1W7WA

Structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
AELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNSEKWIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mutational Analysis of a Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification of Residues Involved in Serine Phosphorylation and Oligomerisation
pubmed doi rcsb
source organism Pisum sativum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1w7wA00
3PRVA 1B4SA 1EHWA 3JS9A 1ZS6A 2DXFA 4WBFA 5IOLA 3FBCA 4DUTA 1HIYA 5CABA 4O0NA 4ENOA 3EVMA 4UOGA 3ZTQA 3EE3A 1NPKA 4FKYA 2HURA 4ANEA 4S0MA 3VGUA 3R9LA 4ANCA 3VVTA 4F4AA 2B8QA 2BX6A 3FBFA 5BXIA 3Q8UA 3NGUA 1MN7A 1LEOA 1S59A 2B8PA 4CP5A 2AZ1A 2HVEA 1BUXA 1F6TA 4HR2A 3WX8A 3FCVA 1B99A 1PAEX 1NDLA 4ANDA 4KPCA 4C6AA 1NLKL 1KDNA 3VGTA 2ZUAA 1XQIA 3B54A 3BH6B 1WKKA 3Q8YA 4DI6A 1VYAA 3L7UA 2DXEA 5CAAA 2DXDA 2NCKL 1NSQA 3DDIA 3NGRA 3FBEA 3ZTRA 1NDCA 3VGVA 1XIQA 1W7WA 3EJMA 3Q83A 3BH7B 1S5ZA 3FC9A 3MPDA 3FBBA 1JXVA 1F3FA 1NB2A 1HLWA 1U8WA 3BBFA 1S57A 3Q8VA 3FCWA 1NSKL 3ELHA 3ZTSA 1LWXA 3DKDA 1HHQA 3ZTPA 1UCNA 1MN9A 3BBCA 4FKXA 3EICA 3EVOA 3NGSA 1PKUA 2HVDA 1NCLA 2VU5A 1BE4A 2BEFA 3GPAA 1K44A 1NSPA 3NGTA 3EMTA 3ETMA 1NUEA 3ENAA 3VVUA 3VGSA 1BHNA 3ZTOA 2CWKA 3FKBA 3EVWA 3PJ9A 3BBBA 1WKJA 2DY9A 4EK2A 4DZ6A 1WKLA 1NDKA 3EM1A 4UOFA 3GP9A 4W98A 3G2XA 2AZ3A 3B6BA 1NHKL 4UOHA 5C7PA 3Q89A 3Q86A 4F36A 2DYAA 1NDPA
chains in the Genus database with same CATH superfamily
4LJMA 4USIA 5BR8F 4P72A 2Z58B 1EHWA 3R27A 3S01A 5KG6A 2UU9J 1QSLA 3DOMA 4WE1A 1JLGA 2HQDA 2LQ5A 2ZEJA 2R7XA 2RKIA 4C8ZA 4OZ0A 2GMLA 2LYVA 2MZQA 2QYCA 2VC0A 4V1Ak 4YB6A 5CQGA 4ZPAA 3J80Y 4FS1A 2VF3A 3SSRA 5I3QA 3SDEB 5DLFA 5CXTA 2J0SD 2G2YA 2JLEA 2M88A 3NXZA 2V8VA 3ADAC 3KHHA 1N52B 2KI2A 4ANEA 3Q2TC 2HW3A 3NAIA 4G65A 3MMBB 1S7HA 1BGXT 4DU7A 3VAIA 3IGNA 1P6TA 2NXNA 4NLQA 3DLKA 1U0HB 4PXCA 1PC4A 1B0PA 5M2UA 1RZMA 1Y00A 3QAEA 3ZNUA 3P4UB 1HW8A 3BSAA 3HJVA 1ZZNA 3OTEA 5H9EK 4USUA 2ADCA 2E5JA 1VK3A 4M5IA 3MEKA 1R0BG 4WYLA 1ZM3A 1Q7LB 1S59A 4OX6A 4DL7A 3W3SA 3T9ZA 5F8JA 1SC4B 3FSYA 4ERDA 2QT7A 5DQGA 4KO0B 1TV6A 2Z4PA 3QPIA 4DX5A 1FKAF 2E44A 1X4EA 2DHSA 1EP4A 2IRXA 1FHTA 2YQ0A 1ZAXA 2ACYA 1SQEA 2YKAA 3I0SB 1BWEA 2PGCA 2FQQB 2BKPA 2E5IA 3PHEA 2R42A 2GFFA 4XPCA 1HYSB 1FX2A 3KUEA 4RBVA 1HNXJ 5LSLA 1EIYB 2Q3PA 3TRGA 2RU3A 2FGOA 1VBXA 1RGVA 2AYEA 3PKYA 3BH6B 2GVZB 1QM9A 2GMHA 3ENVA 2WVCA 4EU0A 4X4TA 1NKCA 3J7Z5 1Q95G 5EDWA 3J81Y 2DNGA 4K8RA 3S7RA 2HHWA 1RUSA 3LP1A 3C15A 3DDIA 3ZZUA 2QV6A 1NDCA 1HMVB 3ZZYA 2U2FA 3TARA 1S5ZA 4K0KF 1X4AA 1XBWA 4GMKA 2AJ0A 2MY7A 4PPZA 4CLPA 1QAIA 1ZPVA 4C4WA 4KGXB 4DQRA 2RNEA 2LXUA 2OEKA 3I0RA 1AUSL 1JJCB 4U6PA 2RHSB 3TA1A 4B3MF 2CPEA 1SJQA 2KB2A 3OR2B 4KE5A 2F4VJ 4QCLA 1GXLA 3D28A 5J1EA 1TMJA 2D7SA 2QSWA 3DKDA 4LRBA 5HMYA 4I6YA 4QW9A 2JHEA 2COLA 3M2VA 4DCOB 1B0TA 3FQKA 2PFDA 4O4GA 3KHRA 3H2LA 1PYSB 2BQRA 2FB0A 3BN4A 1U6BA 2KFNA 3SCJE 3UD4P 4ZPCA 3OUYA 3QIPB 1IXKA 4JI4J 1S48A 1KRPA 2MZSA 5E3PA 4ZVQB 2BRKA 4NWBA 4CYUB 2D3OR 1UWAA 1TFWA 5CA5A 3QBCA 3I32A 2FHKA 4PQAA 1D9AA 3EZ5A 2HHQA 2EBGA 2HS3A 3KMSA 2GA7A 2ILYA 4MJKA 5IFMA 4M95A 4J90A 2AIRB 3G82B 3MUMP 2FLPA 3FZBA 1R3NA 1P9YA 2J6UA 2GGPB 3DXBA 4Y2MA 3MEGA 1S9EA 1KEKA 4LFCJ 1CS4A 3K5LA 2ZOMA 3M05A 1OYDA 1WUUA 4G1PA 1FXRA 1HI1A 4ECQA 3TYTA 2ASDA 1JLGB 1VLOA 4NLOA 3PG9A 2W4CA 2RKIB 3ZZOA 1SV5B 3I87A 3GFHA 4P52A 5I3UB 2IC3B 3M32B 4A8YA 3MECB 2AJ1A 3RAXA 4Y00A 3Q86A 3N9UC 2J6SA 2B3TB 4CNZA 4Y65A 3PO5A 3A8JA 3CCLS 1IBMF 2J0XA 1EX8A 4FPRA 1ZS6A 3NMAA 3K5MA 2BJ9A 4PWWA 3W62A 2XHWA 4NL5A 1T05A 5CCMA 2J6TA 1FD8A 5K5MA 2F7VA 5AXMA 1XNRF 2OKQA 3D2WA 4NCAA 7FDRA 4L72B 2JWNA 4PZVA 4TU8A 4CTAA 2XLIA 1RBOB 1YG0A 4RX6A 4UOGA 1ZZFA 2KDOA 2Z2ZA 2OEMA 2MSTA 3OQ2A 2HQGA 5JMNA 3DM2B 1Y11A 3M6VA 1CJUA 4NLSA 4S0MA 3IMQJ 4JUZA 3SFUA 2EC0A 3HX9A 4D3HA 1U25A 1FDNA 2VUGA 4ANCA 4AXIA 2QRRA 3IR5B 4DDFA 2XCPA 4BCAA 1TV6B 1NHUA 1J2VA 4CLYA 3CJSA 2AJQA 4LQ3A 3RB3A 1KOHA 2C3PA 3FBFA 3ENQA 4ATNA 1IKXA 1RSCA 5L1JA 3I0SA 1KTQA 1CJKA 3CJTA 4Q7AA 5A8WB 3UPFA 2F63A 2C3MA 2B8PA 2PN6A 3J7ZT 4KT0C 4ZPDA 4DN9A 3OVAA 4DV2J 1XNQF 1S0VA 2HNZB 4DSJA 2EC2A 2IAJA 3WX8A 2KT5A 4OZ5A 3H98A 2CQPA 1R0AB 4J37A 1VCTA 4ED4A 5AXKA 4A8MP 4X4VA 2GNKA 3VV2B 4DV5F 4PG6A 5ETQA 1BC6A 1SI9A 3DU6A 1U2FA 4BWJA 3CJ4A 3T9NA 3C15B 3CCRS 5JVGQ 4C48A 4OHYA 1SVDA 4AL6A 1SJFA 3HM9A 3FQLA 2IM1A 1GH8A 1CVJA 1NKBA 5KT5A 2X1FA 1SKUB 3OLBA 2LXIA 2DEJA 2G0JA 4KAIA 2DT9A 4NCBA 2OPSA 2XO6A 1K0VA 1IBKF 5IT9U 3CJ2A 5AE1A 2AP6A 4LT6A 1M5SA 1WTBA 4I2PA 1SXLA 2Z8QA 3GG0A 3UFCX 3IBFB 1XIQA 3GJTB 2GJ2A 2GIRA 4HDGA 1FK9B 1H72C 3A8IA 3Q83A 4TY8B 4W4MA 2AW0A 3C6UB 5DRKA 2H4YB 4DL0C 3V6DB 1SKWA 4B3SJ 5G0RA 4ZIVA 3HSGA 2CXEA 1GTEA 1MMLA 2LQ8A 2F9DA 2QC3A 3LQVA 3LGNA 4DR5J 3DLHA 1LFWA 1OO0B 4KQZA 4ELTA 3CCQS 2R8KA 2H5JB 4LSZB 4LSNB 3J81U 4X4SA 3FMBA 3G82A 3L7OA 3POTB 1KKHA 1UEUA 4FKXA 3HHLA 1RAGB 4HEA9 4IOAQ 2GGPA 2ZWPA 5KFVA 1RTIA 2CPXA 2MGZA 4NI2A 5GVQA 3M7VA 1BE4A 1VGYA 2OPPA 1ZOTA 3GPAA 4ZHRA 4J9SA 4B9LA 4ZDNA 2CJAA 1G7CB 1NSPA 3GJSB 3MPWA 4CWBA 1Q53A 3VF0B 1K9MT 2E9RX 3D66A 1VRTA 1K1SA 5HVFA 3UN3A 3HSJA 1Y5NB 1DARA 2RDJA 5HANA 2C28A 1KVIA 3V2UC 4N56A 5HLFA 2IC3A 3B4DA 3H4BA 2EK1A 3QGPA 5CZVA 1NKEA 1N5YA 3FJ2A 1XR6A 3VZHA 2BR0A 5KT7A 2XS5A 2L9WA 3BYPA 5I42B 3MR2A 1RK8A 3H5SA 1T9XA 1S79A 1OQ6A 8ATCB 3DGVA 2CZ4A 1N4LA 5FLXY 4UOFA 4B9NA 2IDLA 4EZ6A 2N82B 1ZAVA 3B6BA 3DOLB 1F9EB 4NMXA 4EI2A 1FKPB 2MHNA 2RVJA 2YNFA 3KLFA 2K7KA 4CLKA 1XR5A 2HFUA 2BQ3A 2QLFB 1J27A 4ZK7M 1B4SA 4Y3CA 1WORA 3VHQA 5B0DA 1RT4A 3MAQA 1CJUB 2CRLA 4P75A 3D0HE 2X3GA 5DO2A 1HQEA 4WBFA 1N34F 1RHQB 3EUNA 3MEEB 1Y0HA 2FZKB 3FBCA 5L39A 4FYWB 4P2SA 1UWBA 1VQ7S 3CIZA 4AE5A 3GSIA 4LF8J 2CJ9A 3RBEA 3IG1A 4WP9A 4FS2A 2LLZA 1IKXB 1SL1A 1FEEA 2RJZA 1NPKA 5ETOA 4DF8A 2ZC4A 1RT2A 3C3LA 5H9FK 4DOZA 2YWKA 3NOCA 4QZVB 3DOMB 3QGGA 5FDLA 4DPTA 2IPOB 2W2MP 4J9NA 1YKWA 3AQPA 3L9ZA 4C2MA 3KHLA 2E7WA 2ADBA 2DITA 4TU7A 1A7GE 2WZ1A 1L3SA 5LXYA 3MAHA 3KLGB 3IS9B 3G71S 1UEKA 2VASA 4B17A 4B9SA 4A46A 3KLVA 2U1AA 4GO7X 3V81B 2IRYA 3AB4B 4PRFA 1CC7A 3GIJA 2J9DA 1JQGA 2ZD1A 4P2MA 5DQIA 2KXHA 5AXNA 4DS5A 2XSJB 3C16A 3I4PA 4ZCKA 3UVJB 5A2QY 4ZLPA 3OHBA 1Q86T 1YJWS 2XC9A 1ZETA 4CZCA 3U27A 4N8NA 2G0CA 3HHEA 3M8ZA 3FSIA 3TZZA 5A2QU 3G8SA 2DCLA 3U1NA 4GC6A 4ECTA 4WFNQ 4DQQA 2ASJA 1DJ0A 1YVFA 1NZ8A 3GV5B 4DFKA 1NBEB 4CO3A 3JSMB 3HSDA 4C98A 4N77A 2DRDA 2GW8A 3H90A 2BE7D 2ZUAA 1FK9A 1X5TA 3H2UB 4G1IA 4KR0B 3V6DA 1Q81T 1P1LA 1SQFA 4IO1A 1SIZA 4KO0A 4L76A 4OIXA 4QR2A 4A48A 3A12A 4U7UK 4CM2A 4ELVA 1LWFB 2AF6A 1S9GA 4TLRA 1VQOS 3VWSA 1NPRA 3E3XA 3ICLA 2RRNA 3K58A 1NNDA 1N8RT 3C19A 2DNKA 2QFIA 2WONA 1HNWF 4PWDA 4YOEA 2WSFC 3G87A 4ZN1A 2QYGA 3RAQA 4D3GA 1OIAA 3M2UA 4QIVA 1VI7A 4QWEA 4UT4A 1S1WB 2V63A 4HHJA 3LP0B 3BBFA 2L41A 3VAMA 3W65A 2C2ZB 1M90T 2HK3A 2WBRA 4P2XA 1EB0A 4B9TA 3SCKE 4MAKA 5BYSA 4C3LA 4ETXA 4YHHJ 2R8JA 3GYNA 4DR4J 5IV4A 3R5DA 3KLEA 2LKZA 5FLXU 4DR3J 4IRDA 3IAM9 4F0MA 1ULRA 1V5IB 2ZWOA 4PUOA 4DR7F 3BYRA 4ECZA 3V5RA 3BQ0A 5I42A 4F0HA 1K1QA 3OR2A 2DNRA 5ETTA 1FRMA 1NM2A 4I2QB 2MKYA 2UUCF 5B08A 4PR6A 2OMOA 5D0EA 3SSQA 2H54B 1RTJB 1F1BB 3H25A 4ZP6A 3T19A 4BHQA 4RW9A 3EVWA 1H2UX 4KGMA 4DSLA 1HWLA 4X2BA 5C24B 4IFYA 1RWVB 4NLYA 4ES2A 2IHR1 4IRKA 2HHVA 2KFZA 4JI3F 4CRJA 2RE1A 4P10A 4EK2A 2O67A 3JTOA 4P9SA 4KGVB 4KH0B 1VQ8S 2V9WA 1GTHA 3TUPA 1T9TA 4WZQA 4DR3F 5D6GA 4IOCQ 1PJ5A 4JV5F 5L1LA 3N6NA 1URRA 5KFJA 3BEGB 1WSRA 5E0OA 4M1KA 1CLFA 4B9UA 2MQOA 3MM9A 3DLGA 3OTBA 3ETOA 4DPOA 4JI2J 1S1XA 1TL5A 4H4MA 3HLUA 2DH8A 4J7CA 3CXCR 1WHXA 3TEGA 4O3PA 1HD1A 3AQOA 4MYTA 4WJBA 4DBQA 3EGWB 3I5CA 3SYZA 3RTVA 5I3UA 3M32A 3W9JA 3CCES 2XMJA 2G2OA 5H1SV 2IA6A 1VHFA 4MKAA 5E3QA 4K4WA 1XR7A 2XMVA 1RT5B 4FXDA 3BV8A 5CYJA 2E5LJ 1R7IA 3AAWB 3KG1A 3ZZZA 1Y3JA 5HMWA 2F65A 4CH1A 2G2ZA 1RT6B 1ZBTA 3VQSA 4MKVA 4AUKA 1JLQA 3SQOP 1SKRA 2N4DA 5EX3A 2PFFB 2HBYB 3O8WA 2CJYB 3KNGA 2XQCA 3VAKA 5KFPA 4M5NA 1N32J 1I94F 3I56S 1FXDA 1PILA 2QL7B 3RBZA 3ISZA 2C3OA 3BO4A 3W7BA 4A47A 3JTNA 1X4DA 2CA9A 2BJEA 4XAKA 4ZVEA 3VTIA 5K20B 2HVHA 3ENWA 4CO5A 5HVHA 5LXRA 4LF5J 4LF7J 4JI8J 4FYVB 4RW6A 1KHWA 3O1LA 1G3OA 4CQ1A 4PPDA 2C2RA 2VKRA 2UUBJ 2LEBA 3UW1A 3M9MB 3EPGA 5IWAF 1CJKB 3A3PB 4L3NA 3S1TA 2VG6A 3MR6A 4YN3B 4TXSA 1FJCA 2L08A 2QJ3A 3P8BB 4OYWA 2HNZA 2CZ9A 2XWXA 5L38A 5DDOC 2ZH7A 4KB7A 5DDQC 2ZBPA 1G2EA 4IRCA 2EG1A 2GQCA 4BC9A 3CJKA 1VYAA 2EFQA 4YR0A 2A6MA 1WWHA 2VB6A 3D5MA 1APSA 2L3MA 3BKUA 3ISNC 4XDCA 1FNMA 2NSBA 7AT1B 4URGA 4CLUA 4KSEB 3WIVA 2EW9A 2V8DA 3J7AN 4PQUB 2B4UA 3FC9A 2PSZA 4QIFA 3JXOA 1C4CA 1JXVA 4ZVPB 4FXWA 4Y2KA 2VZ9A 5C5JA 2CQCA 4YMEA 3V6KA 3NMRA 1BXNA 3DXSX 1S57A 2VFVA 2V0NA 4TKTA 3BDEA 1O8BA 2CVIA 5K14A 1U0SA 4Z7YA 3RAMA 3KK3B 4DQSA 1SUQB 3DDNA 3DYAB 2RAQA 1TKXB 2CJQA 5GAHI 4ZVSB 4AD6A 2Z30B 4F3QA 2V50A 4HT7A 2UV8G 4TY8A 1N5VA 3E01A 3C6UA 4N5SA 3V4IA 1RTJA 3G6YA 4N41A 1U2RA 4OYIA 4OYMA 1LWCA 2BMBA 1N88A 2MSSA 1KLNA 3DLBA 1FI4A 1GFWB 5C24A 4RR5A 2AX0A 3GTYX 1RBLA 1LWEB 4DEZA 3H42A 2MQ8A 3K8VA 4PAAA 1XJWB 4RUBA 5KFQA 3CJRA 1RTDB 3MD1A 1X0PA 3ETMA 4J9QA 1KD1T 1NUEA 3ZZRA 3VVUA 5KFKA 3NY0A 2AYMA 2XTJP 4MIAA 3FKBA 3HHLB 4R0EA 5E5NA 1RTIB 1BLUA 1SCJB 2XMWA 3LP2A 2XM3A 2OAUA 2GIFA 4DV0J 3IRXB 2CQBA 4KPYA 4C11B 5A8KA 2FZCB 1NMEB 1SC6A 2F9JA 4OHWA 5D0RA 2ZNZA 5HL7Q 4I69A 1KBRA 4U96A 3TZWA 5DGAA 5HJXA 3W2WB 1MU2B 2OPRB 5K9FA 1IBKJ 2ATLA 1UVLA 4DR4F 2C2KB 4B3OA 1X4GA 1Q0NA 1YWXA 1YJRA 1H6KX 1HQUB 4DLEA 3NNCA 2H51B 3MMAA 3NRBA 4K4YA 1HBUA 3E2EA 1N5TA 1M5VC 1RT5A 3JS9A 1LKZA 2XMMA 3FZ2A 2ZH2A 4E0DA 2NZ4A 1AXQA 3HVAA 1IBCB 4C8MA 2C2DA 2WVBA 4V19X 1UKUA 3RW7A 1TR0A 3J81j 1OYEA 2QLWA 2KG1A 3M9OB 3EDRB 3PO4A 1S97A 2H48B 3DHXA 4ETZA 5IV3A 3G9CA 4L75A 2XBPA 3WDOA 1WEZA 4I6AA 2FGCA 2W9BB 2AGQA 4QWAA 3T1YJ 2YKNA 3EDQB 1RISA 1NH7A 1RT4B 4WKYA 2YKQA 5HMZA 4MIWA 3EYZA 3HO1A 4K4XA 1FRHA 8AT1B 1P27B 2IM0A 4R5PB 4K4VA 4NLTA 1R6VA 4RUAA 3IM9A 4ZOSA 4A8OA 1JK9B 5KFFA 3KYLA 2DRAA 3QRPA 5DQHA 4JV5J 2AV5A 4H4OA 3T1HJ 4ECXA 3FCHA 1CJTB 3DLEA 2GX8A 4O23A 4LIWA 5FDLB 3OXGA 4P7VA 4IR1A 2AKWB 2JRSA 3W2VA 5J2MA 3HZGA 2ZVIA 5FIIA 3QFHA 1WC0A 4QYRA 3KLGA 2FJBB 4ECWA 1LNQA 2R7WA 2EK6A 3CJKB 4YDXA 2ZH1A 3QZ8A 2RRBA 1S0OA 1BQMB 2PI5A 1KWMA 2GJFA 5A8RA 3S6EA 2N7CA 1WDTA 2ZM6J 3MUVP 2AMCB 4NRUA 3NBPA 4IG3B 3LWLA 4DN0A 1F0XA 2QIFA 4ILMA 2QMUB 4IO9Q 4WKRA 5B09A 3Q24A 1YDLA 4DPXA 4HYKA 3I5AA 4H4KC 2N3LA 3RBXA 1VJWA 2Y1IA 5HVGA 1SL2A 2NYHA 3SCLE 4DFJA 4IH6A 2QX0A 3CCTA 1PAUB 2B9XA 2F3JA 3A8EA 5F8MA 4DLGA 4GO5X 3SXLA 2FUG9 3Q8PB 2QMWA 2AEJA 1W7WA 1WACA 3EJMA 2UP1A 1N32F 2KHCA 3JAMY 3BH7B 3MPDA 1RWUA 2XLKA 4AXJA 2YX4A 4LVOP 1PBAA 1FFSB 2Y8YA 2HWIA 4F02A 1LW0A 3R7BB 1S9GB 3N0VA 4EO6A 3JAMU 4L6V3 2GO8A 1JXEA 4I64A 5KFLA 3FCWA 2G1DA 4ZCMA 1S1VB 2VC1A 1VK8A 1HNWJ 1B7YB 3N6LA 3C46A 4NYPA 3PYDA 4FF1A 2ZDPA 4DV2F 1L3UA 3QLHA 2JSXA 3K89A 1H2TZ 1PJ7A 4DX8H 3B82A 3BKFA 3QT6A 3OL6A 3EICA 4M5HA 1HBNB 3M6WA 1S1UB 1WHWA 3QIDA 4P73A 3QMQA 2E66A 2M2BA 2DIVA 1S6PA 2HLTA 1FTCA 2LQBA 2VU5A 3JSRA 3LP2B 3V6JA 3CB4A 1KC8T 1KONA 3IRXA 3H5UA 1GXUA 3GLJA 5D0GA 2B51A 2I38A 4UOCA 3UWTA 4DX6A 4ZVGA 2C2MB 2K3IA 3QYYA 2CJXB 3OT9A 4FNIA 4CH0S 4UQTA 1TQLA 2E7VA 4USMA 5J1PA 1HARA 3B4MA 2H1YA 4DV1J 3FEYB 2F1FA 3D6MB 3CW2C 2HVIA 1NHVA 4EYHB 2JX2A 1RDRA 4F8RA 1X9SA 5F8GA 4XIUA 3M8PB 3HSZA 3IP0A 4I2QA 3VAFA 4NOHA 2KXFA 1WEYA 3CO0P 5CZXA 3MUTP 3KJVB 2KH9A 4LF2A 2FZGB 5KFBA 4O3OA 1CBKA 4NLPA 4DSFA 4K2XA 1MWQA 1X5SA 4N8OA 4DV5J 4UUWA 2VQFJ 4YB1P 5ETRA 4LR9A 2YBVA 2DYAA 1NDPA 1TUWA 2HGLA 5KFRA 1Q8IA 2M52A 3JSBA 2VJUA 1VC6A 3QJJA 3CCSS 4DG1A 2PC6A 1WG5A 3C6TB 4X4PA 3ZZ0A 4JOUA 3UD3P 4HI1A 1EZZB 1K73T 5CYQB 4ID5A 4YEAA 5IOLA 1RAIB 4OJGA 3TQEA 4DUYF 2KM8B 3PYFA 3ZC4A 2HSEB 2RSQA 4N7TA 1S6OA 3EE3A 2ZZNA 1BY9A 8RUCA 4F4XA 4LRDA 3VGUA 2DPIA 4NMLA 3SSSA 5KFEA 4WE1B 4KHPJ 1RT3B 3ET6A 1JLBA 3A4TA 2GVDA 3MM7B 4EYIB 4DQPA 3G8QA 2JDJA 5J2PB 4U7UD 2GHVC 1OY9A 5AE3A 4DFPA 4DMZA 2ERRA 1QVGR 4DV4J 1N6QA 2MKKA 1BQMA 2A18A 2DY1A 1MN7A 1NXIA 1AROP 2YNIA 2B6AA 3CDBA 5A8RB 5HN0A 5DG8A 2HMIA 1TL1A 2OFHX 5F0WA 1R31A 2Y1LB 2DGQA 2A2DA 2CQGA 1M5PC 1U0HA 3KKFA 3I31A 4JBCA 1NK7A 4WXOA 1C0TB 2V5HG 2HQFA 4P2FA 4YB5A 3IA0A 4K59A 4YUDA 2VPXB 2AYBA 4KPCA 5H9FJ 3OJUA 2DGWA 5KT6A 2KVIA 1RBAA 1GQEA 4KC5A 4C6AA 3A1YG 4E2FB 5K8MA 3CCUS 2R7QA 1TL4A 2MQQA 1WOSA 1WSVA 2YVSA 4DPWA 5K8OA 1WG1A 4K0KJ 3R2CJ 2B7CB 4MKBA 4NLXA 4E98A 1R0CB 3B8HA 3TAQA 2DXEA 1NJXA 1YJVA 6FD1A 1VQ6S 1XMQJ 4F2RA 1Q78A 4XDDA 2GV1A 2WHOA 2VG6B 3P49B 2VPYB 4FF2A 1GT8A 1HNXF 4ITSA 4K4SA 4ZVRB 5A76A 3GWCA 4LQ9A 4IQXA 3KLIB 1K47A 1F3FA 3Q8RB 2QLXA 5E41A 3AA8A 3D7SB 4WP3A 4ZN3A 4LFAF 1W2IA 1R6YA 3TP2A 2I8EA 2V69A 2L48A 5HSPA 3B78A 2HWTA 1TL7B 3RB4A 1IUJA 3EWGA 1U1QA 4YB7A 3CDEA 4RU2A 4O44A 5IT9Y 3PR5B 4PQUA 5ETLA 3L3CA 3K5OA 1VQKS 1IBMJ 1FCAA 1HQ2A 2QMXA 2XWYA 1PKUA 4FYXB 4QIGA 1L3TA 1J5OB 4Q0BA 5D8HB 2ZJQQ 1OSCA 4C3MA 4C8NA 4K7QA 3GV8B 2DNPA 4ZMMA 3OXFA 5J1EB 2AGPA 2PMHA 2C2EA 2HBZB 4OI3A 2QGFB 3FEXB 5GMKa 4RNNA 4J9RA 3VGSA 1BHNA 5GAHU 1ZA1B 2AHOB 4JI4F 1VQPS 1LWCB 3VQTA 4F2SA 2D3ZA 3UDLA 3MOJB 2OFGX 3NEKA 1LWEA 2N4CA 5ITHA 3AJ2A 4WXWA 2M3DA 1NDKA 3PW2A 1B7FA 3GFXA 3CDUA 1B70B 2AZ3A 4DL6A 5KFIA 4UF4A 1V6HA 4WFYA 4PG8A 3E8OA 1RACB 1KFDA 3ZNJ1 2YPZA 1FVQA 4RJVA 5D15A 5C7PA 1UVNA 3AJ1A 1SC1B 3M8WA 1S6QA 5DDRC 4ED8A 3QSYB 2IBKA 2XZWA 4IR9A 3D1OA 5DM6Q 2DNLA 1VQSA 3F56A 3OHAA 2HBRB 4PEOA 2CPJA 3AY0A 5KG2A 4M5KA 2ZH9A 1TFYA 1UVJA 2KN4A 4EUVA 2VG5A 2BDPA 4DR6J 4CT9A 1YZ6A 3BDPA 4NASA 9RUBA 3MECA 1JKHA 1VRUA 4RW8B 3W66A 1U1RA 2OUGA 3NCQA 3TVYA 2W9CA 1TKDA 2IBOA 2BJ1A 5CHCB 2YNIB 2UXBJ 3TI0A 2QA1A 1NK8A 4F26A 3R9LA 1HI8A 4WTYA 2P2CB 1IKYB 1L3KA 2BM0A 2IRUA 3NWRA 3CSKA 4F4AA 4HKQA 3BPSP 4NLDA 1Z2LA 3M6UA 3KDNA 2NREA 3QJPA 1V3RA 4C8YA 1SC3B 1TZ0A 2P5VA 2IVMA 3AT1B 3O6QA 3DOKA 4HTJA 1IKVA 5HQ8A 1YGYA 1UA1A 5F8LA 3DM2A 4C8OA 3GCXP 5MLCV 5SZTA 2L9NA 4J9LA 1HI0P 3BO3A 2HHXA 4ECVA 1LFPA 2HGNA 2W7OA 4NXMF 4R5PA 3PR4A 4Z2XA 2ZKTA 3RRHA 3KXDA 4NLGA 4KV8B 3WIUA 1BMQB 4CLSA 3HVTA 4ANDA 4F4ZA 3I4HX 4MK9A 1AW0A 2CG4A 5BR8J 4IFVB 2BE2A 3DMJA 4P71A 5A8WA 1XNQJ 3H7HB 1T9UA 1MROB 3I96A 2BV3A 4NZ7A 4KIAA 1XQIA 1Z2ZA 3D67A 3NS7B 5J2MB 3KNAA 2DTJA 2PD1A 1ZPWX 2M7SA 2RUGA 2V8GA 2RRAA 1FRLA 1HL6A 1OY8A 2EEYA 2XY7A 4X4UA 4TU9A 3T1AA 2B4VA 2NCKL 3TO8A 4OI1A 1QTMA 4DX7A 1YIJS 2NYIA 3QGHA 2XMUA 2QLJB 4FN5A 1OJ4A 4J9UE 3THPA 1KTVA 3IO1A 3HKZD 3KJNB 1SJ4P 2DO4A 3HJFA 2CPYA 3LANA 5KT4A 4FYYB 1HLWA 4A8XA 3TAPA 2FJXA 4G3IA 4Q0BB 3M8YA 1J5OA 4OL8A 1UL3A 3KWMA 1N54B 1EKRA 2C2OB 5LT5A 1U09A 3GIMA 4J9KA 2LQ9A 2CNOB 1LXNA 3QQCD 2WAQD 2YH0A 2F40A 3CDWA 4CM0A 2R2TA 4JYAJ 1JIHA 5IQ6A 4FNHA 1C2PA 4UUXA 2KT2A 3HHNB 2RQKA 2CNNB 3EX7B 2UXCJ 2BM1A 3THTA 1AB8A 2D9OA 1S1VA 2OO4A 4MH8A 2RS2A 4QWCA 4BDPA 4AL5A 2NZCA 3KFWX 2IIHA 2MKSA 2YKOA 4URQU 2I6WA 4LBPA 3OPKA 2ROGA 4J91A 1JLEA 2CPIA 4JI7F 2B43A 2BZ2A 2Q1LA 4Q43A 2HQIA 2ZH6A 1JB0C 4MK8A 4NE9C 4WFXA 2V8HA 2ZHAA 2GAGC 1KLMA 1D8YA 4NI2B 2R7RA 1V3ZA 1UP1A 2HFVA 4NLVA 1RHKB 2OPPB 3BBBA 3JQMA 2O01C 1WKJA 1FDBA 1REGX 4OYPA 3VZIA 3DCAA 3T5HA 1JLCB 5A0YA 3HFVA 4CLWA 5KFWA 1VRTB 3KK1A 4TLQA 5KFNA 3MPUB 3BGUA 1RTHA 2EBEA 4ZPWR 2OP5A 5CD4H 2FJWA 3OR1A 2ZITA 4LF4J 5GADI 2FLOA 1C1CB 3FFIB 1XMOJ 4F0KA 4HACA 2RQCA 1QVFR 2DXFA 1IM6A 3OFEA 2NUUG 2HFOA 2UZAA 2Y0SD 2NXJA 3CCJS 3BSOA 4BLGA 4DUTA 2E5HA 2ZC3A 4RLEA 2LA4A 2YH1A 4ELUA 4UTGA 2DNYA 4KKOB 2KRBA 5L46A 4A8QA 3QO9A 5KFCA 2K3KA 3DRXA 3O5TB 2CG8A 2EPIA 2W24A 2XZTB 2XMTA 2XB2D 2CPZA 3MZIA 1ZTTA 2ZUGA 1HWIA 4O3QA 3H0PA 2OGUA 1WC6A 2VG7A 5B0EA 4Z7CA 1LW2B 3J7YU 2AU0A 1HQEB 2A3JA 2HS0A 3MEEA 3M8QA 3AD7C 1DLOA 3FK4A 2PE8A 4LREA 3PDNA 1KQGB 1UWBB 1OSDA 3IWNC 4X84A 2EFPA 1U1OA 5KFDA 3EGNA 2H9ZA 3KG4A 2BX6A 2R2UA 4M5JA 1RAHB 2WVEA 2DEIA 3AOCA 4DV3J 3AOAA 2XO7A 3DGPA 4OZ3A 2BE2B 3DMJB 2DJWA 2JFDA 1I51B 2VOOA 2AZ1A 3CTRA 3M30A 2HVEA 4FPIA 2E9TA 2X3DA 1F6TA 3QGIA 1HNIA 3CF5Q 4C8KA 3K5PA 2DNHA 1N48A 5F3TA 3L7PA 1W26A 3IS9A 2HGMA 4G1QA 2ZH8A 1BQNA 1NK0A 2RIJA 3T6BA 4ZPVR 4DZDA 1KQSR 1WELA 2D3UA 4MT1A 1OQ3A 2ZD1B 2HMIB 1NLKL 2CDQA 1KDNA 5KG4A 2MJUA 3SFGA 2HHTA 4KFBA 2B4PA 3T41A 3SI8A 3W1YC 3H59A 4QIEA 1ELOA 1N33F 1UJ5A 3U1LA 3ITHB 2ZNYA 5B0CA 1GMWA 2KL8A 2GQQA 4K2JA 4Z37A 1QLNA 2LCWA 4W92B 4X64F 1Z1ZA 1H7XA 4OZLA 5L9NA 1RADB 3G86A 1NSQA 2IMWP 2ZHBA 5LMUF 2Q6BA 4OJHA 3FBEA 1T9VA 3T6JA 2HWHA 3T5LA 1Q5VA 3FRZA 4QYZJ 4JI0F 3CGIA 2M4MA 2WB1D 3NG8A 4HHUA 2ASYA 5C42B 5ETMA 1JJ2R 4PG5A 1LQ9A 1REVB 1S49A 1U8WA 4ES3A 2ZVSA 3D3BJ 4TY9A 2QA4G 4MFBB 3QRQA 1DURA 3W9HA 1FERA 1RWPB 1U4BA 3ISND 2MKJA 3C14B 3ILIA 4LRCA 1NSKL 2A0FB 1IKWA 3LF0A 2OPQB 4RW4B 1N33J 3G96A 2ZH4A 3PW5A 4PWDB 1VRQC 1XC9A 2NSCA 2DNZA 2FD2A 3HD1A 2V6AA 3N5BA 3KLIA 3D0GE 1AT1B 2VFRA 1YJTA 3CE8A 1YRUA 3MTJA 2NR0A 1EQMA 5T14A 1CC8A 1S12A 4DV6J 4LFBF 4DV0F 4NRTA 2Z57B 1KQKA 2KJWA 2GHWA 5A6PA 2HAIA 2MLYA 4WIQA 2ZBRA 1JXLA 5EWGA 2XSFA 3BGOP 3AB2B 3QT8A 4GVBB 3RGIA 4I7FB 2VA2A 2RILA 4UY8T 2BANA 1FKOA 1Q8KA 1S7IA 3KK1B 1RABB 3MCOA 1H74A 2CPFA 4JB8B 1RQ0A 4OZJA 4X66F 3TQ1A 1GAOA 5IC6B 3X1LB 1JLFA 2JL9A 3IAS9 2MKCA 3M2RA 2F4FA 4NA2A 4UW2A 2DR9A 4PUOB 2OSQA 3OR1B 3UDCA 5D3GA 4ZVFA 2CADA 4E8UA 1IQTA 4JI1J 3GR1A 1IQZA 1MWZA 2B4OA 2UUCJ 4OX9F 3HZEA 2AGOA 5KFUA 3ONQA 4CO1A 4DWIA 2B9YA 1GK8A 3I9V9 4AT1B 4EMDA 2C42A 4ED6A 3Q89A 4K5RA 3QRRA 4F36A 2PIIA 2CFXA 4OZ2A 3W5ZA 2R8HA 1IBLF 3PRVA 4Y6IA 2H5IB 4DCJB 4XK8C 2KXNB 4GKKJ 3TANA 3AXMA 3HVWA 4X65F 2MQLA 2B56A 2J7UA 3IR7B 3CT9A 4OX7A 5IM0A 2M8DB 4ECYA 4LVNP 2C3UA 2AJFE 3KLHA 2CYYA 3DLKB 3RJMB 5KG7A 2K1RB 4QU6A 1UVMA 3PIOQ 4O0NA 2ZJRQ 1XMBA 3DLJA 2DISA 3GR0A 5HO4A 1H7WA 2Q79A 1UTAA 1R8PA 1U1NA 3MM9B 3DGPB 4OYXA 4CNYA 3DLGB 1X7VA 3CJ5A 1BQXA 1S1XB 5DGBA 1TAQA 3GCWP 2PA8D 3FSXA 1RA7A 1YRTA 1Q8LA 2V68A 2BOAA 3M30B 3KMQA 1IN0A 4WFAQ 1U45A 4DR6F 2IJFA 4OZNA 3D3CJ 2AQ4A 1HPZA 1J5EF 4DSIA 2WW4A 4NEZA 5CH7B 1GMWD 4DXLA 3SDEA 1TKTB 3N4WA 1UA0A 5GMDA 3N28A 1NAQA 1WF2A 2QL9B 9ATCB 1FDDA 4TYAA 2YWFA 2ZBQA 3CJ0A 3MCNA 4DL2A 2DR7A 4AQYF 4DR2J 2FVQA 1GXTA 3QSIA 2UXDF 1HYSA 1BUXA 3F44A 4U9RA 1QDUB 2ZDOA 5D4LA 1IKYA 3GYGA 2J8SA 2DGSA 3ITHA 3HULA 3S8SA 3KK2B 1B99A 2W4PA 4OQJA 4YQWA 1RT1B 4PXDA 5AE2A 2MQPA 2HAFA 3V4IB 4WIIA 4RW7B 4CT8A 5C25A 1CPZA 2VQEJ 3LP1B 4I1TA 1NB7A 2P6TA 1YJUA 1FRJA 1WEXA 3UN2A 2JEGA 1UZHA 1U1PA 4Q44A 2PEBA 4F3OA 4JI5J 4P7TA 1YBUA 2VH7A 3B54A 2JEJA 5L1KA 4C0OC 4ED0A 2W25A 4HDHA 4KV8A 1F5CA 2BJ7A 3HVTB 2UXDJ 3KUHA 4OYOA 2W4DA 2CKWA 5C25B 4FP9A 3NGRA 3K57A 3OLAA 3VGVA 4DPYA 2HYIB 1KS2A 5KT3A 3R5BA 3M2VB 3NLCA 1G6BA 3D6FB 5CYMB 5DLGA 1N36F 2YWHA 1NB2A 3DDKA 2VV5A 2YWEA 5B0BA 3QIPA 4X4RA 3OUYB 4EWTA 1U1KA 1NK4A 2R4FA 4A8SA 1T8EA 3CJQA 2GO9A 1P8GA 3GZ7A 3HMJG 3LTOA 3JQKA 3K0JA 1HMVA 1HBMA 3GSDA 4C3KA 2BUNA 5I3PA 2HNDB 3GJQB 1YRXA 5U47A 2LEPA 5B7WA 5DZ7A 4R8UB 4P6QA 4YY3F 2G9OA 1XWLA 2J5AA 2HHPA 4PG7A 1TP7A 2B5JA 1RB0A 4KYZA 5D3GB 3GU0A 2DNNA 3OW2R 3NS5A 2R7SA 4A4JA 1T95A 2MYFA 2MXYA 1SUQA 2FHMA 2XLJA 1X31C 4JI7J 2FY1A 3UDVA 4FZVA 4KHPF 3GYXB 1SIWB 1RWMB 4RZRA 1H38A 2W2PP 5KFYA 1AA1B 2CQ0A 4O4GB 1X0FA 1NSAA 2JC0A 3P96A 2BJ3A 3CJ3A 1N5SA 1WF1A 1NK9A 3CD7A 5KFTA 4JI0J 5K8PA 4TQRA 4V19J 2GMJA 1ZA2B 4K4UA 1D0EA 1WI6A 2WSCC 1QAJA 2HG4A 4FF3A 1WKLA 2FIUA 1OY6A 3CJ8A 1T94A 4B3RJ 4OLPA 5DJBA 4B3MJ 2OTLS 4W90B 4DV3F 4EFAC 2UXBF 1JLEB 2R3VA 2F5GA 4MMOA 1EETB 5HQMA 2KM8C 2APOA 4KJIA 1FXLA 1F2HA 3HHLC 5KG5A 2IJRA 1RHRB 1FO1A 4J9OA 1RHMB 1S9FA 1P9QC 1S9EB 3I82A 2V2VA 5EWFA 5EHHA 4I4BA 3RB6A 1UJ6A 3R6GB 5M2RA 1HHTP 5E33A 3NCRA 1HR0F 3GFZA 2JJ4D 1WOPA 1UW4A 1V9OA 1PJ6A 3RZAA 4USTA 3W2WA 1RTHB 3BO2A 3HHKA 3D1HA 2R8IA 5AJ3F 5JUMA 4AFFA 4ENOA 1XMQF 1FJEB 5GAEU 3A3NB 4DFMA 3CWJA 1VBKA 3AJDA 4FKYA 1JWWA 2XS7A 3BN7A 2MZTA 3CD0A 1H98A 3MURP 2XYPB 5JJBA 5DZ6A 3FRYA 1ACMB 3O2IA 3MWBA 1SPBP 2IAJB 4QU7A 1RWXB 1DTTA 3SV3A 1T05B 1W25A 1T7PA 3JTPA 3LOUA 3UQSA 3VR1A 4F4KA 2XCAA 5HAOA 3CEDA 4KKOA 3KK2A 2ALYB 3A3OB 3QO9B 3GV7B 2AD9A 2DHHA 1RKJA 1RAJA 2BRLA 2E1AA 2MY8A 2IM2A 3KUGA 1BWVA 1VOMA 2J9DE 3GMGA 3Q8UA 4G6VB 2OMLA 2NPFA 5B0FA 2RQMA 3MI7X 4ZITA 1SKSA 1TK0A 2KKHA 4WZMA 2RF2A 3MM8B 2UVUA 4BWMA 2PO4A 2BABA 2NLWA 4OI4A 3LW5C 4ECSA 2ZE2B 4Y2CA 5IXUA 1TUVA 3QAUA 3RBDA 2JVOA 1U6ZA 2Z2LA 3O3LA 1JMTA 4TYBA 3Q8SB 3H40A 4ECRA 1HNZF 3MMJA 1KSPA 1IR0A 1RLCL 1SQGA 2EXUA 3HFZB 2R7UA 2FJDB 2XYGB 3CCWA 2BKNA 3D4JA 2F8HA 3QFWA 1T9WA 2A10A 4FXVA 4RL1A 2IVFB 1TKZA 2FDNA 3BGFA 3WC0A 1R0AA 2GC8A 2VDHA 3TW0A 4NXNJ 2EG2A 2E1RA 2OHDA 3GIKA 1NU4A 3WX4A 3OTOF 3N6MA 1TTHB 3CMES 2BACA 4OI0A 3TX8A 3SV4A 2D74B 4OHXA 2XI2A 4KFBB 1X4HA 1XN9A 1CJVA 3TUJC 4RUCA 1IJEB 3RR8A 1FWKA 3PXGa 4I56A 2HNDA 1NK5A 1HNZJ 2Y9HA 2OPSB 3QNWB 1O6XA 1PBUA 1E6VB 2M5YA 1DQ8A 3PACA 1MWYA 3OL7A 1BD6A 1FT8A 5D77A 2UU9F 2HS4A 1LK5A 1D1UA 2WB4A 3ELHA 2HPUA 4DCPB 1RYSA 2EFVA 4WCEQ 1LK7A 1H3DA 2CVEA 3U7JA 3OTOJ 1X8DA 5C42A 3J7A1 1AFJA 2XHCA 4Q5VA 2M9KA 1NCLA 2BYCA 3L09A 2FPHX 4DV1F 3TJAA 4HHHA 3WHIA 4ICLA 1S77D 1N34J 3CC2S 3JYTB 3OVBA 4C7QA 1N5QA 2DGOA 2YNGA 3FDSA 2MLZA 5IWAJ 1YTYA 2X1GA 4LSNA 2QL5B 3QLHB 3Q22A 2NPIA 3DOLA 4KY3A 1FJGJ 4NEYA 1L3VA 3TJ8A 4JV1A 5D78A 2WVDA 2B9WA 3CMQA 1B64A 2ABYA 1EKSA 1QE1A 2GCFA 4EBEA 3IR6B 3RU0A 2YWWA 4C0BA 4F67A 3GP9A 5KT2A 3MM5A 3A13A 4C0HA 2JLFA 4DV4F 5F0UA 3KJQB 2V9KA 4ZVTB 5F8NA 2CWXA 3ZZTA 1Q82T 3FEZA 3MPVA 1T3OA 4DR2F 1TELA 1N5YB 3BSCA 4DUYJ 4O3SA 4TN2A 2QO3A 1PG5B 4BBYA 2VJVA 3UO0A 3W5XA 1VQ9S 4OX9J 1CULA 4OI6A 3W8PA 2X51A 3MMCA 1VFJA 4QR1A 4ZIWA 5KOWA 2DHGA 4WFZA 1FKPA 2VPWB 2YNFB 2IVYA 1IWAA 1HW9A 2ZOGA 1HKAA 1NZAA 3BR9A 4AYBD 3KLFB 4HVZA 4X4QA 1VC0A 1Q1KA 3R5GA 4ZCLA 1ICEB 2H5EA 3M9NB 4TNOA 4CO4A 4X65J 2FVCA 4DSKA 4DV7J 2IYGA 2XSJA 3C16B 1VR6A 3MM8A 5IM0B 5KFMA 1R8BA 4U8VA 3N01A 4OHZA 4QPXA 1VQLS 4NZ6A 2ZE2A 2E1CA 2HFZA 4LF8F 2KYZA 1OPZA 4CO2A 2ZZTA 4Q2LA 3Q0AA 4IG0B 2YKMA 3HHLD 3IG1B 3HDSA 4IDKA 4ZS6A 3IWXA 2Y1JA 3NGUA 5IQQA 3JSMA 3UNGC 2BOPA 4NLWA 2IMOA 3MR5A 1FFGB 3OFGA 4P74A 4OZ1A 2YTCA 2PMZD 1WHVA 3K17A 3PYGA 4MYUA 3TOQA 4ZJQA 2ALZA 4IQMA 2OIHA 4B9MA 1CQNA 1HPZB 1PIEA 2C3YA 2V4JB 4URSA 5KFAA 1U48A 3DI6A 1SH0A 3D6HB 4DR1F 1SL0A 2Q66A 2FVPA 4HL9A 4IH5A 2NQPA 2DNOA 3HFKA 4F4WA 4A8WA 1VQNS 4Y34A 3MD3A 1MW7A 4K5SA 5BJRA 2B6AB 2VBXA 2UVRA 3JSYA 2WONB 2VODA 4ILRA 1RHUB 3W5YA 1KVJA 2MTLA 2GIQA 3HPOA 5F8IA 4EBDA 3M2UB 1NK6A 1U02A 3RW6A 4B3TJ 2M8HA 3IBCB 1RYRA 1S1WA 3LPEA 4QBUA 4YS2A 1XNRJ 3SMZA 1RT1A 4RW7A 1S0MA 1QUPA 3IBWA 2WOMA 4IKAA 5KFSA 4EGLA 3MEDB 4LFBJ 3W8GA 4M5MA 3MFIA 3BKTA 4DUZJ 3LGHA 3GE9A 1S4FA 2LFVA 4B08A 4K50A 2VONA 3FBBA 3H20A 3TVZA 3BQ1A 4DF4A 2IY5B 4ZHRB 1T9YA 1VIOA 4ZLLA 5E7OB 5C2CA 2CQHA 2I0XA 3JYTA 2YNGB 3M1VA 3ZTSA 4LF9J 1RHJB 1VJQA 4QIWD 3TVKA 3KHGA 2WTFA 1D9DA 1C0UA 2CPDA 4DU8A 4JI1F 5C2GA 2X7IA 5T7LA 2RUSA 2JH3A 3R1LA 4RW9B 2UVWA 3NGSA 5LMUJ 2W2NP 3PJWA 3R8YA 2W7PA 2DKOB 1QE1B 3OFHA 1HR0J 1DQAA 2JVRA 4NLRA 5AT1B 4I0WA 4JI6F 2DR5A 3MTKA 2AWZA 2DBBA 2W7AA 4U8YA 2O3DA 2HZVA 2E9ZA 4O3RA 3LO3A 2R7TA 1VQ4S 2W1BA 3KLEB 1AYEA 1D8ZA 2DVIA 1JLAA 1U24A 1FD2A 2P9GA 2FLNA 1R8HA 3CPWR 3F41A 2P8IA 4TVAB 2R9LA 3EM1A 3MMCB 3AD8C 1YZ7A 3AOBA 1X9WA 2DHXA 2AJ2A 1UPPA 4BS2A 4USKA 2XZDB 1J5EJ 3OBIA 2V2KA 4NYZA 1DY3A 3PW0A 2GJIA 2DGXA 2WBMA 3PRBA 3HT0A 3RG6A 3HD2A 4DR7J 2WW8A 3MMBA 2CZVC 1Q7YT 1RT6A 1X4FA 5IC4B 3DU5A 4OJ1A 3MR3A 4MKYA 2FJAB 3W63A 1EETA 4LIRA 4ER8A 2O1PA 1IR1A 5EN1A 2MZJA 1QAYA 2CNLB 4LRFA 4IDKB 4IG0A 4RKUC 3TWZA 2HIYA 4Y0FA 4ID8A 1HA1A 3ZTQA 3T5KA 2F8EX 1Y4ZB 1Z4UA 5EWEA 2PT0A 1CQMA 1S0NA 2JEIA 4WWSA 1VS3A 1HHSA 4HT5A 3R2DJ 3D68A 4ZJLA 3VVTA 2VQEF 2YY3A 2AT1B 2ZBIA 1IBLJ 1WI8A 2VG5B 4LF6F 2MZRA 4BC7A 4ZVOB 4ZLNA 4EEYA 1S76D 3DI6B 3QATA 4LMZA 4RW8A 4ED7A 2KT3A 1ZH5A 3PM9A 5F41A 3AA9A 3SEOA 5BXIA 5F8HA 1IVZA 2ROPA 5HROA 2UUBF 2ZOFA 3LH2S 4KH1B 1AZSB 1F5BA 1UAWA 4M5GA 4ILLA 5M2PA 1I5OB 1FRIA 3D6TB 4HR2A 5HK4A 5KFHA 5DG9A 2FVRA 2JNJA 1FJ7A 3X3UA 2OTJS 1OS5A 2YQ1A 2QEXS 2V4QA 1GX5A 3WQPA 3NKYA 2WK4A 4MTPA 4CLLA 4C9DA 1I94J 4FF4A 4GKKF 3THVA 2WOMB 5LSRA 1ZYQA 3KG0A 1T02A 3EZOA 4ZVUB 3TEHB 2FTRA 1YSJA 1RWNB 1JNZB 1TL3B 1OWXA 1UFKA 3R5JB 3MAAB 3H8YA 3OXLA 3GB0A 3BZQA 3BGRB 4DI6A 5FJ4A 5LM7E 3G6XA 1W2BR 5K14B 1VISA 3KK3A 3UR3C 1N0VC 2RHQB 3PKMA 4IFVA 2KVQE 3M1VB 3MXHP 4F4YA 1VDHA 3TNVA 4HI2A 4K4ZA 2DHAA 2EFGA 3L4BC 4RBUA 1SH2A 1MLAA 1UPMB 3GFYA 3K8WA 4HTIA 2ATCB 3RB0A 1PGZA 1B3TA 1UVKA 3IM8A 1RCOB 2MEWA 4JP8A 4QPTA 5LL6d 4CYUA 2EFOA 2UXCF 5KFGA 1NJZA 3RUBL 1LWXA 4AQYJ 1YJ9S 1RTDA 2VHGA 3US5A 4GKJJ 1CJVB 5BYQA 1WTFA 4ED2A 3T5JA 2HK2A 4RWWA 4LF4F 3ZXWA 4Q8EA 1RAOA 1GMVA 1IM4A 2DCUB 4GVLA 2YX1A 1E6VA 3ILJA 3NP5A 4QW8A 2HVDA 3GILA 5HMXA 3VALA 2R8GA 2LMIA 2X1BA 3UE2A 3MEGB 3BF4A 2RB7A 4C11A 5A8KB 1D09B 1DTQB 3HF5A 3UCZP 3NS6A 3W9IA 1IJFB 4U67Q 3E01B 2ZH5A 3ZTOA 3DNCA 3OVSA 4AL7A 1F9HA 1GNKA 1AFIA 2W8KA 3W60A 4DUZF 1K8AT 2XI3A 1SJ1A 1T0TV 2BW7A 2YNHB 4EBCA 4DS4A 1NH8A 2DGVA 4ICLB 3M4XA 1TUGB 2Y1RI 4FBTA 3IGVA 2BA9A 2CJBA 3P45B 5IZHA 2BBEA 3U1MA 1UVIA 2HHSA 1HNVB 1RWKB 5KTQA 2OH2A 2IYIA 3UNYA 2CQ3A 1Q8BA 2W9AA 3AFGA 5ETVA 1I1GA 1I3OB 5A6WA 2N3OA 1SJ3P 1CG2A 1L5UA 1G4CA 1PYTA 1KLMB 2W9BA 4ZKAA 3FNNA 3CUNA 2G0IA 3V4MA 2VKZG 3PW4A 2HHHF 1ITPA 3PW7A 3P5BP 2YX7A 4DR1J 1QSSA 2LU2A 4YHHF 4XPEA 3TX0A 1WC3A 1HIYA 2OPRA 5CABA 1YITS 1O5JA 3R7NB 1RU1A 4F7VA 2R2SA 1U26A 1HQUA 1Y3KA 1JJ4A 4B3RF 3MMAB 1X4BA 1DBDA 1DQ9A 2J7KA 3IXQA 1CJTA 1EJ7L 1PCAA 1WJ9A 3FFIA 4NLUA 2HURA 1AZSA 3LGMA 1CULB 2H4WB 2K06A 1JNRB 2J76E 4NA3A 1T11A 2J0QD 2MJNA 5SUHA 4ZP9A 1MMNA 3O44A 3NL0A 4CH7A 2RS8A 3AODA 3VAHA 5AXLA 4OMFG 5HBMA 2DRBA 1KP6A 2YWGA 3RYLA 3D0IE 1WOOA 4ECUA 1URNA 3GONA 2YKNB 3NOGA 2DNMA 3R5CA 3GQCA 5CD4A 4CLTA 2NS1B 3EGVA 3UI3A 3UCUP 4HH1A 4C97A 5KFOA 2UV8A 2V94A 5AJ3J 4B9VA 1TL3A 1DLOB 5I4MA 2HBQB 1B0VA 3MAAA 2V34A 3G6ES 5ETPA 4O3NA 2GQ2A 3QWPA 4NCGB 2ZZMA 3BGRA 4LF9F 2DIUA 2YKMB 2H3EB 1E6YB 4H4OB 1Y5IB 1RA6A 3PNIA 4PYAA 4Y2IA 3GJRB 1DAXA 3DLEB 4I2PB 4ZPTR 4B02A 2V2QA 2V8PA 1VLYA 4R0JA 1HFEL 4WU2A 2HRYA 2XNQA 4ZPBA 2MQNA 4J9PA 2C22A 3W2VB 2KYXA 2LU1A 2EI5A 4KHMA 1A9NB 1XK8A 2V4JA 4QJVA 4PYDA 4FBUA 1WKKA 3Q8YA 4KTQA 2HFNA 2KTQA 5EGYA 4UZBA 1KR4A 2HRTA 3ILLA 4JI3J 3MR7A 2HNYA 2EKYA 1FE4A 4F04B 4LF6J 2BXJA 2H65B 1FNXH 5HP1B 1TVRA 3MF5A 1U2CA 1H73A 2Q43A 2A1BA 5D4PA 2UUAF 1RLDA 4WPAA 3QJLA 2Y3YA 3I5BA 2HFSA 2OD4A 5E3AA 2BE9B 4NXMJ 1WG4A 2Z0GA 4ZCIA 1KOOA 5THWA 3DRRA 3OSNA 3BM7A 3DC2A 2XGQA 1DTQA 4NA1A 3DRYA 1RWOB 3RRKA 3TA0A 3BREA 3HI9A 1OPIA 5GAGI 3Q8QB 1VC5A 1HWJA 4USHA 3HP6A 1TAUA 3PEHA 3K2YA 3OTDA 1HBOA 1Y9OA 2ILZA 3BBCA 3IN5A 2PA3A 2VICA 3PV8A 1ZTWA 3OD2A 1LW0B 1NJIT 1RP5A 2D41A 3BB5A 4MFBA 3N79A 3HCXA 2L9DA 3VCDA 4M94A 3DFEA 3H2VE 3M8RA 3C14A 1K44A 3W64A 3DHWC 4RW4A 3SZ2A 2LEAA 5GAEI 2ZKUA 3BGLA 4Y2AA 1UFLA 2BJ8A 5B0AA 1C0UB 1QTNB 3CCZA 3D9BA 3ENAA 3HKWA 1U1LA 2OD6A 4X4OA 4HLBA 2JOQA 3I6PA 4QYZK 5LMNJ 2J9EA 2QN6B 3MDFA 1UMJA 5G4DA 5KG3A 1S6PB 4O0IA 4A8KA 3L95X 4NXNF 1FRKA 2BW2A 3NAHA 3F73A 4WP8A 3ILOA 2POKA 4DZ6A 1NJYA 1OMSA 4GVBA 4IUFA 1EARA 1O0PA 4OLOA 1FKOB 4OV1A 5EUHA 1RJJA 4DR5F 1VIXA 4DV7F 1QSYA 1IR2A 4CO0A 2FHJD 3IRWP 3NNHA 1CEZA 2O66A 1TK8A 2DD8S 4RBTA 2NXCA 4LSLA 5BYRA 3PX0A 3CD6S 2VFUA 3J80U 1RAAB 4USJC 1RT2B 2PDAA 3M8PA 5DDPC 3HVRA 2HRUA 3SIPB 2DPJA 4OI2A 4XTTA 2WCXA 3KJVA 2VPZB 1TK5A 1Y7PA 2RD5C 1YHQS 2QTWA 5HATA 1SJRA 2MHEA 4WFBQ 2HEKA 4TQSA 3MM7A 1X60A 3DN9A 5B0GA 2XULA 2LXFA 5FD1A 4JYAF 2YXLA 2V67A 6AT1B 5HBMB 2W2QP 4M5DB 5J2QA 2AEMA 3V81A 1U8SA 3ULHA 1R27B 2KHDA 3C6TA 1TL1B 3UVJA 4Q2MA 2Y0BB 3CVKA 4Q8FA 4WK1A 4UZCA 2FJEB 2LA6A 4H4KA 1YLXA 2IA0A 3CNQP 3KLHB 2HHUA 2VBZA 3BPDA 3TUZC 5F3ZA 2B8QA 4LF1A 4FYDA 1M0SA 2W8LA 4B3TF 1RT7B 4PABA 2XEXA 2VFSA 4WTOB 2CPHA 4CP5A 2VFTA 2E7XA 3PFEA 4QR0A 4RU9A 3TA2A 1RT3A 3ET6B 1JLBB 2ZJPQ 2GVDB 3J7YI 3N5FA 1FA0A 5K8NA 5J2PA 3FCVA 2E1PA 1LWFA 1PAEX 1TKTA 1FWLA 1N6QB 3FMWA 5HROB 1LXJA 2HNYB 2SXLA 3E51A 3IC1A 4RNMA 4UQGA 3HXMA 1RAEB 3BJYA 2A2CA 3DLLQ 1TVRB 3CCVS 3MHYA 1F60B 3TUIC 2MPUA 1C1BA 2MMYA 5J2NB 3OV7A 2RDDA 1GMUA 2PMWA 3K7RA 4L74A 1VQ5S 3MCSA 1UJ4A 3T3FA 3UR0A 1S6UA 1XERA 3LP0A 2XY6A 1C0TA 5DG7A 4J9MA 2O5DA 1FVSA 3HHDA 2DXDA 3H5YA 4LFCF 2YKPA 3MFHA 5LJ3Y 4M8LA 4O44B 3SQGB 3P6YC 4R25A 1VHIA 1LOUA 1WD6A 3MM6B 4OYBA 3UDEA 4YR2A 2FYXA 1HBOB 4ED5A 3HT3A 1WNEA 2B0GA 4Y28C 1S1TB 3PHTA 4DPUA 5DM7Q 2XG8A 1DFDA 1FNOA 2N7YA 5LJ5Y 2K7JA 1U49A 1Y5LB 3I9ZA 1Q5YA 5LSOA 1G1XA 2HLUA 2ZHOA 3TJ9A 3UN5A 1N36J 2KG0A 1HHQA 5CYMA 1V3SA 5JXSA 1R8CA 1MN9A 2NXUA 4RWXA 4LFAJ 3LALA 3PY8A 2HVZA 2CQDA 3EVOA 4DJBA 4IFYB 2JZ5A 2KFYA 5D4OA 5ETSA 2KZMA 1R8AA 1HWUA 2Z2MA 4CLFA 4PG4A 3EZUA 1TL7A 2HZAA 3C66A 4KBIA 3SCIE 3TR5A 2V4RA 1V5VA 1M5HA 1HBMB 4DSEA 4YFUA 1UETA 2QZ8A 3GIRA 4R8UA 3EXYA 3UD5A 4Q45A 4LBHA 4LSLB 5KAKA 2XMAA 1KN6A 2CUYA 2B5JB 3R5AA 1S99A 2JC1A 4X4NA 1DHMA 2P9EA 4KGKA 1H2VZ 5MAOA 4H4MB 1GEHA 4CDIA 3R97A 1H0HB 2C1EB 2F8MA 4IYQA 5H9EJ 2JLGA 4RNHA 1NHKL 3AXKA 4UOHA 4F25A 2QE5A 2P6SA 1KFSA 5KG0A 3PYEA 1VRUB 4YP3A 3PRDA 4B3SF 2YNHA 2XS2A 2RH3A 3H4DA 1WC4A 2PEHA 2OJ3A 1M1GA 2OELA 2BVZA 2FHJA 4DQIA 1KHVA 3BSNA 4HH0A 4J5OA 1DRZA 1YQHA 2AJ4A 2KO1A 4ZA1A 5E3CA 1HNVA 3KOAA 1RU2A 1I6JA 2FC9A 3PVXA 3EGZA 2KRRA 2XMKA 1TMMA 2DGUA 3OSPA 5D4NA 1JLQB 1GX6A 2P9CA 3PEJA 4NPOA 1RE1B 4M63A 2WSEC 1HD0A 1Y10A 1YK9A 2FHOB 3SBMA 3Q23A 2XNRA 3CD5A 2DGTA 1IKVB 1S6QB 3DOKB 1RT7A 3EVMA 1SH3A 2HHHJ 4JI2F 5E3RA 1N56A 4ZJOA 5LMNF 2Z56B 4DL3A 1UW9A 1JJHA 5EX0A 1PC5A 4LRAA 4RNOA 2EKNA 2J9CA 4JV2A 1NEEA 4KHRA 3TAMA 2UUWA 3K59A 1UFWA 2HQCA 4LF5F 4LF7F 1JKHB 4RW6B 1KNZA 1FX4A 2ROEA 2W9CB 1EP4B 1R43A 1U7LA 4CCHA 2IFXA 1NRKA 4KGZB 2DB1A 3RR7A 4OV6A 2MLXA 2VD3A 3LAKA 5HI7A 5CCLA 2X1AA 3C2PA 1MROA 2DK2A 2W01A 2J7WA 3PFOA 1T3NA 1NJWA 1DTTB 2UVVA 2KZZA 1QD1A 4FVMA 4A8FA 3LUYA 1VQMS 3MPYA 1NO8A 1UEVA 3OTCA 4NZ0A 1FRXA 1X5PA 4CLZA 2VOPA 1RI7A 1KQFB 5L8RC 5F9LA 7FD1A 2D9PA 2OEJA 2RF2B 3ZZPA 3VGTA 2QA4S 1S4EA 1VQYA 1YBTA 4PWUA 5ETNA 4X66J 3PIPQ 2A6OA 2D3O1 4JI8F 1VBZA 3G4SS 2GAHC 4J9VA 4NCGA 4QWBA 3UCGA 1D9FA 3DRPB 3QT7A 4CI0B 3TZXA 4GKJF 3CMAS 4ED3A 1C4AA 1E6YA 3I0RB 5CAAA 4PXBA 5F9NA 5E2QA 3WZ0A 1S10A 2FY8A 1AUDA 3DYAA 2VBYA 3LPYA 4OJ3A 4RPFA 1TKXA 2VL1A 4KRWA 2F4VF 2GS8A 5JVHQ 3D54A 1UZDA 2CDRB 4JV0A 1TKZB 4MK7A 1PYOB 4USWA 2B7BB 3WBZA 1S72S 4IOBA 1VBYA 2VQFF 2IM3A 4I68A 1Q16B 2VBWA 3Q8VA 4U7CA 2QSFA 4OHVA 5D0HA 4RNFA 3MGJA 4RO0A 3V6HA 1YI2S 4JI5F 5IT4A 5HP1A 2Z2YB 4OYZA 1FEHA 1PO6A 3NWGA 2V2ZA 5RUBA 3M8SA 2EWHA 4WK3A 3CDAA 1FJGF 3LA0A 2HIQA 3QT5A 1JX4A 2VA3A 1R89A 1F9FA 2BEFA 2DR8A 3CC4S 3DRRB 3KJFB 5KG1A 4EO8A 1DZ5A 2I2YA 1CS4B 4UY85 1FFWB 3R6LB 2AX1A 1M1KT 2BKOA 1QY7A 2I5JA 4U95A 4X62F 3RRGA 3NGTA 4FVCA 3EMTA 4LBIA 1YBAA 3R7SB 2I1RA 1SV5A 2CJKA 1MU2A 5GAGU 4ED1A 4B3OB 2CWKA 3MOZA 3Q2SC 3U02A 3PJ9A 1T03A 2FC8A 2VDIA 2RU9A 3AH6A 2QFJA 2MB0B 1HBUB 1F2GA 1C1CA 5KFZA 2DH7A 3KDOA 4FDFA 2MQMA 4HACB 5HJYA 3NGDA 2XY5A 4OFZA 4OYAA 4EZ9A 4W98A 2RT3A 3G2XA 3EXCX 3NGKA 1HWKA 4N47A 2CQIA 2XGPA 1M5OC 4WF9Q 3DRSB 1FESA 2K2PA 2J0WA 4I6WA 1F3VA 1M1HA 2DNQA 1WHYA 1KVKA 2G13A 3CCMS 2AYGA 4CTAB 4X62J 3H5XA 1XTZA 4QOTA 3R1HA 1ZAWA 2BQUA 4ALZA 1D3WA 2VG7B 5ADZA 1JLCA 5A0YB 3EPIA 1Q79A 1LW2A 1WC1A 2C2NA 4GRSA 3BQ2A 3CULA 3MM5B 4MIBA 3A8KA 1CSJA 1FF2A 3TAMB 2UUTA 1A0OB 6FDRA 3VAJA 1IWGA 2LDYA 1RCXB 4ZVHA 4CIOA 4K4TA 2HZCA 1XMOF 1O51A 3C8YA 3NCPA 1FWPA 4USVA 1X5OA 2CQ1A 2IDEA 4ZP7A 3I55S 1MG7A 1FTRA 2R7VA 1HNIB 1SB6A 3BR8A 2QA2A 4L73A 5T41A 2OSRA 1WF0A 2ZBCA 4PKDB 1K0TA 2M70A 1VMBA 2NUHA 3LWMA 4G1QB 3LAMA 2J8AA 2RQ4A 3P3DA 4M5DA 5J2QB 1BQNB 4LR7A 1U47A 3OFFA 3PX4A 2QG9B 5L9XA 4F3MA 4I67A 1LEOA 3HK2A 5J1NA 2WVFA 2I9SA 1YX2A 2NXEA 2ZM6F 3NBPB 1RWWB 1RXOB 2WRMA 2DH9A 4IG3A 3M8QB 1YJ7A 2FLLA 3PZPA 3CC7S 4LR8A 1SBRA 2ACMA 3W61A 5GADU 3DRPA 4PXEA 4XO0A 3OJSA 1NDLA 4DHVA 2LVWA 2HKEA 1X4CA 4RUHA 2CNKB 4M5LA 1YJNS 2E1MC 2MZ1A 1ZM4A 2RMLA 4YY3J 3PCOB 2OI2A 1F5AA 3PTWA 2CQ4A 3OL9A 1NPPA 2JFKA 1TU0B 1MNEA 2CIMA 3T1YF 2PI4A 1PSDA 2XYHB 4F50A 1WC5A 3KTQA 5G0RB 1REVA 2B9EA 5HQLA 3L7UA 3PJXA 4WU3A 3IFEA 2MKIA 2D69A 4YDDB 2LECA 4DL4A 3ZFVA 2ASLA 1ZM2A 1EQ0A 2E29A 2BJDA 1IKWB 4GC7A 2OPQA 2R7OA 5L1IA 3P5TL 4WYWA 2K8GA 2KU7A 3ZTRA 3AD9C 4PCQA 3VAGA 2G4BA 4ES1A 3T1HF 2YQ3A 2E5LF 1FE0A 1RKIA 1C1BB 3MCMA 5J2NA 5DETA 4IH7A 3BS9A 2LDIA 2G1HA 2Q6CA 1WDDA 3POTA 4ZLJA 1HBNA 2GVZA 3GIIA 3PX6A 4X64J 1S1UA 1U1MA 2D1CA 2RDIA 2MGZB 4L3KA 3FUYA 1RAFB 3R3TA 2JEFA 1N0UA 2M0GB 1XEZA 1X9MA 3G6VA 2FVSA 3MEDA 2GZOA 2QLBB 4ZP8A 2IJNA 2I5JB 4QWDA 2Y8WA 4I7FA 3NNAA 3SQGA 2KJVA 4OX8A 3MM6A 1RTZA 3ZTPA 1UCNA 2LP4A 5HLFB 5IS2A 2GHPA 5LOQA 2HQ3A 4DL5A 4QQBA 3QZ7A 1S1TA 1T03B 3OL8A 2ZH3A 4NYOA 3TZYA 4YR3A 2LQJA 4H54A 4NX9A 5GMEA 1ROFA 5KOXA 3WC2A 3JB9k 1QAXA 2OLWA 2DR6A 2R2RA 3D1QA 4LUBA 2W2OP 3CIMA 5KFXA 3DRSA 2MKHA 5T7LB 3K5NA 2E5GA 1A6LA 3AHPA 1ZM9A 4DV6F 2ZFHA 3GG1A 1M5KC 3JQJA 4JI6J 2MDAA 1LV5A 2CQ2A 3M6XA 3QWUA 2DY9A 5IT0A 2EFNA 3CO9A 1EAYC 2DO0A 4DG1B 4C8LA 4O4RA 5DS7A 5ETKA 1FDAA 3IWLA 3FGVA 5CYQA 2BANB 4ID5B 2FJVA 4N76A 1MSWD 1MMDA 2YPYA 2EVZA 1QUVA 2AEFA 2K1RA 1P1TA 1QJHA 1U6FA 1JLAB 1Q4RA 2CAJA 3F0NA 1JLFB 3FVYA 3M2RB 3ZO7A 3G8TA 2VIHA 2UUAJ
chains in the Genus database with same CATH topology
3PRVA 1B4SA 1EHWA 3JS9A 1ZS6A 2DXFA 4WBFA 5IOLA 3FBCA 4DUTA 1HIYA 5CABA 4O0NA 4ENOA 3EVMA 4UOGA 3ZTQA 3EE3A 1NPKA 4FKYA 2HURA 4ANEA 4S0MA 3VGUA 3R9LA 4ANCA 3VVTA 4F4AA 2B8QA 2BX6A 3FBFA 5BXIA 3Q8UA 3NGUA 1MN7A 1LEOA 1S59A 2B8PA 4CP5A 2AZ1A 2HVEA 1BUXA 1F6TA 4HR2A 3WX8A 3FCVA 1B99A 1PAEX 1NDLA 4ANDA 4KPCA 4C6AA 1NLKL 1KDNA 3VGTA 2ZUAA 1XQIA 3B54A 3BH6B 1WKKA 3Q8YA 4DI6A 1VYAA 3L7UA 2DXEA 5CAAA 2DXDA 2NCKL 1NSQA 3DDIA 3NGRA 3FBEA 3ZTRA 1NDCA 3VGVA 1XIQA 1W7WA 3EJMA 3Q83A 3BH7B 1S5ZA 3FC9A 3MPDA 3FBBA 1JXVA 1F3FA 1NB2A 1HLWA 1U8WA 3BBFA 1S57A 3Q8VA 3FCWA 1NSKL 3ELHA 3ZTSA 1LWXA 3DKDA 1HHQA 3ZTPA 1UCNA 1MN9A 3BBCA 4FKXA 3EICA 3EVOA 3NGSA 1PKUA 2HVDA 1NCLA 2VU5A 1BE4A 2BEFA 3GPAA 1K44A 1NSPA 3NGTA 3EMTA 3ETMA 1NUEA 3ENAA 3VVUA 3VGSA 1BHNA 3ZTOA 2CWKA 3FKBA 3EVWA 3PJ9A 3BBBA 1WKJA 2DY9A 4EK2A 4DZ6A 1WKLA 1NDKA 3EM1A 4UOFA 3GP9A 4W98A 3G2XA 2AZ3A 3B6BA 1NHKL 4UOHA 5C7PA 3Q89A 3Q86A 4F36A 2DYAA 1NDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRV A;  1B4S A;  1EHW A;  3JS9 A;  1ZS6 A;  2DXF A;  4WBF A;  5IOL A;  3FBC A;  4DUT A;  1HIY A;  5CAB A;  4O0N A;  4ENO A;  3EVM A;  4UOG A;  3ZTQ A;  3EE3 A;  1NPK A;  4FKY A;  2HUR A;  4ANE A;  4S0M A;  3VGU A;  3R9L A;  4ANC A;  3VVT A;  4F4A A;  2B8Q A;  2BX6 A;  3FBF A;  5BXI A;  3Q8U A;  3NGU A;  1MN7 A;  1LEO A;  1S59 A;  2B8P A;  4CP5 A;  2AZ1 A;  2HVE A;  1BUX A;  1F6T A;  4HR2 A;  3WX8 A;  3FCV A;  1B99 A;  1PAE X;  1NDL A;  4AND A;  4KPC A;  4C6A A;  1NLK L;  1KDN A;  3VGT A;  2ZUA A;  1XQI A;  3B54 A;  3BH6 B;  1WKK A;  3Q8Y A;  4DI6 A;  1VYA A;  3L7U A;  2DXE A;  5CAA A;  2DXD A;  2NCK L;  1NSQ A;  3DDI A;  3NGR A;  3FBE A;  3ZTR A;  1NDC A;  3VGV A;  1XIQ A;  1W7W A;  3EJM A;  3Q83 A;  3BH7 B;  1S5Z A;  3FC9 A;  3MPD A;  3FBB A;  1JXV A;  1F3F A;  1NB2 A;  1HLW A;  1U8W A;  3BBF A;  1S57 A;  3Q8V A;  3FCW A;  1NSK L;  3ELH A;  3ZTS A;  1LWX A;  3DKD A;  1HHQ A;  3ZTP A;  1UCN A;  1MN9 A;  3BBC A;  4FKX A;  3EIC A;  3EVO A;  3NGS A;  1PKU A;  2HVD A;  1NCL A;  2VU5 A;  1BE4 A;  2BEF A;  3GPA A;  1K44 A;  1NSP A;  3NGT A;  3EMT A;  3ETM A;  1NUE A;  3ENA A;  3VVU A;  3VGS A;  1BHN A;  3ZTO A;  2CWK A;  3FKB A;  3EVW A;  3PJ9 A;  3BBB A;  1WKJ A;  2DY9 A;  4EK2 A;  4DZ6 A;  1WKL A;  1NDK A;  3EM1 A;  4UOF A;  3GP9 A;  4W98 A;  3G2X A;  2AZ3 A;  3B6B A;  1NHK L;  4UOH A;  5C7P A;  3Q89 A;  3Q86 A;  4F36 A;  2DYA A;  1NDP A; 
#chains in the Genus database with same CATH topology
 4LJM A;  4USI A;  5BR8 F;  4P72 A;  2Z58 B;  1EHW A;  3R27 A;  3S01 A;  5KG6 A;  2UU9 J;  1QSL A;  3DOM A;  4WE1 A;  1JLG A;  2HQD A;  2LQ5 A;  2ZEJ A;  2R7X A;  2RKI A;  4C8Z A;  4OZ0 A;  2GML A;  2LYV A;  2MZQ A;  2QYC A;  2VC0 A;  4V1A k;  4YB6 A;  5CQG A;  4ZPA A;  3J80 Y;  4FS1 A;  2VF3 A;  3SSR A;  5I3Q A;  3SDE B;  5DLF A;  5CXT A;  2J0S D;  2G2Y A;  2JLE A;  2M88 A;  3NXZ A;  2V8V A;  3ADA C;  3KHH A;  1N52 B;  2KI2 A;  4ANE A;  3Q2T C;  2HW3 A;  3NAI A;  4G65 A;  3MMB B;  1S7H A;  1BGX T;  4DU7 A;  3VAI A;  3IGN A;  1P6T A;  2NXN A;  4NLQ A;  3DLK A;  1U0H B;  4PXC A;  1PC4 A;  1B0P A;  5M2U A;  1RZM A;  1Y00 A;  3QAE A;  3ZNU A;  3P4U B;  1HW8 A;  3BSA A;  3HJV A;  1ZZN A;  3OTE A;  5H9E K;  4USU A;  2ADC A;  2E5J A;  1VK3 A;  4M5I A;  3MEK A;  1R0B G;  4WYL A;  1ZM3 A;  1Q7L B;  1S59 A;  4OX6 A;  4DL7 A;  3W3S A;  3T9Z A;  5F8J A;  1SC4 B;  3FSY A;  4ERD A;  2QT7 A;  5DQG A;  4KO0 B;  1TV6 A;  2Z4P A;  3QPI A;  4DX5 A;  1FKA F;  2E44 A;  1X4E A;  2DHS A;  1EP4 A;  2IRX A;  1FHT A;  2YQ0 A;  1ZAX A;  2ACY A;  1SQE A;  2YKA A;  3I0S B;  1BWE A;  2PGC A;  2FQQ B;  2BKP A;  2E5I A;  3PHE A;  2R42 A;  2GFF A;  4XPC A;  1HYS B;  1FX2 A;  3KUE A;  4RBV A;  1HNX J;  5LSL A;  1EIY B;  2Q3P A;  3TRG A;  2RU3 A;  2FGO A;  1VBX A;  1RGV A;  2AYE A;  3PKY A;  3BH6 B;  2GVZ B;  1QM9 A;  2GMH A;  3ENV A;  2WVC A;  4EU0 A;  4X4T A;  1NKC A;  3J7Z 5;  1Q95 G;  5EDW A;  3J81 Y;  2DNG A;  4K8R A;  3S7R A;  2HHW A;  1RUS A;  3LP1 A;  3C15 A;  3DDI A;  3ZZU A;  2QV6 A;  1NDC A;  1HMV B;  3ZZY A;  2U2F A;  3TAR A;  1S5Z A;  4K0K F;  1X4A A;  1XBW A;  4GMK A;  2AJ0 A;  2MY7 A;  4PPZ A;  4CLP A;  1QAI A;  1ZPV A;  4C4W A;  4KGX B;  4DQR A;  2RNE A;  2LXU A;  2OEK A;  3I0R A;  1AUS L;  1JJC B;  4U6P A;  2RHS B;  3TA1 A;  4B3M F;  2CPE A;  1SJQ A;  2KB2 A;  3OR2 B;  4KE5 A;  2F4V J;  4QCL A;  1GXL A;  3D28 A;  5J1E A;  1TMJ A;  2D7S A;  2QSW A;  3DKD A;  4LRB A;  5HMY A;  4I6Y A;  4QW9 A;  2JHE A;  2COL A;  3M2V A;  4DCO B;  1B0T A;  3FQK A;  2PFD A;  4O4G A;  3KHR A;  3H2L A;  1PYS B;  2BQR A;  2FB0 A;  3BN4 A;  1U6B A;  2KFN A;  3SCJ E;  3UD4 P;  4ZPC A;  3OUY A;  3QIP B;  1IXK A;  4JI4 J;  1S48 A;  1KRP A;  2MZS A;  5E3P A;  4ZVQ B;  2BRK A;  4NWB A;  4CYU B;  2D3O R;  1UWA A;  1TFW A;  5CA5 A;  3QBC A;  3I32 A;  2FHK A;  4PQA A;  1D9A A;  3EZ5 A;  2HHQ A;  2EBG A;  2HS3 A;  3KMS A;  2GA7 A;  2ILY A;  4MJK A;  5IFM A;  4M95 A;  4J90 A;  2AIR B;  3G82 B;  3MUM P;  2FLP A;  3FZB A;  1R3N A;  1P9Y A;  2J6U A;  2GGP B;  3DXB A;  4Y2M A;  3MEG A;  1S9E A;  1KEK A;  4LFC J;  1CS4 A;  3K5L A;  2ZOM A;  3M05 A;  1OYD A;  1WUU A;  4G1P A;  1FXR A;  1HI1 A;  4ECQ A;  3TYT A;  2ASD A;  1JLG B;  1VLO A;  4NLO A;  3PG9 A;  2W4C A;  2RKI B;  3ZZO A;  1SV5 B;  3I87 A;  3GFH A;  4P52 A;  5I3U B;  2IC3 B;  3M32 B;  4A8Y A;  3MEC B;  2AJ1 A;  3RAX A;  4Y00 A;  3Q86 A;  3N9U C;  2J6S A;  2B3T B;  4CNZ A;  4Y65 A;  3PO5 A;  3A8J A;  3CCL S;  1IBM F;  2J0X A;  1EX8 A;  4FPR A;  1ZS6 A;  3NMA A;  3K5M A;  2BJ9 A;  4PWW A;  3W62 A;  2XHW A;  4NL5 A;  1T05 A;  5CCM A;  2J6T A;  1FD8 A;  5K5M A;  2F7V A;  5AXM A;  1XNR F;  2OKQ A;  3D2W A;  4NCA A;  7FDR A;  4L72 B;  2JWN A;  4PZV A;  4TU8 A;  4CTA A;  2XLI A;  1RBO B;  1YG0 A;  4RX6 A;  4UOG A;  1ZZF A;  2KDO A;  2Z2Z A;  2OEM A;  2MST A;  3OQ2 A;  2HQG A;  5JMN A;  3DM2 B;  1Y11 A;  3M6V A;  1CJU A;  4NLS A;  4S0M A;  3IMQ J;  4JUZ A;  3SFU A;  2EC0 A;  3HX9 A;  4D3H A;  1U25 A;  1FDN A;  2VUG A;  4ANC A;  4AXI A;  2QRR A;  3IR5 B;  4DDF A;  2XCP A;  4BCA A;  1TV6 B;  1NHU A;  1J2V A;  4CLY A;  3CJS A;  2AJQ A;  4LQ3 A;  3RB3 A;  1KOH A;  2C3P A;  3FBF A;  3ENQ A;  4ATN A;  1IKX A;  1RSC A;  5L1J A;  3I0S A;  1KTQ A;  1CJK A;  3CJT A;  4Q7A A;  5A8W B;  3UPF A;  2F63 A;  2C3M A;  2B8P A;  2PN6 A;  3J7Z T;  4KT0 C;  4ZPD A;  4DN9 A;  3OVA A;  4DV2 J;  1XNQ F;  1S0V A;  2HNZ B;  4DSJ A;  2EC2 A;  2IAJ A;  3WX8 A;  2KT5 A;  4OZ5 A;  3H98 A;  2CQP A;  1R0A B;  4J37 A;  1VCT A;  4ED4 A;  5AXK A;  4A8M P;  4X4V A;  2GNK A;  3VV2 B;  4DV5 F;  4PG6 A;  5ETQ A;  1BC6 A;  1SI9 A;  3DU6 A;  1U2F A;  4BWJ A;  3CJ4 A;  3T9N A;  3C15 B;  3CCR S;  5JVG Q;  4C48 A;  4OHY A;  1SVD A;  4AL6 A;  1SJF A;  3HM9 A;  3FQL A;  2IM1 A;  1GH8 A;  1CVJ A;  1NKB A;  5KT5 A;  2X1F A;  1SKU B;  3OLB A;  2LXI A;  2DEJ A;  2G0J A;  4KAI A;  2DT9 A;  4NCB A;  2OPS A;  2XO6 A;  1K0V A;  1IBK F;  5IT9 U;  3CJ2 A;  5AE1 A;  2AP6 A;  4LT6 A;  1M5S A;  1WTB A;  4I2P A;  1SXL A;  2Z8Q A;  3GG0 A;  3UFC X;  3IBF B;  1XIQ A;  3GJT B;  2GJ2 A;  2GIR A;  4HDG A;  1FK9 B;  1H72 C;  3A8I A;  3Q83 A;  4TY8 B;  4W4M A;  2AW0 A;  3C6U B;  5DRK A;  2H4Y B;  4DL0 C;  3V6D B;  1SKW A;  4B3S J;  5G0R A;  4ZIV A;  3HSG A;  2CXE A;  1GTE A;  1MML A;  2LQ8 A;  2F9D A;  2QC3 A;  3LQV A;  3LGN A;  4DR5 J;  3DLH A;  1LFW A;  1OO0 B;  4KQZ A;  4ELT A;  3CCQ S;  2R8K A;  2H5J B;  4LSZ B;  4LSN B;  3J81 U;  4X4S A;  3FMB A;  3G82 A;  3L7O A;  3POT B;  1KKH A;  1UEU A;  4FKX A;  3HHL A;  1RAG B;  4HEA 9;  4IOA Q;  2GGP A;  2ZWP A;  5KFV A;  1RTI A;  2CPX A;  2MGZ A;  4NI2 A;  5GVQ A;  3M7V A;  1BE4 A;  1VGY A;  2OPP A;  1ZOT A;  3GPA A;  4ZHR A;  4J9S A;  4B9L A;  4ZDN A;  2CJA A;  1G7C B;  1NSP A;  3GJS B;  3MPW A;  4CWB A;  1Q53 A;  3VF0 B;  1K9M T;  2E9R X;  3D66 A;  1VRT A;  1K1S A;  5HVF A;  3UN3 A;  3HSJ A;  1Y5N B;  1DAR A;  2RDJ A;  5HAN A;  2C28 A;  1KVI A;  3V2U C;  4N56 A;  5HLF A;  2IC3 A;  3B4D A;  3H4B A;  2EK1 A;  3QGP A;  5CZV A;  1NKE A;  1N5Y A;  3FJ2 A;  1XR6 A;  3VZH A;  2BR0 A;  5KT7 A;  2XS5 A;  2L9W A;  3BYP A;  5I42 B;  3MR2 A;  1RK8 A;  3H5S A;  1T9X A;  1S79 A;  1OQ6 A;  8ATC B;  3DGV A;  2CZ4 A;  1N4L A;  5FLX Y;  4UOF A;  4B9N A;  2IDL A;  4EZ6 A;  2N82 B;  1ZAV A;  3B6B A;  3DOL B;  1F9E B;  4NMX A;  4EI2 A;  1FKP B;  2MHN A;  2RVJ A;  2YNF A;  3KLF A;  2K7K A;  4CLK A;  1XR5 A;  2HFU A;  2BQ3 A;  2QLF B;  1J27 A;  4ZK7 M;  1B4S A;  4Y3C A;  1WOR A;  3VHQ A;  5B0D A;  1RT4 A;  3MAQ A;  1CJU B;  2CRL A;  4P75 A;  3D0H E;  2X3G A;  5DO2 A;  1HQE A;  4WBF A;  1N34 F;  1RHQ B;  3EUN A;  3MEE B;  1Y0H A;  2FZK B;  3FBC A;  5L39 A;  4FYW B;  4P2S A;  1UWB A;  1VQ7 S;  3CIZ A;  4AE5 A;  3GSI A;  4LF8 J;  2CJ9 A;  3RBE A;  3IG1 A;  4WP9 A;  4FS2 A;  2LLZ A;  1IKX B;  1SL1 A;  1FEE A;  2RJZ A;  1NPK A;  5ETO A;  4DF8 A;  2ZC4 A;  1RT2 A;  3C3L A;  5H9F K;  4DOZ A;  2YWK A;  3NOC A;  4QZV B;  3DOM B;  3QGG A;  5FDL A;  4DPT A;  2IPO B;  2W2M P;  4J9N A;  1YKW A;  3AQP A;  3L9Z A;  4C2M A;  3KHL A;  2E7W A;  2ADB A;  2DIT A;  4TU7 A;  1A7G E;  2WZ1 A;  1L3S A;  5LXY A;  3MAH A;  3KLG B;  3IS9 B;  3G71 S;  1UEK A;  2VAS A;  4B17 A;  4B9S A;  4A46 A;  3KLV A;  2U1A A;  4GO7 X;  3V81 B;  2IRY A;  3AB4 B;  4PRF A;  1CC7 A;  3GIJ A;  2J9D A;  1JQG A;  2ZD1 A;  4P2M A;  5DQI A;  2KXH A;  5AXN A;  4DS5 A;  2XSJ B;  3C16 A;  3I4P A;  4ZCK A;  3UVJ B;  5A2Q Y;  4ZLP A;  3OHB A;  1Q86 T;  1YJW S;  2XC9 A;  1ZET A;  4CZC A;  3U27 A;  4N8N A;  2G0C A;  3HHE A;  3M8Z A;  3FSI A;  3TZZ A;  5A2Q U;  3G8S A;  2DCL A;  3U1N A;  4GC6 A;  4ECT A;  4WFN Q;  4DQQ A;  2ASJ A;  1DJ0 A;  1YVF A;  1NZ8 A;  3GV5 B;  4DFK A;  1NBE B;  4CO3 A;  3JSM B;  3HSD A;  4C98 A;  4N77 A;  2DRD A;  2GW8 A;  3H90 A;  2BE7 D;  2ZUA A;  1FK9 A;  1X5T A;  3H2U B;  4G1I A;  4KR0 B;  3V6D A;  1Q81 T;  1P1L A;  1SQF A;  4IO1 A;  1SIZ A;  4KO0 A;  4L76 A;  4OIX A;  4QR2 A;  4A48 A;  3A12 A;  4U7U K;  4CM2 A;  4ELV A;  1LWF B;  2AF6 A;  1S9G A;  4TLR A;  1VQO S;  3VWS A;  1NPR A;  3E3X A;  3ICL A;  2RRN A;  3K58 A;  1NND A;  1N8R T;  3C19 A;  2DNK A;  2QFI A;  2WON A;  1HNW F;  4PWD A;  4YOE A;  2WSF C;  3G87 A;  4ZN1 A;  2QYG A;  3RAQ A;  4D3G A;  1OIA A;  3M2U A;  4QIV A;  1VI7 A;  4QWE A;  4UT4 A;  1S1W B;  2V63 A;  4HHJ A;  3LP0 B;  3BBF A;  2L41 A;  3VAM A;  3W65 A;  2C2Z B;  1M90 T;  2HK3 A;  2WBR A;  4P2X A;  1EB0 A;  4B9T A;  3SCK E;  4MAK A;  5BYS A;  4C3L A;  4ETX A;  4YHH J;  2R8J A;  3GYN A;  4DR4 J;  5IV4 A;  3R5D A;  3KLE A;  2LKZ A;  5FLX U;  4DR3 J;  4IRD A;  3IAM 9;  4F0M A;  1ULR A;  1V5I B;  2ZWO A;  4PUO A;  4DR7 F;  3BYR A;  4ECZ A;  3V5R A;  3BQ0 A;  5I42 A;  4F0H A;  1K1Q A;  3OR2 A;  2DNR A;  5ETT A;  1FRM A;  1NM2 A;  4I2Q B;  2MKY A;  2UUC F;  5B08 A;  4PR6 A;  2OMO A;  5D0E A;  3SSQ A;  2H54 B;  1RTJ B;  1F1B B;  3H25 A;  4ZP6 A;  3T19 A;  4BHQ A;  4RW9 A;  3EVW A;  1H2U X;  4KGM A;  4DSL A;  1HWL A;  4X2B A;  5C24 B;  4IFY A;  1RWV B;  4NLY A;  4ES2 A;  2IHR 1;  4IRK A;  2HHV A;  2KFZ A;  4JI3 F;  4CRJ A;  2RE1 A;  4P10 A;  4EK2 A;  2O67 A;  3JTO A;  4P9S A;  4KGV B;  4KH0 B;  1VQ8 S;  2V9W A;  1GTH A;  3TUP A;  1T9T A;  4WZQ A;  4DR3 F;  5D6G A;  4IOC Q;  1PJ5 A;  4JV5 F;  5L1L A;  3N6N A;  1URR A;  5KFJ A;  3BEG B;  1WSR A;  5E0O A;  4M1K A;  1CLF A;  4B9U A;  2MQO A;  3MM9 A;  3DLG A;  3OTB A;  3ETO A;  4DPO A;  4JI2 J;  1S1X A;  1TL5 A;  4H4M A;  3HLU A;  2DH8 A;  4J7C A;  3CXC R;  1WHX A;  3TEG A;  4O3P A;  1HD1 A;  3AQO A;  4MYT A;  4WJB A;  4DBQ A;  3EGW B;  3I5C A;  3SYZ A;  3RTV A;  5I3U A;  3M32 A;  3W9J A;  3CCE S;  2XMJ A;  2G2O A;  5H1S V;  2IA6 A;  1VHF A;  4MKA A;  5E3Q A;  4K4W A;  1XR7 A;  2XMV A;  1RT5 B;  4FXD A;  3BV8 A;  5CYJ A;  2E5L J;  1R7I A;  3AAW B;  3KG1 A;  3ZZZ A;  1Y3J A;  5HMW A;  2F65 A;  4CH1 A;  2G2Z A;  1RT6 B;  1ZBT A;  3VQS A;  4MKV A;  4AUK A;  1JLQ A;  3SQO P;  1SKR A;  2N4D A;  5EX3 A;  2PFF B;  2HBY B;  3O8W A;  2CJY B;  3KNG A;  2XQC A;  3VAK A;  5KFP A;  4M5N A;  1N32 J;  1I94 F;  3I56 S;  1FXD A;  1PIL A;  2QL7 B;  3RBZ A;  3ISZ A;  2C3O A;  3BO4 A;  3W7B A;  4A47 A;  3JTN A;  1X4D A;  2CA9 A;  2BJE A;  4XAK A;  4ZVE A;  3VTI A;  5K20 B;  2HVH A;  3ENW A;  4CO5 A;  5HVH A;  5LXR A;  4LF5 J;  4LF7 J;  4JI8 J;  4FYV B;  4RW6 A;  1KHW A;  3O1L A;  1G3O A;  4CQ1 A;  4PPD A;  2C2R A;  2VKR A;  2UUB J;  2LEB A;  3UW1 A;  3M9M B;  3EPG A;  5IWA F;  1CJK B;  3A3P B;  4L3N A;  3S1T A;  2VG6 A;  3MR6 A;  4YN3 B;  4TXS A;  1FJC A;  2L08 A;  2QJ3 A;  3P8B B;  4OYW A;  2HNZ A;  2CZ9 A;  2XWX A;  5L38 A;  5DDO C;  2ZH7 A;  4KB7 A;  5DDQ C;  2ZBP A;  1G2E A;  4IRC A;  2EG1 A;  2GQC A;  4BC9 A;  3CJK A;  1VYA A;  2EFQ A;  4YR0 A;  2A6M A;  1WWH A;  2VB6 A;  3D5M A;  1APS A;  2L3M A;  3BKU A;  3ISN C;  4XDC A;  1FNM A;  2NSB A;  7AT1 B;  4URG A;  4CLU A;  4KSE B;  3WIV A;  2EW9 A;  2V8D A;  3J7A N;  4PQU B;  2B4U A;  3FC9 A;  2PSZ A;  4QIF A;  3JXO A;  1C4C A;  1JXV A;  4ZVP B;  4FXW A;  4Y2K A;  2VZ9 A;  5C5J A;  2CQC A;  4YME A;  3V6K A;  3NMR A;  1BXN A;  3DXS X;  1S57 A;  2VFV A;  2V0N A;  4TKT A;  3BDE A;  1O8B A;  2CVI A;  5K14 A;  1U0S A;  4Z7Y A;  3RAM A;  3KK3 B;  4DQS A;  1SUQ B;  3DDN A;  3DYA B;  2RAQ A;  1TKX B;  2CJQ A;  5GAH I;  4ZVS B;  4AD6 A;  2Z30 B;  4F3Q A;  2V50 A;  4HT7 A;  2UV8 G;  4TY8 A;  1N5V A;  3E01 A;  3C6U A;  4N5S A;  3V4I A;  1RTJ A;  3G6Y A;  4N41 A;  1U2R A;  4OYI A;  4OYM A;  1LWC A;  2BMB A;  1N88 A;  2MSS A;  1KLN A;  3DLB A;  1FI4 A;  1GFW B;  5C24 A;  4RR5 A;  2AX0 A;  3GTY X;  1RBL A;  1LWE B;  4DEZ A;  3H42 A;  2MQ8 A;  3K8V A;  4PAA A;  1XJW B;  4RUB A;  5KFQ A;  3CJR A;  1RTD B;  3MD1 A;  1X0P A;  3ETM A;  4J9Q A;  1KD1 T;  1NUE A;  3ZZR A;  3VVU A;  5KFK A;  3NY0 A;  2AYM A;  2XTJ P;  4MIA A;  3FKB A;  3HHL B;  4R0E A;  5E5N A;  1RTI B;  1BLU A;  1SCJ B;  2XMW A;  3LP2 A;  2XM3 A;  2OAU A;  2GIF A;  4DV0 J;  3IRX B;  2CQB A;  4KPY A;  4C11 B;  5A8K A;  2FZC B;  1NME B;  1SC6 A;  2F9J A;  4OHW A;  5D0R A;  2ZNZ A;  5HL7 Q;  4I69 A;  1KBR A;  4U96 A;  3TZW A;  5DGA A;  5HJX A;  3W2W B;  1MU2 B;  2OPR B;  5K9F A;  1IBK J;  2ATL A;  1UVL A;  4DR4 F;  2C2K B;  4B3O A;  1X4G A;  1Q0N A;  1YWX A;  1YJR A;  1H6K X;  1HQU B;  4DLE A;  3NNC A;  2H51 B;  3MMA A;  3NRB A;  4K4Y A;  1HBU A;  3E2E A;  1N5T A;  1M5V C;  1RT5 A;  3JS9 A;  1LKZ A;  2XMM A;  3FZ2 A;  2ZH2 A;  4E0D A;  2NZ4 A;  1AXQ A;  3HVA A;  1IBC B;  4C8M A;  2C2D A;  2WVB A;  4V19 X;  1UKU A;  3RW7 A;  1TR0 A;  3J81 j;  1OYE A;  2QLW A;  2KG1 A;  3M9O B;  3EDR B;  3PO4 A;  1S97 A;  2H48 B;  3DHX A;  4ETZ A;  5IV3 A;  3G9C A;  4L75 A;  2XBP A;  3WDO A;  1WEZ A;  4I6A A;  2FGC A;  2W9B B;  2AGQ A;  4QWA A;  3T1Y J;  2YKN A;  3EDQ B;  1RIS A;  1NH7 A;  1RT4 B;  4WKY A;  2YKQ A;  5HMZ A;  4MIW A;  3EYZ A;  3HO1 A;  4K4X A;  1FRH A;  8AT1 B;  1P27 B;  2IM0 A;  4R5P B;  4K4V A;  4NLT A;  1R6V A;  4RUA A;  3IM9 A;  4ZOS A;  4A8O A;  1JK9 B;  5KFF A;  3KYL A;  2DRA A;  3QRP A;  5DQH A;  4JV5 J;  2AV5 A;  4H4O A;  3T1H J;  4ECX A;  3FCH A;  1CJT B;  3DLE A;  2GX8 A;  4O23 A;  4LIW A;  5FDL B;  3OXG A;  4P7V A;  4IR1 A;  2AKW B;  2JRS A;  3W2V A;  5J2M A;  3HZG A;  2ZVI A;  5FII A;  3QFH A;  1WC0 A;  4QYR A;  3KLG A;  2FJB B;  4ECW A;  1LNQ A;  2R7W A;  2EK6 A;  3CJK B;  4YDX A;  2ZH1 A;  3QZ8 A;  2RRB A;  1S0O A;  1BQM B;  2PI5 A;  1KWM A;  2GJF A;  5A8R A;  3S6E A;  2N7C A;  1WDT A;  2ZM6 J;  3MUV P;  2AMC B;  4NRU A;  3NBP A;  4IG3 B;  3LWL A;  4DN0 A;  1F0X A;  2QIF A;  4ILM A;  2QMU B;  4IO9 Q;  4WKR A;  5B09 A;  3Q24 A;  1YDL A;  4DPX A;  4HYK A;  3I5A A;  4H4K C;  2N3L A;  3RBX A;  1VJW A;  2Y1I A;  5HVG A;  1SL2 A;  2NYH A;  3SCL E;  4DFJ A;  4IH6 A;  2QX0 A;  3CCT A;  1PAU B;  2B9X A;  2F3J A;  3A8E A;  5F8M A;  4DLG A;  4GO5 X;  3SXL A;  2FUG 9;  3Q8P B;  2QMW A;  2AEJ A;  1W7W A;  1WAC A;  3EJM A;  2UP1 A;  1N32 F;  2KHC A;  3JAM Y;  3BH7 B;  3MPD A;  1RWU A;  2XLK A;  4AXJ A;  2YX4 A;  4LVO P;  1PBA A;  1FFS B;  2Y8Y A;  2HWI A;  4F02 A;  1LW0 A;  3R7B B;  1S9G B;  3N0V A;  4EO6 A;  3JAM U;  4L6V 3;  2GO8 A;  1JXE A;  4I64 A;  5KFL A;  3FCW A;  2G1D A;  4ZCM A;  1S1V B;  2VC1 A;  1VK8 A;  1HNW J;  1B7Y B;  3N6L A;  3C46 A;  4NYP A;  3PYD A;  4FF1 A;  2ZDP A;  4DV2 F;  1L3U A;  3QLH A;  2JSX A;  3K89 A;  1H2T Z;  1PJ7 A;  4DX8 H;  3B82 A;  3BKF A;  3QT6 A;  3OL6 A;  3EIC A;  4M5H A;  1HBN B;  3M6W A;  1S1U B;  1WHW A;  3QID A;  4P73 A;  3QMQ A;  2E66 A;  2M2B A;  2DIV A;  1S6P A;  2HLT A;  1FTC A;  2LQB A;  2VU5 A;  3JSR A;  3LP2 B;  3V6J A;  3CB4 A;  1KC8 T;  1KON A;  3IRX A;  3H5U A;  1GXU A;  3GLJ A;  5D0G A;  2B51 A;  2I38 A;  4UOC A;  3UWT A;  4DX6 A;  4ZVG A;  2C2M B;  2K3I A;  3QYY A;  2CJX B;  3OT9 A;  4FNI A;  4CH0 S;  4UQT A;  1TQL A;  2E7V A;  4USM A;  5J1P A;  1HAR A;  3B4M A;  2H1Y A;  4DV1 J;  3FEY B;  2F1F A;  3D6M B;  3CW2 C;  2HVI A;  1NHV A;  4EYH B;  2JX2 A;  1RDR A;  4F8R A;  1X9S A;  5F8G A;  4XIU A;  3M8P B;  3HSZ A;  3IP0 A;  4I2Q A;  3VAF A;  4NOH A;  2KXF A;  1WEY A;  3CO0 P;  5CZX A;  3MUT P;  3KJV B;  2KH9 A;  4LF2 A;  2FZG B;  5KFB A;  4O3O A;  1CBK A;  4NLP A;  4DSF A;  4K2X A;  1MWQ A;  1X5S A;  4N8O A;  4DV5 J;  4UUW A;  2VQF J;  4YB1 P;  5ETR A;  4LR9 A;  2YBV A;  2DYA A;  1NDP A;  1TUW A;  2HGL A;  5KFR A;  1Q8I A;  2M52 A;  3JSB A;  2VJU A;  1VC6 A;  3QJJ A;  3CCS S;  4DG1 A;  2PC6 A;  1WG5 A;  3C6T B;  4X4P A;  3ZZ0 A;  4JOU A;  3UD3 P;  4HI1 A;  1EZZ B;  1K73 T;  5CYQ B;  4ID5 A;  4YEA A;  5IOL A;  1RAI B;  4OJG A;  3TQE A;  4DUY F;  2KM8 B;  3PYF A;  3ZC4 A;  2HSE B;  2RSQ A;  4N7T A;  1S6O A;  3EE3 A;  2ZZN A;  1BY9 A;  8RUC A;  4F4X A;  4LRD A;  3VGU A;  2DPI A;  4NML A;  3SSS A;  5KFE A;  4WE1 B;  4KHP J;  1RT3 B;  3ET6 A;  1JLB A;  3A4T A;  2GVD A;  3MM7 B;  4EYI B;  4DQP A;  3G8Q A;  2JDJ A;  5J2P B;  4U7U D;  2GHV C;  1OY9 A;  5AE3 A;  4DFP A;  4DMZ A;  2ERR A;  1QVG R;  4DV4 J;  1N6Q A;  2MKK A;  1BQM A;  2A18 A;  2DY1 A;  1MN7 A;  1NXI A;  1ARO P;  2YNI A;  2B6A A;  3CDB A;  5A8R B;  5HN0 A;  5DG8 A;  2HMI A;  1TL1 A;  2OFH X;  5F0W A;  1R31 A;  2Y1L B;  2DGQ A;  2A2D A;  2CQG A;  1M5P C;  1U0H A;  3KKF A;  3I31 A;  4JBC A;  1NK7 A;  4WXO A;  1C0T B;  2V5H G;  2HQF A;  4P2F A;  4YB5 A;  3IA0 A;  4K59 A;  4YUD A;  2VPX B;  2AYB A;  4KPC A;  5H9F J;  3OJU A;  2DGW A;  5KT6 A;  2KVI A;  1RBA A;  1GQE A;  4KC5 A;  4C6A A;  3A1Y G;  4E2F B;  5K8M A;  3CCU S;  2R7Q A;  1TL4 A;  2MQQ A;  1WOS A;  1WSV A;  2YVS A;  4DPW A;  5K8O A;  1WG1 A;  4K0K J;  3R2C J;  2B7C B;  4MKB A;  4NLX A;  4E98 A;  1R0C B;  3B8H A;  3TAQ A;  2DXE A;  1NJX A;  1YJV A;  6FD1 A;  1VQ6 S;  1XMQ J;  4F2R A;  1Q78 A;  4XDD A;  2GV1 A;  2WHO A;  2VG6 B;  3P49 B;  2VPY B;  4FF2 A;  1GT8 A;  1HNX F;  4ITS A;  4K4S A;  4ZVR B;  5A76 A;  3GWC A;  4LQ9 A;  4IQX A;  3KLI B;  1K47 A;  1F3F A;  3Q8R B;  2QLX A;  5E41 A;  3AA8 A;  3D7S B;  4WP3 A;  4ZN3 A;  4LFA F;  1W2I A;  1R6Y A;  3TP2 A;  2I8E A;  2V69 A;  2L48 A;  5HSP A;  3B78 A;  2HWT A;  1TL7 B;  3RB4 A;  1IUJ A;  3EWG A;  1U1Q A;  4YB7 A;  3CDE A;  4RU2 A;  4O44 A;  5IT9 Y;  3PR5 B;  4PQU A;  5ETL A;  3L3C A;  3K5O A;  1VQK S;  1IBM J;  1FCA A;  1HQ2 A;  2QMX A;  2XWY A;  1PKU A;  4FYX B;  4QIG A;  1L3T A;  1J5O B;  4Q0B A;  5D8H B;  2ZJQ Q;  1OSC A;  4C3M A;  4C8N A;  4K7Q A;  3GV8 B;  2DNP A;  4ZMM A;  3OXF A;  5J1E B;  2AGP A;  2PMH A;  2C2E A;  2HBZ B;  4OI3 A;  2QGF B;  3FEX B;  5GMK a;  4RNN A;  4J9R A;  3VGS A;  1BHN A;  5GAH U;  1ZA1 B;  2AHO B;  4JI4 F;  1VQP S;  1LWC B;  3VQT A;  4F2S A;  2D3Z A;  3UDL A;  3MOJ B;  2OFG X;  3NEK A;  1LWE A;  2N4C A;  5ITH A;  3AJ2 A;  4WXW A;  2M3D A;  1NDK A;  3PW2 A;  1B7F A;  3GFX A;  3CDU A;  1B70 B;  2AZ3 A;  4DL6 A;  5KFI A;  4UF4 A;  1V6H A;  4WFY A;  4PG8 A;  3E8O A;  1RAC B;  1KFD A;  3ZNJ 1;  2YPZ A;  1FVQ A;  4RJV A;  5D15 A;  5C7P A;  1UVN A;  3AJ1 A;  1SC1 B;  3M8W A;  1S6Q A;  5DDR C;  4ED8 A;  3QSY B;  2IBK A;  2XZW A;  4IR9 A;  3D1O A;  5DM6 Q;  2DNL A;  1VQS A;  3F56 A;  3OHA A;  2HBR B;  4PEO A;  2CPJ A;  3AY0 A;  5KG2 A;  4M5K A;  2ZH9 A;  1TFY A;  1UVJ A;  2KN4 A;  4EUV A;  2VG5 A;  2BDP A;  4DR6 J;  4CT9 A;  1YZ6 A;  3BDP A;  4NAS A;  9RUB A;  3MEC A;  1JKH A;  1VRU A;  4RW8 B;  3W66 A;  1U1R A;  2OUG A;  3NCQ A;  3TVY A;  2W9C A;  1TKD A;  2IBO A;  2BJ1 A;  5CHC B;  2YNI B;  2UXB J;  3TI0 A;  2QA1 A;  1NK8 A;  4F26 A;  3R9L A;  1HI8 A;  4WTY A;  2P2C B;  1IKY B;  1L3K A;  2BM0 A;  2IRU A;  3NWR A;  3CSK A;  4F4A A;  4HKQ A;  3BPS P;  4NLD A;  1Z2L A;  3M6U A;  3KDN A;  2NRE A;  3QJP A;  1V3R A;  4C8Y A;  1SC3 B;  1TZ0 A;  2P5V A;  2IVM A;  3AT1 B;  3O6Q A;  3DOK A;  4HTJ A;  1IKV A;  5HQ8 A;  1YGY A;  1UA1 A;  5F8L A;  3DM2 A;  4C8O A;  3GCX P;  5MLC V;  5SZT A;  2L9N A;  4J9L A;  1HI0 P;  3BO3 A;  2HHX A;  4ECV A;  1LFP A;  2HGN A;  2W7O A;  4NXM F;  4R5P A;  3PR4 A;  4Z2X A;  2ZKT A;  3RRH A;  3KXD A;  4NLG A;  4KV8 B;  3WIU A;  1BMQ B;  4CLS A;  3HVT A;  4AND A;  4F4Z A;  3I4H X;  4MK9 A;  1AW0 A;  2CG4 A;  5BR8 J;  4IFV B;  2BE2 A;  3DMJ A;  4P71 A;  5A8W A;  1XNQ J;  3H7H B;  1T9U A;  1MRO B;  3I96 A;  2BV3 A;  4NZ7 A;  4KIA A;  1XQI A;  1Z2Z A;  3D67 A;  3NS7 B;  5J2M B;  3KNA A;  2DTJ A;  2PD1 A;  1ZPW X;  2M7S A;  2RUG A;  2V8G A;  2RRA A;  1FRL A;  1HL6 A;  1OY8 A;  2EEY A;  2XY7 A;  4X4U A;  4TU9 A;  3T1A A;  2B4V A;  2NCK L;  3TO8 A;  4OI1 A;  1QTM A;  4DX7 A;  1YIJ S;  2NYI A;  3QGH A;  2XMU A;  2QLJ B;  4FN5 A;  1OJ4 A;  4J9U E;  3THP A;  1KTV A;  3IO1 A;  3HKZ D;  3KJN B;  1SJ4 P;  2DO4 A;  3HJF A;  2CPY A;  3LAN A;  5KT4 A;  4FYY B;  1HLW A;  4A8X A;  3TAP A;  2FJX A;  4G3I A;  4Q0B B;  3M8Y A;  1J5O A;  4OL8 A;  1UL3 A;  3KWM A;  1N54 B;  1EKR A;  2C2O B;  5LT5 A;  1U09 A;  3GIM A;  4J9K A;  2LQ9 A;  2CNO B;  1LXN A;  3QQC D;  2WAQ D;  2YH0 A;  2F40 A;  3CDW A;  4CM0 A;  2R2T A;  4JYA J;  1JIH A;  5IQ6 A;  4FNH A;  1C2P A;  4UUX A;  2KT2 A;  3HHN B;  2RQK A;  2CNN B;  3EX7 B;  2UXC J;  2BM1 A;  3THT A;  1AB8 A;  2D9O A;  1S1V A;  2OO4 A;  4MH8 A;  2RS2 A;  4QWC A;  4BDP A;  4AL5 A;  2NZC A;  3KFW X;  2IIH A;  2MKS A;  2YKO A;  4URQ U;  2I6W A;  4LBP A;  3OPK A;  2ROG A;  4J91 A;  1JLE A;  2CPI A;  4JI7 F;  2B43 A;  2BZ2 A;  2Q1L A;  4Q43 A;  2HQI A;  2ZH6 A;  1JB0 C;  4MK8 A;  4NE9 C;  4WFX A;  2V8H A;  2ZHA A;  2GAG C;  1KLM A;  1D8Y A;  4NI2 B;  2R7R A;  1V3Z A;  1UP1 A;  2HFV A;  4NLV A;  1RHK B;  2OPP B;  3BBB A;  3JQM A;  2O01 C;  1WKJ A;  1FDB A;  1REG X;  4OYP A;  3VZI A;  3DCA A;  3T5H A;  1JLC B;  5A0Y A;  3HFV A;  4CLW A;  5KFW A;  1VRT B;  3KK1 A;  4TLQ A;  5KFN A;  3MPU B;  3BGU A;  1RTH A;  2EBE A;  4ZPW R;  2OP5 A;  5CD4 H;  2FJW A;  3OR1 A;  2ZIT A;  4LF4 J;  5GAD I;  2FLO A;  1C1C B;  3FFI B;  1XMO J;  4F0K A;  4HAC A;  2RQC A;  1QVF R;  2DXF A;  1IM6 A;  3OFE A;  2NUU G;  2HFO A;  2UZA A;  2Y0S D;  2NXJ A;  3CCJ S;  3BSO A;  4BLG A;  4DUT A;  2E5H A;  2ZC3 A;  4RLE A;  2LA4 A;  2YH1 A;  4ELU A;  4UTG A;  2DNY A;  4KKO B;  2KRB A;  5L46 A;  4A8Q A;  3QO9 A;  5KFC A;  2K3K A;  3DRX A;  3O5T B;  2CG8 A;  2EPI A;  2W24 A;  2XZT B;  2XMT A;  2XB2 D;  2CPZ A;  3MZI A;  1ZTT A;  2ZUG A;  1HWI A;  4O3Q A;  3H0P A;  2OGU A;  1WC6 A;  2VG7 A;  5B0E A;  4Z7C A;  1LW2 B;  3J7Y U;  2AU0 A;  1HQE B;  2A3J A;  2HS0 A;  3MEE A;  3M8Q A;  3AD7 C;  1DLO A;  3FK4 A;  2PE8 A;  4LRE A;  3PDN A;  1KQG B;  1UWB B;  1OSD A;  3IWN C;  4X84 A;  2EFP A;  1U1O A;  5KFD A;  3EGN A;  2H9Z A;  3KG4 A;  2BX6 A;  2R2U A;  4M5J A;  1RAH B;  2WVE A;  2DEI A;  3AOC A;  4DV3 J;  3AOA A;  2XO7 A;  3DGP A;  4OZ3 A;  2BE2 B;  3DMJ B;  2DJW A;  2JFD A;  1I51 B;  2VOO A;  2AZ1 A;  3CTR A;  3M30 A;  2HVE A;  4FPI A;  2E9T A;  2X3D A;  1F6T A;  3QGI A;  1HNI A;  3CF5 Q;  4C8K A;  3K5P A;  2DNH A;  1N48 A;  5F3T A;  3L7P A;  1W26 A;  3IS9 A;  2HGM A;  4G1Q A;  2ZH8 A;  1BQN A;  1NK0 A;  2RIJ A;  3T6B A;  4ZPV R;  4DZD A;  1KQS R;  1WEL A;  2D3U A;  4MT1 A;  1OQ3 A;  2ZD1 B;  2HMI B;  1NLK L;  2CDQ A;  1KDN A;  5KG4 A;  2MJU A;  3SFG A;  2HHT A;  4KFB A;  2B4P A;  3T41 A;  3SI8 A;  3W1Y C;  3H59 A;  4QIE A;  1ELO A;  1N33 F;  1UJ5 A;  3U1L A;  3ITH B;  2ZNY A;  5B0C A;  1GMW A;  2KL8 A;  2GQQ A;  4K2J A;  4Z37 A;  1QLN A;  2LCW A;  4W92 B;  4X64 F;  1Z1Z A;  1H7X A;  4OZL A;  5L9N A;  1RAD B;  3G86 A;  1NSQ A;  2IMW P;  2ZHB A;  5LMU F;  2Q6B A;  4OJH A;  3FBE A;  1T9V A;  3T6J A;  2HWH A;  3T5L A;  1Q5V A;  3FRZ A;  4QYZ J;  4JI0 F;  3CGI A;  2M4M A;  2WB1 D;  3NG8 A;  4HHU A;  2ASY A;  5C42 B;  5ETM A;  1JJ2 R;  4PG5 A;  1LQ9 A;  1REV B;  1S49 A;  1U8W A;  4ES3 A;  2ZVS A;  3D3B J;  4TY9 A;  2QA4 G;  4MFB B;  3QRQ A;  1DUR A;  3W9H A;  1FER A;  1RWP B;  1U4B A;  3ISN D;  2MKJ A;  3C14 B;  3ILI A;  4LRC A;  1NSK L;  2A0F B;  1IKW A;  3LF0 A;  2OPQ B;  4RW4 B;  1N33 J;  3G96 A;  2ZH4 A;  3PW5 A;  4PWD B;  1VRQ C;  1XC9 A;  2NSC A;  2DNZ A;  2FD2 A;  3HD1 A;  2V6A A;  3N5B A;  3KLI A;  3D0G E;  1AT1 B;  2VFR A;  1YJT A;  3CE8 A;  1YRU A;  3MTJ A;  2NR0 A;  1EQM A;  5T14 A;  1CC8 A;  1S12 A;  4DV6 J;  4LFB F;  4DV0 F;  4NRT A;  2Z57 B;  1KQK A;  2KJW A;  2GHW A;  5A6P A;  2HAI A;  2MLY A;  4WIQ A;  2ZBR A;  1JXL A;  5EWG A;  2XSF A;  3BGO P;  3AB2 B;  3QT8 A;  4GVB B;  3RGI A;  4I7F B;  2VA2 A;  2RIL A;  4UY8 T;  2BAN A;  1FKO A;  1Q8K A;  1S7I A;  3KK1 B;  1RAB B;  3MCO A;  1H74 A;  2CPF A;  4JB8 B;  1RQ0 A;  4OZJ A;  4X66 F;  3TQ1 A;  1GAO A;  5IC6 B;  3X1L B;  1JLF A;  2JL9 A;  3IAS 9;  2MKC A;  3M2R A;  2F4F A;  4NA2 A;  4UW2 A;  2DR9 A;  4PUO B;  2OSQ A;  3OR1 B;  3UDC A;  5D3G A;  4ZVF A;  2CAD A;  4E8U A;  1IQT A;  4JI1 J;  3GR1 A;  1IQZ A;  1MWZ A;  2B4O A;  2UUC J;  4OX9 F;  3HZE A;  2AGO A;  5KFU A;  3ONQ A;  4CO1 A;  4DWI A;  2B9Y A;  1GK8 A;  3I9V 9;  4AT1 B;  4EMD A;  2C42 A;  4ED6 A;  3Q89 A;  4K5R A;  3QRR A;  4F36 A;  2PII A;  2CFX A;  4OZ2 A;  3W5Z A;  2R8H A;  1IBL F;  3PRV A;  4Y6I A;  2H5I B;  4DCJ B;  4XK8 C;  2KXN B;  4GKK J;  3TAN A;  3AXM A;  3HVW A;  4X65 F;  2MQL A;  2B56 A;  2J7U A;  3IR7 B;  3CT9 A;  4OX7 A;  5IM0 A;  2M8D B;  4ECY A;  4LVN P;  2C3U A;  2AJF E;  3KLH A;  2CYY A;  3DLK B;  3RJM B;  5KG7 A;  2K1R B;  4QU6 A;  1UVM A;  3PIO Q;  4O0N A;  2ZJR Q;  1XMB A;  3DLJ A;  2DIS A;  3GR0 A;  5HO4 A;  1H7W A;  2Q79 A;  1UTA A;  1R8P A;  1U1N A;  3MM9 B;  3DGP B;  4OYX A;  4CNY A;  3DLG B;  1X7V A;  3CJ5 A;  1BQX A;  1S1X B;  5DGB A;  1TAQ A;  3GCW P;  2PA8 D;  3FSX A;  1RA7 A;  1YRT A;  1Q8L A;  2V68 A;  2BOA A;  3M30 B;  3KMQ A;  1IN0 A;  4WFA Q;  1U45 A;  4DR6 F;  2IJF A;  4OZN A;  3D3C J;  2AQ4 A;  1HPZ A;  1J5E F;  4DSI A;  2WW4 A;  4NEZ A;  5CH7 B;  1GMW D;  4DXL A;  3SDE A;  1TKT B;  3N4W A;  1UA0 A;  5GMD A;  3N28 A;  1NAQ A;  1WF2 A;  2QL9 B;  9ATC B;  1FDD A;  4TYA A;  2YWF A;  2ZBQ A;  3CJ0 A;  3MCN A;  4DL2 A;  2DR7 A;  4AQY F;  4DR2 J;  2FVQ A;  1GXT A;  3QSI A;  2UXD F;  1HYS A;  1BUX A;  3F44 A;  4U9R A;  1QDU B;  2ZDO A;  5D4L A;  1IKY A;  3GYG A;  2J8S A;  2DGS A;  3ITH A;  3HUL A;  3S8S A;  3KK2 B;  1B99 A;  2W4P A;  4OQJ A;  4YQW A;  1RT1 B;  4PXD A;  5AE2 A;  2MQP A;  2HAF A;  3V4I B;  4WII A;  4RW7 B;  4CT8 A;  5C25 A;  1CPZ A;  2VQE J;  3LP1 B;  4I1T A;  1NB7 A;  2P6T A;  1YJU A;  1FRJ A;  1WEX A;  3UN2 A;  2JEG A;  1UZH A;  1U1P A;  4Q44 A;  2PEB A;  4F3O A;  4JI5 J;  4P7T A;  1YBU A;  2VH7 A;  3B54 A;  2JEJ A;  5L1K A;  4C0O C;  4ED0 A;  2W25 A;  4HDH A;  4KV8 A;  1F5C A;  2BJ7 A;  3HVT B;  2UXD J;  3KUH A;  4OYO A;  2W4D A;  2CKW A;  5C25 B;  4FP9 A;  3NGR A;  3K57 A;  3OLA A;  3VGV A;  4DPY A;  2HYI B;  1KS2 A;  5KT3 A;  3R5B A;  3M2V B;  3NLC A;  1G6B A;  3D6F B;  5CYM B;  5DLG A;  1N36 F;  2YWH A;  1NB2 A;  3DDK A;  2VV5 A;  2YWE A;  5B0B A;  3QIP A;  4X4R A;  3OUY B;  4EWT A;  1U1K A;  1NK4 A;  2R4F A;  4A8S A;  1T8E A;  3CJQ A;  2GO9 A;  1P8G A;  3GZ7 A;  3HMJ G;  3LTO A;  3JQK A;  3K0J A;  1HMV A;  1HBM A;  3GSD A;  4C3K A;  2BUN A;  5I3P A;  2HND B;  3GJQ B;  1YRX A;  5U47 A;  2LEP A;  5B7W A;  5DZ7 A;  4R8U B;  4P6Q A;  4YY3 F;  2G9O A;  1XWL A;  2J5A A;  2HHP A;  4PG7 A;  1TP7 A;  2B5J A;  1RB0 A;  4KYZ A;  5D3G B;  3GU0 A;  2DNN A;  3OW2 R;  3NS5 A;  2R7S A;  4A4J A;  1T95 A;  2MYF A;  2MXY A;  1SUQ A;  2FHM A;  2XLJ A;  1X31 C;  4JI7 J;  2FY1 A;  3UDV A;  4FZV A;  4KHP F;  3GYX B;  1SIW B;  1RWM B;  4RZR A;  1H38 A;  2W2P P;  5KFY A;  1AA1 B;  2CQ0 A;  4O4G B;  1X0F A;  1NSA A;  2JC0 A;  3P96 A;  2BJ3 A;  3CJ3 A;  1N5S A;  1WF1 A;  1NK9 A;  3CD7 A;  5KFT A;  4JI0 J;  5K8P A;  4TQR A;  4V19 J;  2GMJ A;  1ZA2 B;  4K4U A;  1D0E A;  1WI6 A;  2WSC C;  1QAJ A;  2HG4 A;  4FF3 A;  1WKL A;  2FIU A;  1OY6 A;  3CJ8 A;  1T94 A;  4B3R J;  4OLP A;  5DJB A;  4B3M J;  2OTL S;  4W90 B;  4DV3 F;  4EFA C;  2UXB F;  1JLE B;  2R3V A;  2F5G A;  4MMO A;  1EET B;  5HQM A;  2KM8 C;  2APO A;  4KJI A;  1FXL A;  1F2H A;  3HHL C;  5KG5 A;  2IJR A;  1RHR B;  1FO1 A;  4J9O A;  1RHM B;  1S9F A;  1P9Q C;  1S9E B;  3I82 A;  2V2V A;  5EWF A;  5EHH A;  4I4B A;  3RB6 A;  1UJ6 A;  3R6G B;  5M2R A;  1HHT P;  5E33 A;  3NCR A;  1HR0 F;  3GFZ A;  2JJ4 D;  1WOP A;  1UW4 A;  1V9O A;  1PJ6 A;  3RZA A;  4UST A;  3W2W A;  1RTH B;  3BO2 A;  3HHK A;  3D1H A;  2R8I A;  5AJ3 F;  5JUM A;  4AFF A;  4ENO A;  1XMQ F;  1FJE B;  5GAE U;  3A3N B;  4DFM A;  3CWJ A;  1VBK A;  3AJD A;  4FKY A;  1JWW A;  2XS7 A;  3BN7 A;  2MZT A;  3CD0 A;  1H98 A;  3MUR P;  2XYP B;  5JJB A;  5DZ6 A;  3FRY A;  1ACM B;  3O2I A;  3MWB A;  1SPB P;  2IAJ B;  4QU7 A;  1RWX B;  1DTT A;  3SV3 A;  1T05 B;  1W25 A;  1T7P A;  3JTP A;  3LOU A;  3UQS A;  3VR1 A;  4F4K A;  2XCA A;  5HAO A;  3CED A;  4KKO A;  3KK2 A;  2ALY B;  3A3O B;  3QO9 B;  3GV7 B;  2AD9 A;  2DHH A;  1RKJ A;  1RAJ A;  2BRL A;  2E1A A;  2MY8 A;  2IM2 A;  3KUG A;  1BWV A;  1VOM A;  2J9D E;  3GMG A;  3Q8U A;  4G6V B;  2OML A;  2NPF A;  5B0F A;  2RQM A;  3MI7 X;  4ZIT A;  1SKS A;  1TK0 A;  2KKH A;  4WZM A;  2RF2 A;  3MM8 B;  2UVU A;  4BWM A;  2PO4 A;  2BAB A;  2NLW A;  4OI4 A;  3LW5 C;  4ECS A;  2ZE2 B;  4Y2C A;  5IXU A;  1TUV A;  3QAU A;  3RBD A;  2JVO A;  1U6Z A;  2Z2L A;  3O3L A;  1JMT A;  4TYB A;  3Q8S B;  3H40 A;  4ECR A;  1HNZ F;  3MMJ A;  1KSP A;  1IR0 A;  1RLC L;  1SQG A;  2EXU A;  3HFZ B;  2R7U A;  2FJD B;  2XYG B;  3CCW A;  2BKN A;  3D4J A;  2F8H A;  3QFW A;  1T9W A;  2A10 A;  4FXV A;  4RL1 A;  2IVF B;  1TKZ A;  2FDN A;  3BGF A;  3WC0 A;  1R0A A;  2GC8 A;  2VDH A;  3TW0 A;  4NXN J;  2EG2 A;  2E1R A;  2OHD A;  3GIK A;  1NU4 A;  3WX4 A;  3OTO F;  3N6M A;  1TTH B;  3CME S;  2BAC A;  4OI0 A;  3TX8 A;  3SV4 A;  2D74 B;  4OHX A;  2XI2 A;  4KFB B;  1X4H A;  1XN9 A;  1CJV A;  3TUJ C;  4RUC A;  1IJE B;  3RR8 A;  1FWK A;  3PXG a;  4I56 A;  2HND A;  1NK5 A;  1HNZ J;  2Y9H A;  2OPS B;  3QNW B;  1O6X A;  1PBU A;  1E6V B;  2M5Y A;  1DQ8 A;  3PAC A;  1MWY A;  3OL7 A;  1BD6 A;  1FT8 A;  5D77 A;  2UU9 F;  2HS4 A;  1LK5 A;  1D1U A;  2WB4 A;  3ELH A;  2HPU A;  4DCP B;  1RYS A;  2EFV A;  4WCE Q;  1LK7 A;  1H3D A;  2CVE A;  3U7J A;  3OTO J;  1X8D A;  5C42 A;  3J7A 1;  1AFJ A;  2XHC A;  4Q5V A;  2M9K A;  1NCL A;  2BYC A;  3L09 A;  2FPH X;  4DV1 F;  3TJA A;  4HHH A;  3WHI A;  4ICL A;  1S77 D;  1N34 J;  3CC2 S;  3JYT B;  3OVB A;  4C7Q A;  1N5Q A;  2DGO A;  2YNG A;  3FDS A;  2MLZ A;  5IWA J;  1YTY A;  2X1G A;  4LSN A;  2QL5 B;  3QLH B;  3Q22 A;  2NPI A;  3DOL A;  4KY3 A;  1FJG J;  4NEY A;  1L3V A;  3TJ8 A;  4JV1 A;  5D78 A;  2WVD A;  2B9W A;  3CMQ A;  1B64 A;  2ABY A;  1EKS A;  1QE1 A;  2GCF A;  4EBE A;  3IR6 B;  3RU0 A;  2YWW A;  4C0B A;  4F67 A;  3GP9 A;  5KT2 A;  3MM5 A;  3A13 A;  4C0H A;  2JLF A;  4DV4 F;  5F0U A;  3KJQ B;  2V9K A;  4ZVT B;  5F8N A;  2CWX A;  3ZZT A;  1Q82 T;  3FEZ A;  3MPV A;  1T3O A;  4DR2 F;  1TEL A;  1N5Y B;  3BSC A;  4DUY J;  4O3S A;  4TN2 A;  2QO3 A;  1PG5 B;  4BBY A;  2VJV A;  3UO0 A;  3W5X A;  1VQ9 S;  4OX9 J;  1CUL A;  4OI6 A;  3W8P A;  2X51 A;  3MMC A;  1VFJ A;  4QR1 A;  4ZIW A;  5KOW A;  2DHG A;  4WFZ A;  1FKP A;  2VPW B;  2YNF B;  2IVY A;  1IWA A;  1HW9 A;  2ZOG A;  1HKA A;  1NZA A;  3BR9 A;  4AYB D;  3KLF B;  4HVZ A;  4X4Q A;  1VC0 A;  1Q1K A;  3R5G A;  4ZCL A;  1ICE B;  2H5E A;  3M9N B;  4TNO A;  4CO4 A;  4X65 J;  2FVC A;  4DSK A;  4DV7 J;  2IYG A;  2XSJ A;  3C16 B;  1VR6 A;  3MM8 A;  5IM0 B;  5KFM A;  1R8B A;  4U8V A;  3N01 A;  4OHZ A;  4QPX A;  1VQL S;  4NZ6 A;  2ZE2 A;  2E1C A;  2HFZ A;  4LF8 F;  2KYZ A;  1OPZ A;  4CO2 A;  2ZZT A;  4Q2L A;  3Q0A A;  4IG0 B;  2YKM A;  3HHL D;  3IG1 B;  3HDS A;  4IDK A;  4ZS6 A;  3IWX A;  2Y1J A;  3NGU A;  5IQQ A;  3JSM A;  3UNG C;  2BOP A;  4NLW A;  2IMO A;  3MR5 A;  1FFG B;  3OFG A;  4P74 A;  4OZ1 A;  2YTC A;  2PMZ D;  1WHV A;  3K17 A;  3PYG A;  4MYU A;  3TOQ A;  4ZJQ A;  2ALZ A;  4IQM A;  2OIH A;  4B9M A;  1CQN A;  1HPZ B;  1PIE A;  2C3Y A;  2V4J B;  4URS A;  5KFA A;  1U48 A;  3DI6 A;  1SH0 A;  3D6H B;  4DR1 F;  1SL0 A;  2Q66 A;  2FVP A;  4HL9 A;  4IH5 A;  2NQP A;  2DNO A;  3HFK A;  4F4W A;  4A8W A;  1VQN S;  4Y34 A;  3MD3 A;  1MW7 A;  4K5S A;  5BJR A;  2B6A B;  2VBX A;  2UVR A;  3JSY A;  2WON B;  2VOD A;  4ILR A;  1RHU B;  3W5Y A;  1KVJ A;  2MTL A;  2GIQ A;  3HPO A;  5F8I A;  4EBD A;  3M2U B;  1NK6 A;  1U02 A;  3RW6 A;  4B3T J;  2M8H A;  3IBC B;  1RYR A;  1S1W A;  3LPE A;  4QBU A;  4YS2 A;  1XNR J;  3SMZ A;  1RT1 A;  4RW7 A;  1S0M A;  1QUP A;  3IBW A;  2WOM A;  4IKA A;  5KFS A;  4EGL A;  3MED B;  4LFB J;  3W8G A;  4M5M A;  3MFI A;  3BKT A;  4DUZ J;  3LGH A;  3GE9 A;  1S4F A;  2LFV A;  4B08 A;  4K50 A;  2VON A;  3FBB A;  3H20 A;  3TVZ A;  3BQ1 A;  4DF4 A;  2IY5 B;  4ZHR B;  1T9Y A;  1VIO A;  4ZLL A;  5E7O B;  5C2C A;  2CQH A;  2I0X A;  3JYT A;  2YNG B;  3M1V A;  3ZTS A;  4LF9 J;  1RHJ B;  1VJQ A;  4QIW D;  3TVK A;  3KHG A;  2WTF A;  1D9D A;  1C0U A;  2CPD A;  4DU8 A;  4JI1 F;  5C2G A;  2X7I A;  5T7L A;  2RUS A;  2JH3 A;  3R1L A;  4RW9 B;  2UVW A;  3NGS A;  5LMU J;  2W2N P;  3PJW A;  3R8Y A;  2W7P A;  2DKO B;  1QE1 B;  3OFH A;  1HR0 J;  1DQA A;  2JVR A;  4NLR A;  5AT1 B;  4I0W A;  4JI6 F;  2DR5 A;  3MTK A;  2AWZ A;  2DBB A;  2W7A A;  4U8Y A;  2O3D A;  2HZV A;  2E9Z A;  4O3R A;  3LO3 A;  2R7T A;  1VQ4 S;  2W1B A;  3KLE B;  1AYE A;  1D8Z A;  2DVI A;  1JLA A;  1U24 A;  1FD2 A;  2P9G A;  2FLN A;  1R8H A;  3CPW R;  3F41 A;  2P8I A;  4TVA B;  2R9L A;  3EM1 A;  3MMC B;  3AD8 C;  1YZ7 A;  3AOB A;  1X9W A;  2DHX A;  2AJ2 A;  1UPP A;  4BS2 A;  4USK A;  2XZD B;  1J5E J;  3OBI A;  2V2K A;  4NYZ A;  1DY3 A;  3PW0 A;  2GJI A;  2DGX A;  2WBM A;  3PRB A;  3HT0 A;  3RG6 A;  3HD2 A;  4DR7 J;  2WW8 A;  3MMB A;  2CZV C;  1Q7Y T;  1RT6 A;  1X4F A;  5IC4 B;  3DU5 A;  4OJ1 A;  3MR3 A;  4MKY A;  2FJA B;  3W63 A;  1EET A;  4LIR A;  4ER8 A;  2O1P A;  1IR1 A;  5EN1 A;  2MZJ A;  1QAY A;  2CNL B;  4LRF A;  4IDK B;  4IG0 A;  4RKU C;  3TWZ A;  2HIY A;  4Y0F A;  4ID8 A;  1HA1 A;  3ZTQ A;  3T5K A;  2F8E X;  1Y4Z B;  1Z4U A;  5EWE A;  2PT0 A;  1CQM A;  1S0N A;  2JEI A;  4WWS A;  1VS3 A;  1HHS A;  4HT5 A;  3R2D J;  3D68 A;  4ZJL A;  3VVT A;  2VQE F;  2YY3 A;  2AT1 B;  2ZBI A;  1IBL J;  1WI8 A;  2VG5 B;  4LF6 F;  2MZR A;  4BC7 A;  4ZVO B;  4ZLN A;  4EEY A;  1S76 D;  3DI6 B;  3QAT A;  4LMZ A;  4RW8 A;  4ED7 A;  2KT3 A;  1ZH5 A;  3PM9 A;  5F41 A;  3AA9 A;  3SEO A;  5BXI A;  5F8H A;  1IVZ A;  2ROP A;  5HRO A;  2UUB F;  2ZOF A;  3LH2 S;  4KH1 B;  1AZS B;  1F5B A;  1UAW A;  4M5G A;  4ILL A;  5M2P A;  1I5O B;  1FRI A;  3D6T B;  4HR2 A;  5HK4 A;  5KFH A;  5DG9 A;  2FVR A;  2JNJ A;  1FJ7 A;  3X3U A;  2OTJ S;  1OS5 A;  2YQ1 A;  2QEX S;  2V4Q A;  1GX5 A;  3WQP A;  3NKY A;  2WK4 A;  4MTP A;  4CLL A;  4C9D A;  1I94 J;  4FF4 A;  4GKK F;  3THV A;  2WOM B;  5LSR A;  1ZYQ A;  3KG0 A;  1T02 A;  3EZO A;  4ZVU B;  3TEH B;  2FTR A;  1YSJ A;  1RWN B;  1JNZ B;  1TL3 B;  1OWX A;  1UFK A;  3R5J B;  3MAA B;  3H8Y A;  3OXL A;  3GB0 A;  3BZQ A;  3BGR B;  4DI6 A;  5FJ4 A;  5LM7 E;  3G6X A;  1W2B R;  5K14 B;  1VIS A;  3KK3 A;  3UR3 C;  1N0V C;  2RHQ B;  3PKM A;  4IFV A;  2KVQ E;  3M1V B;  3MXH P;  4F4Y A;  1VDH A;  3TNV A;  4HI2 A;  4K4Z A;  2DHA A;  2EFG A;  3L4B C;  4RBU A;  1SH2 A;  1MLA A;  1UPM B;  3GFY A;  3K8W A;  4HTI A;  2ATC B;  3RB0 A;  1PGZ A;  1B3T A;  1UVK A;  3IM8 A;  1RCO B;  2MEW A;  4JP8 A;  4QPT A;  5LL6 d;  4CYU A;  2EFO A;  2UXC F;  5KFG A;  1NJZ A;  3RUB L;  1LWX A;  4AQY J;  1YJ9 S;  1RTD A;  2VHG A;  3US5 A;  4GKJ J;  1CJV B;  5BYQ A;  1WTF A;  4ED2 A;  3T5J A;  2HK2 A;  4RWW A;  4LF4 F;  3ZXW A;  4Q8E A;  1RAO A;  1GMV A;  1IM4 A;  2DCU B;  4GVL A;  2YX1 A;  1E6V A;  3ILJ A;  3NP5 A;  4QW8 A;  2HVD A;  3GIL A;  5HMX A;  3VAL A;  2R8G A;  2LMI A;  2X1B A;  3UE2 A;  3MEG B;  3BF4 A;  2RB7 A;  4C11 A;  5A8K B;  1D09 B;  1DTQ B;  3HF5 A;  3UCZ P;  3NS6 A;  3W9I A;  1IJF B;  4U67 Q;  3E01 B;  2ZH5 A;  3ZTO A;  3DNC A;  3OVS A;  4AL7 A;  1F9H A;  1GNK A;  1AFI A;  2W8K A;  3W60 A;  4DUZ F;  1K8A T;  2XI3 A;  1SJ1 A;  1T0T V;  2BW7 A;  2YNH B;  4EBC A;  4DS4 A;  1NH8 A;  2DGV A;  4ICL B;  3M4X A;  1TUG B;  2Y1R I;  4FBT A;  3IGV A;  2BA9 A;  2CJB A;  3P45 B;  5IZH A;  2BBE A;  3U1M A;  1UVI A;  2HHS A;  1HNV B;  1RWK B;  5KTQ A;  2OH2 A;  2IYI A;  3UNY A;  2CQ3 A;  1Q8B A;  2W9A A;  3AFG A;  5ETV A;  1I1G A;  1I3O B;  5A6W A;  2N3O A;  1SJ3 P;  1CG2 A;  1L5U A;  1G4C A;  1PYT A;  1KLM B;  2W9B A;  4ZKA A;  3FNN A;  3CUN A;  2G0I A;  3V4M A;  2VKZ G;  3PW4 A;  2HHH F;  1ITP A;  3PW7 A;  3P5B P;  2YX7 A;  4DR1 J;  1QSS A;  2LU2 A;  4YHH F;  4XPE A;  3TX0 A;  1WC3 A;  1HIY A;  2OPR A;  5CAB A;  1YIT S;  1O5J A;  3R7N B;  1RU1 A;  4F7V A;  2R2S A;  1U26 A;  1HQU A;  1Y3K A;  1JJ4 A;  4B3R F;  3MMA B;  1X4B A;  1DBD A;  1DQ9 A;  2J7K A;  3IXQ A;  1CJT A;  1EJ7 L;  1PCA A;  1WJ9 A;  3FFI A;  4NLU A;  2HUR A;  1AZS A;  3LGM A;  1CUL B;  2H4W B;  2K06 A;  1JNR B;  2J76 E;  4NA3 A;  1T11 A;  2J0Q D;  2MJN A;  5SUH A;  4ZP9 A;  1MMN A;  3O44 A;  3NL0 A;  4CH7 A;  2RS8 A;  3AOD A;  3VAH A;  5AXL A;  4OMF G;  5HBM A;  2DRB A;  1KP6 A;  2YWG A;  3RYL A;  3D0I E;  1WOO A;  4ECU A;  1URN A;  3GON A;  2YKN B;  3NOG A;  2DNM A;  3R5C A;  3GQC A;  5CD4 A;  4CLT A;  2NS1 B;  3EGV A;  3UI3 A;  3UCU P;  4HH1 A;  4C97 A;  5KFO A;  2UV8 A;  2V94 A;  5AJ3 J;  4B9V A;  1TL3 A;  1DLO B;  5I4M A;  2HBQ B;  1B0V A;  3MAA A;  2V34 A;  3G6E S;  5ETP A;  4O3N A;  2GQ2 A;  3QWP A;  4NCG B;  2ZZM A;  3BGR A;  4LF9 F;  2DIU A;  2YKM B;  2H3E B;  1E6Y B;  4H4O B;  1Y5I B;  1RA6 A;  3PNI A;  4PYA A;  4Y2I A;  3GJR B;  1DAX A;  3DLE B;  4I2P B;  4ZPT R;  4B02 A;  2V2Q A;  2V8P A;  1VLY A;  4R0J A;  1HFE L;  4WU2 A;  2HRY A;  2XNQ A;  4ZPB A;  2MQN A;  4J9P A;  2C22 A;  3W2V B;  2KYX A;  2LU1 A;  2EI5 A;  4KHM A;  1A9N B;  1XK8 A;  2V4J A;  4QJV A;  4PYD A;  4FBU A;  1WKK A;  3Q8Y A;  4KTQ A;  2HFN A;  2KTQ A;  5EGY A;  4UZB A;  1KR4 A;  2HRT A;  3ILL A;  4JI3 J;  3MR7 A;  2HNY A;  2EKY A;  1FE4 A;  4F04 B;  4LF6 J;  2BXJ A;  2H65 B;  1FNX H;  5HP1 B;  1TVR A;  3MF5 A;  1U2C A;  1H73 A;  2Q43 A;  2A1B A;  5D4P A;  2UUA F;  1RLD A;  4WPA A;  3QJL A;  2Y3Y A;  3I5B A;  2HFS A;  2OD4 A;  5E3A A;  2BE9 B;  4NXM J;  1WG4 A;  2Z0G A;  4ZCI A;  1KOO A;  5THW A;  3DRR A;  3OSN A;  3BM7 A;  3DC2 A;  2XGQ A;  1DTQ A;  4NA1 A;  3DRY A;  1RWO B;  3RRK A;  3TA0 A;  3BRE A;  3HI9 A;  1OPI A;  5GAG I;  3Q8Q B;  1VC5 A;  1HWJ A;  4USH A;  3HP6 A;  1TAU A;  3PEH A;  3K2Y A;  3OTD A;  1HBO A;  1Y9O A;  2ILZ A;  3BBC A;  3IN5 A;  2PA3 A;  2VIC A;  3PV8 A;  1ZTW A;  3OD2 A;  1LW0 B;  1NJI T;  1RP5 A;  2D41 A;  3BB5 A;  4MFB A;  3N79 A;  3HCX A;  2L9D A;  3VCD A;  4M94 A;  3DFE A;  3H2V E;  3M8R A;  3C14 A;  1K44 A;  3W64 A;  3DHW C;  4RW4 A;  3SZ2 A;  2LEA A;  5GAE I;  2ZKU A;  3BGL A;  4Y2A A;  1UFL A;  2BJ8 A;  5B0A A;  1C0U B;  1QTN B;  3CCZ A;  3D9B A;  3ENA A;  3HKW A;  1U1L A;  2OD6 A;  4X4O A;  4HLB A;  2JOQ A;  3I6P A;  4QYZ K;  5LMN J;  2J9E A;  2QN6 B;  3MDF A;  1UMJ A;  5G4D A;  5KG3 A;  1S6P B;  4O0I A;  4A8K A;  3L95 X;  4NXN F;  1FRK A;  2BW2 A;  3NAH A;  3F73 A;  4WP8 A;  3ILO A;  2POK A;  4DZ6 A;  1NJY A;  1OMS A;  4GVB A;  4IUF A;  1EAR A;  1O0P A;  4OLO A;  1FKO B;  4OV1 A;  5EUH A;  1RJJ A;  4DR5 F;  1VIX A;  4DV7 F;  1QSY A;  1IR2 A;  4CO0 A;  2FHJ D;  3IRW P;  3NNH A;  1CEZ A;  2O66 A;  1TK8 A;  2DD8 S;  4RBT A;  2NXC A;  4LSL A;  5BYR A;  3PX0 A;  3CD6 S;  2VFU A;  3J80 U;  1RAA B;  4USJ C;  1RT2 B;  2PDA A;  3M8P A;  5DDP C;  3HVR A;  2HRU A;  3SIP B;  2DPJ A;  4OI2 A;  4XTT A;  2WCX A;  3KJV A;  2VPZ B;  1TK5 A;  1Y7P A;  2RD5 C;  1YHQ S;  2QTW A;  5HAT A;  1SJR A;  2MHE A;  4WFB Q;  2HEK A;  4TQS A;  3MM7 A;  1X60 A;  3DN9 A;  5B0G A;  2XUL A;  2LXF A;  5FD1 A;  4JYA F;  2YXL A;  2V67 A;  6AT1 B;  5HBM B;  2W2Q P;  4M5D B;  5J2Q A;  2AEM A;  3V81 A;  1U8S A;  3ULH A;  1R27 B;  2KHD A;  3C6T A;  1TL1 B;  3UVJ A;  4Q2M A;  2Y0B B;  3CVK A;  4Q8F A;  4WK1 A;  4UZC A;  2FJE B;  2LA6 A;  4H4K A;  1YLX A;  2IA0 A;  3CNQ P;  3KLH B;  2HHU A;  2VBZ A;  3BPD A;  3TUZ C;  5F3Z A;  2B8Q A;  4LF1 A;  4FYD A;  1M0S A;  2W8L A;  4B3T F;  1RT7 B;  4PAB A;  2XEX A;  2VFS A;  4WTO B;  2CPH A;  4CP5 A;  2VFT A;  2E7X A;  3PFE A;  4QR0 A;  4RU9 A;  3TA2 A;  1RT3 A;  3ET6 B;  1JLB B;  2ZJP Q;  2GVD B;  3J7Y I;  3N5F A;  1FA0 A;  5K8N A;  5J2P A;  3FCV A;  2E1P A;  1LWF A;  1PAE X;  1TKT A;  1FWL A;  1N6Q B;  3FMW A;  5HRO B;  1LXJ A;  2HNY B;  2SXL A;  3E51 A;  3IC1 A;  4RNM A;  4UQG A;  3HXM A;  1RAE B;  3BJY A;  2A2C A;  3DLL Q;  1TVR B;  3CCV S;  3MHY A;  1F60 B;  3TUI C;  2MPU A;  1C1B A;  2MMY A;  5J2N B;  3OV7 A;  2RDD A;  1GMU A;  2PMW A;  3K7R A;  4L74 A;  1VQ5 S;  3MCS A;  1UJ4 A;  3T3F A;  3UR0 A;  1S6U A;  1XER A;  3LP0 A;  2XY6 A;  1C0T A;  5DG7 A;  4J9M A;  2O5D A;  1FVS A;  3HHD A;  2DXD A;  3H5Y A;  4LFC F;  2YKP A;  3MFH A;  5LJ3 Y;  4M8L A;  4O44 B;  3SQG B;  3P6Y C;  4R25 A;  1VHI A;  1LOU A;  1WD6 A;  3MM6 B;  4OYB A;  3UDE A;  4YR2 A;  2FYX A;  1HBO B;  4ED5 A;  3HT3 A;  1WNE A;  2B0G A;  4Y28 C;  1S1T B;  3PHT A;  4DPU A;  5DM7 Q;  2XG8 A;  1DFD A;  1FNO A;  2N7Y A;  5LJ5 Y;  2K7J A;  1U49 A;  1Y5L B;  3I9Z A;  1Q5Y A;  5LSO A;  1G1X A;  2HLU A;  2ZHO A;  3TJ9 A;  3UN5 A;  1N36 J;  2KG0 A;  1HHQ A;  5CYM A;  1V3S A;  5JXS A;  1R8C A;  1MN9 A;  2NXU A;  4RWX A;  4LFA J;  3LAL A;  3PY8 A;  2HVZ A;  2CQD A;  3EVO A;  4DJB A;  4IFY B;  2JZ5 A;  2KFY A;  5D4O A;  5ETS A;  2KZM A;  1R8A A;  1HWU A;  2Z2M A;  4CLF A;  4PG4 A;  3EZU A;  1TL7 A;  2HZA A;  3C66 A;  4KBI A;  3SCI E;  3TR5 A;  2V4R A;  1V5V A;  1M5H A;  1HBM B;  4DSE A;  4YFU A;  1UET A;  2QZ8 A;  3GIR A;  4R8U A;  3EXY A;  3UD5 A;  4Q45 A;  4LBH A;  4LSL B;  5KAK A;  2XMA A;  1KN6 A;  2CUY A;  2B5J B;  3R5A A;  1S99 A;  2JC1 A;  4X4N A;  1DHM A;  2P9E A;  4KGK A;  1H2V Z;  5MAO A;  4H4M B;  1GEH A;  4CDI A;  3R97 A;  1H0H B;  2C1E B;  2F8M A;  4IYQ A;  5H9E J;  2JLG A;  4RNH A;  1NHK L;  3AXK A;  4UOH A;  4F25 A;  2QE5 A;  2P6S A;  1KFS A;  5KG0 A;  3PYE A;  1VRU B;  4YP3 A;  3PRD A;  4B3S F;  2YNH A;  2XS2 A;  2RH3 A;  3H4D A;  1WC4 A;  2PEH A;  2OJ3 A;  1M1G A;  2OEL A;  2BVZ A;  2FHJ A;  4DQI A;  1KHV A;  3BSN A;  4HH0 A;  4J5O A;  1DRZ A;  1YQH A;  2AJ4 A;  2KO1 A;  4ZA1 A;  5E3C A;  1HNV A;  3KOA A;  1RU2 A;  1I6J A;  2FC9 A;  3PVX A;  3EGZ A;  2KRR A;  2XMK A;  1TMM A;  2DGU A;  3OSP A;  5D4N A;  1JLQ B;  1GX6 A;  2P9C A;  3PEJ A;  4NPO A;  1RE1 B;  4M63 A;  2WSE C;  1HD0 A;  1Y10 A;  1YK9 A;  2FHO B;  3SBM A;  3Q23 A;  2XNR A;  3CD5 A;  2DGT A;  1IKV B;  1S6Q B;  3DOK B;  1RT7 A;  3EVM A;  1SH3 A;  2HHH J;  4JI2 F;  5E3R A;  1N56 A;  4ZJO A;  5LMN F;  2Z56 B;  4DL3 A;  1UW9 A;  1JJH A;  5EX0 A;  1PC5 A;  4LRA A;  4RNO A;  2EKN A;  2J9C A;  4JV2 A;  1NEE A;  4KHR A;  3TAM A;  2UUW A;  3K59 A;  1UFW A;  2HQC A;  4LF5 F;  4LF7 F;  1JKH B;  4RW6 B;  1KNZ A;  1FX4 A;  2ROE A;  2W9C B;  1EP4 B;  1R43 A;  1U7L A;  4CCH A;  2IFX A;  1NRK A;  4KGZ B;  2DB1 A;  3RR7 A;  4OV6 A;  2MLX A;  2VD3 A;  3LAK A;  5HI7 A;  5CCL A;  2X1A A;  3C2P A;  1MRO A;  2DK2 A;  2W01 A;  2J7W A;  3PFO A;  1T3N A;  1NJW A;  1DTT B;  2UVV A;  2KZZ A;  1QD1 A;  4FVM A;  4A8F A;  3LUY A;  1VQM S;  3MPY A;  1NO8 A;  1UEV A;  3OTC A;  4NZ0 A;  1FRX A;  1X5P A;  4CLZ A;  2VOP A;  1RI7 A;  1KQF B;  5L8R C;  5F9L A;  7FD1 A;  2D9P A;  2OEJ A;  2RF2 B;  3ZZP A;  3VGT A;  2QA4 S;  1S4E A;  1VQY A;  1YBT A;  4PWU A;  5ETN A;  4X66 J;  3PIP Q;  2A6O A;  2D3O 1;  4JI8 F;  1VBZ A;  3G4S S;  2GAH C;  4J9V A;  4NCG A;  4QWB A;  3UCG A;  1D9F A;  3DRP B;  3QT7 A;  4CI0 B;  3TZX A;  4GKJ F;  3CMA S;  4ED3 A;  1C4A A;  1E6Y A;  3I0R B;  5CAA A;  4PXB A;  5F9N A;  5E2Q A;  3WZ0 A;  1S10 A;  2FY8 A;  1AUD A;  3DYA A;  2VBY A;  3LPY A;  4OJ3 A;  4RPF A;  1TKX A;  2VL1 A;  4KRW A;  2F4V F;  2GS8 A;  5JVH Q;  3D54 A;  1UZD A;  2CDR B;  4JV0 A;  1TKZ B;  4MK7 A;  1PYO B;  4USW A;  2B7B B;  3WBZ A;  1S72 S;  4IOB A;  1VBY A;  2VQF F;  2IM3 A;  4I68 A;  1Q16 B;  2VBW A;  3Q8V A;  4U7C A;  2QSF A;  4OHV A;  5D0H A;  4RNF A;  3MGJ A;  4RO0 A;  3V6H A;  1YI2 S;  4JI5 F;  5IT4 A;  5HP1 A;  2Z2Y B;  4OYZ A;  1FEH A;  1PO6 A;  3NWG A;  2V2Z A;  5RUB A;  3M8S A;  2EWH A;  4WK3 A;  3CDA A;  1FJG F;  3LA0 A;  2HIQ A;  3QT5 A;  1JX4 A;  2VA3 A;  1R89 A;  1F9F A;  2BEF A;  2DR8 A;  3CC4 S;  3DRR B;  3KJF B;  5KG1 A;  4EO8 A;  1DZ5 A;  2I2Y A;  1CS4 B;  4UY8 5;  1FFW B;  3R6L B;  2AX1 A;  1M1K T;  2BKO A;  1QY7 A;  2I5J A;  4U95 A;  4X62 F;  3RRG A;  3NGT A;  4FVC A;  3EMT A;  4LBI A;  1YBA A;  3R7S B;  2I1R A;  1SV5 A;  2CJK A;  1MU2 A;  5GAG U;  4ED1 A;  4B3O B;  2CWK A;  3MOZ A;  3Q2S C;  3U02 A;  3PJ9 A;  1T03 A;  2FC8 A;  2VDI A;  2RU9 A;  3AH6 A;  2QFJ A;  2MB0 B;  1HBU B;  1F2G A;  1C1C A;  5KFZ A;  2DH7 A;  3KDO A;  4FDF A;  2MQM A;  4HAC B;  5HJY A;  3NGD A;  2XY5 A;  4OFZ A;  4OYA A;  4EZ9 A;  4W98 A;  2RT3 A;  3G2X A;  3EXC X;  3NGK A;  1HWK A;  4N47 A;  2CQI A;  2XGP A;  1M5O C;  4WF9 Q;  3DRS B;  1FES A;  2K2P A;  2J0W A;  4I6W A;  1F3V A;  1M1H A;  2DNQ A;  1WHY A;  1KVK A;  2G13 A;  3CCM S;  2AYG A;  4CTA B;  4X62 J;  3H5X A;  1XTZ A;  4QOT A;  3R1H A;  1ZAW A;  2BQU A;  4ALZ A;  1D3W A;  2VG7 B;  5ADZ A;  1JLC A;  5A0Y B;  3EPI A;  1Q79 A;  1LW2 A;  1WC1 A;  2C2N A;  4GRS A;  3BQ2 A;  3CUL A;  3MM5 B;  4MIB A;  3A8K A;  1CSJ A;  1FF2 A;  3TAM B;  2UUT A;  1A0O B;  6FDR A;  3VAJ A;  1IWG A;  2LDY A;  1RCX B;  4ZVH A;  4CIO A;  4K4T A;  2HZC A;  1XMO F;  1O51 A;  3C8Y A;  3NCP A;  1FWP A;  4USV A;  1X5O A;  2CQ1 A;  2IDE A;  4ZP7 A;  3I55 S;  1MG7 A;  1FTR A;  2R7V A;  1HNI B;  1SB6 A;  3BR8 A;  2QA2 A;  4L73 A;  5T41 A;  2OSR A;  1WF0 A;  2ZBC A;  4PKD B;  1K0T A;  2M70 A;  1VMB A;  2NUH A;  3LWM A;  4G1Q B;  3LAM A;  2J8A A;  2RQ4 A;  3P3D A;  4M5D A;  5J2Q B;  1BQN B;  4LR7 A;  1U47 A;  3OFF A;  3PX4 A;  2QG9 B;  5L9X A;  4F3M A;  4I67 A;  1LEO A;  3HK2 A;  5J1N A;  2WVF A;  2I9S A;  1YX2 A;  2NXE A;  2ZM6 F;  3NBP B;  1RWW B;  1RXO B;  2WRM A;  2DH9 A;  4IG3 A;  3M8Q B;  1YJ7 A;  2FLL A;  3PZP A;  3CC7 S;  4LR8 A;  1SBR A;  2ACM A;  3W61 A;  5GAD U;  3DRP A;  4PXE A;  4XO0 A;  3OJS A;  1NDL A;  4DHV A;  2LVW A;  2HKE A;  1X4C A;  4RUH A;  2CNK B;  4M5L A;  1YJN S;  2E1M C;  2MZ1 A;  1ZM4 A;  2RML A;  4YY3 J;  3PCO B;  2OI2 A;  1F5A A;  3PTW A;  2CQ4 A;  3OL9 A;  1NPP A;  2JFK A;  1TU0 B;  1MNE A;  2CIM A;  3T1Y F;  2PI4 A;  1PSD A;  2XYH B;  4F50 A;  1WC5 A;  3KTQ A;  5G0R B;  1REV A;  2B9E A;  5HQL A;  3L7U A;  3PJX A;  4WU3 A;  3IFE A;  2MKI A;  2D69 A;  4YDD B;  2LEC A;  4DL4 A;  3ZFV A;  2ASL A;  1ZM2 A;  1EQ0 A;  2E29 A;  2BJD A;  1IKW B;  4GC7 A;  2OPQ A;  2R7O A;  5L1I A;  3P5T L;  4WYW A;  2K8G A;  2KU7 A;  3ZTR A;  3AD9 C;  4PCQ A;  3VAG A;  2G4B A;  4ES1 A;  3T1H F;  2YQ3 A;  2E5L F;  1FE0 A;  1RKI A;  1C1B B;  3MCM A;  5J2N A;  5DET A;  4IH7 A;  3BS9 A;  2LDI A;  2G1H A;  2Q6C A;  1WDD A;  3POT A;  4ZLJ A;  1HBN A;  2GVZ A;  3GII A;  3PX6 A;  4X64 J;  1S1U A;  1U1M A;  2D1C A;  2RDI A;  2MGZ B;  4L3K A;  3FUY A;  1RAF B;  3R3T A;  2JEF A;  1N0U A;  2M0G B;  1XEZ A;  1X9M A;  3G6V A;  2FVS A;  3MED A;  2GZO A;  2QLB B;  4ZP8 A;  2IJN A;  2I5J B;  4QWD A;  2Y8W A;  4I7F A;  3NNA A;  3SQG A;  2KJV A;  4OX8 A;  3MM6 A;  1RTZ A;  3ZTP A;  1UCN A;  2LP4 A;  5HLF B;  5IS2 A;  2GHP A;  5LOQ A;  2HQ3 A;  4DL5 A;  4QQB A;  3QZ7 A;  1S1T A;  1T03 B;  3OL8 A;  2ZH3 A;  4NYO A;  3TZY A;  4YR3 A;  2LQJ A;  4H54 A;  4NX9 A;  5GME A;  1ROF A;  5KOX A;  3WC2 A;  3JB9 k;  1QAX A;  2OLW A;  2DR6 A;  2R2R A;  3D1Q A;  4LUB A;  2W2O P;  3CIM A;  5KFX A;  3DRS A;  2MKH A;  5T7L B;  3K5N A;  2E5G A;  1A6L A;  3AHP A;  1ZM9 A;  4DV6 F;  2ZFH A;  3GG1 A;  1M5K C;  3JQJ A;  4JI6 J;  2MDA A;  1LV5 A;  2CQ2 A;  3M6X A;  3QWU A;  2DY9 A;  5IT0 A;  2EFN A;  3CO9 A;  1EAY C;  2DO0 A;  4DG1 B;  4C8L A;  4O4R A;  5DS7 A;  5ETK A;  1FDA A;  3IWL A;  3FGV A;  5CYQ A;  2BAN B;  4ID5 B;  2FJV A;  4N76 A;  1MSW D;  1MMD A;  2YPY A;  2EVZ A;  1QUV A;  2AEF A;  2K1R A;  1P1T A;  1QJH A;  1U6F A;  1JLA B;  1Q4R A;  2CAJ A;  3F0N A;  1JLF B;  3FVY A;  3M2R B;  3ZO7 A;  3G8T A;  2VIH A;  2UUA J; 
#chains in the Genus database with same CATH homology
 3PRV A;  1B4S A;  1EHW A;  3JS9 A;  1ZS6 A;  2DXF A;  4WBF A;  5IOL A;  3FBC A;  4DUT A;  1HIY A;  5CAB A;  4O0N A;  4ENO A;  3EVM A;  4UOG A;  3ZTQ A;  3EE3 A;  1NPK A;  4FKY A;  2HUR A;  4ANE A;  4S0M A;  3VGU A;  3R9L A;  4ANC A;  3VVT A;  4F4A A;  2B8Q A;  2BX6 A;  3FBF A;  5BXI A;  3Q8U A;  3NGU A;  1MN7 A;  1LEO A;  1S59 A;  2B8P A;  4CP5 A;  2AZ1 A;  2HVE A;  1BUX A;  1F6T A;  4HR2 A;  3WX8 A;  3FCV A;  1B99 A;  1PAE X;  1NDL A;  4AND A;  4KPC A;  4C6A A;  1NLK L;  1KDN A;  3VGT A;  2ZUA A;  1XQI A;  3B54 A;  3BH6 B;  1WKK A;  3Q8Y A;  4DI6 A;  1VYA A;  3L7U A;  2DXE A;  5CAA A;  2DXD A;  2NCK L;  1NSQ A;  3DDI A;  3NGR A;  3FBE A;  3ZTR A;  1NDC A;  3VGV A;  1XIQ A;  1W7W A;  3EJM A;  3Q83 A;  3BH7 B;  1S5Z A;  3FC9 A;  3MPD A;  3FBB A;  1JXV A;  1F3F A;  1NB2 A;  1HLW A;  1U8W A;  3BBF A;  1S57 A;  3Q8V A;  3FCW A;  1NSK L;  3ELH A;  3ZTS A;  1LWX A;  3DKD A;  1HHQ A;  3ZTP A;  1UCN A;  1MN9 A;  3BBC A;  4FKX A;  3EIC A;  3EVO A;  3NGS A;  1PKU A;  2HVD A;  1NCL A;  2VU5 A;  1BE4 A;  2BEF A;  3GPA A;  1K44 A;  1NSP A;  3NGT A;  3EMT A;  3ETM A;  1NUE A;  3ENA A;  3VVU A;  3VGS A;  1BHN A;  3ZTO A;  2CWK A;  3FKB A;  3EVW A;  3PJ9 A;  3BBB A;  1WKJ A;  2DY9 A;  4EK2 A;  4DZ6 A;  1WKL A;  1NDK A;  3EM1 A;  4UOF A;  3GP9 A;  4W98 A;  3G2X A;  2AZ3 A;  3B6B A;  1NHK L;  4UOH A;  5C7P A;  3Q89 A;  3Q86 A;  4F36 A;  2DYA A;  1NDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...