4HX7 A;  3HYI A;  3K4K A;  4CO8 A;  3EUA A;  1BW6 A;  1H8A C;  1O57 A;  3DU5 A;  3PIO F;  1Y1W J;  1MBE A;  2AO9 A;  5DD4 A;  2NYX A;  3U1D A;  2E1C A;  4LG0 B;  1W5S A;  2V6E A;  1D5Y A;  2RRE A;  1LQ1 A;  5FGM A;  4L9N A;  2LDU A;  3BLY A;  3W2W A;  2R5Z B;  2ZFW A;  1OCC H;  2DA7 A;  3C3W A;  3H5A A;  4C3J J;  2JUG A;  4Y7N J;  2XC7 A;  1TTY A;  2L7M P;  4ENM A;  1G3T A;  5CVU A;  3PQK A;  2EFW A;  3S2D J;  1ERD A;  2H6B A;  3SZG A;  2VUM J;  3MKZ A;  1U0J A;  5F1R A;  1T95 A;  2L9S A;  1Y8R B;  1LEB A;  2JPC A;  2NNY A;  1B9M A;  1IGN A;  2KQR A;  4XK4 A;  2C6Y A;  2NS7 A;  2HU9 A;  1ETY A;  4BHB A;  3PO2 J;  4PGG A;  2XPU A;  4BUP A;  5JLW A;  1XDU A;  3QPH A;  3GTM J;  4Y17 A;  2VQC A;  1Q1V A;  1R9T J;  2V9V A;  2DPD A;  3JRB A;  2CQ7 A;  3HDD A;  3CD6 I;  5ICG A;  2ADU A;  2H6C A;  3J80 Z;  1LE8 B;  4JK1 X;  2L5Q A;  2GA2 A;  1YX5 A;  4HYE A;  4IQ4 A;  1EH6 A;  3CCQ I;  4MGR A;  3G3Z A;  3PFI A;  4PSW A;  2K40 A;  3M07 A;  4YRV A;  3AL0 C;  1G2H A;  5TGT A;  4AIH A;  1YLF A;  5LRS A;  1XN7 A;  2VBX A;  2O8K A;  2X1E A;  3OYK A;  2WAF A;  2JVH A;  2K86 A;  2HDW A;  1AHD P;  3A01 B;  1VQ8 I;  2R7S A;  3SQN A;  3M8F A;  2GOX B;  2YX4 A;  3M8J A;  3I59 B;  4IL6 C;  2F2E A;  5HS7 A;  2R7F A;  4MIM A;  2QKL B;  3DTE A;  4CCN A;  4P9F A;  3SYT A;  2VQG A;  3BR3 A;  3OR2 C;  4TV7 A;  4XOR A;  5F64 A;  2B63 J;  1P4A A;  5BOX A;  1XGN A;  1LVA A;  2VC1 A;  5LGN A;  3F9K A;  2Q1Z B;  2MBF A;  4N9I A;  5JVG F;  3JSP A;  3PUF A;  2K85 A;  4M73 A;  2VC0 A;  1KZH A;  1MND A;  1ZR2 A;  4W1U A;  4ITV A;  2J5P A;  2DOF A;  4XLP F;  1B72 A;  3VPR A;  1ZYR F;  3ZMD A;  4OMZ A;  3JAM Z;  1JKR C;  2DLL A;  2L9V A;  4A3C J;  3MVP A;  4LLG F;  1C0W A;  1BR2 A;  3K7A J;  2DMP A;  1HDD C;  2ELH A;  1TT5 B;  3KYC B;  2IP2 A;  2EWN A;  1BIB A;  2AXL A;  4I2O A;  2RN7 A;  2WB1 N;  3VFZ A;  3L00 A;  1IDY A;  1IUF A;  3O8H A;  4F55 A;  1OKR A;  1P2F A;  4CYC B;  5D4R A;  3DEU A;  4LLN A;  2LF7 A;  3WTV C;  2R7U A;  2X85 A;  2XAG A;  3S2W A;  5DCF A;  1IN7 A;  4D9J A;  3B02 A;  4WXC A;  4XLC A;  1TWG J;  2E5N A;  5D8L B;  1IRZ A;  5H2F C;  2WY8 Q;  1FBQ A;  1IF1 A;  1ZTR A;  5GAD J;  2ZCW A;  3OSG A;  3HRM A;  1G3S A;  2O03 A;  3ABM H;  3LAP A;  1NHA A;  2XAJ A;  1UJ8 A;  1ZN2 A;  3A0B C;  5F08 A;  3H92 A;  4D7N A;  3W3C A;  4BYY A;  4ZYH A;  1Z3Y A;  1A31 A;  1YRN A;  2EIJ H;  2R7D A;  4XN3 A;  3GTQ J;  5CVR A;  2RV8 A;  4E7L A;  4UUT A;  4RAY A;  1AU7 A;  3NWT A;  3CC2 I;  2IEK A;  2GQQ A;  2GAU A;  3IH3 A;  4FQG A;  4GO1 A;  3CCE I;  1VQ6 I;  3OIQ A;  5FD6 A;  4WF2 A;  5D8K B;  2X48 A;  5H20 A;  2DT5 A;  3PM1 A;  1UHW A;  4M9Z A;  2MC3 A;  4P9U A;  2Z3Y A;  4IHY A;  1D5V A;  1BI2 A;  4R8H A;  5IOY A;  1UMQ A;  3RKQ A;  3RZD J;  3S1R J;  2Q0O A;  1HKS A;  5DEQ A;  1WRJ A;  4NQW B;  1RI7 A;  3BG9 A;  1IN5 A;  3I5U A;  2A05 A;  4G7Z F;  1DP7 P;  3W6J B;  2KL4 A;  3CDL A;  5HLH A;  4G7O F;  5K5Q A;  3V8J A;  2GXG A;  3CP8 A;  4KA4 A;  2QBY A;  3L9F A;  4JX6 A;  1DPU A;  3OYC A;  2FUG 2;  1RR8 C;  5J3L A;  4NDL A;  3T0Y A;  4WXH A;  2KFD A;  3PSI A;  4DGW B;  2M4G A;  4PGH A;  4Q48 A;  4HV5 A;  4MTD A;  3VB2 A;  2HDC A;  4M3B A;  3EUK L;  3DFG A;  2E36 A;  3ELK A;  5LRR A;  3HSE A;  2R93 J;  1W5T A;  2L9R A;  1V3F A;  4BE2 A;  1J09 A;  3ZXS A;  3CQZ J;  1X1C A;  1R4M B;  1ENH A;  4UHT A;  4A3I J;  3N97 A;  1KU2 A;  5C4X J;  1R7J A;  3RSN A;  2DFH A;  3CUQ C;  5J1R A;  3ROU A;  3A03 A;  3IWF A;  2VXD A;  1YW8 A;  3TW6 A;  5ED4 A;  1X1B A;  5L3B A;  3ZQF A;  1JGG A;  2HDD A;  2EIM H;  3OS2 A;  2G0E A;  3JRC A;  3N4M A;  4H0E A;  3UR3 C;  2XUB A;  4ETS A;  1AOY A;  5IYC J;  1T08 B;  1FMV A;  3BZC A;  3EQL F;  5J6X A;  5J1Y A;  2JQ7 A;  3S2H J;  1A36 A;  3CCV I;  2LFB A;  2NNN A;  2O61 A;  4G6T B;  4U87 A;  4ZTF A;  2CUJ A;  3E5Q A;  2M34 A;  4HF2 A;  2Y2Z A;  3FXU A;  2B9S A;  5TIS C;  1T33 A;  3MKY B;  2I8D A;  3D0S A;  1ETX A;  2DT7 B;  2CWE A;  2HYF A;  3TOA A;  5IP9 J;  2VB6 A;  2PX9 A;  3E97 A;  2MC4 A;  5GAE J;  3FK7 A;  3FXO A;  4E7S A;  5ICF A;  2HTS A;  3AG1 H;  1T38 A;  1D0Z A;  3J7Z I;  1H9T A;  1SAU A;  1TP4 A;  2IGK A;  2DCE A;  4ZZL A;  2ZSI B;  4LIT A;  2EIL H;  5D5V B;  1U5T A;  2VKE A;  3FBN B;  5J4V A;  1P7J A;  4ASN A;  1IN6 A;  4LD5 A;  4OU0 A;  1G3W A;  5LEJ A;  4A3J J;  3L2W A;  3LSG A;  3CDI A;  3GLX A;  5H6R A;  2P5L C;  2ECB A;  2HXI A;  2LY1 A;  3BY6 A;  2D1V A;  4PZJ A;  3MCZ A;  2Y69 H;  3GFJ A;  3LQR A;  1NK2 P;  1SAN A;  5M3M J;  4EV0 A;  1J5Y A;  3GTP J;  5K7F A;  5KHD A;  2XAF A;  4S0H B;  3DPL C;  1U6G A;  2LBF A;  3IP4 B;  3ZP5 A;  2K02 A;  4X0G A;  3F6O A;  2W4S A;  1OR7 C;  2K9M A;  5LFA A;  4CGZ A;  3SEZ A;  2X1D A;  4JX5 A;  4ABZ A;  5JLX A;  2I10 A;  3JRI A;  2XRL A;  3KFW X;  1A6Q A;  3K70 C;  1TWC J;  3CTA A;  2CV0 A;  1D1A A;  2CG4 A;  4GRI A;  4IPA A;  5EEG A;  1LDJ A;  4AD9 A;  4QIW N;  2LOO A;  1MMD A;  1YOV B;  2HOS A;  1BA5 A;  2CW7 A;  2JRT A;  4XLA A;  4DIQ A;  4MQ9 F;  2E60 A;  3V7R A;  1ZG3 A;  1HSJ A;  3M9A A;  4UV8 A;  4O5V A;  3ZQL A;  5EF6 A;  3MZH A;  1FLI A;  2BY1 A;  1VQN I;  3ASN H;  1BM9 A;  1HQC A;  3OYL A;  1FTZ A;  2HR3 A;  3ERM A;  2KJC A;  2ZXI A;  3E6M A;  5K7Z A;  3P7N A;  4Q5S F;  4G7H F;  1D0X A;  1GHC A;  3ZGK A;  1I6X A;  4YIF A;  3COA C;  1K83 J;  4RM2 A;  3HPH A;  2MAB A;  3OL4 A;  2CJJ A;  2ZB9 A;  3D5L A;  3MQ0 A;  1RIO H;  2BY3 A;  4PCQ A;  5B5E C;  2GA1 A;  2FML A;  2M8G X;  2QSG X;  2DTR A;  3MN2 A;  3ZQH A;  2R5Z A;  4KIF A;  1KON A;  2KJB A;  1FMW A;  4KT6 A;  4J19 A;  1FOX A;  3E5U A;  3S14 J;  5D6F A;  3S16 J;  1Y0U A;  1ODD A;  2KRF A;  3N05 A;  2MD5 A;  3JRF A;  4HDU A;  1QNT A;  2HXO A;  4C3I J;  3DXJ F;  1YE9 A;  3BC8 A;  2CUF A;  1XGM A;  1VTN C;  4I98 B;  3BR1 A;  1B72 B;  2WV0 A;  5JI6 A;  3M8E A;  2RQQ A;  3L09 A;  2HOA A;  5HOD A;  3KP5 A;  1GXQ A;  3K9T A;  4H4K C;  3H3U A;  2DMN A;  4AYB A;  3PFY A;  4N9H A;  4Q47 A;  4UB6 C;  4IVN A;  2GIV A;  2DFE A;  1FSE A;  4I7H A;  3SZP A;  1K79 A;  1E3O C;  3WU0 A;  2VOO A;  4DW6 A;  2W48 A;  3O2P E;  3OMY A;  3FK6 A;  2VBY A;  3CDH A;  1YIO A;  2L4A A;  1I5Z A;  2HQR A;  3DBH B;  2OJE D;  2VI6 A;  3C2B A;  1QO0 D;  3HGY A;  3GVA A;  3QOP A;  1ETV A;  1SMT A;  2BVM A;  2OV7 A;  3H1C A;  1X1P A;  3Q0U A;  2KZG A;  4CCM A;  5FLX Z;  1X3W B;  3HRU A;  3KZZ A;  2V4J C;  2DO7 A;  4E7Z A;  1BR4 A;  2IT0 A;  3TP0 A;  1HW5 A;  1S72 I;  3WTY C;  3WTS C;  2EV6 A;  3DTI A;  5CQG A;  2L54 A;  3OYG A;  3GFL A;  4L5J A;  4C9Y A;  3A01 A;  4JP0 A;  4C30 A;  3QP5 A;  3WHB A;  1POG A;  2R4G A;  2X6X A;  3DPU A;  4UVC A;  1MMA A;  2JPB A;  2LMD A;  1X58 A;  5DUI A;  3CCY A;  1WJB A;  3WG7 H;  2E19 A;  3WOD F;  1B8I A;  4F91 B;  1G59 A;  3ZQ7 A;  4KUM A;  1SD6 A;  2VIX A;  2X1C A;  1OYW A;  4A6D A;  2PLY A;  5JVT A;  4Y4R A;  4EJV A;  4XSX F;  4QPQ A;  3HOW J;  3G1L A;  1YRN B;  5CVV A;  2E1M B;  3H5N A;  3MD2 A;  1ZEL A;  3GW2 A;  1R4N B;  2F5E A;  2GWR A;  2UV1 A;  2GXB A;  3TO9 A;  4BHP A;  4QTR A;  1ZGJ A;  4KT5 C;  3KE2 A;  3FDY A;  2MH9 A;  5M5W J;  4U88 A;  4JYK A;  4E7I A;  3ZQC A;  3LSI A;  3F3X A;  2V1X A;  3A0H C;  4GDF A;  2KRC A;  3K10 A;  3WE2 A;  4BXF A;  2BE5 F;  3FXL A;  4B47 A;  5HLG A;  1OCT C;  3ZN1 A;  1ZRD A;  3MEX A;  4Z2Y A;  4CYC A;  3Q0V A;  2ZBK A;  5ILS A;  1XMK A;  3RCO A;  3OS1 A;  3I58 A;  1QZE A;  3SJM A;  2VE9 A;  2DOD A;  3EYY A;  4L5I A;  4CCL A;  1ZK8 A;  2QSH X;  1HW1 A;  2CUZ A;  1WI3 A;  4WWC A;  2EQR A;  1XG1 A;  3KPH A;  3HG9 A;  1T8I A;  3KP2 A;  4OIN F;  2JRM A;  5HLT A;  3HHH A;  3GZ6 A;  3ABU A;  1ORK A;  2L02 A;  3LOC A;  1QZZ A;  3HXL A;  4ZYG A;  4KIG A;  5LD2 C;  4HNT A;  2FXA A;  4J00 A;  5A2Q K;  4L5E A;  3R0J A;  3LAJ A;  4XKV A;  1SVM A;  5EJC A;  3L2Q A;  1WWX A;  5HNH A;  3TGN A;  1VQ9 I;  4KMU X;  5J40 A;  4M6Y A;  1R5I D;  3ZMZ A;  1ITY A;  2HNH A;  4BQN A;  2XRN A;  3DEE A;  5DS9 A;  3FKI J;  1IRF A;  1VQ5 I;  2KMU A;  5DDG A;  2R7R A;  3DU6 A;  2JWT A;  4XL9 A;  3AG3 H;  3HBL A;  3V8L A;  4DQ2 A;  4QLC U;  1HA8 A;  1R1V A;  5GTH C;  1USS A;  2QLZ A;  5LGU A;  4ZDO A;  4I09 A;  5FRM A;  4K2E A;  3CC7 I;  1WH5 A;  1X2M A;  4HQE A;  2H8R A;  4A3E J;  2ZKZ A;  2VQL A;  1ON2 A;  2VKH A;  3ML6 A;  1D8K A;  3VYU B;  3HL2 A;  2KP6 A;  4LB5 A;  3HPG A;  1O7F A;  3QYE A;  1MMN A;  3GUD A;  1IN8 A;  3KP6 A;  3D5S C;  3FBI B;  1HOM A;  4AVZ A;  5IT9 K;  1GDT A;  2R5Y B;  1E17 A;  2VBZ A;  2W1O A;  1MSE C;  1RRJ A;  1JUP A;  2EA2 A;  3TDU C;  1I27 A;  4FE4 A;  1J59 A;  3J7A O;  1TBX A;  2DYS H;  5EG0 B;  3KEQ A;  3RKW A;  2GZW A;  2MD0 A;  2O8X A;  2QWW A;  2BW3 B;  4G9Y A;  1LUJ B;  5J1U A;  2BXY A;  2P8T A;  4HRI A;  2A61 A;  2KDO A;  2DW4 A;  2JSP A;  1E3H A;  2VAS A;  4A0X A;  1XCV A;  5IOZ A;  1ZR4 A;  1DPR A;  4D5C A;  3QYF A;  3A02 A;  3BZ6 A;  2DOA A;  3GZN B;  3PSF A;  1NH3 A;  3OYN A;  3EYI A;  1FSH A;  4M3E A;  4EJO A;  5EZH A;  4IOC F;  3VYR B;  2XAH A;  4V2F A;  3RPQ A;  2CH0 A;  3SZT A;  3KP7 A;  1LFU P;  2DN0 A;  4O3M A;  2R92 J;  5FKL A;  4A3D J;  3CJR B;  2IS2 A;  4L9J A;  2ZSH B;  1VQM I;  3C2G A;  2YPR A;  2VOD A;  4F52 A;  3I64 A;  2KKO A;  1HC8 A;  1X2N A;  3D5R C;  1RET A;  1EF4 A;  5FLV A;  4XLE A;  2EIK H;  3S1N J;  1S3J A;  4HDV A;  5DTD A;  2W82 A;  1N78 A;  2STT A;  1OIS A;  1LFP A;  3H9J A;  2OAZ A;  2XGC A;  4XRS A;  1VND A;  2JTV A;  2D5V A;  3JTH A;  5LLQ A;  2X6O A;  3GEZ A;  2G7U A;  3PJR A;  2IS6 A;  1GUU A;  2OC6 A;  3SXY A;  1YO5 C;  4OOI A;  1IW7 F;  5FKN A;  4EM0 B;  4MFE A;  3OR1 C;  2GXA A;  1QRY A;  2MG4 A;  3PO3 J;  3BR0 A;  3KP4 A;  3VYS B;  4DBR A;  3FXR A;  4II3 A;  4NC6 A;  2YR2 A;  5F04 A;  4FX0 A;  1V4R A;  2LF8 A;  1XGS A;  5B1B H;  1G8X A;  1M1E B;  1ETO A;  3RIR A;  1JT6 A;  1R49 A;  3G1O A;  2DMQ A;  3BJ6 A;  2WWY A;  3JRA A;  3CMA I;  3BT9 A;  5DUK A;  3GTJ J;  4RGX A;  2VE8 A;  5FFX A;  3U21 A;  1VFC A;  4BAC A;  4A3B J;  3GYH X;  3S3N A;  1FNN A;  3VSK A;  2KRH A;  2CV1 A;  1JI8 A;  3R61 A;  2HYG D;  2W25 A;  3ZPL A;  2Y31 A;  3SDG A;  1FT9 A;  1SMY F;  4FT8 A;  4M3D A;  3T5X A;  5D5W B;  1ZAR A;  1QPM A;  5EGO B;  1QGP A;  1ZG1 A;  2YSR A;  3HRS A;  3LSR A;  3LSM A;  4ESJ A;  2F4M B;  3K4C A;  1O7L A;  2HOT A;  2WBM A;  2L2O A;  4XKC A;  2LKS A;  2ESN A;  1P4W A;  3DBR B;  3G1M A;  3MZY A;  4ZC3 A;  4P96 A;  2FBI A;  1D3Y A;  3EUH A;  1FIP A;  2XV4 S;  5B66 C;  4BE1 A;  3TBI A;  5EEH A;  1LPQ A;  2F4O B;  2FNP A;  1BL0 A;  5CVI A;  1MNE A;  4HZF A;  4NC7 A;  2YU9 J;  5ICE A;  4EEF G;  5F0F A;  5DCM A;  1H88 C;  2B0L A;  1DU0 A;  2E1O A;  3P9C A;  2NXN B;  5FLM J;  3U9G A;  4RAZ A;  1FP2 A;  5BPI A;  1JJ8 C;  3DBL B;  2AXT C;  3VDX A;  4DZJ A;  2FOW A;  4E70 A;  3K70 D;  1X3Z B;  1QA6 A;  3FXM A;  1BC8 C;  3W2V A;  2DT6 A;  4FHT A;  1B8I B;  1JHF A;  1Z0X A;  2JJ7 A;  2V9P A;  3RQI A;  4ZJZ A;  2CSO A;  2ME6 A;  2DOE A;  1UEL B;  1GLN A;  2P5K A;  2YS9 A;  4GYI A;  3DLL F;  4HG2 A;  4JX4 A;  5M3F J;  3QRF F;  2HEO A;  1Z1D A;  4AC0 A;  2P7V B;  2B7E A;  2BVL A;  3LSH A;  3Q9V A;  3TOB A;  3M4O J;  2NVU B;  1U8R A;  2XAS A;  3BRO A;  5JHU A;  3J80 K;  2BBY A;  3BCB A;  2P4W A;  4BY1 J;  3RJP A;  2NVY J;  3QP6 A;  5D5X B;  1N77 A;  2BHZ A;  3IWZ A;  2K9Q A;  4YFX F;  3MAJ A;  3DEW A;  4A3K J;  4LIV A;  2K9L A;  1ETQ A;  1Z6T A;  1GV2 A;  3I3L A;  1BIA A;  5H6Q A;  3J81 Z;  3I55 I;  4CSW A;  3GLL A;  3DKW A;  4CCJ A;  1O3R A;  2H1K A;  1UAA A;  1K61 A;  2OD5 A;  3CO7 C;  2LG4 A;  3ZOB A;  3P9K A;  1OYI A;  3JRG A;  2K3F A;  3C7J A;  4BXU A;  3HOZ J;  1IRX A;  3BR2 A;  4KIB A;  4E6K G;  3BPX A;  2FEZ A;  1JJ6 C;  2WAE A;  2CQQ A;  1WJF A;  3SEQ A;  1OCO H;  5GPA A;  2OZU A;  3IL2 A;  1BC7 C;  5E1Z B;  4RB0 A;  4XN0 A;  1EH7 A;  4AIJ A;  3ASO H;  1S6L A;  1BJZ A;  4BHC A;  1FJL A;  3HTU A;  1TNS A;  2XPW A;  1SVO A;  3ESW B;  3FMQ A;  3NEU A;  4U7B A;  4HV6 A;  4BH9 A;  2DMU A;  4I6Z A;  1TLH B;  2E34 A;  2DAO A;  5J8F A;  3K1N A;  1TWA J;  4M72 A;  3G71 I;  4CHU A;  3ECO A;  1TW3 A;  3HGG A;  1ZG5 A;  4A3F J;  2ZJR F;  2FF4 A;  3H35 A;  1TW2 A;  4PJJ A;  3DPT A;  4XRS G;  1IZ1 A;  2CFX A;  2EZK A;  2HVR A;  1TQP A;  5HNF A;  4UV9 A;  3OSF A;  3KIO A;  5EZG A;  5HS9 A;  3TMO A;  2A6T A;  2CQN A;  4KIC A;  1DGW Y;  4CZZ A;  1K7A A;  1QHH D;  1XX5 A;  3BCA A;  3W6K B;  2HQA A;  1ETW A;  3OOP A;  3BR5 A;  5FKK A;  1I3A A;  4ZH4 F;  4L18 B;  1YS6 A;  2Y48 A;  2XHK A;  1Z05 A;  3QYB A;  3RTR A;  2F5C A;  4G12 A;  1WGX A;  4FAS D;  5JHF A;  3IRR A;  2LNB A;  4IEJ A;  3KYL A;  1Z7L A;  1P92 A;  4RLF A;  2JMW A;  4F93 B;  2QKM B;  5KAI C;  2OQR A;  3CCM I;  1IRG A;  2GBY A;  4LGW A;  4PUS A;  2QQB A;  2AQE A;  5E3N A;  5CKT A;  4BS9 A;  1T6S A;  4FIS A;  2P81 A;  1EV7 A;  3TL4 X;  2OCE A;  1W1W E;  4MLO A;  4MEY F;  4PJ0 C;  5LEK A;  2OBP A;  4JBA A;  3BQZ A;  1B59 A;  1X4O A;  4BDZ A;  2H27 A;  4ZTJ A;  4U0Y A;  5DM6 F;  2V1U A;  4XLF A;  3VEP A;  1IJW C;  2GM4 A;  1X1A A;  1N75 A;  1JTX A;  2LSO A;  2MA3 A;  2Y0S A;  1W36 C;  2JVG A;  3ZQI A;  2HZT A;  1WI9 A;  2DK5 A;  3H9Q A;  3PNY A;  3FHZ A;  2LKP A;  2FJ1 A;  2OA4 A;  3ZMU A;  4AID A;  2EJR A;  2QUF A;  2X51 A;  2M3A A;  3RKX A;  1K78 A;  1AA7 A;  2ESH A;  5BS6 A;  4FTH A;  1R1U A;  2HFH A;  3HOY J;  2A5W A;  3CCL I;  2GLO A;  4ZYA A;  4BQA A;  3C2H A;  2R0Q C;  2XF6 A;  3RZO J;  2QF7 A;  2Z5U A;  4A3G J;  1Z91 A;  4RB1 A;  2K7L A;  1FOW A;  3HOT A;  4HF0 A;  4NBQ A;  3IV5 A;  1LJ9 A;  2ZME B;  2MW8 A;  3FM3 A;  4MFD A;  2PMZ N;  4IKF A;  1TWH J;  2F5F A;  1REP C;  1WSU A;  4IQJ A;  4C3H J;  2R5Y A;  1UFM A;  4BAY A;  4BDY A;  1PUE E;  2EH3 A;  1PP7 U;  5DM7 F;  1J9I A;  3F8B A;  2OTL I;  2KHM A;  4M3G A;  5AIP A;  5EG0 A;  1FYL A;  2EV0 A;  1MIJ A;  1JGS A;  2UWM A;  4LOC A;  1Z21 A;  1NK3 P;  1PDN C;  5GP9 A;  1MBH A;  2BW3 A;  3TED A;  3EET A;  5F27 A;  3CP2 A;  4L9V A;  1ON1 A;  1APL C;  2F5D A;  3JTG A;  4M71 A;  5L3C A;  1Y0N A;  4A5N A;  5J8C A;  2STW A;  2DA2 A;  2Y9Z A;  1FZP B;  2RQP A;  1ZGW A;  5KVR A;  3FMR A;  5IYD J;  4CXF A;  4XNF A;  2DJN A;  2W57 A;  4RA2 A;  4I01 A;  2JT1 A;  2ECC A;  2M0M A;  3ZRG A;  2ELK A;  4HX8 A;  4G6D A;  3B73 A;  2DQL A;  1W5C C;  3BQY A;  1X3U A;  2VJ5 A;  3Q9S A;  2FA5 A;  4OIR F;  3SFI A;  4AUX A;  4LFU A;  4UB8 C;  2OTJ I;  5ERI A;  3NWS A;  4ZDL A;  4GCV A;  3HOS A;  3M1E A;  5EYR A;  2VLA A;  1TT0 A;  1J0R A;  5IP6 A;  2CV2 A;  4CUG A;  1OCR H;  2X4H A;  5E3M A;  2V26 A;  4HQM A;  1QPI A;  1WVR A;  3FXJ A;  3OV8 A;  3CF2 A;  1R6R A;  4LK0 F;  2HWV A;  2GIZ A;  2WV1 A;  5EDN A;  5L3E A;  1B6A A;  3HHG A;  4UNO A;  2H8W A;  1FYK A;  2QYO A;  4RLQ A;  2CQK A;  4Y52 J;  3LWF A;  2DU9 A;  3FX3 A;  2CW8 A;  3CUO A;  2M9H A;  3MMY B;  3Q0W A;  4YEJ A;  5BNG A;  4BBR J;  1CQT A;  2M1B A;  1G4D A;  2VKV A;  1T56 A;  2DJI A;  1MSF C;  4XON A;  4HPQ A;  3I53 A;  2XVC A;  2ICW G;  2E35 A;  3HOV J;  1V5G A;  4HNU A;  1UG0 A;  2M7A A;  4RB2 C;  1KA8 A;  4DOZ A;  4A5M A;  5DCM B;  5C44 J;  1JUS A;  1QVT A;  1TZL A;  3V7C A;  2W84 A;  1Y39 A;  1IUY A;  2O5R A;  3BJA A;  3JRE A;  4YG2 F;  1F9N A;  5DV5 A;  2PJP A;  3IHU A;  2A69 F;  5CLS A;  3VYT B;  2UUZ A;  4M9X A;  1MZB A;  1SFU A;  1IXS B;  1OQY A;  3K4N A;  3TO6 A;  1JUM A;  1F4K A;  2HI3 A;  2Z99 A;  3DQV C;  3TDZ C;  2FQ4 A;  5C3E J;  2E2H J;  2JZY A;  1IAW A;  5HVQ C;  1U8B A;  1LKX A;  2CQX A;  2M5W A;  4O6J A;  3S32 A;  1H89 C;  2AHQ A;  1WJ5 A;  3I71 A;  5EGO A;  3BR6 A;  5FRN A;  2O0Y A;  4ESB A;  3LNQ A;  2EZH A;  4P5O A;  2OPT A;  2F6C A;  2X6Y A;  4EJW A;  1LFB A;  5KNL A;  3ONQ A;  3T1B A;  1BN5 A;  4EGZ A;  2PMH A;  5E1W A;  3DTK A;  3I4M J;  1LVK A;  3K0L A;  3WTT C;  2F48 A;  2Z33 A;  5FO5 A;  1XGO A;  4ENN A;  3JW4 A;  2BYV E;  3BP8 A;  4EVI A;  3WG9 A;  3K4J A;  4ANJ A;  2LY9 A;  3CES A;  1R58 A;  3K6G A;  1OJL A;  2DPU A;  2LC2 A;  1J75 A;  3LSJ A;  3HIF A;  5JFR A;  2EFQ A;  2EZI A;  2FRH A;  2R7X A;  1BI3 A;  1XD7 A;  2KIM A;  2Q8K A;  1O3T A;  1BI0 A;  2IW5 A;  1ZQ3 P;  5GPC A;  2L7Z A;  2BHY A; 
#chains in the Genus database with same CATH homology
 2PFB A;  2XGX A;  1LDD A;  2XRO A;  2VXZ A;  4XRF A;  2EV5 A;  1KQ9 A;  3C1D A;  1FX7 A;  1EH8 A;  2UZK A;  2DFI A;  4L0Z B;  2QVO A;  2IVM A;  1QZY A;  1KGS A;  2K4J A;  4U0W A;  4KFC A;  1FBU A;  2G9W A;  1XSV A;  4NHJ A;  3V8K A;  2VBW A;  1SD7 A;  2EFP A;  5FLX K;  2FBH A;  2RVC A;  5CYV A;  5E18 F;  4DNC A;  3QAH A;  1DUX C;  3IRQ A;  5JR3 A;  2CO5 A;  4WCG A;  3ZMV A;  3EDP A;  1D8J A;  3ECH A;  1T39 A;  2HKO A;  1KYW A;  3V4G A;  4AVP A;  2ZNZ A;  1XSX A;  3R4K A;  5A2Q Z;  2E7W A;  2FU4 A;  4A6E A;  4QWQ A;  1YW9 A;  3FWE A;  1J2X A;  2Q2E A;  2ISZ A;  1U5T C;  2K4B A;  1HXD A;  4WX9 A;  2E1N A;  3RDI A;  1KQ8 A;  3ZMS A;  2VT2 A;  2FE3 A;  1SD4 A;  1K78 B;  4F7Z A;  4EM1 A;  5IT9 Z;  2J5O A;  1R22 A;  5L3F A;  2V6C A;  3GF2 A;  4G6Q A;  3ERE D;  1T0F A;  2DBB A;  1G3Y A;  4Q4Z F;  3GFM A;  3HSF A;  4KN7 X;  3F8C A;  2XKP A;  4HA8 A;  3GZ5 A;  3TQN A;  4IRG A;  5K5R A;  3KCC A;  2X0L A;  4G94 A;  2QZ8 A;  3BWG A;  2PEX A;  4FX4 A;  3WE3 A;  4A2U A;  4EQQ A;  1ZLJ A;  4XBF A;  3H3Z A;  1TQI A;  2HQN A;  5FB2 A;  4ZZD A;  4UUV A;  4MQV A;  1PP8 F;  4EGY A;  4M6X A;  1ZRE A;  3VOD A;  1ZAO A;  1O3Q A;  1LNW A;  1RUO A;  2VN2 A;  2ZME A;  3QU6 A;  4EMS A;  2ACJ A;  2DI3 A;  3O3K A;  4L9T A;  1W7P D;  4M9S A;  5KK1 A;  2NS0 A;  2BGC A;  3SFZ A;  1KQ0 A;  2P6S A;  3F8F A;  1JE8 A;  2Z9O A;  1FWZ A;  2MLG A;  1FP1 D;  2IRF G;  2H09 A;  1B4A A;  3GFI A;  2FSW A;  4HF1 A;  1T2K A;  2A3S A;  2EFN A;  3HRT A;  5BPD A;  2FQ3 A;  1W7P A;  2P6T A;  2RKH A;  3BDD A;  1F5T A;  5HOO A;  3CUQ A;  1ULY A;  1UST A;  3WGG A;  1XDS A;  1JXS A;  2IA1 A;  5L3D A;  1SFE A;  5K1Y A;  4UVB A;  2MH2 A;  4KN4 X;  4XLN F;  3WTU C;  5D4S A;  5CJ9 A;  3AAF A;  2XKO A;  3F8N A;  3LA7 A;  4UVA A;  3I54 A;  2PN6 A;  2XAQ A;  2FOK A;  4B8X A;  4IF4 A;  2COM A;  3LA2 A;  4IHT A;  1STZ A;  2TDX A;  3ISP A;  4HLY A;  1XB4 A;  5E8I A;  4A0Y A;  2NRA C;  4OIP F;  1HST A;  2D2W A;  4LJZ F;  1OR7 A;  3NQO A;  4U0V A;  4HBL A;  4I0B A;  2UXX A;  4XSZ F;  5HDG A;  4R1H A;  2HGC A;  1UHM A;  2HS5 A;  3F8M A;  1XCB A;  2FNA A;  2OZ6 A;  2CW0 F;  3K1M A;  4GGG A;  4I0A A;  3F23 A;  3K2Z A;  5IT3 A;  1SFX A;  3ULQ B;  3LST A;  2WC2 A;  2PG4 A;  3F72 A;  2L3D A;  2HOE A;  2VON A;  1LEA A;  3GXO A;  1MGT A;  2ISY A;  3V7S A;  1R5H A;  3WU1 B;  2A68 F;  3JSO A;  2A5Y B;  3HUG A;  3JAM K;  2L01 A;  2P5V A;  2RNJ A;  3FM5 A;  1R36 A;  1HW2 A;  4LLL A;  5E17 F;  4IRI A;  1F1Z A;  1IXC A;  3J81 K;  2D45 A;  2EA4 A;  1T98 A;  2DK8 A;  4IJA A;  5BMZ A;  1QQI A;  1S29 A;  1O3S A;  2KIF A;  1R00 A;  4RGR A;  3DV8 A;  1WQ2 A;  4YFK F;  2ZME C;  4B09 A;  1FPQ A;  1G6N A;  1OMI A;  2ZO4 A;  1R23 A;  3RYR A;  4OIO F;  2M87 A;  1H0M A;  2IA2 A;  1YS7 A;  3QPT A;  1IN4 A;  1ONV A;  2FBK A;  2V1D A;  3R6S A;  1QBJ A;  4EM2 A;  1MD0 A;  5D5U B;  3PQJ A;  5FFZ A;  4NB5 A;  1MDM A;  2O6G E;  2CYY A;  4OMY A;  3G73 A;  2KIU A;  5LHH A;  4LK1 F;  1MJB A;  5L3G A;  3DP7 A;  1XMA A;  1WKM A;  2D1H A;  1LB2 A;  1YTY A;  1ZHF A;  3F6V A;  1CF7 A;  3GX4 X;  1U78 A;  1W4M A;  5ICC A;  4U7D A;  4ZYE A;  1ZGA A;  2K27 A;  3DF8 A;  4KNY A;  3ABT A;  4HLX A;  4Y15 A;  2ZXJ A;  2A6H F;  1L3L A;  3T8T A;  3E6D A;  5HLI A;  1J7K A;  1UB9 A;  4Y13 A;  3REO A;  1W7P B;  5DYM A;  5LHI A;  3MWM A;  5HS8 A;  3CUQ B;  3KLN A;  4LB6 B;  3P9I A;  4MEX F;  4CDG A;  4HW0 A;  3IKT A;  1MKM A;  1UCR A;  4I02 A;  5ILV A;  2QEN A;  3WTZ A;  3RKY A;  1KYZ A;  3QU3 A;  2YU3 A;  4AWX B;  2V79 A;  2PQ8 A;  1HBX G;  1YG2 A;  3FZV A;  1K6O A;  5D6E A;  4D0P A;  4A0Z A;  2W85 A;  3R0A A;  5E20 A;  2A6E F;  3HSR A;  4S04 A;  3E6C C;  3BPV A;  2HTJ A;  3K1P A;  2HKX A;  1XSD A;  1H9G A;  1U2W A;  4KDP A;  4LG0 A;  4CYD A;  3FXQ A;  3CLO A;  3KLO A;  5LBQ A;  4LMY A;  4OIQ F;  4GYG A;  3TO7 A;  2CGP A;  1YFH A;  4RGS A;  2IA0 A;  1AWC A;  3M7G A;  1ZRF A;  2JSC A;  4MTE A;  3U2R A;  2ZNY A;  1GVJ A;  3O6B B;  2ZJ2 A;  2RGV A;  4RS8 A;  4PDK A;  1TNT A;  3LQQ A;  3R60 A;  3WTW C;  1B9N A;  1BOA A;  1HKT A;  3E5X A;  3GO5 A;  4HX4 A;  2OU2 A;  1ZLK A;  4A12 A;  3FF5 A;  2BV6 A;  1S7O A;  1P6R A;  3WGI A;  3MFK A;  1B1B A;  4WK8 F;  3NRV A;  1RZ4 A;  3CJN A;  2M45 A;  4CIC A;  1P4X A;  2DQR A;  1I1S A;  3I59 A;  2O3F A;  1OYY A;  4IRH A;  2EK5 A;  4MHG A;  2Y0M A;  3L7W A;  1FOK A;  2VT3 A;  1KU9 A;  5HDN A;  1KU3 A;  1CGP A;  4ENJ A;  2EFO A;  1YW7 A;  2UXN A;  4KYW A;  2QQA A;  1L0O C;  1DDN A;  5LHG A;  4EJU A;  1A04 A;  1S8N A;  1BI1 A;  2IJL A;  1I1G A;  3TKY A;  1SAX A;  1FC3 A;  5TRD A;  3CO6 C;  5CVJ A;  3ZMT A;  2P7C B;  3E6B A;  5AIQ A;  3L2C A;  1OPC A;  1FYM A;  2PI0 A;  4YII A;  4WXD A;  3T8R A;  2M30 A;  3I4P A;  4IHS A;  1RNL A;  1BBY A;  1R5G A;  5TJJ A;  3KET A;  5ILU A;  2ETH A;  1HKQ A;  4M74 A;  3KEO A;  4UXN A;  2MLK A;  3RPU A;  2QBY B;  1FBS A;  4GXO A;  4JQF A;  4HOB A;  3KP3 A;  1MDM B;  1LDK B;  1R1T A;  1E2X A;  4HAM A;  5E8G A;  4G8X A;  1IXR C;  3F22 A;  2RDP A;  2XIG A;  3SHF A;  2IPQ X;  4EJT A;  3ZN0 A;  2L4M A;  5AON A;  2VOP A;  4YFN F;  1CF7 B;  4NQW A;  1GXP A;  2W24 A;  1YYV A;  1MJA A;  3LFK A;  3RYP A;  3BJO A;  4RGU A;  3Q5F A;  4ESF A;  4N0B A;  2BEO A;  4L0Y B;  2AS5 F;  4RB3 C;  1ZH5 A;  4KMF A;  4ON0 A;  5K5O A;  2QQ9 A;  3IKV A;  4ENK A;  1KU7 A;  3I0T A;  6PAX A;  2YX7 A;  3E3V A;  3IC7 A;  1U5T B;  2M8E A;  3K69 A;  5F6F A;  5LGT A;  1TQM A;  1BJA A;  2NAZ A;  2RC4 A;  5E1X A;  4AIK A;  1MJ9 A;  5HDK A;  1Q1H A;  3LA3 A;  2Y75 A;  2PMU A;  4R79 A;  5FD5 A;  2FMY A;  4MNU A;  3RI4 A;  4ZYD A;  3HTS B;  1RUN A;  3F21 A;  1Z6R A;  2WTE A;  2E7X A;  2A07 F;  4BNC A;  2R3S A;  1SD5 A;  1ZRC A;  4IXA A;  2EB7 A;  5BQT A;  4P55 A;  1U3E M;  3BOQ A;  3GWZ A;  2G7H A;  1Z7U A;  2OQG A;  3FMS A;  2PBI A;  5DD8 A;  3WTX C;  1JHH A;  3KZY A;  3WGH A;  3VOE A;  1S7A A;  4S05 A;  2H94 A;  2QM3 A;  1YQA A;  3C18 A;  1Z9C A;  1FY7 A;  4HX7 A;  3HYI A;  4CO8 A;  1O57 A;  5DD4 A;  4LG0 B;  2NYX A;  3U1D A;  2E1C A;  1W5S A;  1LQ1 A;  5FGM A;  4L9N A;  2LDU A;  2ZFW A;  3C3W A;  1TTY A;  4ENM A;  1G3T A;  5CVU A;  3PQK A;  2EFW A;  2H6B A;  5F1R A;  1LEB A;  2JPC A;  2NNY A;  1B9M A;  2C6Y A;  4BHB A;  4PGG A;  1XDU A;  3QPH A;  4Y17 A;  2V9V A;  2DPD A;  5ICG A;  2ADU A;  2H6C A;  3J80 Z;  4JK1 X;  2GA2 A;  4HYE A;  1EH6 A;  4MGR A;  3G3Z A;  3PFI A;  4AIH A;  1YLF A;  5LRS A;  1XN7 A;  2VBX A;  2K86 A;  3SQN A;  3M8F A;  2YX4 A;  3I59 B;  5HS7 A;  2F2E A;  2R7F A;  4P9F A;  4TV7 A;  5F64 A;  1P4A A;  5BOX A;  1XGN A;  1LVA A;  2VC1 A;  5LGN A;  2MBF A;  4N9I A;  3JSP A;  4M73 A;  2VC0 A;  2J5P A;  4XLP F;  1ZYR F;  3ZMD A;  4OMZ A;  3JAM Z;  2DLL A;  4LLG F;  1C0W A;  2ELH A;  2IP2 A;  2EWN A;  1BIB A;  2AXL A;  4I2O A;  2RN7 A;  3VFZ A;  3L00 A;  1OKR A;  1P2F A;  5D4R A;  3DEU A;  4LLN A;  2LF7 A;  3WTV C;  2XAG A;  3S2W A;  5DCF A;  1IN7 A;  3B02 A;  4WXC A;  5D8L B;  1FBQ A;  1IF1 A;  2ZCW A;  3HRM A;  1G3S A;  2O03 A;  3LAP A;  1NHA A;  2XAJ A;  1ZN2 A;  3H92 A;  4BYY A;  4ZYH A;  2R7D A;  5CVR A;  2RV8 A;  4RAY A;  2GQQ A;  2GAU A;  4GO1 A;  5FD6 A;  4WF2 A;  5D8K B;  5H20 A;  2DT5 A;  1UHW A;  4M9Z A;  2MC3 A;  4P9U A;  2Z3Y A;  1D5V A;  1BI2 A;  4R8H A;  2Q0O A;  1HKS A;  5DEQ A;  1WRJ A;  1RI7 A;  1IN5 A;  3I5U A;  4G7Z F;  1DP7 P;  3W6J B;  5HLH A;  4G7O F;  5K5Q A;  3V8J A;  2GXG A;  4KA4 A;  2QBY A;  3L9F A;  1DPU A;  3T0Y A;  4WXH A;  4PGH A;  4Q48 A;  4HV5 A;  4MTD A;  3VB2 A;  2HDC A;  3DFG A;  3ELK A;  5LRR A;  3HSE A;  1W5T A;  1V3F A;  4UHT A;  3N97 A;  1KU2 A;  1R7J A;  3CUQ C;  3ROU A;  3IWF A;  1YW8 A;  5ED4 A;  5L3B A;  3N4M A;  4H0E A;  2XUB A;  4ETS A;  1AOY A;  3EQL F;  5J6X A;  2NNN A;  2O61 A;  3E5Q A;  4HF2 A;  3FXU A;  3D0S A;  2HYF A;  2CWE A;  3TOA A;  3E97 A;  5ICF A;  2HTS A;  1T38 A;  1H9T A;  4ZZL A;  5D5V B;  1U5T A;  4ASN A;  1IN6 A;  4LD5 A;  4OU0 A;  1G3W A;  5LEJ A;  3GLX A;  2P5L C;  5H6R A;  3BY6 A;  4PZJ A;  2D1V A;  3MCZ A;  3GFJ A;  3LQR A;  4EV0 A;  1J5Y A;  2XAF A;  3DPL C;  1U6G A;  3ZP5 A;  2K02 A;  3F6O A;  4CGZ A;  3KFW X;  3CTA A;  2CG4 A;  4IPA A;  5EEG A;  1LDJ A;  4AD9 A;  2JRT A;  4MQ9 F;  3V7R A;  1ZG3 A;  1HSJ A;  3M9A A;  4UV8 A;  4O5V A;  1FLI A;  3MZH A;  1BM9 A;  1HQC A;  2HR3 A;  4Q5S F;  2KJC A;  3E6M A;  3P7N A;  4G7H F;  1GHC A;  1I6X A;  4YIF A;  3COA C;  3D5L A;  3MQ0 A;  1RIO H;  4PCQ A;  2GA1 A;  2FML A;  2DTR A;  4KIF A;  2KJB A;  3E5U A;  5D6F A;  1Y0U A;  1ODD A;  2KRF A;  2MD5 A;  4HDU A;  1QNT A;  3DXJ F;  1XGM A;  1VTN C;  4I98 B;  2WV0 A;  5JI6 A;  3M8E A;  3L09 A;  3KP5 A;  1GXQ A;  3K9T A;  3H3U A;  4Q47 A;  4N9H A;  4IVN A;  2GIV A;  1FSE A;  4I7H A;  3SZP A;  1K79 A;  3WU0 A;  2VOO A;  3O2P E;  2VBY A;  3CDH A;  1YIO A;  2L4A A;  1I5Z A;  2HQR A;  1QO0 D;  3GVA A;  3QOP A;  1SMT A;  5FLX Z;  3HRU A;  3KZZ A;  2DO7 A;  2IT0 A;  1HW5 A;  3WTY C;  3WTS C;  2EV6 A;  2L54 A;  3GFL A;  4L5J A;  3QP5 A;  4UVC A;  2JPB A;  5DUI A;  3WOD F;  3ZQ7 A;  4KUM A;  1SD6 A;  1OYW A;  4A6D A;  2PLY A;  5JVT A;  4EJV A;  4XSX F;  5CVV A;  3GW2 A;  2F5E A;  2GWR A;  2GXB A;  3TO9 A;  4BHP A;  1ZGJ A;  4KT5 C;  3KE2 A;  2MH9 A;  4U88 A;  3F3X A;  2V1X A;  3WE2 A;  2BE5 F;  5HLG A;  3ZN1 A;  1ZRD A;  3MEX A;  4Z2Y A;  2ZBK A;  5ILS A;  1XMK A;  3I58 A;  2VE9 A;  3EYY A;  4L5I A;  1HW1 A;  4WWC A;  3KP2 A;  4OIN F;  3HHH A;  3GZ6 A;  3ABU A;  2L02 A;  1QZZ A;  4ZYG A;  4KIG A;  2FXA A;  5A2Q K;  3R0J A;  3LAJ A;  1WWX A;  3TGN A;  4KMU X;  4M6Y A;  3ZMZ A;  2XRN A;  1IRF A;  5DDG A;  3V8L A;  4DQ2 A;  4QLC U;  1R1V A;  1USS A;  2QLZ A;  5LGU A;  4I09 A;  4K2E A;  4HQE A;  2ZKZ A;  1ON2 A;  3ML6 A;  1D8K A;  4LB5 A;  1O7F A;  3GUD A;  1IN8 A;  3KP6 A;  5IT9 K;  1E17 A;  2VBZ A;  2EA2 A;  3TDU C;  1I27 A;  1J59 A;  3J7A O;  1TBX A;  3KEQ A;  3RKW A;  2GZW A;  2O8X A;  2QWW A;  4G9Y A;  2P8T A;  2A61 A;  2DW4 A;  4A0X A;  1XCV A;  1DPR A;  3BZ6 A;  3EYI A;  1FSH A;  4EJO A;  2XAH A;  3RPQ A;  3SZT A;  3KP7 A;  4O3M A;  4L9J A;  2YPR A;  2VOD A;  3I64 A;  2KKO A;  1S3J A;  4HDV A;  2STT A;  2OAZ A;  2JTV A;  3JTH A;  5LLQ A;  3GEZ A;  2G7U A;  3SXY A;  1YO5 C;  4OOI A;  1IW7 F;  4EM0 B;  3KP4 A;  3FXR A;  2YR2 A;  4FX0 A;  1V4R A;  2LF8 A;  1XGS A;  3RIR A;  3BJ6 A;  2WWY A;  5DUK A;  4RGX A;  2VE8 A;  5FFX A;  3GYH X;  1FNN A;  3R61 A;  2HYG D;  2W25 A;  3ZPL A;  1FT9 A;  1SMY F;  4FT8 A;  3T5X A;  5D5W B;  1ZAR A;  1QPM A;  1QGP A;  1ZG1 A;  2YSR A;  3HRS A;  4ESJ A;  1O7L A;  2ESN A;  1P4W A;  3MZY A;  4P96 A;  2FBI A;  1D3Y A;  3EUH A;  2XV4 S;  5EEH A;  2FNP A;  5CVI A;  4HZF A;  5ICE A;  5DCM A;  2B0L A;  3P9C A;  3U9G A;  4RAZ A;  1FP2 A;  5BPI A;  4E70 A;  1BC8 C;  4FHT A;  1JHF A;  2CSO A;  4GYI A;  3QRF F;  2P5K A;  2HEO A;  1Z1D A;  2P7V B;  3TOB A;  3Q9V A;  1U8R A;  2XAS A;  3BRO A;  5JHU A;  3J80 K;  2BBY A;  2P4W A;  3RJP A;  3QP6 A;  5D5X B;  3IWZ A;  4YFX F;  3MAJ A;  1Z6T A;  1BIA A;  5H6Q A;  3J81 Z;  3DKW A;  1O3R A;  2OD5 A;  3CO7 C;  3P9K A;  1OYI A;  3C7J A;  4BXU A;  4KIB A;  2FEZ A;  3BPX A;  2OZU A;  3IL2 A;  1BC7 C;  5E1Z B;  4RB0 A;  1EH7 A;  4AIJ A;  1S6L A;  4BHC A;  3HTU A;  1TNS A;  3NEU A;  3FMQ A;  4U7B A;  4HV6 A;  4BH9 A;  1TLH B;  2DAO A;  5J8F A;  3K1N A;  4M72 A;  4CHU A;  3ECO A;  1TW3 A;  1ZG5 A;  2FF4 A;  1TW2 A;  3DPT A;  1IZ1 A;  2CFX A;  1TQP A;  4UV9 A;  5HS9 A;  4KIC A;  4CZZ A;  1K7A A;  3W6K B;  3OOP A;  4ZH4 F;  4L18 B;  1YS6 A;  2Y48 A;  2XHK A;  1Z05 A;  3RTR A;  2F5C A;  3IRR A;  2LNB A;  1P92 A;  2OQR A;  1IRG A;  4LGW A;  2QQB A;  1T6S A;  1EV7 A;  4MEY F;  5LEK A;  2OBP A;  4JBA A;  1B59 A;  2H27 A;  4U0Y A;  2V1U A;  3VEP A;  2LSO A;  2MA3 A;  2HZT A;  1WI9 A;  2DK5 A;  3FHZ A;  2LKP A;  2OA4 A;  3ZMU A;  2EJR A;  2QUF A;  3RKX A;  1K78 A;  2ESH A;  5BS6 A;  1R1U A;  2HFH A;  4BQA A;  2Z5U A;  1Z91 A;  4RB1 A;  2K7L A;  3HOT A;  4HF0 A;  1LJ9 A;  2ZME B;  3FM3 A;  2F5F A;  1REP C;  1WSU A;  1UFM A;  4BAY A;  1PUE E;  1PP7 U;  1J9I A;  3F8B A;  5AIP A;  1FYL A;  2EV0 A;  2UWM A;  1JGS A;  1PDN C;  3EET A;  4L9V A;  1ON1 A;  2F5D A;  3JTG A;  4M71 A;  5L3C A;  4A5N A;  5J8C A;  2STW A;  1FZP B;  2RQP A;  5KVR A;  3FMR A;  4CXF A;  2W57 A;  4I01 A;  2JT1 A;  4HX8 A;  4G6D A;  3B73 A;  2DQL A;  1X3U A;  3Q9S A;  4OIR F;  2FA5 A;  4LFU A;  5ERI A;  4GCV A;  3HOS A;  3M1E A;  1J0R A;  2X4H A;  4HQM A;  3OV8 A;  4LK0 F;  2HWV A;  5L3E A;  1B6A A;  3HHG A;  4UNO A;  1FYK A;  2QYO A;  2CQK A;  3LWF A;  2DU9 A;  3FX3 A;  3CUO A;  2M1B A;  1G4D A;  3I53 A;  2XVC A;  4RB2 C;  1KA8 A;  4A5M A;  5DCM B;  3V7C A;  2W84 A;  1IUY A;  3BJA A;  4YG2 F;  1F9N A;  5DV5 A;  2PJP A;  3IHU A;  2A69 F;  5CLS A;  4M9X A;  1MZB A;  1SFU A;  1IXS B;  3TO6 A;  1F4K A;  2Z99 A;  3DQV C;  3TDZ C;  2JZY A;  1IAW A;  5HVQ C;  2M5W A;  4O6J A;  3I71 A;  2O0Y A;  4ESB A;  4P5O A;  4EJW A;  3T1B A;  1BN5 A;  4EGZ A;  2PMH A;  5E1W A;  3K0L A;  3WTT C;  2Z33 A;  5FO5 A;  1XGO A;  4ENN A;  3JW4 A;  2BYV E;  3BP8 A;  4EVI A;  3WG9 A;  2DPU A;  1R58 A;  1J75 A;  3HIF A;  5JFR A;  2EFQ A;  2FRH A;  1BI3 A;  1XD7 A;  2KIM A;  2Q8K A;  1O3T A;  1BI0 A;  2IW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...