1W7WA

Structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
AELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNSEKWIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure and Mutational Analysis of a Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification of Residues Involved in Serine Phosphorylation and Oligomerisation
pubmed doi rcsb
source organism Pisum sativum
molecule tags Transferase
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1w7wA00
2DYAA 3FBFA 3NGTA 3EM1A 2AZ3A 3BBFA 3FKBA 1U8WA 3B6BA 1B4SA 3Q8YA 2DXFA 1B99A 1VYAA 3ELHA 3EVOA 3EVWA 1S59A 5BXIA 3BBCA 4DZ6A 3ZTRA 1UCNA 3FCVA 3FCWA 4ANDA 3Q89A 1LWXA 2VU5A 1BE4A 1NDKA 1NHKL 3GPAA 3L7UA 1HLWA 4W98A 1HIYA 4DI6A 2NCKL 1BUXA 1NDPA 3BH7B 3VGSA 3VGUA 1WKLA 3ZTQA 4EK2A 1PAEX 4C6AA 3GP9A 2DXDA 1NSQA 1MN9A 2B8PA 3EICA 3ZTPA 3NGSA 1MN7A 3FC9A 3MPDA 4FKYA 1NDLA 5CAAA 2B8QA 4O0NA 1WKJA 3BBBA 2DXEA 3Q86A 3G2XA 2BEFA 1NUEA 1K44A 4ENOA 3EJMA 1PKUA 4UOFA 4F36A 5C7PA 3FBCA 1NLKL 1JXVA 1XIQA 1F3FA 2HVEA 4ANCA 1WKKA 3VGVA 4DUTA 3ZTSA 1KDNA 3WX8A 3FBBA 1LEOA 1W7WA 5IOLA 3VGTA 3BH6B 2DY9A 3VVTA 3Q83A 3ZTOA 1HHQA 1NSPA 1NDCA 4CP5A 2BX6A 1XQIA 1NCLA 3ETMA 3EE3A 1ZS6A 1NPKA 4UOGA 3EMTA 4UOHA 1NSKL 1S5ZA 3EVMA 3JS9A 3DDIA 4WBFA 4KPCA 3VVUA 4F4AA 2AZ1A 3PRVA 3Q8VA 1EHWA 4S0MA 3DKDA 3PJ9A 4FKXA 4ANEA 3NGUA 3ENAA 3R9LA 1S57A 1F6TA 2HVDA 2HURA 3Q8UA 1NB2A 5CABA 1BHNA 4HR2A 3B54A 3FBEA 3NGRA 2ZUAA 2CWKA
chains in the Genus database with same CATH superfamily
2DPJA 4D3HA 1VBYA 1GNKA 4TLQA 5KFEA 3EVOA 5KFSA 3UD4P 1VMBA 2LXIA 5L1KA 1T11A 5J2QB 1VQ5S 1UWBB 1ZA1B 4OHZA 5DLGA 3KK3B 3BQ0A 1TKTB 1VQLS 3V81A 3C14B 2HZAA 2ZVSA 5KOWA 3NAIA 2J0QD 4OZ3A 1IR2A 3VTIA 1VC0A 3TARA 4XAKA 2DCUB 3QRRA 1YDLA 4G65A 3N6NA 1XIQA 2QSFA 4K7QA 4MMOA 4YY3J 2UXBJ 3V81B 1I6JA 1O0PA 3FEXB 1WI6A 5AJ3F 4DQQA 4J9UE 4I67A 5IWAF 1NDCA 3DLGA 3M2VA 1ZM3A 1HKAA 5M2UA 4GVLA 1MNEA 1D09B 4C8OA 1YJ9S 1L3KA 1M5SA 3PV8A 3IBCB 1UPMB 3MPWA 3PJ9A 4DWIA 2XS5A 4I7FA 2YKPA 3DLGB 1CULA 3FQLA 1QAYA 3OVAA 4QZVB 2Q79A 3N79A 1YJ7A 4PG6A 3PACA 4W90B 1HARA 2WCXA 1JIHA 2G0IA 2JHEA 4I7FB 4QU7A 1FRJA 1CULB 3VZIA 1TFWA 3CTRA 1FRLA 4R5PA 4WFXA 4GC7A 4G1IA 5K9FA 3LA0A 1LQ9A 2AIRB 2Q43A 2AX1A 1Q0NA 2UXCJ 1L3TA 3F56A 1FE4A 3QJLA 2BJ3A 1LK7A 5BYQA 2FJAB 3MECA 4R5PB 4YHHF 1E6YA 1IBLJ 1NSKL 1RWWB 1GX5A 2MQPA 1T0TV 4RU2A 3JTNA 5F0UA 1AFIA 4ZPWR 1YX2A 2X1BA 1W26A 1EHWA 1UFKA 4J9QA 1C2PA 4QR1A 4WFAQ 3MTKA 3DGPA 5DDOC 3T5KA 3PFOA 3Q0AA 3BYPA 3K89A 2KI2A 1PYSB 1F0XA 1A9NB 4QW8A 4NA3A 1PG5B 1DARA 2LA6A 5ETTA 3P49B 3PW5A 7FDRA 4CO2A 2DNMA 3DGPB 4DUZJ 2EC2A 2MKCA 3E51A 3UDLA 2DXDA 4WFYA 4I6WA 5CHCB 1WC1A 2V94A 5CCLA 5KFFA 2IVMA 2CWXA 3K5MA 3KTQA 2RDJA 4L75A 4CT8A 3ISZA 2CVEA 2IBKA 2FVPA 4KGXB 5E33A 1S72S 1YJNS 3IRXA 5ETQA 4AQYF 3TA2A 1U2RA 5IT9U 3H8YA 2HNDA 4RWXA 5GAGI 4ZK7M 5IC6B 4KQZA 4AXJA 5DM6Q 4ECQA 1N52B 2JFDA 2KM8B 3IRXB 5KT3A 2D3OR 2HNDB 1RK8A 1VYAA 4W4MA 3B8HA 3W61A 3LALA 3FCWA 4TN2A 3I0SA 2E1PA 4DR7J 5KFNA 4OYOA 3GIJA 4C9DA 4LR9A 2DXEA 3B4MA 2IIHA 2YTCA 4X2BA 2HGMA 5L38A 4ILLA 2NPIA 4HTIA 3QYYA 3I0SB 4M5LA 4KPYA 5I3UA 4B9SA 1DFDA 2JX2A 4EYHB 2IJNA 4M5JA 3VGTA 3HSZA 3OHBA 4F8RA 2H5JB 2RS2A 3J7YI 3V6KA 4M5IA 4A46A 4DG1A 5I3UB 2QA1A 4NYZA 1TMJA 4Z7CA 2GO8A 2VASA 2JC1A 2ZH5A 2QA4S 4U7CA 2WSEC 3MAAA 1QSYA 4FPIA 4B9MA 2FZKB 2K8GA 2OH2A 2I8EA 3FRZA 3JSMA 1E6VA 5B0CA 4DG1B 1N36J 4DS5A 4JI7F 2EXUA 3ULHA 5KFMA 4DLEA 2BJDA 3K58A 2ZKTA 2P2CB 3MAAB 4BHQA 3MM7A 1ZM4A 2EEYA 3IAM9 3JSMB 4DPTA 1E6VB 4P72A 2PFDA 4DV3F 4BWJA 3PJXA 1X31C 2KT5A 2Y1IA 5F8JA 2AJ1A 4OX9J 1SJ4P 4DF4A 1W7WA 3MM7B 4DL7A 1MLAA 2WSCC 2ZJPQ 2PC6A 2DTJA 3FK4A 2M8DB 3EGVA 5LXYA 1SQFA 3OV7A 2MZSA 2ZWPA 3BF4A 2UVVA 3NS5A 2VFUA 4JV0A 1VFJA 1WEXA 1U09A 3CJTA 3NNCA 4OYXA 2DB1A 2V2QA 3M2RA 4LF8F 4WJBA 3GYXB 1F9EB 1RWNB 4RUHA 3EDRB 1F5BA 1SPBP 2VPYB 4F4KA 2Q66A 5AE3A 4I69A 1TUGB 3LTOA 2MY7A 3P8BB 3VAFA 2NSCA 2CADA 3M2RB 2EFPA 2N7CA 3D1QA 1JLEA 1UKUA 1QY7A 2Z30B 3KJQB 1D8ZA 1X0FA 3HX9A 3HO1A 1N32J 2HHTA 1NLKL 2DH8A 2CPDA 1TMMA 3NY0A 2R7RA 2RDIA 2YPZA 2XZDB 1LFWA 2AJFE 2HGLA 2VBZA 1JLEB 3AOAA 2W01A 4ETXA 4A8FA 1YKWA 4F50A 2F4VJ 1HD0A 3RJMB 4ZIWA 2H5EA 2EKNA 3SDEA 3EVMA 1CJVA 4KPCA 5HVGA 5KOXA 2NS1B 3FMWA 2W1BA 3L7PA 5K8OA 1R3NA 1HQ2A 3CCZA 1N5QA 1X4FA 1N56A 1B3TA 2PMHA 1JQGA 1TL3B 1EKSA 3H5UA 1CJVB 2EFQA 5DG7A 1S59A 3DI6A 2G0JA 2CRLA 2GVDA 1FT8A 2EVZA 4U95A 3HHLD 2YKAA 2J0WA 1NDPA 1Q95G 4GMKA 4KGVB 1NKBA 1ZPVA 1MN9A 5IM0A 2R7WA 2AF6A 8ATCB 3W62A 1H7XA 1K44A 3DI6B 3R2DJ 2GVDB 4RNFA 3BN7A 2XCPA 3FBBA 4A8WA 5HLFA 1C1CA 2MDAA 1ITPA 3MUMP 4Y00A 5A0YB 5JMNA 4X4TA 5KG1A 3FGVA 1GH8A 2VG5B 2L08A 3S7RA 4OI3A 3TVZA 4JYAF 5DG8A 3BSOA 1D8YA 4KB7A 3OTCA 4CNYA 1C1CB 3ENVA 4KC5A 2HZCA 1R0BG 4KV8A 5BYRA 4C48A 1RYRA 1XNRJ 3DDNA 2RNEA 3FKBA 2DXFA 5HO4A 3TX0A 1KN6A 1S9EB 3GCXP 3E3XA 4ANDA 3EXCX 2PE8A 5KFDA 4W98A 4ZVGA 8AT1B 2BOAA 4YR2A 3PKYA 3KJVA 1LV5A 3HVAA 3T1YF 3WQPA 4K0KF 4JI2F 2VDIA 1IM4A 2MSSA 5L9XA 3NCQA 4PG7A 4CLUA 3GMGA 3T19A 4DV0J 2E5HA 4NLVA 5B09A 1KSPA 2FVQA 2OO4A 4F4ZA 2MKHA 2RHSB 3KJVB 4JV1A 3L9ZA 3KG1A 3DOLA 3T1AA 2B3TB 4PABA 4QIFA 5D3GA 3R7SB 2ZH4A 4WFZA 2BQRA 1OSCA 3CD6S 3QATA 4IG3A 5A76A 5E3CA 1SVDA 2UZAA 3R1LA 1HQEA 2LEPA 3DOLB 3A8KA 1KEKA 1WC4A 3ZFVA 1PIEA 3SSSA 2MXYA 5D3GB 5HQLA 3CJRA 4QWCA 2LQ8A 4KHPF 4CZCA 4L6V3 2JZ5A 4RUAA 3IXQA 1HQEB 3H4DA 5GAGU 2RB7A 1V3ZA 3C3LA 4WE1A 3H5YA 2FIUA 4ZVUB 5F3ZA 2W4CA 3CW2C 2Y9HA 3MEDB 3R5AA 3W9HA 1S76D 4F36A 1FTCA 2ZH7A 4QIVA 2GCFA 1H2VZ 4ED1A 1JJ2R 1UMJA 4WE1B 1EIYB 3CE8A 3N01A 3D0IE 2QO3A 1XMQF 3E01A 1RA7A 1Z2LA 2B4PA 5I42A 2WHOA 3R7NB 1U2FA 5IS2A 3NNHA 4TY8A 3BM7A 4UOGA 3GFHA 4NASA 5H9EK 1UL3A 3FJ2A 4YP3A 4C0BA 1WOPA 5C42A 3E01B 5I42B 1LWXA 4TY8B 1TKZA 2E5LF 2IRXA 3BGLA 1SC1B 2OEKA 4HI2A 4NMXA 2I1RA 4ZLJA 4MKVA 3J7YU 3Q89A 4FVCA 2KJVA 5CD4H 1JJ4A 5C42B 4GKJF 3T6JA 2W7PA 4YB7A 1S0NA 5DM7Q 2CDRB 3HSGA 1KONA 3V4MA 1OY6A 2XMKA 5FLXY 2EBGA 3BKUA 3O5TB 3H2UB 3DC2A 1NHVA 2DR7A 1FEHA 5A6WA 1HL6A 2CNOB 2RF2A 4JB8B 4OMFG 4NZ0A 3Q83A 1WWHA 3ZNJ1 2RH3A 4QWEA 4DR1J 1N88A 2RDDA 3GWCA 2FB0A 2ZOMA 4ZVSB 3CCVS 3RB6A 1FKAF 9ATCB 1FK9A 4PCQA 1U24A 2V8VA 3W2WA 1K1SA 3BKFA 1VQ6S 2RF2B 2B6AA 2FJBB 2DHGA 3VZHA 2A18A 2G2YA 2J8SA 2KZMA 1GTHA 1FK9B 3LQVA 4JUZA 1ZTWA 5F8MA 2OIHA 3W2WB 4Q8FA 2ASYA 5HBMA 2B6AB 3MCOA 2C2MB 5E5NA 1OMSA 3AJ1A 3OVSA 5T41A 2D9OA 2OEMA 1J5OA 1S77D 4AUKA 1YRTA 4BDPA 2F40A 4DU7A 2HWIA 1RSCA 1YBAA 2FHJD 1S97A 5HBMB 3TOQA 3DU6A 2HQCA 4IO1A 1WDTA 2QA4G 1J5OB 1KLMA 4NLYA 1GMUA 1TL5A 4A8KA 3DLLQ 1RWMB 2VONA 1VRUA 2FZGB 4ECXA 3DLEA 3FMBA 5H9FK 5E7OB 5KFPA 4UOHA 2EFGA 2H1YA 1L3UA 3LAMA 3O3LA 5HVHA 1Q5VA 4F4XA 1KLMB 3QIDA 3KDNA 2R9LA 3IRWP 1Y5IB 1NK9A 4AFFA 4Q8EA 1VRUB 3CIZA 2F9DA 4OX8A 1H72C 3LAKA 5KFYA 1IBMJ 1M1KT 4K4XA 3M6XA 1U8WA 4C0HA 1PJ7A 4O4GA 3GFZA 2VU5A 1VJWA 4CM2A 3MFHA 3HKWA 3MUVP 4C6AA 1S9GA 4X66F 3UD5A 4KHRA 2PI5A 1G1XA 5B0AA 1NKCA 3UCZP 4N8NA 3ZZRA 2FD2A 4O4GB 1LW0A 2BBEA 4DQRA 2R7TA 1LK5A 3HHLC 4ZLNA 2Y3YA 2XY6A 2P9EA 1S9GB 4L3KA 2MLYA 1T9UA 2OI2A 4DSKA 5ETSA 1CJKA 2OJ3A 3MHYA 4C97A 4PXBA 2ATLA 4RO0A 3QRQA 1XWLA 1LW0B 5KTQA 2AV5A 4JI8J 1K0TA 1U1MA 1RP5A 3CWJA 2UVWA 1CC8A 4BLGA 5KFLA 4ZP7A 2XSFA 4IYQA 1WTBA 1WTFA 4PG5A 3VAIA 1CJKB 1IR1A 2OLWA 2DIUA 3KLIA 3O1LA 5KFBA 3FBEA 1YI2S 4X4PA 1OPIA 3F73A 3T3FA 2KT2A 3EPGA 2FHMA 3KG0A 1WDDA 3BO4A 2FDNA 4QJVA 3N28A 2PA3A 5SUHA 3TW0A 1S1TA 3PEHA 1Q5YA 2RAQA 2FJDB 4IFYA 1QAXA 1TFYA 3KLIB 3EDQB 4X4NA 1G6BA 1RT6A 1LWFA 2CZ4A 2JEIA 4JOUA 4WF9Q 1KS2A 1YQHA 2K06A 2XZWA 4OV6A 4O0NA 3MM6A 2XHCA 4Q0BB 4P2FA 4IFYB 1NKEA 2HVZA 3MR7A 3CCRS 1RT6B 3LGMA 1LWFB 2HHQA 4MFBA 4TKTA 2Z4PA 2ZZNA 5FD1A 4ZJQA 2HG4A 3MM6B 3GYNA 2NUUG 4FF1A 1DRZA 1HR0F 3CGIA 2EI5A 3BSAA 5T14A 5HMWA 1N4LA 3PIPQ 4C3MA 4NCBA 2HVDA 4EYIB 1EARA 4MFBB 2K2PA 2ALYB 2W2MP 2DYAA 5I3PA 2YX7A 4IR1A 1TQLA 4PQUB 5BR8F 2FHKA 2ZD1A 2ROEA 3KLGA 5FJ4A 2DRDA 3J81Y 5J1NA 3HHNB 2CQ1A 4F0HA 2UV8G 1RBOB 6FD1A 3CCQS 2MKJA 3K5LA 5KFTA 3JQMA 3C16A 4FXDA 9RUBA 4FPRA 4AD6A 1RTDA 2FTRA 3CDEA 2CIMA 2ZD1B 3KLGB 3D2WA 1NJXA 4KHMA 2LA4A 2FGCA 2SXLA 2E66A 2F4FA 3EGNA 4DU8A 2LMIA 4NCGA 3WX8A 3C16B 4F4WA 3J80U 4K4TA 3AD7C 3KFWX 4WU2A 2V8DA 3TJ8A 1RTDB 2MKSA 4O44A 3WHIA 4LBPA 1AW0A 4NRTA 3CCES 2VFRA 2GVZA 1M5PC 4OYPA 2DGVA 1W25A 2RRNA 2HFUA 3OJUA 4GKKF 2F8MA 2G1HA 2XNQA 5HI7A 4O44B 2OD6A 2BKNA 1V6HA 2K7JA 1WELA 1RCOB 2AZ3A 5C5JA 3B78A 2KFYA 3GE9A 1NSAA 4NWBA 1FD8A 2GVZB 2M9KA 4P2XA 1HNZF 1UFLA 4QPTA 4CLTA 4G6VB 5DGBA 2ZJQQ 4IKAA 2VL1A 2HQIA 2DGQA 3A13A 1UW9A 2LECA 1NZ8A 1N0UA 2HIYA 3BDPA 4PEOA 3CJQA 2LEBA 2AJ4A 2BE2A 4U8YA 2DH7A 1A6LA 3UCGA 3DOKA 2XULA 4C8KA 4RBUA 1ACMB 3MFIA 4B3MF 1UVLA 2KXHA 2V0NA 1I51B 2G4BA 1Q82T 4KGZB 1QUPA 1CQNA 1RU2A 2BE2B 2P8IA 3JAMY 2KXFA 3D0GE 3DOKB 4OI6A 2B9WA 4L73A 2XSJB 5KT7A 2KHDA 7AT1B 3GB0A 3M8ZA 2KM8C 3OD2A 2W25A 1HWJA 1TELA 2QFIA 3R27A 5DRKA 4ECSA 1CSJA 2N4DA 3K8VA 5JJBA 3CCWA 4YDXA 3ZO7A 2VQEJ 4ZVRB 3TUPA 2IY5B 4A47A 3DLBA 4USHA 1R89A 4ZCIA 3BJYA 4OYBA 2CPJA 3P4UB 2YNIB 1VQ8S 1F3VA 2LQJA 1LEOA 3RUBL 3R7BB 2XMWA 3QJJA 4JI3F 2CUYA 2W8LA 1BWEA 1ZS6A 1IBKF 1JJCB 2ZM6J 1P6TA 2QTWA 1MROA 3PYDA 1SBRA 2E1CA 3GFXA 3PO4A 2W2QP 1X4DA 1Q16B 5THWA 4I6AA 2HQFA 4QYRA 4CTAA 2UVRA 1ZM9A 3LO3A 1G7CB 4OZ1A 4EBEA 1MROB 4ZPCA 3THVA 3ELHA 2DHHA 3JTPA 1M5VC 4KH1B 2KHCA 4ZVOB 1YVFA 4BBYA 3TEGA 2HKEA 3HF5A 1R7IA 3FSYA 2HHHJ 1HBOA 2QSWA 1FRKA 4LIRA 2PGCA 3BPSP 3CD7A 1UFWA 4CTAB 3ILJA 2DR8A 4KSEB 3MPDA 4FYXB 4NXMJ 2BEFA 4FNHA 4ZS6A 3C6TA 5A2QU 1RHRB 2B4OA 5IFMA 3P3DA 1HBOB 4LUBA 3TUIC 3SCLE 3OW2R 2Z2YB 4YY3F 2HHXA 2HQ3A 5IV3A 1JLQA 3DFEA 3CDUA 1Y5LB 2GFFA 4PXEA 5DZ6A 3C6TB 2MHEA 3I5AA 2JEJA 2W9AA 2DNQA 5D0EA 3AH6A 2ATCB 3JXOA 1B7YB 4PYAA 2AGOA 4XPEA 3NGUA 3R9LA 1NB2A 4EGLA 1JLQB 2GAHC 2B0GA 4BCAA 2A3JA 1H38A 2PDAA 2WZ1A 4HEA9 2KG1A 3T5LA 4UUWA 1RTZA 5BYSA 3QPIA 4X62J 2MQLA 2BANA 2DNYA 4YB5A 2CQGA 1KRPA 3PYEA 2V34A 1UEUA 3W64A 4ED0A 1HPZA 2RU3A 2HMIA 2WOMA 3CJ8A 3TAMA 3NKYA 2QZ8A 3T5JA 5CYMA 2H4YB 3K2YA 4X4QA 2BANB 2LLZA 1D3WA 4WKYA 2VQFJ 3PHEA 4B3TJ 1O6XA 3BH6B 3TAMB 4PG4A 1HNWJ 1P1TA 4QWAA 5CYMB 3W63A 5E41A 5GAEI 4CO3A 4P2MA 1X5SA 2Z2ZA 2LFVA 4HLBA 3BGOP 1BQXA 5JXSA 4Y3CA 4MJKA 3M4XA 3M8SA 1FEEA 1XBWA 5EX3A 3PW7A 1PC4A 1WNEA 5BXIA 3DRXA 2YNGA 3NXZA 4O3NA 3RB3A 4QR2A 2ZKUA 3WBZA 1FX2A 3W66A 3OL7A 3POTA 4A8XA 1MN7A 4ECVA 4KH0B 2IBOA 1CS4B 2QIFA 4LRCA 2PIIA 2D69A 2QFJA 3SQOP 2VOOA 5DETA 1Y11A 3POTB 4U8VA 2M70A 2HVHA 3H42A 2GZOA 3VV2B 2N82B 5ADZA 4F26A 1NEEA 2L3MA 1V9OA 4KT0C 2VA3A 4MIBA 1JLBA 3OXFA 4KR0B 1Y7PA 4KJIA 4CLLA 4KY3A 2EFVA 4ZPBA 1WF1A 5KFGA 2RJZA 4UQTA 3RG6A 3O2IA 1RLDA 2NR0A 1RTJA 4OJGA 4LR8A 5FDLA 5HROA 2D74B 2V4JA 1VK3A 2V4QA 3MGJA 4DV4J 3EZOA 1JLBB 2QMXA 1RT2A 2VBWA 1Q7YT 3D6MB 2HFVA 5AXMA 4A48A 3MR3A 3DRSA 1S0VA 1ZETA 1KTVA 3TEHB 3GG1A 2J0XA 1RTJB 5FDLB 5HROB 1N33J 2GQ2A 4N56A 1PBUA 4R0JA 2VFSA 1RT2B 5G0RA 2VH7A 3OSNA 3BGFA 4C0OC 4B3SJ 2HZVA 5DG9A 1SKSA 3KNGA 4AL5A 2NSBA 2Z58B 3NRBA 1VHIA 1EX8A 4ED2A 2B5JA 3QGIA 3CMQA 4R0EA 2B9XA 3TA1A 4DPUA 3UR0A 5A8KB 1F60B 2EG1A 1VRTA 5G0RB 2ZZMA 3Q8RB 2UXDF 1MWQA 2JH3A 3BPDA 3GTYX 5CZVA 1KHVA 3V2UC 4WWSA 3ENAA 4LF7J 1L3SA 4OIXA 2R2UA 1DTTA 3UDEA 1WORA 2WVCA 5ETRA 4C4WA 5HMYA 4OYMA 2OHDA 1B7FA 2Q6BA 4CRJA 4EI2A 1RLCL 1CVJA 1RHUB 3GIMA 4OV1A 4DPXA 1N36F 4DUYJ 3AOBA 4KKOA 4EK2A 3UQSA 3HSDA 2VPXB 2I0XA 3DRYA 2MZTA 1FWKA 4X4VA 4KO0A 4F2RA 1IJEB 2XNRA 2PMWA 3U1NA 1KVJA 1FXRA 5ETNA 3CCSS 4KKOB 3UWTA 4C8YA 3RGIA 4OX9F 2WB1D 1C1BA 4AL6A 1J5EF 3ISND 4KO0B 4CLPA 5F41A 3MM5A 4YFUA 3I4PA 5I3QA 1Q8LA 3RR7A 4K4WA 1RBAA 1FRXA 2FLPA 1O8BA 3Q8UA 2YQ3A 5ETPA 3UVJB 2DR5A 1C1BB 3A4TA 2IM0A 1NJIT 5K14A 4CDIA 5HQ8A 4F2SA 5DZ7A 1JLCA 3MWBA 1RAOA 4CH7A 3LPEA 4RNOA 3MM5B 2CDQA 3GR0A 5F0WA 3LGNA 1TL4A 1AROP 1REVA 2E7WA 3RBZA 4LFAF 4Y6IA 5LL6d 4GVBA 3H40A 2DHXA 4NLPA 1N34F 1OQ3A 3FNNA 3LF0A 1VHFA 5K14B 1WF0A 2BV3A 3SQGB 4CLKA 3EYZA 2F5GA 5KG7A 1D0EA 2HWTA 1REVB 3EGWB 1WEYA 1WJ9A 1IQTA 3D1OA 4B17A 1TV6A 4U9RA 4XDDA 2B4UA 2CQ2A 3HXMA 4FDFA 4LT6A 3I82A 1N32F 2CPEA 2XTJP 2GAGC 2P5VA 1HMVA 1FD2A 4RBTA 2O67A 5ETKA 3L4BC 5AJ3J 3Q2TC 1TV6B 3CDBA 3KHGA 5IWAJ 2J9DA 2AMCB 4NLXA 3P5TL 3D5MA 3DRPA 3PRBA 2AGQA 1CJTA 3VQSA 3PFEA 1HMVB 4ZVPB 2CQ4A 2NZCA 1SL0A 1NJWA 3H2LA 2V9KA 5KG4A 1HWKA 4G1PA 4DN9A 4OLPA 4L74A 3DRPB 3QGPA 2E5IA 2O3DA 1U1PA 3VWSA 3NMAA 2FPHX 2XCAA 1I5OB 6AT1B 3EICA 4H4MA 1CQMA 1BLUA 1XN9A 1RT7A 4C3LA 2ZDPA 3OR2B 3ZTSA 1RGVA 3NCRA 1EB0A 1U26A 1Q79A 4OHYA 3EX7B 1TK5A 2XS7A 1WACA 1GK8A 1R0AA 2YWGA 1NSPA 3I56S 1RT7B 1LXJA 5EUHA 5L8RC 2DH9A 2MEWA 2H9ZA 2C28A 1FDDA 1UVJA 2X3DA 2PO4A 3LWLA 1L3VA 1M0SA 3VF0B 1R0AB 5CABA 2I2YA 1OWXA 3P6YC 2MLZA 4LSNB 1VK8A 3W5ZA 1TAUA 3UDCA 2J7WA 2OFGX 1XERA 1D9DA 1FVQA 1SXLA 1XNRF 2R7XA 1MMDA 2R4FA 2DT9A 3TYTA 3PIOQ 1MG7A 3H25A 4OFZA 3HHDA 5GAEU 4NYPA 3CD0A 4P9SA 1FI4A 2ILZA 4YR3A 2BXJA 3TUZC 4FKYA 1RI7A 1AA1B 4RWWA 3TO8A 2D3ZA 2F1FA 4C3KA 4PRFA 4OI0A 1FNOA 5KFOA 5CQGA 1IM6A 4N77A 2DRBA 4NCAA 3H5XA 1GFWB 2G13A 2EBEA 4X4UA 2DVIA 1VISA 3KOAA 1SC3B 2AU0A 4RBVA 5AE1A 2GC8A 3HVTA 2WVFA 1T3NA 2CXEA 1M5KC 4L3NA 4ZPVR 3AJ2A 2MQQA 5IC4B 2ZEJA 2V9WA 2M7SA 4AQYJ 4FS1A 3RZAA 5B7WA 4FKXA 3NP5A 5DGAA 1K9MT 1ZZNA 4HR2A 1RJJA 3MCNA 3HVTB 3CD5A 2JLGA 4EMDA 2Z8QA 3TZZA 3SYZA 1TVRB 2K1RA 1URNA 4F25A 1DQAA 1UVMA 3DLKB 2NCKL 3PW0A 4DV6F 3J7Z5 1YBTA 2OPQA 3KNAA 1NK0A 4QQBA 2CJKA 1KNZA 4A8YA 1JLGA 4DV7J 3OTEA 4I2QA 2XO7A 1NUEA 1CC7A 2K1RB 1AUDA 5LSLA 3TQ1A 2EFOA 4X64J 4H54A 2VFTA 1NPRA 1VQOS 1B0TA 2E5JA 2OPQB 1TUVA 2W9CB 1JLGB 2YQ0A 4I2QB 3W8PA 4CWBA 1L5UA 1PO6A 3CC2S 1O5JA 2OKQA 2PSZA 3HMJG 3PR4A 1B0PA 2YX4A 2DEIA 2V50A 2AZ1A 2NYIA 2VOPA 2GIQA 3EWGA 2A6OA 2XGPA 1OO0B 2IFXA 4TXSA 1S57A 4PR6A 1WC0A 2P6TA 4PWDA 2DHAA 3M6UA 2ZOGA 1MMNA 1QSLA 5D0RA 2HWHA 2B51A 3S01A 1GXUA 4ID5A 1FRHA 3CC4S 2CQCA 5LMUF 1WF2A 2D3UA 4IH7A 4PWDB 1S1VA 4Y2KA 5DS7A 5D0GA 4B3RJ 3THPA 4OJ1A 2C2OB 4LF5J 1NH8A 2E9RX 2QLFB 1PKUA 1F2GA 5GMDA 4P75A 4ID5B 4EO6A 4ECRA 3I5BA 4PYDA 1VQSA 1S1VB 4JV5J 2CG8A 2JVOA 2BJ9A 3CMAS 2W4DA 5JUMA 1Y4ZB 4WK3A 3D54A 4DCPB 3DXSX 3GILA 2KDOA 3QRPA 2YWKA 4GO5X 1UVNA 4EFAC 4DR1F 1S48A 4YR0A 2APOA 1EAYC 4DV5J 3VVUA 4QIGA 4CYUA 2O01C 3NAHA 3RR8A 1Q1KA 2ZH3A 1IUJA 2AHOB 3HHLA 4TU9A 1GEHA 4J37A 3ISNC 4HT5A 2HHWA 4MK7A 4YN3B 3L3CA 2H5IB 1QAJA 4OZNA 3HD1A 3M2UB 3GFYA 2MLXA 2ERRA 1NMEB 2WAQD 2IDEA 3EVWA 5GMEA 4CLZA 1GTEA 1XMOJ 2MQ8A 2AYBA 2HRTA 2WB4A 3HHLB 3HD2A 4DI6A 1IXKA 2HNYA 2HNZA 2N3LA 1U45A 1RHQB 4QYZK 1TK8A 2C2EA 2F9JA 3BO3A 1EP4A 5HSPA 3VGVA 1FESA 1RHJB 2BM0A 4USTA 3GU0A 3FQKA 3TNVA 2HNYB 2HNZB 3I9ZA 1S6OA 4CT9A 4M5HA 4JI6J 1LFPA 4J5OA 3C14A 1H2UX 4ED5A 4DSFA 1Y9OA 4P71A 2BVZA 1EP4B 1FRMA 1EQ0A 2OGUA 3A3NB 4S0MA 3MCMA 2AYEA 4DCOB 4ANEA 3DNCA 4LF4F 1OYDA 2C2ZB 3PZPA 4ZJLA 2FC8A 1AT1B 4CO5A 4DL2A 2BMBA 1OIAA 2XHWA 2CKWA 5CD4A 5D77A 5D78A 4HHUA 1ZZFA 2J9EA 4LF6J 1T94A 1HNVA 1T9XA 5EGYA 2GW8A 3I96A 4NOHA 4YB6A 1SC4B 3IP0A 1P9YA 4BC9A 1WG1A 4DMZA 1VC6A 4ILMA 3MMBA 4ETZA 2LQ5A 2RU9A 3HVWA 5LSOA 4ZN3A 3Q86A 4PXDA 2X51A 2RIJA 5LM7E 4PG8A 1HNVB 3GJQB 2HVEA 4DUTA 1IJFB 3LGHA 2Y8WA 3JB9k 2QLXA 4LMZA 1VC5A 3NOGA 2CVIA 3MMBB 1UEKA 3QSYB 1RAGB 1YJTA 1MU2A 4WCEQ 4ZIVA 1DURA 1PJ6A 2QL9B 2AEJA 2Z2LA 2LQ9A 4M5NA 4ALZA 4NZ7A 3Q8VA 2UU9F 4ZJOA 4JI8F 5D0HA 2J76E 2H4WB 4QR0A 4JYAJ 3KWMA 1MU2B 4FP9A 5KFCA 1U1RA 2YVSA 2C3PA 1RHKB 2WSFC 3D0HE 5AXLA 3L09A 3BBCA 4UZCA 4OI4A 3KHLA 1FWPA 4NYOA 3CIMA 3MTJA 2P6SA 1GMVA 3JSRA 2KVIA 3IGVA 2GGPA 5IT0A 2ZNZA 1OSDA 4RUCA 2U1AA 2CA9A 5HAOA 4UOFA 2BJEA 1ZM2A 4F3OA 4LF9F 4CLFA 1DAXA 3ETOA 4QCLA 1X0PA 1U02A 1Q8KA 2GGPB 1RT3A 2VPWB 5A8RB 5GMKa 1WOSA 3H20A 2KJWA 1U8SA 4OI1A 3MM9A 5IV4A 3TI0A 3PCOB 4PXCA 5K8MA 4WBFA 4Y2IA 2POKA 8RUCA 5A8WB 1VQPS 4F04B 3GJRB 1UETA 2ZVIA 2AX0A 4PWWA 1BXNA 4UY85 1RT3B 2IYGA 4M5KA 1OQ6A 4ZP9A 4MAKA 3FBFA 4O23A 5CYQB 4UQGA 3MM9B 1N5YA 4RPFA 3SCKE 1FXDA 2MQMA 4K2XA 2L41A 1NU4A 3CO9A 1X5OA 3GIKA 5KFHA 4DLGA 4M5MA 4NLWA 2ZH8A 4BS2A 5F8HA 1UVIA 1C0TA 2VB6A 4B02A 3OLBA 4KHPJ 1TKDA 1N5YB 2I5JB 4A8MP 3G2XA 2DIVA 1F5AA 3I87A 4LR7A 2M3DA 4LRAA 2W4PA 3UFCX 1C0TB 3SCIE 4ELTA 1HBUA 1KHWA 4IOBA 3D3CJ 2J5AA 1RBLA 2YKMA 3ETMA 4R25A 4WZMA 1B70B 3CCLS 5DDRC 1FDAA 1RT4A 1HBUB 3N6MA 3CJ3A 4ZVEA 2YKMB 3OUYA 2PN6A 1XR5A 3HHEA 3KMSA 2FVRA 2ZE2A 3I4HX 3LH2S 2FHJA 4Q2LA 1S0MA 4DZ6A 3SFUA 2FUG9 3GIRA 2V67A 5GAHI 3LP0A 1YITS 1RT4B 1TP7A 4EBCA 2K7KA 2V8GA 1M1GA 3UNGC 1ICEB 3BH7B 2C3YA 3OUYB 1ZOTA 2ZE2B 3BV8A 2O1PA 5DQHA 2BE7D 4GKJJ 2ZITA 4OX6A 1YWXA 1ZYQA 1FNMA 3LP0B 3N5BA 2IRUA 1S9FA 2W7AA 4DZDA 2KN4A 2KRBA 4DQPA 4NEYA 3R3TA 4PWUA 4K4VA 2HYIB 1TL7A 1R6YA 2Y1LB 2QLBB 4QW9A 2GQCA 2C2RA 4K50A 2UUTA 4IH5A 3AODA 3CC7S 3HFZB 1Q81T 4B9TA 2R7SA 3A3PB 1TL7B 2JLEA 2PEBA 3NGRA 3JSYA 5FIIA 2GJFA 3KK1A 2JSXA 3R6LB 2QYCA 3SCJE 4DQSA 1Q78A 1DQ9A 4UUXA 1U0HA 1VCTA 4ECYA 1WC5A 4KGMA 1JLAA 2ZWOA 1CLFA 4X4OA 4NA2A 3KK1B 2DR6A 4J91A 3KLHA 2VQEF 1HYSB 1NDLA 1U0HB 3MEEA 5KG6A 2UUCF 1JLAB 3BB5A 2HS3A 1LWCA 2KKHA 3GLJA 4M5DA 3QBCA 3RAXA 4QWBA 3KLHB 5RUBA 2XMUA 2M4MA 1HHQA 5KFVA 2ZH1A 3BREA 3MEEB 3HK2A 4K4SA 4DR4F 2ZH9A 3ICLA 2RQ4A 1LWCB 4M5DB 2HGNA 1X7VA 2CZ9A 2DKOB 3J81U 3SV3A 1CJUB 1YJWS 1K0VA 4PPZA 2ZHBA 3H59A 3DRRA 4NPOA 2WW4A 2A2CA 4LBHA 2KZZA 3OL9A 5L9NA 1RWXB 3NEKA 4NLQA 3SZ2A 3K17A 2GMHA 4JI0J 2V5HG 1N6QA 2ACYA 1SIZA 5G4DA 2HQDA 2MMYA 5C25B 3DRRB 1X4AA 3T5HA 3Q8QB 2YKQA 2XLJA 2AKWB 3AXKA 1SL2A 2R8JA 2CPIA 4V19X 2YH1A 2MZQA 1H7WA 4J9MA 4NXMF 4O3PA 3MZIA 1N6QB 1TL3A 2VBXA 3TX8A 1LNQA 5E3AA 1IKXA 3UN2A 1C4CA 4ZITA 3A12A 3MD3A 1KWMA 4HHHA 1UP1A 1FTRA 4FF2A 1S99A 2BACA 1BY9A 2VUGA 4DBQA 2AP6A 4J9VA 3GYGA 3CXCR 4O0IA 4O3QA 3V6HA 4ELVA 1YSJA 3MOZA 4IG0A 1IKXB 1AYEA 2VICA 2CNNB 2ALZA 1BQNA 4DOZA 2LP4A 5T7LA 1Y00A 3BBFA 2HBQB 2CNLB 4TVAB 5A0YA 3A8JA 3IFEA 5KFIA 2KTQA 2G9OA 2VG5A 3GV5B 1SC6A 1TAQA 1EQMA 1NHKL 2W2PP 3HPOA 5HN0A 4IG0B 3W9IA 1RHMB 1HWLA 3GP9A 5KG0A 2E44A 1BQNB 3M9OB 2KFNA 5T7LB 4FBTA 2JC0A 1RQ0A 2RQKA 2EPIA 3CCMS 2YX1A 2HHVA 4V19J 1HQUB 4P2SA 2IA6A 4EO8A 1S9EA 3A3OB 2FGOA 4CQ1A 2FVCA 4QWDA 2LDYA 4X65F 3H2VE 2XGQA 1MMLA 5H9EJ 4FYYB 5HK4A 3EZ5A 2RQMA 1KOHA 2GIFA 1S79A 3V6DA 4IDKA 4N8OA 4F4AA 3OTDA 5DQGA 4TLRA 3QFWA 1GAOA 3U27A 1RKJA 4K4ZA 1UJ6A 2XY7A 4B9VA 4KIAA 4I6YA 3V6DB 3VAJA 3CCJS 4IDKB 3EPIA 4CIOA 4PPDA 4PQAA 3FCVA 1NDKA 3A8EA 4J9KA 5BR8J 1T8EA 1XNQJ 5D4PA 1X9WA 4F3MA 4E0DA 2HRYA 6FDRA 3KXDA 1H6KX 4XK8C 3FSIA 2RT3A 2J0SD 5B08A 2ZH2A 1K8AT 5HMXA 4O3SA 3CVKA 4C8MA 2VC0A 3MF5A 1PBAA 1P1LA 1VBZA 4Q43A 2N3OA 2ZNYA 3MPVA 4QIWD 2JNJA 3HFVA 2Z57B 4HHJA 2ZFHA 4OL8A 2C22A 1FA0A 4BC7A 2YQ1A 3OPKA 1NCLA 2PI4A 2LKZA 2O5DA 2NLWA 3AT1B 4NL5A 3ZXWA 4DV1J 3JQKA 3OBIA 2C3OA 4MIAA 3MEDA 3G6ES 2KT3A 2V4RA 3OFFA 1P27B 3BEGB 1DBDA 1RAEB 2YH0A 1U1OA 4UT4A 3O6QA 1S1WA 4H4OA 3GJTB 4DR2J 3QMQA 3OLAA 2HLTA 1KQKA 1X4EA 5L46A 4GKKJ 4A8QA 4ED8A 3PRDA 2D7SA 2QLWA 3NG8A 4DV4F 1SIWB 1HLWA 1R8BA 3EUNA 3N9UC 4OHWA 1HNZJ 2L9WA 2R8GA 2DGUA 3NMRA 1S1WB 4H4OB 1D9FA 3DHWC 2HK3A 3GCWP 4KBIA 4HL9A 2AWZA 2DGXA 2CQPA 1N33F 4DS4A 5HANA 3M8RA 4F0KA 2I6WA 3N6LA 2ROPA 4PZVA 4B3SF 1KKHA 3R8YA 1U48A 3CDAA 1EJ7L 3QT6A 2DY9A 2D1CA 3M8QB 5GAHU 2ZZTA 3RTVA 5H9FJ 2FJXA 4JBCA 3DMJB 1BQMA 1S7HA 2BABA 1U1LA 4HT7A 1JXLA 1FO1A 2BZ2A 4OYAA 3SFGA 3PRVA 3IAS9 2HVIA 5F8GA 3AA8A 3MMJA 1JXEA 3AA9A 2FHOB 3J7ZT 1BQMB 4RNHA 4LF7F 4I64A 3IM8A 4G3IA 2AJ2A 4K8RA 2X1FA 4DR5F 1JX4A 4OX7A 3D9BA 5EWFA 2OD4A 3O44A 1VQMS 4HVZA 4WYLA 2ZUGA 1M1HA 2DNLA 2JEGA 2G0CA 1FHTA 1FDBA 1M90T 3OTBA 4DUYF 2GQQA 3C46A 2HS4A 2F7VA 1RTIA 2XMMA 2HFZA 1KTQA 3UPFA 4ZVTB 5L1IA 4WIQA 3CSKA 5MAOA 1KFDA 3ENQA 4DSLA 2ROGA 1SH0A 1RTIB 3IG1B 3EE3A 2M88A 4J9LA 4O3OA 3JS9A 2DRAA 1UVKA 1FXLA 1DLOA 3QSIA 2GNKA 2LEAA 4Q5VA 1AUSL 1NAQA 4JI3J 1FJGJ 4F0MA 2R7QA 1IBKJ 3LW5C 2KFZA 2MZJA 1R43A 2QMUB 3MDFA 4YB1P 4M94A 1DHMA 3TANA 2DISA 4I4BA 4ZVHA 4LQ3A 1DLOB 4LSZB 2C42A 4LIWA 3F44A 2UUBF 3ZZ0A 3I6PA 3M30A 5HQMA 3ZTRA 1SJFA 4ICLA 2QN6B 4LRBA 1W2BR 2HS0A 5EDWA 4ERDA 1BMQB 2XMJA 3M30B 1U6ZA 3HHKA 1C0UA 4ICLB 1VBXA 4IOAQ 3IN5A 2W7OA 4JI5J 1XQIA 4LBIA 1HA1A 1ZH5A 3PW4A 2GMJA 5EWGA 2CPZA 2HW3A 1NPKA 2VG6A 1APSA 3G96A 4OLOA 1C0UB 4BWMA 4OZJA 4JV2A 2CPHA 2QGFB 3WC0A 2F63A 1REGX 1S4EA 2OMLA 4ID8A 2V69A 5F8IA 2NZ4A 2E1RA 1S4FA 5CCMA 5IQQA 3RRKA 3W3SA 3QGHA 5LMNJ 3Q22A 2VG6B 3M8YA 4DR6J 3W8GA 2CPFA 1RZMA 1FFSB 2IMWP 1YZ6A 1X4HA 1SKUB 1D9AA 3ZC4A 5F3TA 3BR8A 4USKA 1YZ7A 2CPXA 3OSPA 2XEXA 3HVRA 3M2VB 2VPZB 2YKOA 2VFVA 3ZTQA 1M5HA 1RWPB 3TVYA 2BYCA 4MK8A 2QE5A 3MR6A 3HCXA 5F8LA 3MAQA 2J9DE 3CCUS 4J9PA 5F9LA 4NLOA 2L48A 4O3RA 4OJHA 4H4KC 1S12A 4URGA 1LWEA 1H2TZ 4FF3A 4E98A 7FD1A 4DPOA 4DL6A 4RW7A 4F4YA 3OR1A 2UVUA 4J9SA 3I31A 2DO0A 3ZZPA 1LWEB 4EUVA 2ZBCA 2W2OP 4NXNF 3DYAA 2Q1LA 4AT1B 4DX5A 3ZZTA 4Q0BA 2QL7B 4RL1A 1NJYA 2LQBA 4ED4A 3CJKA 2ILYA 3OL8A 4DV2J 4WU3A 4RW7B 1KD1T 4NLDA 3OR1B 2R2RA 5M2PA 3PY8A 1NNDA 4DFKA 1Z4UA 4ER8A 1F2HA 1B99A 3TJAA 3K5PA 3MECB 1GXLA 1S7IA 4JP8A 3THTA 4J9NA 3DYAB 4ZPDA 2GHPA 1E6YB 2FJVA 2CQIA 1YIJS 3RB4A 4KFBA 4NLRA 3CJKB 3R5GA 1U25A 3T9ZA 4WK1A 3TUJC 3WX4A 3BYRA 2IVFB 4FYDA 1WC3A 4L72B 3R5CA 4PQUA 2BA9A 2A1BA 4HH0A 2B4VA 4KFBB 5HMZA 1KDNA 1HI8A 3QT7A 2MZ1A 3IBFB 5L1JA 1I94J 4DX7A 3W7BA 1O51A 4JI4F 5K8NA 1U7LA 3FZ2A 4IQMA 1WOOA 3F0NA 3DN9A 3RRGA 4MYUA 3R5JB 2HURA 1FKOA 2WVBA 2GHWA 4ZCMA 2MPUA 1R8HA 1YHQS 1R6VA 3ILLA 3EM1A 5HATA 2R8KA 2DGWA 1GMWD 4P7VA 2Y8YA 1RT1A 1UA0A 4USWA 1U4BA 3GJSB 1K73T 1FKOB 2R3VA 4EBDA 2KVQE 2EWHA 1RXOB 2GHVC 2XO6A 4NA1A 1XJWB 2IM2A 2ASJA 3T6BA 4N76A 2MYFA 2IAJA 3TAQA 4LF2A 1RT1B 4K2JA 4DV7F 3LP1A 3S1TA 3FBCA 1SV5A 4WXOA 4LSLA 1HNIA 3QGGA 1AZSA 5DDPC 4UY8T 4X64F 2J7KA 3G6YA 5IT4A 3NLCA 3Q8PB 2BJ8A 2IAJB 4N7TA 2PMZD 3LP1B 3NOCA 1SV5B 3CNQP 3E8OA 4LSLB 1HNIB 4MKBA 3H5SA 1QVGR 1AZSB 3VCDA 1TTHB 2UXDJ 3IC1A 3G4SS 2GS8A 4J7CA 3GV8B 1X8DA 3R5BA 3CPWR 3UD3P 2PEHA 4IUFA 1NRKA 2ZBQA 4Q45A 3NCPA 5HJYA 4CO0A 2JRSA 4F7VA 2YNHA 2ASLA 2XS2A 4P7TA 2LXFA 2XLIA 5CYJA 1WSVA 3OTOJ 2U2FA 3GPAA 4NE9C 2QRRA 1VS3A 1YGYA 3T1HJ 2XC9A 3PYGA 4WPAA 2YNHB 2VJVA 5ETLA 1SH3A 3BBBA 2XSJA 5D4NA 1N54B 1AXQA 2RILA 4FZVA 4B3RF 5E3QA 4ANCA 4ES3A 4LF5F 3JQJA 3H90A 4Q2MA 1ROFA 3GV7B 1EKRA 2A2DA 3IBWA 2R2TA 3SEOA 1UJ4A 3S8SA 4JV5F 4IR9A 1VJQA 3LP2A 3BN4A 1T95A 3OT9A 1VQKS 2YY3A 1B64A 1J5EJ 4FYVB 4B08A 2W2NP 4WP9A 2ASDA 1T9VA 1U2CA 3I55S 1UZHA 2IM1A 4DV5F 4NMLA 2YNIA 2JL9A 2RD5C 3LP2B 3LOUA 1M5OC 2NPFA 2AEFA 1OPZA 2DGOA 3HT3A 4UTGA 4XTTA 4ZMMA 4B3OA 2Q6CA 5K5MA 4TNOA 5DDQC 4DFPA 1VI7A 3NWRA 4Y0FA 2DPIA 1KC8T 4J90A 1J2VA 1XMOF 1RWUA 4WXWA 4LFAJ 4F67A 2DNPA 3OXLA 4B3OB 4URQU 1TK0A 2PFFB 4QIEA 1N34J 5AE2A 2WW8A 1Q4RA 3UN5A 1LOUA 3R2CJ 1QTNB 2AQ4A 2FVSA 2B56A 1T7PA 2JLFA 1URRA 1ZBTA 1G2EA 5KG2A 1R8PA 4JI6F 4MTPA 2RE1A 1R8CA 3CUNA 1VIOA 2DGSA 2QLJB 4EEYA 2RMLA 5KFJA 1T05A 1BHNA 2A6MA 1YJRA 2RVJA 4ZDNA 4E8UA 5LT5A 4IO9Q 2P9GA 5AXKA 3CJ5A 4Z2XA 3MR5A 2BOPA 1T05B 3BGRA 4ZPAA 3QO9A 2RRBA 4IRKA 4LF6F 5IQ6A 4M63A 5EX0A 2E29A 3SDEB 2UXBF 4LFCJ 4LRDA 1IN0A 4ENOA 2HBZB 3BGRB 1YJUA 2CZVC 3QO9B 3MURP 3HZEA 3W65A 2KG0A 3VVTA 1ZTTA 3ZTOA 2CQ3A 5J2MA 4ZA1A 1PC5A 3G8TA 2LU2A 2FY8A 4DQIA 4GRSA 4NLTA 5D15A 4HTJA 1SJ1A 1SL1A 1U49A 3RBEA 2HAIA 4JI1J 4PKDB 5IM0B 2MJUA 2ADCA 2A10A 2ZHOA 1UJ5A 5J2MB 4Y65A 3CB4A 4LFBJ 1MWZA 2CYYA 3NGTA 1RA6A 2DHSA 2IJFA 1WHWA 4WTOB 1S10A 5HLFB 1S6PA 4DR3J 4AE5A 4FNIA 1BE4A 4HH1A 2ABYA 5LSRA 2MY8A 2UXCF 1BUXA 1UEVA 2ACMA 1RB0A 3OJSA 2RRAA 1QD1A 1S1XA 3NNAA 1JJHA 3QZ7A 1VLOA 2B43A 4RU9A 2WBRA 3RAQA 1S6PB 4OZ5A 3J81j 2E7VA 2QYGA 4UZBA 5K8PA 4KV8B 1RTHA 5KT2A 1IBLF 3IWLA 2NQPA 1S1XB 4YS2A 2XWXA 3K57A 2V2VA 2P9CA 5D4OA 2OPRA 1K47A 1X60A 2CQ0A 1FRIA 3ITHA 5B0DA 2HBRB 1RTHB 1FJEB 1NZAA 2DD8S 5C2GA 3G8SA 1WUUA 1FVSA 3LANA 1CS4A 5KT4A 1NK8A 1HBNA 4CH0S 2ZUAA 3WIUA 2OPRB 2C2DA 2YWFA 2DO4A 3V4IA 3M9NB 1R27B 4DUZF 3ITHB 2VJUA 1N5TA 4UOCA 4OQJA 4OYZA 2X3GA 2C3UA 3K5NA 1HBNB 5KFUA 3A8IA 1GT8A 2XYGB 3V4IB 2HFOA 3BGUA 4ZP6A 4IG3B 1MW7A 4ATNA 2B7CB 4UW2A 5E3RA 4DV6J 2VD3A 3OFEA 3D68A 3KUEA 2UP1A 3G86A 2BUNA 3HZGA 4KYZA 5F9NA 1BWVA 2MKIA 2GJ2A 1U47A 3CEDA 1WI8A 1XC9A 2XBPA 2VODA 4C8ZA 4HYKA 4DSEA 4ECUA 4IRDA 2ZOFA 1WG4A 4MKAA 5BJRA 3IM9A 4DN0A 3PDNA 1X5TA 4OYIA 3K7RA 5B0BA 3ILIA 4USVA 2CJXB 4I56A 2XI2A 3BQ1A 5F8NA 2OMOA 3R6GB 1PYOB 5KT6A 4J9RA 3P96A 4P6QA 1UZDA 3ILOA 4DR7F 1B4SA 2E5GA 2OPSA 2DNHA 5A8KA 2QJ3A 4MKYA 5JVGQ 4MYTA 4TQSA 3VGUA 2XMAA 3PXGa 3UI3A 1V3SA 4OHXA 3CJ4A 5AT1B 3MOJB 1TZ0A 3FEZA 1PJ5A 2HEKA 1OYEA 2OPSB 5LMUJ 5ETVA 2NXEA 3PM9A 2V8HA 3PO5A 3OFHA 3H4BA 3PKMA 1RACB 1VQ7S 2QV6A 1TKZB 4NI2A 2XMVA 2DEJA 3NBPA 1HNXJ 1ZAXA 3GSDA 1RABB 4RW6A 1SI9A 3RW6A 1YRUA 3UNYA 3HKZD 3PTWA 4NI2B 2YXLA 4Y2MA 1SKWA 3NBPB 3N4WA 1WC6A 2YBVA 3CDWA 3UDVA 3VAGA 1AB8A 2HSEB 4Z37A 3GIIA 4RW6B 2BM1A 4QBUA 3BKTA 1GQEA 3C15A 5KFXA 2QT7A 3D7SB 1IWGA 1RT5A 4DF8A 4YEAA 5ETOA 2YNFA 3MPUB 3AHPA 4RLEA 1GX6A 2Q3PA 4NRUA 3I32A 3C15B 3UVJA 2DITA 1FF2A 4DFMA 3EGZA 3FRYA 1RT5B 2B9YA 3VAMA 2DJWA 1HW9A 3MUTP 2YNFB 4URSA 3HP6A 2WTFA 1FJ7A 5DQIA 1LKZA 2OAUA 2HAFA 2E1AA 2Y1JA 3WIVA 5C24A 1QAIA 1RWOB 1WHXA 2V2ZA 2UUAJ 3C8YA 1DJ0A 3L95X 1QM9A 3UO0A 4DCJB 3QAUA 1VQNS 4RNMA 3W9JA 1P9QC 3DXBA 3SQGA 2BKPA 3GR1A 4KAIA 5C24B 3MMCA 5IT9Y 4A8SA 3FVYA 4ZCKA 3AFGA 1S49A 5HL7Q 3KLEA 3R5DA 4PAAA 4N5SA 4LF4J 4A8OA 4B9LA 3RAMA 1H98A 5IXUA 3MMCB 3DDKA 4JI0F 3DLEB 4DHVA 3VGSA 3IWXA 4MIWA 2CJYB 2HQGA 1VBKA 3MMAA 4G1QA 3ZTPA 3KLEB 1AFJA 3D6FB 1F9FA 1HI0P 2AYMA 2KB2A 2XYPB 5KFAA 2BW7A 3N0VA 2H65B 5I4MA 2BR0A 2F4VF 2IJRA 2BKOA 2BJ1A 3FEYB 3D28A 2H51B 2NYHA 4WFBQ 3MMAB 4DSJA 2MQNA 4G1QB 3W2VA 4TQRA 2XQCA 3QT5A 5JVHQ 5H1SV 4FXWA 3M7VA 2BQ3A 2HRUA 3DU5A 2MSTA 1NM2A 4DDFA 3QAEA 2GO9A 3OR2A 3W2VB 3OVBA 4DSIA 1JNRB 2UU9J 3TZYA 2J6TA 3CMES 3JYTA 4CNZA 4NX9A 3D67A 3SSRA 4C8LA 3AB4B 5CXTA 4ZCLA 2F8HA 1XR6A 3KG4A 3HI9A 2Z56B 3ZZOA 1SJ3P 1TR0A 2AT1B 3CULA 1WEZA 1QE1A 3AJDA 2EFNA 2NUHA 3I0RA 3JYTB 1S1UA 2E1MC 2BRKA 2YWHA 4LSNA 2WK4A 1NJZA 1KVIA 4YHHJ 1DTQA 1V5VA 2GV1A 1QE1B 3QLHA 3I0RB 4GC6A 4I68A 3PJWA 4P10A 3KK2A 1S1UB 4LF9J 2IC3A 1RWKB 1S1TB 2ZBIA 1YG0A 1FFGB 4CCHA 4LVNP 3W5YA 5CA5A 1DTQB 1Y10A 2J9CA 4EWTA 4DL4A 1KQGB 3QLHB 4X4SA 3Q23A 3NWGA 4LF1A 3KK2B 1FE0A 1I3OB 4OYWA 3QJPA 3D1HA 4I2PA 3T9NA 2IC3B 1FX4A 1VLYA 2M0GB 3G87A 4Y2AA 1YRXA 4J9OA 3ZNUA 3KJNB 4PUOA 4ED6A 4I2PB 1QVFR 2OTJS 3M9MB 1XNQF 4DV0F 3SXLA 4I1TA 2R2SA 3EJMA 4IH6A 4U7UD 3KLFA 4PUOB 3CJ2A 3M32A 2CQHA 2G1DA 3IR5B 3JTOA 3VQTA 1TVRA 3NGKA 4HACA 1RYSA 3TP2A 1FNXH 5E2QA 4DX6A 4RNNA 1HW8A 2LDIA 3D3BJ 2ZBPA 3DLKA 4ECZA 3MM8A 2WVEA 5B0EA 3KLFB 3M32B 3IA0A 3BZQA 3RB0A 4DV1F 2XZTB 3VAKA 3EZUA 4HACB 5HP1A 2MKKA 2R7VA 1OJ4A 1CBKA 2QA2A 3FZBA 1BC6A 1N8RT 3MM8B 1H73A 2W9CA 1X9SA 4NCGB 2V63A 2KH9A 4MT1A 1VRQC 2K3IA 5HP1B 1F9HA 2RKIA 4DR2F 4ZOSA 4DX8H 3G9CA 2R42A 2B8PA 4QYZJ 1U1QA 2PA8D 4CH1A 4RZRA 4CO1A 3UW1A 2FLNA 4K59A 5C7PA 5M2RA 2RKIB 1OS5A 2Y0SD 2J6SA 4CLSA 3GQCA 4WP3A 5LOQA 1ULRA 2ZHAA 2BDPA 2R7OA 3G8QA 1WHYA 3LPYA 2VKZG 2G2OA 1Y3JA 2OPPA 2DR9A 1IVZA 3DOMA 1UWAA 1VGYA 4A4JA 4ZLPA 4M1KA 1BGXT 3OXGA 1N0VC 2H3EB 2OPPB 3R1HA 3G6VA 4JI7J 4KRWA 3RW7A 2HIQA 2EK1A 1U1NA 3DOMB 3TA0A 3PW2A 3K0JA 1RDRA 1U6FA 1SQGA 4DL5A 3FFIA 1HIYA 4M95A 2KRRA 1T9YA 1WKLA 2YKNA 1YK9A 4DV3J 1Q8BA 4U6PA 2M8HA 3UCUP 3O8WA 2DNGA 2GX8A 3MI7X 2CFXA 1T3OA 2J6UA 4I0WA 2NREA 3G82A 5GADI 2VBYA 3M2UA 3FFIB 3PR5B 1X5PA 4XPCA 4D3GA 2YKNB 4NLUA 2IM3A 2UUCJ 1KFSA 3AY0A 3QNWB 1KQSR 3H98A 3HDSA 1DY3A 4L76A 1GXTA 1RUSA 2VZ9A 5KFRA 2XMTA 4ZHRA 1NO8A 2HHPA 3G82B 4ZLLA 3U02A 4DFJA 3IR7B 2C2KB 1SCJB 4H4KA 4QOTA 4LF8J 4DR4J 2PD1A 3TR5A 1UPPA 3IMQJ 1FJGF 2XI3A 4AXIA 1MSWD 4U96A 2CPYA 3M1VA 3HJVA 3HFKA 1Z1ZA 4ZHRB 3VAHA 3Q8YA 2OELA 1PGZA 3KHRA 3S6EA 5HVFA 4DJBA 1UCNA 2RHQB 3DLJA 3A1YG 4R8UA 4B9NA 3CCTA 4UF4A 2AW0A 1NSQA 2QMWA 2OSQA 2YWWA 3M1VB 4YQWA 2YPYA 3C19A 2B9EA 2O66A 1SJQA 4RW8A 5E0OA 3M8PA 2AGPA 2CQDA 1JXVA 1F3FA 3D66A 3MXHP 3C2PA 4R8UB 2UUWA 3CJSA 4XIUA 1IWAA 5KFQA 3PNIA 3ADAC 3DM2A 3K8WA 2HLUA 1IKWA 3TZWA 4RW8B 3M8PB 2OEJA 3QQCD 5KFKA 1S5ZA 4JI5F 2RS8A 2KXNB 4DEZA 2C2NA 2W24A 1IBMF 4DL0C 4WKRA 1T9WA 2CJAA 1YJVA 3TVKA 3DM2B 2WBMA 1JLFA 4ZVFA 2IA0A 3IWNC 4AL7A 1X9MA 1IKWB 4LQ9A 2ZH6A 4NEZA 1RU1A 4EZ9A 1XR7A 4NZ6A 5LMNF 2BJ7A 2IYIA 4DR6F 1DQ8A 3KKFA 1JLFB 4C11A 1Q7LB 2MKYA 1UW4A 3WZ0A 1HI1A 2QC3A 5KG5A 5L1LA 1VIXA 3W1YC 2VA2A 4OJ3A 1ZA2B 1U1KA 4RUBA 4TU8A 2EC0A 3US5A 2RSQA 2K3KA 1JNZB 4C11B 2QEXS 4ILRA 2JFKA 3RBDA 3N5FA 2Y1RI 3AQPA 2JDJA 5KG3A 2ZJRQ 2NXCA 3CO0P 1QDUB 2RUSA 2YWEA 1KVKA 2AYGA 3QFHA 1JMTA 3ET6A 1QTMA 4MK9A 1PCAA 1FJCA 4ITSA 2CG4A 3OHAA 3DDIA 4O4RA 4X65J 1HPZB 1OY9A 1ZAVA 2JJ4D 3RBXA 2HMIB 2WOMB 2OFHX 1V3RA 1RKIA 2GIRA 5FLXU 4ED7A 3ET6B 1IKVA 2AEMA 4CI0B 2D41A 4K5RA 2IVYA 4YDDB 4OI2A 4DV2F 1VQ4S 4YOEA 5AXNA 5A8RA 4P73A 2WONA 4W92B 1WD6A 3RU0A 4V1Ak 3J7AN 2BE9B 2BQUA 1IR0A 4HDGA 1H74A 3L7UA 3T1YJ 2NXUA 1UAWA 4ZKAA 5A8WA 1IKVB 4K0KJ 3TRGA 4JI2J 3MEGA 2AD9A 1KLNA 4GO7X 3IGNA 4E2FB 2X1GA 2C1EB 2WONB 3FUYA 1WG5A 3TZXA 5CYQA 1R8AA 4K4YA 2B7BB 1Q8IA 2HK2A 2I38A 1RAFB 5C2CA 4HDHA 2I9SA 3MEGB 4ZP8A 4CP5A 4Z7YA 2RUGA 1VQYA 3BSCA 2YNGB 2XY5A 3UN3A 3QZ8A 2XLKA 5J1PA 2IPOB 3CJ0A 2I5JA 4U67Q 5GVQA 1PYTA 3DHXA 1I94F 3CF5Q 1TKXA 3MD1A 2D9PA 1SUQA 3MPYA 5D6GA 1ELOA 1KOOA 3FCHA 4FS2A 4OZ2A 4C2MA 3I9V9 2VHGA 3QIPA 2CJBA 3B82A 2N7YA 5SZTA 1TKXB 2DNRA 1HFEL 2JVRA 3PEJA 1SUQB 3OFGA 1T02A 3UE2A 2KYXA 3DLHA 2Z0GA 2VF3A 3LWMA 2HFNA 3DCAA 3NS7B 1TU0B 3QIPB 1I1GA 1YLXA 2AJ0A 4XDCA 4USUA 4HI1A 3BS9A 3GSIA 4C8NA 1DZ5A 1MWYA 2LU1A 2JEFA 3Q8SB 1S6UA 1Q53A 2W8KA 1XMQJ 3X1LB 4RX6A 2V4JB 3D4JA 1QLNA 2E7XA 2F3JA 3IR6B 3G6XA 3KDOA 2GMLA 5IZHA 2HHUA 3MEKA 3DRSB 1Q86T 3QT8A 2FZCB 1QSSA 3SIPB 3BR9A 2F65A 3GZ7A 2FLOA 4EU0A 2E5LJ 1Y0HA 2VG7A 3IS9A 3B54A 4LVOP 4IFVA 4U7UK 2FQQB 3G71S 5D4LA 5B0GA 1S0OA 2XWYA 2VIHA 1B0VA 2B5JB 3SMZA 3MCSA 2CJ9A 1R31A 4FYWB 1IKYA 3ZZYA 3K59A 2J7UA 2VG7B 3IS9B 4YUDA 4DR5J 3WC2A 1VRTB 4IFVB 3OTOF 2ZBRA 2GJIA 4KGKA 4RJVA 3C6UA 3W5XA 2MGZA 4ES1A 1JK9B 2FJEB 4KE5A 1CPZA 3T1HF 1BD6A 4AYBD 1IKYB 4USMA 2L9DA 1DTTB 4CLWA 3J7A1 5ETMA 2XYHB 1KBRA 5KT5A 3C6UB 1H0HB 2MGZB 3BQ2A 3FSXA 3KHHA 4ZN1A 4CM0A 3D6TB 2V2KA 2UV8A 1KQFB 4M8LA 1HYSA 3TQEA 1YBUA 3LUYA 1NHUA 2KO1A 1NB7A 4ZPTR 1HD1A 5GADU 1Y3KA 5J2PA 1X4GA 5CZXA 3NS6A 3AQOA 3BO2A 4M5GA 4CLYA 1LXNA 1RADB 5J2PB 4LRFA 3KMQA 2UUBJ 3KUHA 2B8QA 4F3QA 1CJUA 1G4CA 2HBYB 2NXJA 1RAIB 5L39A 2DY1A 3M6WA 3KUGA 1JLCB 2VDHA 2ZM6F 3C66A 1FFWB 2HHSA 4CO4A 2DNNA 3DGVA 1VR6A 3BSNA 2X7IA 4USIA 5C25A 3V5RA 2VV5A 1G3OA 2FYXA 1A0OB 4GVBB 2DNKA 2H48B 3J80Y 2Y0BB 3MAHA 2HPUA 1RAHB 4X4RA 3T41A 1F6TA 3U7JA 2X1AA 4WZQA 2EKYA 3EMTA 2CWKA 1T03A 1CEZA 4WTYA 2DGTA 2R8IA 3B4DA 2HHHF 1N48A 1N5VA 2J8AA 2GA7A 3HSJA 4NLSA 1QJHA 1J27A 4X66J 4DPYA 1FDNA 5EN1A 3PX4A 2CNKB 2CAJA 1T03B 2N4CA 1D1UA 3SSQA 4RW9A 2PT0A 1FERA 2MB0B 3CT9A 3NGSA 3D6HB 4FF4A 2A0FB 1VOMA 1XTZA 1WKJA 1CG2A 4P74A 3KYLA 4HKQA 3HM9A 2HFSA 2E9TA 1HHTP 4LFCF 1CJTB 2DNOA 1WKKA 1YTYA 1ZPWX 2QL5B 2EG2A 4ED3A 4IQXA 4RW9B 2W9BA 2VKRA 5DJBA 4EZ6A 2LYVA 5DO2A 4N47A 3KJFB 4ECTA 1SJRA 5DLFA 1GMWA 5LJ3Y 3TAPA 4P52A 1OY8A 3NGDA 2ADBA 5LXRA 2W9BB 4H4MB 4WIIA 3AD9C 4USJC 5KFWA 1Z2ZA 2AJQA 4ECWA 4ZVQB 1HQUA 4X62F 1KP6A 1XK8A 4FVMA 4JI1F 1LW2A 1V5IB 3HLUA 4Y34A 4NXNJ 1H3DA 2OUGA 1NK6A 2FC9A 3L7OA 2F8EX 2JOQA 4LFBF 4DPWA 2XM3A 2NXNA 3PX6A 1RAJA 4K4UA 1TL1A 4DR3F 1LW2B 2G2ZA 3GG0A 3U1MA 3JSBA 1WSRA 2FY1A 1HWUA 3FC9A 2XG8A 3H7HB 1NPPA 2VQFF 3JAMU 1QUVA 3SV4A 3AAWB 4B3TF 1Y5NB 2VC1A 3AOCA 1HNWF 2MJNA 3P5BP 4B9UA 1RCXB 5U47A 3SI8A 1TL1B 2WRMA 5CH7B 5IOLA 1C4AA 2MQOA 2BX6A 5A6PA 1HR0J 3OQ2A 3VR1A 3M05A 3PHTA 5HJXA 2D3O1 4C98A 2EK6A 4Y28C 3HULA 4QPXA 4N41A 5J1EA 5MLCV 4OZLA 2LXUA 4F02A 4JI4J 4DXLA 2EW9A 2MZRA 2MHNA 3K5OA 1P8GA 3E2EA 3M8WA 1SQEA 1JWWA 2QG9B 5J1EB 4NLGA 3VHQA 5E3PA 2XB2D 1PAEX 3I5CA 4ELUA 4TY9A 2OSRA 2KYZA 3RYLA 4TU7A 1VQ9S 3U1LA 1PAUB 4FXVA 4RR5A 5EHHA 1FCAA 2L9NA 2RQCA 4WFNQ 1X4CA 3Q24A 2DCLA 3M6VA 4TYBA 3PVXA 1KR4A 1JB0C 1EZZB 2V68A 2LVWA 5A2QY 4DL3A 3ZZUA 3PYFA 5J2NA 1S6QA 3Q2SC 2KL8A 4RW4A 2DBBA 4Q7AA 3OL6A 2Z2MA 1UTAA 3P45B 3SBMA 3VALA 2LCWA 2FLLA 2ZDOA 3RRHA 2MTLA 1A7GE 4QU6A 5J2NB 4K5SA 1FKPA 1S6QB 4XO0A 2H54B 2WVDA 4RW4B 1NK4A 2ZC4A 3QWPA 2KU7A 1NH7A 3M8QA 3B6BA 2V6AA 1ZAWA 3KLVA 3DMJA 1X4BA 3AB2B 2BW2A 4IRCA 2C3MA 3PX0A 3GONA 1SH2A 2IDLA 3WDOA 5KFZA 4RKUC 1HHSA 2ZC3A 1JKHA 1FKPB 1F1BB 1NXIA 1XMBA 4ES2A 5CAAA 2JWNA 1W2IA 2BRLA 4Y2CA 4X84A 4FBUA 2OP5A 1PSDA 1FWLA 3MR2A 2CQBA 4B3MJ 1JKHB 1U0SA 1RISA 4C7QA 1PILA 4YMEA 4KTQA 2OTLS 3TWZA 3F41A 3UR3C 2M5YA 3ZZZA 3TJ9A 2DNZA 1HNXF 2IMOA 5EWEA 3ENWA 1WHVA 1HBMA 3DKDA 3NL0A 1XEZA 3R97A 4WP8A 1SKRA 1RWVB 1NK5A 2M52A 5LJ5Y 5KAKA 1U6BA 3AD8C 2M2BA 4LJMA 1IBCB 2DK2A 3IG1A 3H0PA 1HBMB 5ITHA 3X3UA 2E9ZA 2QX0A 3IO1A 1K1QA 3ONQA 1SB6A 4FN5A 1R0CB 1T9TA 4WYWA 2FJWA 1HWIA 5K20B 4MH8A 1EETA 4CYUB 4OHVA 2R7UA 3PG9A 2R8HA 1NBEB 1IQZA 2COLA 3HJFA 3AXMA 1UA1A 2IRYA 1F5CA 2V8PA 4Q44A 1N5SA 3EXYA 3BDEA 1EETB 5D8HB 3FDSA 3W60A 3V6JA 3HT0A 1RE1B 4LREA 2IHR1 2UUAF 5B0FA 1RAAB 3QWUA 4OZ0A 1TUWA 5J2QA 1VDHA 4TYAA 1UWBA 3KK3A 1TKTA 1NK7A 4IOCQ 2CJQA
chains in the Genus database with same CATH topology
2DYAA 3FBFA 3NGTA 3EM1A 2AZ3A 3BBFA 3FKBA 1U8WA 3B6BA 1B4SA 3Q8YA 2DXFA 1B99A 1VYAA 3ELHA 3EVOA 3EVWA 1S59A 5BXIA 3BBCA 4DZ6A 3ZTRA 1UCNA 3FCVA 3FCWA 4ANDA 3Q89A 1LWXA 2VU5A 1BE4A 1NDKA 1NHKL 3GPAA 3L7UA 1HLWA 4W98A 1HIYA 4DI6A 2NCKL 1BUXA 1NDPA 3BH7B 3VGSA 3VGUA 1WKLA 3ZTQA 4EK2A 1PAEX 4C6AA 3GP9A 2DXDA 1NSQA 1MN9A 2B8PA 3EICA 3ZTPA 3NGSA 1MN7A 3FC9A 3MPDA 4FKYA 1NDLA 5CAAA 2B8QA 4O0NA 1WKJA 3BBBA 2DXEA 3Q86A 3G2XA 2BEFA 1NUEA 1K44A 4ENOA 3EJMA 1PKUA 4UOFA 4F36A 5C7PA 3FBCA 1NLKL 1JXVA 1XIQA 1F3FA 2HVEA 4ANCA 1WKKA 3VGVA 4DUTA 3ZTSA 1KDNA 3WX8A 3FBBA 1LEOA 1W7WA 5IOLA 3VGTA 3BH6B 2DY9A 3VVTA 3Q83A 3ZTOA 1HHQA 1NSPA 1NDCA 4CP5A 2BX6A 1XQIA 1NCLA 3ETMA 3EE3A 1ZS6A 1NPKA 4UOGA 3EMTA 4UOHA 1NSKL 1S5ZA 3EVMA 3JS9A 3DDIA 4WBFA 4KPCA 3VVUA 4F4AA 2AZ1A 3PRVA 3Q8VA 1EHWA 4S0MA 3DKDA 3PJ9A 4FKXA 4ANEA 3NGUA 3ENAA 3R9LA 1S57A 1F6TA 2HVDA 2HURA 3Q8UA 1NB2A 5CABA 1BHNA 4HR2A 3B54A 3FBEA 3NGRA 2ZUAA 2CWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYA A;  3FBF A;  3NGT A;  3EM1 A;  2AZ3 A;  3BBF A;  3FKB A;  1U8W A;  3B6B A;  1B4S A;  3Q8Y A;  2DXF A;  1B99 A;  1VYA A;  3ELH A;  3EVO A;  3EVW A;  1S59 A;  5BXI A;  3BBC A;  4DZ6 A;  3ZTR A;  1UCN A;  3FCV A;  3FCW A;  4AND A;  3Q89 A;  1LWX A;  2VU5 A;  1BE4 A;  1NDK A;  1NHK L;  3GPA A;  3L7U A;  1HLW A;  4W98 A;  1HIY A;  4DI6 A;  2NCK L;  1BUX A;  1NDP A;  3BH7 B;  3VGS A;  3VGU A;  1WKL A;  3ZTQ A;  4EK2 A;  1PAE X;  4C6A A;  3GP9 A;  2DXD A;  1NSQ A;  1MN9 A;  2B8P A;  3EIC A;  3ZTP A;  3NGS A;  1MN7 A;  3FC9 A;  3MPD A;  4FKY A;  1NDL A;  5CAA A;  2B8Q A;  4O0N A;  1WKJ A;  3BBB A;  2DXE A;  3Q86 A;  3G2X A;  2BEF A;  1NUE A;  1K44 A;  4ENO A;  3EJM A;  1PKU A;  4UOF A;  4F36 A;  5C7P A;  3FBC A;  1NLK L;  1JXV A;  1XIQ A;  1F3F A;  2HVE A;  4ANC A;  1WKK A;  3VGV A;  4DUT A;  3ZTS A;  1KDN A;  3WX8 A;  3FBB A;  1LEO A;  1W7W A;  5IOL A;  3VGT A;  3BH6 B;  2DY9 A;  3VVT A;  3Q83 A;  3ZTO A;  1HHQ A;  1NSP A;  1NDC A;  4CP5 A;  2BX6 A;  1XQI A;  1NCL A;  3ETM A;  3EE3 A;  1ZS6 A;  1NPK A;  4UOG A;  3EMT A;  4UOH A;  1NSK L;  1S5Z A;  3EVM A;  3JS9 A;  3DDI A;  4WBF A;  4KPC A;  3VVU A;  4F4A A;  2AZ1 A;  3PRV A;  3Q8V A;  1EHW A;  4S0M A;  3DKD A;  3PJ9 A;  4FKX A;  4ANE A;  3NGU A;  3ENA A;  3R9L A;  1S57 A;  1F6T A;  2HVD A;  2HUR A;  3Q8U A;  1NB2 A;  5CAB A;  1BHN A;  4HR2 A;  3B54 A;  3FBE A;  3NGR A;  2ZUA A;  2CWK A; 
#chains in the Genus database with same CATH topology
 2DPJ A;  4D3H A;  1VBY A;  1GNK A;  4TLQ A;  5KFE A;  3EVO A;  5KFS A;  3UD4 P;  1VMB A;  2LXI A;  5L1K A;  1T11 A;  5J2Q B;  1VQ5 S;  1UWB B;  1ZA1 B;  4OHZ A;  5DLG A;  3KK3 B;  3BQ0 A;  1TKT B;  1VQL S;  3V81 A;  3C14 B;  2HZA A;  2ZVS A;  5KOW A;  3NAI A;  2J0Q D;  4OZ3 A;  1IR2 A;  3VTI A;  1VC0 A;  3TAR A;  4XAK A;  2DCU B;  3QRR A;  1YDL A;  4G65 A;  3N6N A;  1XIQ A;  2QSF A;  4K7Q A;  4MMO A;  4YY3 J;  2UXB J;  3V81 B;  1I6J A;  1O0P A;  3FEX B;  1WI6 A;  5AJ3 F;  4DQQ A;  4J9U E;  4I67 A;  5IWA F;  1NDC A;  3DLG A;  3M2V A;  1ZM3 A;  1HKA A;  5M2U A;  4GVL A;  1MNE A;  1D09 B;  4C8O A;  1YJ9 S;  1L3K A;  1M5S A;  3PV8 A;  3IBC B;  1UPM B;  3MPW A;  3PJ9 A;  4DWI A;  2XS5 A;  4I7F A;  2YKP A;  3DLG B;  1CUL A;  3FQL A;  1QAY A;  3OVA A;  4QZV B;  2Q79 A;  3N79 A;  1YJ7 A;  4PG6 A;  3PAC A;  4W90 B;  1HAR A;  2WCX A;  1JIH A;  2G0I A;  2JHE A;  4I7F B;  4QU7 A;  1FRJ A;  1CUL B;  3VZI A;  1TFW A;  3CTR A;  1FRL A;  4R5P A;  4WFX A;  4GC7 A;  4G1I A;  5K9F A;  3LA0 A;  1LQ9 A;  2AIR B;  2Q43 A;  2AX1 A;  1Q0N A;  2UXC J;  1L3T A;  3F56 A;  1FE4 A;  3QJL A;  2BJ3 A;  1LK7 A;  5BYQ A;  2FJA B;  3MEC A;  4R5P B;  4YHH F;  1E6Y A;  1IBL J;  1NSK L;  1RWW B;  1GX5 A;  2MQP A;  1T0T V;  4RU2 A;  3JTN A;  5F0U A;  1AFI A;  4ZPW R;  1YX2 A;  2X1B A;  1W26 A;  1EHW A;  1UFK A;  4J9Q A;  1C2P A;  4QR1 A;  4WFA Q;  3MTK A;  3DGP A;  5DDO C;  3T5K A;  3PFO A;  3Q0A A;  3BYP A;  3K89 A;  2KI2 A;  1PYS B;  1F0X A;  1A9N B;  4QW8 A;  4NA3 A;  1PG5 B;  1DAR A;  2LA6 A;  5ETT A;  3P49 B;  3PW5 A;  7FDR A;  4CO2 A;  2DNM A;  3DGP B;  4DUZ J;  2EC2 A;  2MKC A;  3E51 A;  3UDL A;  2DXD A;  4WFY A;  4I6W A;  5CHC B;  1WC1 A;  2V94 A;  5CCL A;  5KFF A;  2IVM A;  2CWX A;  3K5M A;  3KTQ A;  2RDJ A;  4L75 A;  4CT8 A;  3ISZ A;  2CVE A;  2IBK A;  2FVP A;  4KGX B;  5E33 A;  1S72 S;  1YJN S;  3IRX A;  5ETQ A;  4AQY F;  3TA2 A;  1U2R A;  5IT9 U;  3H8Y A;  2HND A;  4RWX A;  5GAG I;  4ZK7 M;  5IC6 B;  4KQZ A;  4AXJ A;  5DM6 Q;  4ECQ A;  1N52 B;  2JFD A;  2KM8 B;  3IRX B;  5KT3 A;  2D3O R;  2HND B;  1RK8 A;  1VYA A;  4W4M A;  3B8H A;  3W61 A;  3LAL A;  3FCW A;  4TN2 A;  3I0S A;  2E1P A;  4DR7 J;  5KFN A;  4OYO A;  3GIJ A;  4C9D A;  4LR9 A;  2DXE A;  3B4M A;  2IIH A;  2YTC A;  4X2B A;  2HGM A;  5L38 A;  4ILL A;  2NPI A;  4HTI A;  3QYY A;  3I0S B;  4M5L A;  4KPY A;  5I3U A;  4B9S A;  1DFD A;  2JX2 A;  4EYH B;  2IJN A;  4M5J A;  3VGT A;  3HSZ A;  3OHB A;  4F8R A;  2H5J B;  2RS2 A;  3J7Y I;  3V6K A;  4M5I A;  4A46 A;  4DG1 A;  5I3U B;  2QA1 A;  4NYZ A;  1TMJ A;  4Z7C A;  2GO8 A;  2VAS A;  2JC1 A;  2ZH5 A;  2QA4 S;  4U7C A;  2WSE C;  3MAA A;  1QSY A;  4FPI A;  4B9M A;  2FZK B;  2K8G A;  2OH2 A;  2I8E A;  3FRZ A;  3JSM A;  1E6V A;  5B0C A;  4DG1 B;  1N36 J;  4DS5 A;  4JI7 F;  2EXU A;  3ULH A;  5KFM A;  4DLE A;  2BJD A;  3K58 A;  2ZKT A;  2P2C B;  3MAA B;  4BHQ A;  3MM7 A;  1ZM4 A;  2EEY A;  3IAM 9;  3JSM B;  4DPT A;  1E6V B;  4P72 A;  2PFD A;  4DV3 F;  4BWJ A;  3PJX A;  1X31 C;  2KT5 A;  2Y1I A;  5F8J A;  2AJ1 A;  4OX9 J;  1SJ4 P;  4DF4 A;  1W7W A;  3MM7 B;  4DL7 A;  1MLA A;  2WSC C;  2ZJP Q;  2PC6 A;  2DTJ A;  3FK4 A;  2M8D B;  3EGV A;  5LXY A;  1SQF A;  3OV7 A;  2MZS A;  2ZWP A;  3BF4 A;  2UVV A;  3NS5 A;  2VFU A;  4JV0 A;  1VFJ A;  1WEX A;  1U09 A;  3CJT A;  3NNC A;  4OYX A;  2DB1 A;  2V2Q A;  3M2R A;  4LF8 F;  4WJB A;  3GYX B;  1F9E B;  1RWN B;  4RUH A;  3EDR B;  1F5B A;  1SPB P;  2VPY B;  4F4K A;  2Q66 A;  5AE3 A;  4I69 A;  1TUG B;  3LTO A;  2MY7 A;  3P8B B;  3VAF A;  2NSC A;  2CAD A;  3M2R B;  2EFP A;  2N7C A;  3D1Q A;  1JLE A;  1UKU A;  1QY7 A;  2Z30 B;  3KJQ B;  1D8Z A;  1X0F A;  3HX9 A;  3HO1 A;  1N32 J;  2HHT A;  1NLK L;  2DH8 A;  2CPD A;  1TMM A;  3NY0 A;  2R7R A;  2RDI A;  2YPZ A;  2XZD B;  1LFW A;  2AJF E;  2HGL A;  2VBZ A;  1JLE B;  3AOA A;  2W01 A;  4ETX A;  4A8F A;  1YKW A;  4F50 A;  2F4V J;  1HD0 A;  3RJM B;  4ZIW A;  2H5E A;  2EKN A;  3SDE A;  3EVM A;  1CJV A;  4KPC A;  5HVG A;  5KOX A;  2NS1 B;  3FMW A;  2W1B A;  3L7P A;  5K8O A;  1R3N A;  1HQ2 A;  3CCZ A;  1N5Q A;  1X4F A;  1N56 A;  1B3T A;  2PMH A;  1JQG A;  1TL3 B;  1EKS A;  3H5U A;  1CJV B;  2EFQ A;  5DG7 A;  1S59 A;  3DI6 A;  2G0J A;  2CRL A;  2GVD A;  1FT8 A;  2EVZ A;  4U95 A;  3HHL D;  2YKA A;  2J0W A;  1NDP A;  1Q95 G;  4GMK A;  4KGV B;  1NKB A;  1ZPV A;  1MN9 A;  5IM0 A;  2R7W A;  2AF6 A;  8ATC B;  3W62 A;  1H7X A;  1K44 A;  3DI6 B;  3R2D J;  2GVD B;  4RNF A;  3BN7 A;  2XCP A;  3FBB A;  4A8W A;  5HLF A;  1C1C A;  2MDA A;  1ITP A;  3MUM P;  4Y00 A;  5A0Y B;  5JMN A;  4X4T A;  5KG1 A;  3FGV A;  1GH8 A;  2VG5 B;  2L08 A;  3S7R A;  4OI3 A;  3TVZ A;  4JYA F;  5DG8 A;  3BSO A;  1D8Y A;  4KB7 A;  3OTC A;  4CNY A;  1C1C B;  3ENV A;  4KC5 A;  2HZC A;  1R0B G;  4KV8 A;  5BYR A;  4C48 A;  1RYR A;  1XNR J;  3DDN A;  2RNE A;  3FKB A;  2DXF A;  5HO4 A;  3TX0 A;  1KN6 A;  1S9E B;  3GCX P;  3E3X A;  4AND A;  3EXC X;  2PE8 A;  5KFD A;  4W98 A;  4ZVG A;  8AT1 B;  2BOA A;  4YR2 A;  3PKY A;  3KJV A;  1LV5 A;  3HVA A;  3T1Y F;  3WQP A;  4K0K F;  4JI2 F;  2VDI A;  1IM4 A;  2MSS A;  5L9X A;  3NCQ A;  4PG7 A;  4CLU A;  3GMG A;  3T19 A;  4DV0 J;  2E5H A;  4NLV A;  5B09 A;  1KSP A;  2FVQ A;  2OO4 A;  4F4Z A;  2MKH A;  2RHS B;  3KJV B;  4JV1 A;  3L9Z A;  3KG1 A;  3DOL A;  3T1A A;  2B3T B;  4PAB A;  4QIF A;  5D3G A;  3R7S B;  2ZH4 A;  4WFZ A;  2BQR A;  1OSC A;  3CD6 S;  3QAT A;  4IG3 A;  5A76 A;  5E3C A;  1SVD A;  2UZA A;  3R1L A;  1HQE A;  2LEP A;  3DOL B;  3A8K A;  1KEK A;  1WC4 A;  3ZFV A;  1PIE A;  3SSS A;  2MXY A;  5D3G B;  5HQL A;  3CJR A;  4QWC A;  2LQ8 A;  4KHP F;  4CZC A;  4L6V 3;  2JZ5 A;  4RUA A;  3IXQ A;  1HQE B;  3H4D A;  5GAG U;  2RB7 A;  1V3Z A;  3C3L A;  4WE1 A;  3H5Y A;  2FIU A;  4ZVU B;  5F3Z A;  2W4C A;  3CW2 C;  2Y9H A;  3MED B;  3R5A A;  3W9H A;  1S76 D;  4F36 A;  1FTC A;  2ZH7 A;  4QIV A;  2GCF A;  1H2V Z;  4ED1 A;  1JJ2 R;  1UMJ A;  4WE1 B;  1EIY B;  3CE8 A;  3N01 A;  3D0I E;  2QO3 A;  1XMQ F;  3E01 A;  1RA7 A;  1Z2L A;  2B4P A;  5I42 A;  2WHO A;  3R7N B;  1U2F A;  5IS2 A;  3NNH A;  4TY8 A;  3BM7 A;  4UOG A;  3GFH A;  4NAS A;  5H9E K;  1UL3 A;  3FJ2 A;  4YP3 A;  4C0B A;  1WOP A;  5C42 A;  3E01 B;  5I42 B;  1LWX A;  4TY8 B;  1TKZ A;  2E5L F;  2IRX A;  3BGL A;  1SC1 B;  2OEK A;  4HI2 A;  4NMX A;  2I1R A;  4ZLJ A;  4MKV A;  3J7Y U;  3Q89 A;  4FVC A;  2KJV A;  5CD4 H;  1JJ4 A;  5C42 B;  4GKJ F;  3T6J A;  2W7P A;  4YB7 A;  1S0N A;  5DM7 Q;  2CDR B;  3HSG A;  1KON A;  3V4M A;  1OY6 A;  2XMK A;  5FLX Y;  2EBG A;  3BKU A;  3O5T B;  3H2U B;  3DC2 A;  1NHV A;  2DR7 A;  1FEH A;  5A6W A;  1HL6 A;  2CNO B;  2RF2 A;  4JB8 B;  4OMF G;  4NZ0 A;  3Q83 A;  1WWH A;  3ZNJ 1;  2RH3 A;  4QWE A;  4DR1 J;  1N88 A;  2RDD A;  3GWC A;  2FB0 A;  2ZOM A;  4ZVS B;  3CCV S;  3RB6 A;  1FKA F;  9ATC B;  1FK9 A;  4PCQ A;  1U24 A;  2V8V A;  3W2W A;  1K1S A;  3BKF A;  1VQ6 S;  2RF2 B;  2B6A A;  2FJB B;  2DHG A;  3VZH A;  2A18 A;  2G2Y A;  2J8S A;  2KZM A;  1GTH A;  1FK9 B;  3LQV A;  4JUZ A;  1ZTW A;  5F8M A;  2OIH A;  3W2W B;  4Q8F A;  2ASY A;  5HBM A;  2B6A B;  3MCO A;  2C2M B;  5E5N A;  1OMS A;  3AJ1 A;  3OVS A;  5T41 A;  2D9O A;  2OEM A;  1J5O A;  1S77 D;  4AUK A;  1YRT A;  4BDP A;  2F40 A;  4DU7 A;  2HWI A;  1RSC A;  1YBA A;  2FHJ D;  1S97 A;  5HBM B;  3TOQ A;  3DU6 A;  2HQC A;  4IO1 A;  1WDT A;  2QA4 G;  1J5O B;  1KLM A;  4NLY A;  1GMU A;  1TL5 A;  4A8K A;  3DLL Q;  1RWM B;  2VON A;  1VRU A;  2FZG B;  4ECX A;  3DLE A;  3FMB A;  5H9F K;  5E7O B;  5KFP A;  4UOH A;  2EFG A;  2H1Y A;  1L3U A;  3LAM A;  3O3L A;  5HVH A;  1Q5V A;  4F4X A;  1KLM B;  3QID A;  3KDN A;  2R9L A;  3IRW P;  1Y5I B;  1NK9 A;  4AFF A;  4Q8E A;  1VRU B;  3CIZ A;  2F9D A;  4OX8 A;  1H72 C;  3LAK A;  5KFY A;  1IBM J;  1M1K T;  4K4X A;  3M6X A;  1U8W A;  4C0H A;  1PJ7 A;  4O4G A;  3GFZ A;  2VU5 A;  1VJW A;  4CM2 A;  3MFH A;  3HKW A;  3MUV P;  4C6A A;  1S9G A;  4X66 F;  3UD5 A;  4KHR A;  2PI5 A;  1G1X A;  5B0A A;  1NKC A;  3UCZ P;  4N8N A;  3ZZR A;  2FD2 A;  4O4G B;  1LW0 A;  2BBE A;  4DQR A;  2R7T A;  1LK5 A;  3HHL C;  4ZLN A;  2Y3Y A;  2XY6 A;  2P9E A;  1S9G B;  4L3K A;  2MLY A;  1T9U A;  2OI2 A;  4DSK A;  5ETS A;  1CJK A;  2OJ3 A;  3MHY A;  4C97 A;  4PXB A;  2ATL A;  4RO0 A;  3QRQ A;  1XWL A;  1LW0 B;  5KTQ A;  2AV5 A;  4JI8 J;  1K0T A;  1U1M A;  1RP5 A;  3CWJ A;  2UVW A;  1CC8 A;  4BLG A;  5KFL A;  4ZP7 A;  2XSF A;  4IYQ A;  1WTB A;  1WTF A;  4PG5 A;  3VAI A;  1CJK B;  1IR1 A;  2OLW A;  2DIU A;  3KLI A;  3O1L A;  5KFB A;  3FBE A;  1YI2 S;  4X4P A;  1OPI A;  3F73 A;  3T3F A;  2KT2 A;  3EPG A;  2FHM A;  3KG0 A;  1WDD A;  3BO4 A;  2FDN A;  4QJV A;  3N28 A;  2PA3 A;  5SUH A;  3TW0 A;  1S1T A;  3PEH A;  1Q5Y A;  2RAQ A;  2FJD B;  4IFY A;  1QAX A;  1TFY A;  3KLI B;  3EDQ B;  4X4N A;  1G6B A;  1RT6 A;  1LWF A;  2CZ4 A;  2JEI A;  4JOU A;  4WF9 Q;  1KS2 A;  1YQH A;  2K06 A;  2XZW A;  4OV6 A;  4O0N A;  3MM6 A;  2XHC A;  4Q0B B;  4P2F A;  4IFY B;  1NKE A;  2HVZ A;  3MR7 A;  3CCR S;  1RT6 B;  3LGM A;  1LWF B;  2HHQ A;  4MFB A;  4TKT A;  2Z4P A;  2ZZN A;  5FD1 A;  4ZJQ A;  2HG4 A;  3MM6 B;  3GYN A;  2NUU G;  4FF1 A;  1DRZ A;  1HR0 F;  3CGI A;  2EI5 A;  3BSA A;  5T14 A;  5HMW A;  1N4L A;  3PIP Q;  4C3M A;  4NCB A;  2HVD A;  4EYI B;  1EAR A;  4MFB B;  2K2P A;  2ALY B;  2W2M P;  2DYA A;  5I3P A;  2YX7 A;  4IR1 A;  1TQL A;  4PQU B;  5BR8 F;  2FHK A;  2ZD1 A;  2ROE A;  3KLG A;  5FJ4 A;  2DRD A;  3J81 Y;  5J1N A;  3HHN B;  2CQ1 A;  4F0H A;  2UV8 G;  1RBO B;  6FD1 A;  3CCQ S;  2MKJ A;  3K5L A;  5KFT A;  3JQM A;  3C16 A;  4FXD A;  9RUB A;  4FPR A;  4AD6 A;  1RTD A;  2FTR A;  3CDE A;  2CIM A;  2ZD1 B;  3KLG B;  3D2W A;  1NJX A;  4KHM A;  2LA4 A;  2FGC A;  2SXL A;  2E66 A;  2F4F A;  3EGN A;  4DU8 A;  2LMI A;  4NCG A;  3WX8 A;  3C16 B;  4F4W A;  3J80 U;  4K4T A;  3AD7 C;  3KFW X;  4WU2 A;  2V8D A;  3TJ8 A;  1RTD B;  2MKS A;  4O44 A;  3WHI A;  4LBP A;  1AW0 A;  4NRT A;  3CCE S;  2VFR A;  2GVZ A;  1M5P C;  4OYP A;  2DGV A;  1W25 A;  2RRN A;  2HFU A;  3OJU A;  4GKK F;  2F8M A;  2G1H A;  2XNQ A;  5HI7 A;  4O44 B;  2OD6 A;  2BKN A;  1V6H A;  2K7J A;  1WEL A;  1RCO B;  2AZ3 A;  5C5J A;  3B78 A;  2KFY A;  3GE9 A;  1NSA A;  4NWB A;  1FD8 A;  2GVZ B;  2M9K A;  4P2X A;  1HNZ F;  1UFL A;  4QPT A;  4CLT A;  4G6V B;  5DGB A;  2ZJQ Q;  4IKA A;  2VL1 A;  2HQI A;  2DGQ A;  3A13 A;  1UW9 A;  2LEC A;  1NZ8 A;  1N0U A;  2HIY A;  3BDP A;  4PEO A;  3CJQ A;  2LEB A;  2AJ4 A;  2BE2 A;  4U8Y A;  2DH7 A;  1A6L A;  3UCG A;  3DOK A;  2XUL A;  4C8K A;  4RBU A;  1ACM B;  3MFI A;  4B3M F;  1UVL A;  2KXH A;  2V0N A;  1I51 B;  2G4B A;  1Q82 T;  4KGZ B;  1QUP A;  1CQN A;  1RU2 A;  2BE2 B;  2P8I A;  3JAM Y;  2KXF A;  3D0G E;  3DOK B;  4OI6 A;  2B9W A;  4L73 A;  2XSJ B;  5KT7 A;  2KHD A;  7AT1 B;  3GB0 A;  3M8Z A;  2KM8 C;  3OD2 A;  2W25 A;  1HWJ A;  1TEL A;  2QFI A;  3R27 A;  5DRK A;  4ECS A;  1CSJ A;  2N4D A;  3K8V A;  5JJB A;  3CCW A;  4YDX A;  3ZO7 A;  2VQE J;  4ZVR B;  3TUP A;  2IY5 B;  4A47 A;  3DLB A;  4USH A;  1R89 A;  4ZCI A;  3BJY A;  4OYB A;  2CPJ A;  3P4U B;  2YNI B;  1VQ8 S;  1F3V A;  2LQJ A;  1LEO A;  3RUB L;  3R7B B;  2XMW A;  3QJJ A;  4JI3 F;  2CUY A;  2W8L A;  1BWE A;  1ZS6 A;  1IBK F;  1JJC B;  2ZM6 J;  1P6T A;  2QTW A;  1MRO A;  3PYD A;  1SBR A;  2E1C A;  3GFX A;  3PO4 A;  2W2Q P;  1X4D A;  1Q16 B;  5THW A;  4I6A A;  2HQF A;  4QYR A;  4CTA A;  2UVR A;  1ZM9 A;  3LO3 A;  1G7C B;  4OZ1 A;  4EBE A;  1MRO B;  4ZPC A;  3THV A;  3ELH A;  2DHH A;  3JTP A;  1M5V C;  4KH1 B;  2KHC A;  4ZVO B;  1YVF A;  4BBY A;  3TEG A;  2HKE A;  3HF5 A;  1R7I A;  3FSY A;  2HHH J;  1HBO A;  2QSW A;  1FRK A;  4LIR A;  2PGC A;  3BPS P;  3CD7 A;  1UFW A;  4CTA B;  3ILJ A;  2DR8 A;  4KSE B;  3MPD A;  4FYX B;  4NXM J;  2BEF A;  4FNH A;  4ZS6 A;  3C6T A;  5A2Q U;  1RHR B;  2B4O A;  5IFM A;  3P3D A;  1HBO B;  4LUB A;  3TUI C;  3SCL E;  3OW2 R;  2Z2Y B;  4YY3 F;  2HHX A;  2HQ3 A;  5IV3 A;  1JLQ A;  3DFE A;  3CDU A;  1Y5L B;  2GFF A;  4PXE A;  5DZ6 A;  3C6T B;  2MHE A;  3I5A A;  2JEJ A;  2W9A A;  2DNQ A;  5D0E A;  3AH6 A;  2ATC B;  3JXO A;  1B7Y B;  4PYA A;  2AGO A;  4XPE A;  3NGU A;  3R9L A;  1NB2 A;  4EGL A;  1JLQ B;  2GAH C;  2B0G A;  4BCA A;  2A3J A;  1H38 A;  2PDA A;  2WZ1 A;  4HEA 9;  2KG1 A;  3T5L A;  4UUW A;  1RTZ A;  5BYS A;  3QPI A;  4X62 J;  2MQL A;  2BAN A;  2DNY A;  4YB5 A;  2CQG A;  1KRP A;  3PYE A;  2V34 A;  1UEU A;  3W64 A;  4ED0 A;  1HPZ A;  2RU3 A;  2HMI A;  2WOM A;  3CJ8 A;  3TAM A;  3NKY A;  2QZ8 A;  3T5J A;  5CYM A;  2H4Y B;  3K2Y A;  4X4Q A;  2BAN B;  2LLZ A;  1D3W A;  4WKY A;  2VQF J;  3PHE A;  4B3T J;  1O6X A;  3BH6 B;  3TAM B;  4PG4 A;  1HNW J;  1P1T A;  4QWA A;  5CYM B;  3W63 A;  5E41 A;  5GAE I;  4CO3 A;  4P2M A;  1X5S A;  2Z2Z A;  2LFV A;  4HLB A;  3BGO P;  1BQX A;  5JXS A;  4Y3C A;  4MJK A;  3M4X A;  3M8S A;  1FEE A;  1XBW A;  5EX3 A;  3PW7 A;  1PC4 A;  1WNE A;  5BXI A;  3DRX A;  2YNG A;  3NXZ A;  4O3N A;  3RB3 A;  4QR2 A;  2ZKU A;  3WBZ A;  1FX2 A;  3W66 A;  3OL7 A;  3POT A;  4A8X A;  1MN7 A;  4ECV A;  4KH0 B;  2IBO A;  1CS4 B;  2QIF A;  4LRC A;  2PII A;  2D69 A;  2QFJ A;  3SQO P;  2VOO A;  5DET A;  1Y11 A;  3POT B;  4U8V A;  2M70 A;  2HVH A;  3H42 A;  2GZO A;  3VV2 B;  2N82 B;  5ADZ A;  4F26 A;  1NEE A;  2L3M A;  1V9O A;  4KT0 C;  2VA3 A;  4MIB A;  1JLB A;  3OXF A;  4KR0 B;  1Y7P A;  4KJI A;  4CLL A;  4KY3 A;  2EFV A;  4ZPB A;  1WF1 A;  5KFG A;  2RJZ A;  4UQT A;  3RG6 A;  3O2I A;  1RLD A;  2NR0 A;  1RTJ A;  4OJG A;  4LR8 A;  5FDL A;  5HRO A;  2D74 B;  2V4J A;  1VK3 A;  2V4Q A;  3MGJ A;  4DV4 J;  3EZO A;  1JLB B;  2QMX A;  1RT2 A;  2VBW A;  1Q7Y T;  3D6M B;  2HFV A;  5AXM A;  4A48 A;  3MR3 A;  3DRS A;  1S0V A;  1ZET A;  1KTV A;  3TEH B;  3GG1 A;  2J0X A;  1RTJ B;  5FDL B;  5HRO B;  1N33 J;  2GQ2 A;  4N56 A;  1PBU A;  4R0J A;  2VFS A;  1RT2 B;  5G0R A;  2VH7 A;  3OSN A;  3BGF A;  4C0O C;  4B3S J;  2HZV A;  5DG9 A;  1SKS A;  3KNG A;  4AL5 A;  2NSB A;  2Z58 B;  3NRB A;  1VHI A;  1EX8 A;  4ED2 A;  2B5J A;  3QGI A;  3CMQ A;  4R0E A;  2B9X A;  3TA1 A;  4DPU A;  3UR0 A;  5A8K B;  1F60 B;  2EG1 A;  1VRT A;  5G0R B;  2ZZM A;  3Q8R B;  2UXD F;  1MWQ A;  2JH3 A;  3BPD A;  3GTY X;  5CZV A;  1KHV A;  3V2U C;  4WWS A;  3ENA A;  4LF7 J;  1L3S A;  4OIX A;  2R2U A;  1DTT A;  3UDE A;  1WOR A;  2WVC A;  5ETR A;  4C4W A;  5HMY A;  4OYM A;  2OHD A;  1B7F A;  2Q6B A;  4CRJ A;  4EI2 A;  1RLC L;  1CVJ A;  1RHU B;  3GIM A;  4OV1 A;  4DPX A;  1N36 F;  4DUY J;  3AOB A;  4KKO A;  4EK2 A;  3UQS A;  3HSD A;  2VPX B;  2I0X A;  3DRY A;  2MZT A;  1FWK A;  4X4V A;  4KO0 A;  4F2R A;  1IJE B;  2XNR A;  2PMW A;  3U1N A;  1KVJ A;  1FXR A;  5ETN A;  3CCS S;  4KKO B;  3UWT A;  4C8Y A;  3RGI A;  4OX9 F;  2WB1 D;  1C1B A;  4AL6 A;  1J5E F;  3ISN D;  4KO0 B;  4CLP A;  5F41 A;  3MM5 A;  4YFU A;  3I4P A;  5I3Q A;  1Q8L A;  3RR7 A;  4K4W A;  1RBA A;  1FRX A;  2FLP A;  1O8B A;  3Q8U A;  2YQ3 A;  5ETP A;  3UVJ B;  2DR5 A;  1C1B B;  3A4T A;  2IM0 A;  1NJI T;  5K14 A;  4CDI A;  5HQ8 A;  4F2S A;  5DZ7 A;  1JLC A;  3MWB A;  1RAO A;  4CH7 A;  3LPE A;  4RNO A;  3MM5 B;  2CDQ A;  3GR0 A;  5F0W A;  3LGN A;  1TL4 A;  1ARO P;  1REV A;  2E7W A;  3RBZ A;  4LFA F;  4Y6I A;  5LL6 d;  4GVB A;  3H40 A;  2DHX A;  4NLP A;  1N34 F;  1OQ3 A;  3FNN A;  3LF0 A;  1VHF A;  5K14 B;  1WF0 A;  2BV3 A;  3SQG B;  4CLK A;  3EYZ A;  2F5G A;  5KG7 A;  1D0E A;  2HWT A;  1REV B;  3EGW B;  1WEY A;  1WJ9 A;  1IQT A;  3D1O A;  4B17 A;  1TV6 A;  4U9R A;  4XDD A;  2B4U A;  2CQ2 A;  3HXM A;  4FDF A;  4LT6 A;  3I82 A;  1N32 F;  2CPE A;  2XTJ P;  2GAG C;  2P5V A;  1HMV A;  1FD2 A;  4RBT A;  2O67 A;  5ETK A;  3L4B C;  5AJ3 J;  3Q2T C;  1TV6 B;  3CDB A;  3KHG A;  5IWA J;  2J9D A;  2AMC B;  4NLX A;  3P5T L;  3D5M A;  3DRP A;  3PRB A;  2AGQ A;  1CJT A;  3VQS A;  3PFE A;  1HMV B;  4ZVP B;  2CQ4 A;  2NZC A;  1SL0 A;  1NJW A;  3H2L A;  2V9K A;  5KG4 A;  1HWK A;  4G1P A;  4DN9 A;  4OLP A;  4L74 A;  3DRP B;  3QGP A;  2E5I A;  2O3D A;  1U1P A;  3VWS A;  3NMA A;  2FPH X;  2XCA A;  1I5O B;  6AT1 B;  3EIC A;  4H4M A;  1CQM A;  1BLU A;  1XN9 A;  1RT7 A;  4C3L A;  2ZDP A;  3OR2 B;  3ZTS A;  1RGV A;  3NCR A;  1EB0 A;  1U26 A;  1Q79 A;  4OHY A;  3EX7 B;  1TK5 A;  2XS7 A;  1WAC A;  1GK8 A;  1R0A A;  2YWG A;  1NSP A;  3I56 S;  1RT7 B;  1LXJ A;  5EUH A;  5L8R C;  2DH9 A;  2MEW A;  2H9Z A;  2C28 A;  1FDD A;  1UVJ A;  2X3D A;  2PO4 A;  3LWL A;  1L3V A;  1M0S A;  3VF0 B;  1R0A B;  5CAB A;  2I2Y A;  1OWX A;  3P6Y C;  2MLZ A;  4LSN B;  1VK8 A;  3W5Z A;  1TAU A;  3UDC A;  2J7W A;  2OFG X;  1XER A;  1D9D A;  1FVQ A;  1SXL A;  1XNR F;  2R7X A;  1MMD A;  2R4F A;  2DT9 A;  3TYT A;  3PIO Q;  1MG7 A;  3H25 A;  4OFZ A;  3HHD A;  5GAE U;  4NYP A;  3CD0 A;  4P9S A;  1FI4 A;  2ILZ A;  4YR3 A;  2BXJ A;  3TUZ C;  4FKY A;  1RI7 A;  1AA1 B;  4RWW A;  3TO8 A;  2D3Z A;  2F1F A;  4C3K A;  4PRF A;  4OI0 A;  1FNO A;  5KFO A;  5CQG A;  1IM6 A;  4N77 A;  2DRB A;  4NCA A;  3H5X A;  1GFW B;  2G13 A;  2EBE A;  4X4U A;  2DVI A;  1VIS A;  3KOA A;  1SC3 B;  2AU0 A;  4RBV A;  5AE1 A;  2GC8 A;  3HVT A;  2WVF A;  1T3N A;  2CXE A;  1M5K C;  4L3N A;  4ZPV R;  3AJ2 A;  2MQQ A;  5IC4 B;  2ZEJ A;  2V9W A;  2M7S A;  4AQY J;  4FS1 A;  3RZA A;  5B7W A;  4FKX A;  3NP5 A;  5DGA A;  1K9M T;  1ZZN A;  4HR2 A;  1RJJ A;  3MCN A;  3HVT B;  3CD5 A;  2JLG A;  4EMD A;  2Z8Q A;  3TZZ A;  3SYZ A;  1TVR B;  2K1R A;  1URN A;  4F25 A;  1DQA A;  1UVM A;  3DLK B;  2NCK L;  3PW0 A;  4DV6 F;  3J7Z 5;  1YBT A;  2OPQ A;  3KNA A;  1NK0 A;  4QQB A;  2CJK A;  1KNZ A;  4A8Y A;  1JLG A;  4DV7 J;  3OTE A;  4I2Q A;  2XO7 A;  1NUE A;  1CC7 A;  2K1R B;  1AUD A;  5LSL A;  3TQ1 A;  2EFO A;  4X64 J;  4H54 A;  2VFT A;  1NPR A;  1VQO S;  1B0T A;  2E5J A;  2OPQ B;  1TUV A;  2W9C B;  1JLG B;  2YQ0 A;  4I2Q B;  3W8P A;  4CWB A;  1L5U A;  1PO6 A;  3CC2 S;  1O5J A;  2OKQ A;  2PSZ A;  3HMJ G;  3PR4 A;  1B0P A;  2YX4 A;  2DEI A;  2V50 A;  2AZ1 A;  2NYI A;  2VOP A;  2GIQ A;  3EWG A;  2A6O A;  2XGP A;  1OO0 B;  2IFX A;  4TXS A;  1S57 A;  4PR6 A;  1WC0 A;  2P6T A;  4PWD A;  2DHA A;  3M6U A;  2ZOG A;  1MMN A;  1QSL A;  5D0R A;  2HWH A;  2B51 A;  3S01 A;  1GXU A;  4ID5 A;  1FRH A;  3CC4 S;  2CQC A;  5LMU F;  1WF2 A;  2D3U A;  4IH7 A;  4PWD B;  1S1V A;  4Y2K A;  5DS7 A;  5D0G A;  4B3R J;  3THP A;  4OJ1 A;  2C2O B;  4LF5 J;  1NH8 A;  2E9R X;  2QLF B;  1PKU A;  1F2G A;  5GMD A;  4P75 A;  4ID5 B;  4EO6 A;  4ECR A;  3I5B A;  4PYD A;  1VQS A;  1S1V B;  4JV5 J;  2CG8 A;  2JVO A;  2BJ9 A;  3CMA S;  2W4D A;  5JUM A;  1Y4Z B;  4WK3 A;  3D54 A;  4DCP B;  3DXS X;  3GIL A;  2KDO A;  3QRP A;  2YWK A;  4GO5 X;  1UVN A;  4EFA C;  4DR1 F;  1S48 A;  4YR0 A;  2APO A;  1EAY C;  4DV5 J;  3VVU A;  4QIG A;  4CYU A;  2O01 C;  3NAH A;  3RR8 A;  1Q1K A;  2ZH3 A;  1IUJ A;  2AHO B;  3HHL A;  4TU9 A;  1GEH A;  4J37 A;  3ISN C;  4HT5 A;  2HHW A;  4MK7 A;  4YN3 B;  3L3C A;  2H5I B;  1QAJ A;  4OZN A;  3HD1 A;  3M2U B;  3GFY A;  2MLX A;  2ERR A;  1NME B;  2WAQ D;  2IDE A;  3EVW A;  5GME A;  4CLZ A;  1GTE A;  1XMO J;  2MQ8 A;  2AYB A;  2HRT A;  2WB4 A;  3HHL B;  3HD2 A;  4DI6 A;  1IXK A;  2HNY A;  2HNZ A;  2N3L A;  1U45 A;  1RHQ B;  4QYZ K;  1TK8 A;  2C2E A;  2F9J A;  3BO3 A;  1EP4 A;  5HSP A;  3VGV A;  1FES A;  1RHJ B;  2BM0 A;  4UST A;  3GU0 A;  3FQK A;  3TNV A;  2HNY B;  2HNZ B;  3I9Z A;  1S6O A;  4CT9 A;  4M5H A;  4JI6 J;  1LFP A;  4J5O A;  3C14 A;  1H2U X;  4ED5 A;  4DSF A;  1Y9O A;  4P71 A;  2BVZ A;  1EP4 B;  1FRM A;  1EQ0 A;  2OGU A;  3A3N B;  4S0M A;  3MCM A;  2AYE A;  4DCO B;  4ANE A;  3DNC A;  4LF4 F;  1OYD A;  2C2Z B;  3PZP A;  4ZJL A;  2FC8 A;  1AT1 B;  4CO5 A;  4DL2 A;  2BMB A;  1OIA A;  2XHW A;  2CKW A;  5CD4 A;  5D77 A;  5D78 A;  4HHU A;  1ZZF A;  2J9E A;  4LF6 J;  1T94 A;  1HNV A;  1T9X A;  5EGY A;  2GW8 A;  3I96 A;  4NOH A;  4YB6 A;  1SC4 B;  3IP0 A;  1P9Y A;  4BC9 A;  1WG1 A;  4DMZ A;  1VC6 A;  4ILM A;  3MMB A;  4ETZ A;  2LQ5 A;  2RU9 A;  3HVW A;  5LSO A;  4ZN3 A;  3Q86 A;  4PXD A;  2X51 A;  2RIJ A;  5LM7 E;  4PG8 A;  1HNV B;  3GJQ B;  2HVE A;  4DUT A;  1IJF B;  3LGH A;  2Y8W A;  3JB9 k;  2QLX A;  4LMZ A;  1VC5 A;  3NOG A;  2CVI A;  3MMB B;  1UEK A;  3QSY B;  1RAG B;  1YJT A;  1MU2 A;  4WCE Q;  4ZIV A;  1DUR A;  1PJ6 A;  2QL9 B;  2AEJ A;  2Z2L A;  2LQ9 A;  4M5N A;  4ALZ A;  4NZ7 A;  3Q8V A;  2UU9 F;  4ZJO A;  4JI8 F;  5D0H A;  2J76 E;  2H4W B;  4QR0 A;  4JYA J;  3KWM A;  1MU2 B;  4FP9 A;  5KFC A;  1U1R A;  2YVS A;  2C3P A;  1RHK B;  2WSF C;  3D0H E;  5AXL A;  3L09 A;  3BBC A;  4UZC A;  4OI4 A;  3KHL A;  1FWP A;  4NYO A;  3CIM A;  3MTJ A;  2P6S A;  1GMV A;  3JSR A;  2KVI A;  3IGV A;  2GGP A;  5IT0 A;  2ZNZ A;  1OSD A;  4RUC A;  2U1A A;  2CA9 A;  5HAO A;  4UOF A;  2BJE A;  1ZM2 A;  4F3O A;  4LF9 F;  4CLF A;  1DAX A;  3ETO A;  4QCL A;  1X0P A;  1U02 A;  1Q8K A;  2GGP B;  1RT3 A;  2VPW B;  5A8R B;  5GMK a;  1WOS A;  3H20 A;  2KJW A;  1U8S A;  4OI1 A;  3MM9 A;  5IV4 A;  3TI0 A;  3PCO B;  4PXC A;  5K8M A;  4WBF A;  4Y2I A;  2POK A;  8RUC A;  5A8W B;  1VQP S;  4F04 B;  3GJR B;  1UET A;  2ZVI A;  2AX0 A;  4PWW A;  1BXN A;  4UY8 5;  1RT3 B;  2IYG A;  4M5K A;  1OQ6 A;  4ZP9 A;  4MAK A;  3FBF A;  4O23 A;  5CYQ B;  4UQG A;  3MM9 B;  1N5Y A;  4RPF A;  3SCK E;  1FXD A;  2MQM A;  4K2X A;  2L41 A;  1NU4 A;  3CO9 A;  1X5O A;  3GIK A;  5KFH A;  4DLG A;  4M5M A;  4NLW A;  2ZH8 A;  4BS2 A;  5F8H A;  1UVI A;  1C0T A;  2VB6 A;  4B02 A;  3OLB A;  4KHP J;  1TKD A;  1N5Y B;  2I5J B;  4A8M P;  3G2X A;  2DIV A;  1F5A A;  3I87 A;  4LR7 A;  2M3D A;  4LRA A;  2W4P A;  3UFC X;  1C0T B;  3SCI E;  4ELT A;  1HBU A;  1KHW A;  4IOB A;  3D3C J;  2J5A A;  1RBL A;  2YKM A;  3ETM A;  4R25 A;  4WZM A;  1B70 B;  3CCL S;  5DDR C;  1FDA A;  1RT4 A;  1HBU B;  3N6M A;  3CJ3 A;  4ZVE A;  2YKM B;  3OUY A;  2PN6 A;  1XR5 A;  3HHE A;  3KMS A;  2FVR A;  2ZE2 A;  3I4H X;  3LH2 S;  2FHJ A;  4Q2L A;  1S0M A;  4DZ6 A;  3SFU A;  2FUG 9;  3GIR A;  2V67 A;  5GAH I;  3LP0 A;  1YIT S;  1RT4 B;  1TP7 A;  4EBC A;  2K7K A;  2V8G A;  1M1G A;  3UNG C;  1ICE B;  3BH7 B;  2C3Y A;  3OUY B;  1ZOT A;  2ZE2 B;  3BV8 A;  2O1P A;  5DQH A;  2BE7 D;  4GKJ J;  2ZIT A;  4OX6 A;  1YWX A;  1ZYQ A;  1FNM A;  3LP0 B;  3N5B A;  2IRU A;  1S9F A;  2W7A A;  4DZD A;  2KN4 A;  2KRB A;  4DQP A;  4NEY A;  3R3T A;  4PWU A;  4K4V A;  2HYI B;  1TL7 A;  1R6Y A;  2Y1L B;  2QLB B;  4QW9 A;  2GQC A;  2C2R A;  4K50 A;  2UUT A;  4IH5 A;  3AOD A;  3CC7 S;  3HFZ B;  1Q81 T;  4B9T A;  2R7S A;  3A3P B;  1TL7 B;  2JLE A;  2PEB A;  3NGR A;  3JSY A;  5FII A;  2GJF A;  3KK1 A;  2JSX A;  3R6L B;  2QYC A;  3SCJ E;  4DQS A;  1Q78 A;  1DQ9 A;  4UUX A;  1U0H A;  1VCT A;  4ECY A;  1WC5 A;  4KGM A;  1JLA A;  2ZWO A;  1CLF A;  4X4O A;  4NA2 A;  3KK1 B;  2DR6 A;  4J91 A;  3KLH A;  2VQE F;  1HYS B;  1NDL A;  1U0H B;  3MEE A;  5KG6 A;  2UUC F;  1JLA B;  3BB5 A;  2HS3 A;  1LWC A;  2KKH A;  3GLJ A;  4M5D A;  3QBC A;  3RAX A;  4QWB A;  3KLH B;  5RUB A;  2XMU A;  2M4M A;  1HHQ A;  5KFV A;  2ZH1 A;  3BRE A;  3MEE B;  3HK2 A;  4K4S A;  4DR4 F;  2ZH9 A;  3ICL A;  2RQ4 A;  1LWC B;  4M5D B;  2HGN A;  1X7V A;  2CZ9 A;  2DKO B;  3J81 U;  3SV3 A;  1CJU B;  1YJW S;  1K0V A;  4PPZ A;  2ZHB A;  3H59 A;  3DRR A;  4NPO A;  2WW4 A;  2A2C A;  4LBH A;  2KZZ A;  3OL9 A;  5L9N A;  1RWX B;  3NEK A;  4NLQ A;  3SZ2 A;  3K17 A;  2GMH A;  4JI0 J;  2V5H G;  1N6Q A;  2ACY A;  1SIZ A;  5G4D A;  2HQD A;  2MMY A;  5C25 B;  3DRR B;  1X4A A;  3T5H A;  3Q8Q B;  2YKQ A;  2XLJ A;  2AKW B;  3AXK A;  1SL2 A;  2R8J A;  2CPI A;  4V19 X;  2YH1 A;  2MZQ A;  1H7W A;  4J9M A;  4NXM F;  4O3P A;  3MZI A;  1N6Q B;  1TL3 A;  2VBX A;  3TX8 A;  1LNQ A;  5E3A A;  1IKX A;  3UN2 A;  1C4C A;  4ZIT A;  3A12 A;  3MD3 A;  1KWM A;  4HHH A;  1UP1 A;  1FTR A;  4FF2 A;  1S99 A;  2BAC A;  1BY9 A;  2VUG A;  4DBQ A;  2AP6 A;  4J9V A;  3GYG A;  3CXC R;  4O0I A;  4O3Q A;  3V6H A;  4ELV A;  1YSJ A;  3MOZ A;  4IG0 A;  1IKX B;  1AYE A;  2VIC A;  2CNN B;  2ALZ A;  1BQN A;  4DOZ A;  2LP4 A;  5T7L A;  1Y00 A;  3BBF A;  2HBQ B;  2CNL B;  4TVA B;  5A0Y A;  3A8J A;  3IFE A;  5KFI A;  2KTQ A;  2G9O A;  2VG5 A;  3GV5 B;  1SC6 A;  1TAQ A;  1EQM A;  1NHK L;  2W2P P;  3HPO A;  5HN0 A;  4IG0 B;  3W9I A;  1RHM B;  1HWL A;  3GP9 A;  5KG0 A;  2E44 A;  1BQN B;  3M9O B;  2KFN A;  5T7L B;  4FBT A;  2JC0 A;  1RQ0 A;  2RQK A;  2EPI A;  3CCM S;  2YX1 A;  2HHV A;  4V19 J;  1HQU B;  4P2S A;  2IA6 A;  4EO8 A;  1S9E A;  3A3O B;  2FGO A;  4CQ1 A;  2FVC A;  4QWD A;  2LDY A;  4X65 F;  3H2V E;  2XGQ A;  1MML A;  5H9E J;  4FYY B;  5HK4 A;  3EZ5 A;  2RQM A;  1KOH A;  2GIF A;  1S79 A;  3V6D A;  4IDK A;  4N8O A;  4F4A A;  3OTD A;  5DQG A;  4TLR A;  3QFW A;  1GAO A;  3U27 A;  1RKJ A;  4K4Z A;  1UJ6 A;  2XY7 A;  4B9V A;  4KIA A;  4I6Y A;  3V6D B;  3VAJ A;  3CCJ S;  4IDK B;  3EPI A;  4CIO A;  4PPD A;  4PQA A;  3FCV A;  1NDK A;  3A8E A;  4J9K A;  5BR8 J;  1T8E A;  1XNQ J;  5D4P A;  1X9W A;  4F3M A;  4E0D A;  2HRY A;  6FDR A;  3KXD A;  1H6K X;  4XK8 C;  3FSI A;  2RT3 A;  2J0S D;  5B08 A;  2ZH2 A;  1K8A T;  5HMX A;  4O3S A;  3CVK A;  4C8M A;  2VC0 A;  3MF5 A;  1PBA A;  1P1L A;  1VBZ A;  4Q43 A;  2N3O A;  2ZNY A;  3MPV A;  4QIW D;  2JNJ A;  3HFV A;  2Z57 B;  4HHJ A;  2ZFH A;  4OL8 A;  2C22 A;  1FA0 A;  4BC7 A;  2YQ1 A;  3OPK A;  1NCL A;  2PI4 A;  2LKZ A;  2O5D A;  2NLW A;  3AT1 B;  4NL5 A;  3ZXW A;  4DV1 J;  3JQK A;  3OBI A;  2C3O A;  4MIA A;  3MED A;  3G6E S;  2KT3 A;  2V4R A;  3OFF A;  1P27 B;  3BEG B;  1DBD A;  1RAE B;  2YH0 A;  1U1O A;  4UT4 A;  3O6Q A;  1S1W A;  4H4O A;  3GJT B;  4DR2 J;  3QMQ A;  3OLA A;  2HLT A;  1KQK A;  1X4E A;  5L46 A;  4GKK J;  4A8Q A;  4ED8 A;  3PRD A;  2D7S A;  2QLW A;  3NG8 A;  4DV4 F;  1SIW B;  1HLW A;  1R8B A;  3EUN A;  3N9U C;  4OHW A;  1HNZ J;  2L9W A;  2R8G A;  2DGU A;  3NMR A;  1S1W B;  4H4O B;  1D9F A;  3DHW C;  2HK3 A;  3GCW P;  4KBI A;  4HL9 A;  2AWZ A;  2DGX A;  2CQP A;  1N33 F;  4DS4 A;  5HAN A;  3M8R A;  4F0K A;  2I6W A;  3N6L A;  2ROP A;  4PZV A;  4B3S F;  1KKH A;  3R8Y A;  1U48 A;  3CDA A;  1EJ7 L;  3QT6 A;  2DY9 A;  2D1C A;  3M8Q B;  5GAH U;  2ZZT A;  3RTV A;  5H9F J;  2FJX A;  4JBC A;  3DMJ B;  1BQM A;  1S7H A;  2BAB A;  1U1L A;  4HT7 A;  1JXL A;  1FO1 A;  2BZ2 A;  4OYA A;  3SFG A;  3PRV A;  3IAS 9;  2HVI A;  5F8G A;  3AA8 A;  3MMJ A;  1JXE A;  3AA9 A;  2FHO B;  3J7Z T;  1BQM B;  4RNH A;  4LF7 F;  4I64 A;  3IM8 A;  4G3I A;  2AJ2 A;  4K8R A;  2X1F A;  4DR5 F;  1JX4 A;  4OX7 A;  3D9B A;  5EWF A;  2OD4 A;  3O44 A;  1VQM S;  4HVZ A;  4WYL A;  2ZUG A;  1M1H A;  2DNL A;  2JEG A;  2G0C A;  1FHT A;  1FDB A;  1M90 T;  3OTB A;  4DUY F;  2GQQ A;  3C46 A;  2HS4 A;  2F7V A;  1RTI A;  2XMM A;  2HFZ A;  1KTQ A;  3UPF A;  4ZVT B;  5L1I A;  4WIQ A;  3CSK A;  5MAO A;  1KFD A;  3ENQ A;  4DSL A;  2ROG A;  1SH0 A;  1RTI B;  3IG1 B;  3EE3 A;  2M88 A;  4J9L A;  4O3O A;  3JS9 A;  2DRA A;  1UVK A;  1FXL A;  1DLO A;  3QSI A;  2GNK A;  2LEA A;  4Q5V A;  1AUS L;  1NAQ A;  4JI3 J;  1FJG J;  4F0M A;  2R7Q A;  1IBK J;  3LW5 C;  2KFZ A;  2MZJ A;  1R43 A;  2QMU B;  3MDF A;  4YB1 P;  4M94 A;  1DHM A;  3TAN A;  2DIS A;  4I4B A;  4ZVH A;  4LQ3 A;  1DLO B;  4LSZ B;  2C42 A;  4LIW A;  3F44 A;  2UUB F;  3ZZ0 A;  3I6P A;  3M30 A;  5HQM A;  3ZTR A;  1SJF A;  4ICL A;  2QN6 B;  4LRB A;  1W2B R;  2HS0 A;  5EDW A;  4ERD A;  1BMQ B;  2XMJ A;  3M30 B;  1U6Z A;  3HHK A;  1C0U A;  4ICL B;  1VBX A;  4IOA Q;  3IN5 A;  2W7O A;  4JI5 J;  1XQI A;  4LBI A;  1HA1 A;  1ZH5 A;  3PW4 A;  2GMJ A;  5EWG A;  2CPZ A;  2HW3 A;  1NPK A;  2VG6 A;  1APS A;  3G96 A;  4OLO A;  1C0U B;  4BWM A;  4OZJ A;  4JV2 A;  2CPH A;  2QGF B;  3WC0 A;  2F63 A;  1REG X;  1S4E A;  2OML A;  4ID8 A;  2V69 A;  5F8I A;  2NZ4 A;  2E1R A;  1S4F A;  5CCM A;  5IQQ A;  3RRK A;  3W3S A;  3QGH A;  5LMN J;  3Q22 A;  2VG6 B;  3M8Y A;  4DR6 J;  3W8G A;  2CPF A;  1RZM A;  1FFS B;  2IMW P;  1YZ6 A;  1X4H A;  1SKU B;  1D9A A;  3ZC4 A;  5F3T A;  3BR8 A;  4USK A;  1YZ7 A;  2CPX A;  3OSP A;  2XEX A;  3HVR A;  3M2V B;  2VPZ B;  2YKO A;  2VFV A;  3ZTQ A;  1M5H A;  1RWP B;  3TVY A;  2BYC A;  4MK8 A;  2QE5 A;  3MR6 A;  3HCX A;  5F8L A;  3MAQ A;  2J9D E;  3CCU S;  4J9P A;  5F9L A;  4NLO A;  2L48 A;  4O3R A;  4OJH A;  4H4K C;  1S12 A;  4URG A;  1LWE A;  1H2T Z;  4FF3 A;  4E98 A;  7FD1 A;  4DPO A;  4DL6 A;  4RW7 A;  4F4Y A;  3OR1 A;  2UVU A;  4J9S A;  3I31 A;  2DO0 A;  3ZZP A;  1LWE B;  4EUV A;  2ZBC A;  2W2O P;  4NXN F;  3DYA A;  2Q1L A;  4AT1 B;  4DX5 A;  3ZZT A;  4Q0B A;  2QL7 B;  4RL1 A;  1NJY A;  2LQB A;  4ED4 A;  3CJK A;  2ILY A;  3OL8 A;  4DV2 J;  4WU3 A;  4RW7 B;  1KD1 T;  4NLD A;  3OR1 B;  2R2R A;  5M2P A;  3PY8 A;  1NND A;  4DFK A;  1Z4U A;  4ER8 A;  1F2H A;  1B99 A;  3TJA A;  3K5P A;  3MEC B;  1GXL A;  1S7I A;  4JP8 A;  3THT A;  4J9N A;  3DYA B;  4ZPD A;  2GHP A;  1E6Y B;  2FJV A;  2CQI A;  1YIJ S;  3RB4 A;  4KFB A;  4NLR A;  3CJK B;  3R5G A;  1U25 A;  3T9Z A;  4WK1 A;  3TUJ C;  3WX4 A;  3BYR A;  2IVF B;  4FYD A;  1WC3 A;  4L72 B;  3R5C A;  4PQU A;  2BA9 A;  2A1B A;  4HH0 A;  2B4V A;  4KFB B;  5HMZ A;  1KDN A;  1HI8 A;  3QT7 A;  2MZ1 A;  3IBF B;  5L1J A;  1I94 J;  4DX7 A;  3W7B A;  1O51 A;  4JI4 F;  5K8N A;  1U7L A;  3FZ2 A;  4IQM A;  1WOO A;  3F0N A;  3DN9 A;  3RRG A;  4MYU A;  3R5J B;  2HUR A;  1FKO A;  2WVB A;  2GHW A;  4ZCM A;  2MPU A;  1R8H A;  1YHQ S;  1R6V A;  3ILL A;  3EM1 A;  5HAT A;  2R8K A;  2DGW A;  1GMW D;  4P7V A;  2Y8Y A;  1RT1 A;  1UA0 A;  4USW A;  1U4B A;  3GJS B;  1K73 T;  1FKO B;  2R3V A;  4EBD A;  2KVQ E;  2EWH A;  1RXO B;  2GHV C;  2XO6 A;  4NA1 A;  1XJW B;  2IM2 A;  2ASJ A;  3T6B A;  4N76 A;  2MYF A;  2IAJ A;  3TAQ A;  4LF2 A;  1RT1 B;  4K2J A;  4DV7 F;  3LP1 A;  3S1T A;  3FBC A;  1SV5 A;  4WXO A;  4LSL A;  1HNI A;  3QGG A;  1AZS A;  5DDP C;  4UY8 T;  4X64 F;  2J7K A;  3G6Y A;  5IT4 A;  3NLC A;  3Q8P B;  2BJ8 A;  2IAJ B;  4N7T A;  2PMZ D;  3LP1 B;  3NOC A;  1SV5 B;  3CNQ P;  3E8O A;  4LSL B;  1HNI B;  4MKB A;  3H5S A;  1QVG R;  1AZS B;  3VCD A;  1TTH B;  2UXD J;  3IC1 A;  3G4S S;  2GS8 A;  4J7C A;  3GV8 B;  1X8D A;  3R5B A;  3CPW R;  3UD3 P;  2PEH A;  4IUF A;  1NRK A;  2ZBQ A;  4Q45 A;  3NCP A;  5HJY A;  4CO0 A;  2JRS A;  4F7V A;  2YNH A;  2ASL A;  2XS2 A;  4P7T A;  2LXF A;  2XLI A;  5CYJ A;  1WSV A;  3OTO J;  2U2F A;  3GPA A;  4NE9 C;  2QRR A;  1VS3 A;  1YGY A;  3T1H J;  2XC9 A;  3PYG A;  4WPA A;  2YNH B;  2VJV A;  5ETL A;  1SH3 A;  3BBB A;  2XSJ A;  5D4N A;  1N54 B;  1AXQ A;  2RIL A;  4FZV A;  4B3R F;  5E3Q A;  4ANC A;  4ES3 A;  4LF5 F;  3JQJ A;  3H90 A;  4Q2M A;  1ROF A;  3GV7 B;  1EKR A;  2A2D A;  3IBW A;  2R2T A;  3SEO A;  1UJ4 A;  3S8S A;  4JV5 F;  4IR9 A;  1VJQ A;  3LP2 A;  3BN4 A;  1T95 A;  3OT9 A;  1VQK S;  2YY3 A;  1B64 A;  1J5E J;  4FYV B;  4B08 A;  2W2N P;  4WP9 A;  2ASD A;  1T9V A;  1U2C A;  3I55 S;  1UZH A;  2IM1 A;  4DV5 F;  4NML A;  2YNI A;  2JL9 A;  2RD5 C;  3LP2 B;  3LOU A;  1M5O C;  2NPF A;  2AEF A;  1OPZ A;  2DGO A;  3HT3 A;  4UTG A;  4XTT A;  4ZMM A;  4B3O A;  2Q6C A;  5K5M A;  4TNO A;  5DDQ C;  4DFP A;  1VI7 A;  3NWR A;  4Y0F A;  2DPI A;  1KC8 T;  4J90 A;  1J2V A;  1XMO F;  1RWU A;  4WXW A;  4LFA J;  4F67 A;  2DNP A;  3OXL A;  4B3O B;  4URQ U;  1TK0 A;  2PFF B;  4QIE A;  1N34 J;  5AE2 A;  2WW8 A;  1Q4R A;  3UN5 A;  1LOU A;  3R2C J;  1QTN B;  2AQ4 A;  2FVS A;  2B56 A;  1T7P A;  2JLF A;  1URR A;  1ZBT A;  1G2E A;  5KG2 A;  1R8P A;  4JI6 F;  4MTP A;  2RE1 A;  1R8C A;  3CUN A;  1VIO A;  2DGS A;  2QLJ B;  4EEY A;  2RML A;  5KFJ A;  1T05 A;  1BHN A;  2A6M A;  1YJR A;  2RVJ A;  4ZDN A;  4E8U A;  5LT5 A;  4IO9 Q;  2P9G A;  5AXK A;  3CJ5 A;  4Z2X A;  3MR5 A;  2BOP A;  1T05 B;  3BGR A;  4ZPA A;  3QO9 A;  2RRB A;  4IRK A;  4LF6 F;  5IQ6 A;  4M63 A;  5EX0 A;  2E29 A;  3SDE B;  2UXB F;  4LFC J;  4LRD A;  1IN0 A;  4ENO A;  2HBZ B;  3BGR B;  1YJU A;  2CZV C;  3QO9 B;  3MUR P;  3HZE A;  3W65 A;  2KG0 A;  3VVT A;  1ZTT A;  3ZTO A;  2CQ3 A;  5J2M A;  4ZA1 A;  1PC5 A;  3G8T A;  2LU2 A;  2FY8 A;  4DQI A;  4GRS A;  4NLT A;  5D15 A;  4HTJ A;  1SJ1 A;  1SL1 A;  1U49 A;  3RBE A;  2HAI A;  4JI1 J;  4PKD B;  5IM0 B;  2MJU A;  2ADC A;  2A10 A;  2ZHO A;  1UJ5 A;  5J2M B;  4Y65 A;  3CB4 A;  4LFB J;  1MWZ A;  2CYY A;  3NGT A;  1RA6 A;  2DHS A;  2IJF A;  1WHW A;  4WTO B;  1S10 A;  5HLF B;  1S6P A;  4DR3 J;  4AE5 A;  4FNI A;  1BE4 A;  4HH1 A;  2ABY A;  5LSR A;  2MY8 A;  2UXC F;  1BUX A;  1UEV A;  2ACM A;  1RB0 A;  3OJS A;  2RRA A;  1QD1 A;  1S1X A;  3NNA A;  1JJH A;  3QZ7 A;  1VLO A;  2B43 A;  4RU9 A;  2WBR A;  3RAQ A;  1S6P B;  4OZ5 A;  3J81 j;  2E7V A;  2QYG A;  4UZB A;  5K8P A;  4KV8 B;  1RTH A;  5KT2 A;  1IBL F;  3IWL A;  2NQP A;  1S1X B;  4YS2 A;  2XWX A;  3K57 A;  2V2V A;  2P9C A;  5D4O A;  2OPR A;  1K47 A;  1X60 A;  2CQ0 A;  1FRI A;  3ITH A;  5B0D A;  2HBR B;  1RTH B;  1FJE B;  1NZA A;  2DD8 S;  5C2G A;  3G8S A;  1WUU A;  1FVS A;  3LAN A;  1CS4 A;  5KT4 A;  1NK8 A;  1HBN A;  4CH0 S;  2ZUA A;  3WIU A;  2OPR B;  2C2D A;  2YWF A;  2DO4 A;  3V4I A;  3M9N B;  1R27 B;  4DUZ F;  3ITH B;  2VJU A;  1N5T A;  4UOC A;  4OQJ A;  4OYZ A;  2X3G A;  2C3U A;  3K5N A;  1HBN B;  5KFU A;  3A8I A;  1GT8 A;  2XYG B;  3V4I B;  2HFO A;  3BGU A;  4ZP6 A;  4IG3 B;  1MW7 A;  4ATN A;  2B7C B;  4UW2 A;  5E3R A;  4DV6 J;  2VD3 A;  3OFE A;  3D68 A;  3KUE A;  2UP1 A;  3G86 A;  2BUN A;  3HZG A;  4KYZ A;  5F9N A;  1BWV A;  2MKI A;  2GJ2 A;  1U47 A;  3CED A;  1WI8 A;  1XC9 A;  2XBP A;  2VOD A;  4C8Z A;  4HYK A;  4DSE A;  4ECU A;  4IRD A;  2ZOF A;  1WG4 A;  4MKA A;  5BJR A;  3IM9 A;  4DN0 A;  3PDN A;  1X5T A;  4OYI A;  3K7R A;  5B0B A;  3ILI A;  4USV A;  2CJX B;  4I56 A;  2XI2 A;  3BQ1 A;  5F8N A;  2OMO A;  3R6G B;  1PYO B;  5KT6 A;  4J9R A;  3P96 A;  4P6Q A;  1UZD A;  3ILO A;  4DR7 F;  1B4S A;  2E5G A;  2OPS A;  2DNH A;  5A8K A;  2QJ3 A;  4MKY A;  5JVG Q;  4MYT A;  4TQS A;  3VGU A;  2XMA A;  3PXG a;  3UI3 A;  1V3S A;  4OHX A;  3CJ4 A;  5AT1 B;  3MOJ B;  1TZ0 A;  3FEZ A;  1PJ5 A;  2HEK A;  1OYE A;  2OPS B;  5LMU J;  5ETV A;  2NXE A;  3PM9 A;  2V8H A;  3PO5 A;  3OFH A;  3H4B A;  3PKM A;  1RAC B;  1VQ7 S;  2QV6 A;  1TKZ B;  4NI2 A;  2XMV A;  2DEJ A;  3NBP A;  1HNX J;  1ZAX A;  3GSD A;  1RAB B;  4RW6 A;  1SI9 A;  3RW6 A;  1YRU A;  3UNY A;  3HKZ D;  3PTW A;  4NI2 B;  2YXL A;  4Y2M A;  1SKW A;  3NBP B;  3N4W A;  1WC6 A;  2YBV A;  3CDW A;  3UDV A;  3VAG A;  1AB8 A;  2HSE B;  4Z37 A;  3GII A;  4RW6 B;  2BM1 A;  4QBU A;  3BKT A;  1GQE A;  3C15 A;  5KFX A;  2QT7 A;  3D7S B;  1IWG A;  1RT5 A;  4DF8 A;  4YEA A;  5ETO A;  2YNF A;  3MPU B;  3AHP A;  4RLE A;  1GX6 A;  2Q3P A;  4NRU A;  3I32 A;  3C15 B;  3UVJ A;  2DIT A;  1FF2 A;  4DFM A;  3EGZ A;  3FRY A;  1RT5 B;  2B9Y A;  3VAM A;  2DJW A;  1HW9 A;  3MUT P;  2YNF B;  4URS A;  3HP6 A;  2WTF A;  1FJ7 A;  5DQI A;  1LKZ A;  2OAU A;  2HAF A;  2E1A A;  2Y1J A;  3WIV A;  5C24 A;  1QAI A;  1RWO B;  1WHX A;  2V2Z A;  2UUA J;  3C8Y A;  1DJ0 A;  3L95 X;  1QM9 A;  3UO0 A;  4DCJ B;  3QAU A;  1VQN S;  4RNM A;  3W9J A;  1P9Q C;  3DXB A;  3SQG A;  2BKP A;  3GR1 A;  4KAI A;  5C24 B;  3MMC A;  5IT9 Y;  4A8S A;  3FVY A;  4ZCK A;  3AFG A;  1S49 A;  5HL7 Q;  3KLE A;  3R5D A;  4PAA A;  4N5S A;  4LF4 J;  4A8O A;  4B9L A;  3RAM A;  1H98 A;  5IXU A;  3MMC B;  3DDK A;  4JI0 F;  3DLE B;  4DHV A;  3VGS A;  3IWX A;  4MIW A;  2CJY B;  2HQG A;  1VBK A;  3MMA A;  4G1Q A;  3ZTP A;  3KLE B;  1AFJ A;  3D6F B;  1F9F A;  1HI0 P;  2AYM A;  2KB2 A;  2XYP B;  5KFA A;  2BW7 A;  3N0V A;  2H65 B;  5I4M A;  2BR0 A;  2F4V F;  2IJR A;  2BKO A;  2BJ1 A;  3FEY B;  3D28 A;  2H51 B;  2NYH A;  4WFB Q;  3MMA B;  4DSJ A;  2MQN A;  4G1Q B;  3W2V A;  4TQR A;  2XQC A;  3QT5 A;  5JVH Q;  5H1S V;  4FXW A;  3M7V A;  2BQ3 A;  2HRU A;  3DU5 A;  2MST A;  1NM2 A;  4DDF A;  3QAE A;  2GO9 A;  3OR2 A;  3W2V B;  3OVB A;  4DSI A;  1JNR B;  2UU9 J;  3TZY A;  2J6T A;  3CME S;  3JYT A;  4CNZ A;  4NX9 A;  3D67 A;  3SSR A;  4C8L A;  3AB4 B;  5CXT A;  4ZCL A;  2F8H A;  1XR6 A;  3KG4 A;  3HI9 A;  2Z56 B;  3ZZO A;  1SJ3 P;  1TR0 A;  2AT1 B;  3CUL A;  1WEZ A;  1QE1 A;  3AJD A;  2EFN A;  2NUH A;  3I0R A;  3JYT B;  1S1U A;  2E1M C;  2BRK A;  2YWH A;  4LSN A;  2WK4 A;  1NJZ A;  1KVI A;  4YHH J;  1DTQ A;  1V5V A;  2GV1 A;  1QE1 B;  3QLH A;  3I0R B;  4GC6 A;  4I68 A;  3PJW A;  4P10 A;  3KK2 A;  1S1U B;  4LF9 J;  2IC3 A;  1RWK B;  1S1T B;  2ZBI A;  1YG0 A;  1FFG B;  4CCH A;  4LVN P;  3W5Y A;  5CA5 A;  1DTQ B;  1Y10 A;  2J9C A;  4EWT A;  4DL4 A;  1KQG B;  3QLH B;  4X4S A;  3Q23 A;  3NWG A;  4LF1 A;  3KK2 B;  1FE0 A;  1I3O B;  4OYW A;  3QJP A;  3D1H A;  4I2P A;  3T9N A;  2IC3 B;  1FX4 A;  1VLY A;  2M0G B;  3G87 A;  4Y2A A;  1YRX A;  4J9O A;  3ZNU A;  3KJN B;  4PUO A;  4ED6 A;  4I2P B;  1QVF R;  2OTJ S;  3M9M B;  1XNQ F;  4DV0 F;  3SXL A;  4I1T A;  2R2S A;  3EJM A;  4IH6 A;  4U7U D;  3KLF A;  4PUO B;  3CJ2 A;  3M32 A;  2CQH A;  2G1D A;  3IR5 B;  3JTO A;  3VQT A;  1TVR A;  3NGK A;  4HAC A;  1RYS A;  3TP2 A;  1FNX H;  5E2Q A;  4DX6 A;  4RNN A;  1HW8 A;  2LDI A;  3D3B J;  2ZBP A;  3DLK A;  4ECZ A;  3MM8 A;  2WVE A;  5B0E A;  3KLF B;  3M32 B;  3IA0 A;  3BZQ A;  3RB0 A;  4DV1 F;  2XZT B;  3VAK A;  3EZU A;  4HAC B;  5HP1 A;  2MKK A;  2R7V A;  1OJ4 A;  1CBK A;  2QA2 A;  3FZB A;  1BC6 A;  1N8R T;  3MM8 B;  1H73 A;  2W9C A;  1X9S A;  4NCG B;  2V63 A;  2KH9 A;  4MT1 A;  1VRQ C;  2K3I A;  5HP1 B;  1F9H A;  2RKI A;  4DR2 F;  4ZOS A;  4DX8 H;  3G9C A;  2R42 A;  2B8P A;  4QYZ J;  1U1Q A;  2PA8 D;  4CH1 A;  4RZR A;  4CO1 A;  3UW1 A;  2FLN A;  4K59 A;  5C7P A;  5M2R A;  2RKI B;  1OS5 A;  2Y0S D;  2J6S A;  4CLS A;  3GQC A;  4WP3 A;  5LOQ A;  1ULR A;  2ZHA A;  2BDP A;  2R7O A;  3G8Q A;  1WHY A;  3LPY A;  2VKZ G;  2G2O A;  1Y3J A;  2OPP A;  2DR9 A;  1IVZ A;  3DOM A;  1UWA A;  1VGY A;  4A4J A;  4ZLP A;  4M1K A;  1BGX T;  3OXG A;  1N0V C;  2H3E B;  2OPP B;  3R1H A;  3G6V A;  4JI7 J;  4KRW A;  3RW7 A;  2HIQ A;  2EK1 A;  1U1N A;  3DOM B;  3TA0 A;  3PW2 A;  3K0J A;  1RDR A;  1U6F A;  1SQG A;  4DL5 A;  3FFI A;  1HIY A;  4M95 A;  2KRR A;  1T9Y A;  1WKL A;  2YKN A;  1YK9 A;  4DV3 J;  1Q8B A;  4U6P A;  2M8H A;  3UCU P;  3O8W A;  2DNG A;  2GX8 A;  3MI7 X;  2CFX A;  1T3O A;  2J6U A;  4I0W A;  2NRE A;  3G82 A;  5GAD I;  2VBY A;  3M2U A;  3FFI B;  3PR5 B;  1X5P A;  4XPC A;  4D3G A;  2YKN B;  4NLU A;  2IM3 A;  2UUC J;  1KFS A;  3AY0 A;  3QNW B;  1KQS R;  3H98 A;  3HDS A;  1DY3 A;  4L76 A;  1GXT A;  1RUS A;  2VZ9 A;  5KFR A;  2XMT A;  4ZHR A;  1NO8 A;  2HHP A;  3G82 B;  4ZLL A;  3U02 A;  4DFJ A;  3IR7 B;  2C2K B;  1SCJ B;  4H4K A;  4QOT A;  4LF8 J;  4DR4 J;  2PD1 A;  3TR5 A;  1UPP A;  3IMQ J;  1FJG F;  2XI3 A;  4AXI A;  1MSW D;  4U96 A;  2CPY A;  3M1V A;  3HJV A;  3HFK A;  1Z1Z A;  4ZHR B;  3VAH A;  3Q8Y A;  2OEL A;  1PGZ A;  3KHR A;  3S6E A;  5HVF A;  4DJB A;  1UCN A;  2RHQ B;  3DLJ A;  3A1Y G;  4R8U A;  4B9N A;  3CCT A;  4UF4 A;  2AW0 A;  1NSQ A;  2QMW A;  2OSQ A;  2YWW A;  3M1V B;  4YQW A;  2YPY A;  3C19 A;  2B9E A;  2O66 A;  1SJQ A;  4RW8 A;  5E0O A;  3M8P A;  2AGP A;  2CQD A;  1JXV A;  1F3F A;  3D66 A;  3MXH P;  3C2P A;  4R8U B;  2UUW A;  3CJS A;  4XIU A;  1IWA A;  5KFQ A;  3PNI A;  3ADA C;  3DM2 A;  3K8W A;  2HLU A;  1IKW A;  3TZW A;  4RW8 B;  3M8P B;  2OEJ A;  3QQC D;  5KFK A;  1S5Z A;  4JI5 F;  2RS8 A;  2KXN B;  4DEZ A;  2C2N A;  2W24 A;  1IBM F;  4DL0 C;  4WKR A;  1T9W A;  2CJA A;  1YJV A;  3TVK A;  3DM2 B;  2WBM A;  1JLF A;  4ZVF A;  2IA0 A;  3IWN C;  4AL7 A;  1X9M A;  1IKW B;  4LQ9 A;  2ZH6 A;  4NEZ A;  1RU1 A;  4EZ9 A;  1XR7 A;  4NZ6 A;  5LMN F;  2BJ7 A;  2IYI A;  4DR6 F;  1DQ8 A;  3KKF A;  1JLF B;  4C11 A;  1Q7L B;  2MKY A;  1UW4 A;  3WZ0 A;  1HI1 A;  2QC3 A;  5KG5 A;  5L1L A;  1VIX A;  3W1Y C;  2VA2 A;  4OJ3 A;  1ZA2 B;  1U1K A;  4RUB A;  4TU8 A;  2EC0 A;  3US5 A;  2RSQ A;  2K3K A;  1JNZ B;  4C11 B;  2QEX S;  4ILR A;  2JFK A;  3RBD A;  3N5F A;  2Y1R I;  3AQP A;  2JDJ A;  5KG3 A;  2ZJR Q;  2NXC A;  3CO0 P;  1QDU B;  2RUS A;  2YWE A;  1KVK A;  2AYG A;  3QFH A;  1JMT A;  3ET6 A;  1QTM A;  4MK9 A;  1PCA A;  1FJC A;  4ITS A;  2CG4 A;  3OHA A;  3DDI A;  4O4R A;  4X65 J;  1HPZ B;  1OY9 A;  1ZAV A;  2JJ4 D;  3RBX A;  2HMI B;  2WOM B;  2OFH X;  1V3R A;  1RKI A;  2GIR A;  5FLX U;  4ED7 A;  3ET6 B;  1IKV A;  2AEM A;  4CI0 B;  2D41 A;  4K5R A;  2IVY A;  4YDD B;  4OI2 A;  4DV2 F;  1VQ4 S;  4YOE A;  5AXN A;  5A8R A;  4P73 A;  2WON A;  4W92 B;  1WD6 A;  3RU0 A;  4V1A k;  3J7A N;  2BE9 B;  2BQU A;  1IR0 A;  4HDG A;  1H74 A;  3L7U A;  3T1Y J;  2NXU A;  1UAW A;  4ZKA A;  5A8W A;  1IKV B;  4K0K J;  3TRG A;  4JI2 J;  3MEG A;  2AD9 A;  1KLN A;  4GO7 X;  3IGN A;  4E2F B;  2X1G A;  2C1E B;  2WON B;  3FUY A;  1WG5 A;  3TZX A;  5CYQ A;  1R8A A;  4K4Y A;  2B7B B;  1Q8I A;  2HK2 A;  2I38 A;  1RAF B;  5C2C A;  4HDH A;  2I9S A;  3MEG B;  4ZP8 A;  4CP5 A;  4Z7Y A;  2RUG A;  1VQY A;  3BSC A;  2YNG B;  2XY5 A;  3UN3 A;  3QZ8 A;  2XLK A;  5J1P A;  2IPO B;  3CJ0 A;  2I5J A;  4U67 Q;  5GVQ A;  1PYT A;  3DHX A;  1I94 F;  3CF5 Q;  1TKX A;  3MD1 A;  2D9P A;  1SUQ A;  3MPY A;  5D6G A;  1ELO A;  1KOO A;  3FCH A;  4FS2 A;  4OZ2 A;  4C2M A;  3I9V 9;  2VHG A;  3QIP A;  2CJB A;  3B82 A;  2N7Y A;  5SZT A;  1TKX B;  2DNR A;  1HFE L;  2JVR A;  3PEJ A;  1SUQ B;  3OFG A;  1T02 A;  3UE2 A;  2KYX A;  3DLH A;  2Z0G A;  2VF3 A;  3LWM A;  2HFN A;  3DCA A;  3NS7 B;  1TU0 B;  3QIP B;  1I1G A;  1YLX A;  2AJ0 A;  4XDC A;  4USU A;  4HI1 A;  3BS9 A;  3GSI A;  4C8N A;  1DZ5 A;  1MWY A;  2LU1 A;  2JEF A;  3Q8S B;  1S6U A;  1Q53 A;  2W8K A;  1XMQ J;  3X1L B;  4RX6 A;  2V4J B;  3D4J A;  1QLN A;  2E7X A;  2F3J A;  3IR6 B;  3G6X A;  3KDO A;  2GML A;  5IZH A;  2HHU A;  3MEK A;  3DRS B;  1Q86 T;  3QT8 A;  2FZC B;  1QSS A;  3SIP B;  3BR9 A;  2F65 A;  3GZ7 A;  2FLO A;  4EU0 A;  2E5L J;  1Y0H A;  2VG7 A;  3IS9 A;  3B54 A;  4LVO P;  4IFV A;  4U7U K;  2FQQ B;  3G71 S;  5D4L A;  5B0G A;  1S0O A;  2XWY A;  2VIH A;  1B0V A;  2B5J B;  3SMZ A;  3MCS A;  2CJ9 A;  1R31 A;  4FYW B;  1IKY A;  3ZZY A;  3K59 A;  2J7U A;  2VG7 B;  3IS9 B;  4YUD A;  4DR5 J;  3WC2 A;  1VRT B;  4IFV B;  3OTO F;  2ZBR A;  2GJI A;  4KGK A;  4RJV A;  3C6U A;  3W5X A;  2MGZ A;  4ES1 A;  1JK9 B;  2FJE B;  4KE5 A;  1CPZ A;  3T1H F;  1BD6 A;  4AYB D;  1IKY B;  4USM A;  2L9D A;  1DTT B;  4CLW A;  3J7A 1;  5ETM A;  2XYH B;  1KBR A;  5KT5 A;  3C6U B;  1H0H B;  2MGZ B;  3BQ2 A;  3FSX A;  3KHH A;  4ZN1 A;  4CM0 A;  3D6T B;  2V2K A;  2UV8 A;  1KQF B;  4M8L A;  1HYS A;  3TQE A;  1YBU A;  3LUY A;  1NHU A;  2KO1 A;  1NB7 A;  4ZPT R;  1HD1 A;  5GAD U;  1Y3K A;  5J2P A;  1X4G A;  5CZX A;  3NS6 A;  3AQO A;  3BO2 A;  4M5G A;  4CLY A;  1LXN A;  1RAD B;  5J2P B;  4LRF A;  3KMQ A;  2UUB J;  3KUH A;  2B8Q A;  4F3Q A;  1CJU A;  1G4C A;  2HBY B;  2NXJ A;  1RAI B;  5L39 A;  2DY1 A;  3M6W A;  3KUG A;  1JLC B;  2VDH A;  2ZM6 F;  3C66 A;  1FFW B;  2HHS A;  4CO4 A;  2DNN A;  3DGV A;  1VR6 A;  3BSN A;  2X7I A;  4USI A;  5C25 A;  3V5R A;  2VV5 A;  1G3O A;  2FYX A;  1A0O B;  4GVB B;  2DNK A;  2H48 B;  3J80 Y;  2Y0B B;  3MAH A;  2HPU A;  1RAH B;  4X4R A;  3T41 A;  1F6T A;  3U7J A;  2X1A A;  4WZQ A;  2EKY A;  3EMT A;  2CWK A;  1T03 A;  1CEZ A;  4WTY A;  2DGT A;  2R8I A;  3B4D A;  2HHH F;  1N48 A;  1N5V A;  2J8A A;  2GA7 A;  3HSJ A;  4NLS A;  1QJH A;  1J27 A;  4X66 J;  4DPY A;  1FDN A;  5EN1 A;  3PX4 A;  2CNK B;  2CAJ A;  1T03 B;  2N4C A;  1D1U A;  3SSQ A;  4RW9 A;  2PT0 A;  1FER A;  2MB0 B;  3CT9 A;  3NGS A;  3D6H B;  4FF4 A;  2A0F B;  1VOM A;  1XTZ A;  1WKJ A;  1CG2 A;  4P74 A;  3KYL A;  4HKQ A;  3HM9 A;  2HFS A;  2E9T A;  1HHT P;  4LFC F;  1CJT B;  2DNO A;  1WKK A;  1YTY A;  1ZPW X;  2QL5 B;  2EG2 A;  4ED3 A;  4IQX A;  4RW9 B;  2W9B A;  2VKR A;  5DJB A;  4EZ6 A;  2LYV A;  5DO2 A;  4N47 A;  3KJF B;  4ECT A;  1SJR A;  5DLF A;  1GMW A;  5LJ3 Y;  3TAP A;  4P52 A;  1OY8 A;  3NGD A;  2ADB A;  5LXR A;  2W9B B;  4H4M B;  4WII A;  3AD9 C;  4USJ C;  5KFW A;  1Z2Z A;  2AJQ A;  4ECW A;  4ZVQ B;  1HQU A;  4X62 F;  1KP6 A;  1XK8 A;  4FVM A;  4JI1 F;  1LW2 A;  1V5I B;  3HLU A;  4Y34 A;  4NXN J;  1H3D A;  2OUG A;  1NK6 A;  2FC9 A;  3L7O A;  2F8E X;  2JOQ A;  4LFB F;  4DPW A;  2XM3 A;  2NXN A;  3PX6 A;  1RAJ A;  4K4U A;  1TL1 A;  4DR3 F;  1LW2 B;  2G2Z A;  3GG0 A;  3U1M A;  3JSB A;  1WSR A;  2FY1 A;  1HWU A;  3FC9 A;  2XG8 A;  3H7H B;  1NPP A;  2VQF F;  3JAM U;  1QUV A;  3SV4 A;  3AAW B;  4B3T F;  1Y5N B;  2VC1 A;  3AOC A;  1HNW F;  2MJN A;  3P5B P;  4B9U A;  1RCX B;  5U47 A;  3SI8 A;  1TL1 B;  2WRM A;  5CH7 B;  5IOL A;  1C4A A;  2MQO A;  2BX6 A;  5A6P A;  1HR0 J;  3OQ2 A;  3VR1 A;  3M05 A;  3PHT A;  5HJX A;  2D3O 1;  4C98 A;  2EK6 A;  4Y28 C;  3HUL A;  4QPX A;  4N41 A;  5J1E A;  5MLC V;  4OZL A;  2LXU A;  4F02 A;  4JI4 J;  4DXL A;  2EW9 A;  2MZR A;  2MHN A;  3K5O A;  1P8G A;  3E2E A;  3M8W A;  1SQE A;  1JWW A;  2QG9 B;  5J1E B;  4NLG A;  3VHQ A;  5E3P A;  2XB2 D;  1PAE X;  3I5C A;  4ELU A;  4TY9 A;  2OSR A;  2KYZ A;  3RYL A;  4TU7 A;  1VQ9 S;  3U1L A;  1PAU B;  4FXV A;  4RR5 A;  5EHH A;  1FCA A;  2L9N A;  2RQC A;  4WFN Q;  1X4C A;  3Q24 A;  2DCL A;  3M6V A;  4TYB A;  3PVX A;  1KR4 A;  1JB0 C;  1EZZ B;  2V68 A;  2LVW A;  5A2Q Y;  4DL3 A;  3ZZU A;  3PYF A;  5J2N A;  1S6Q A;  3Q2S C;  2KL8 A;  4RW4 A;  2DBB A;  4Q7A A;  3OL6 A;  2Z2M A;  1UTA A;  3P45 B;  3SBM A;  3VAL A;  2LCW A;  2FLL A;  2ZDO A;  3RRH A;  2MTL A;  1A7G E;  4QU6 A;  5J2N B;  4K5S A;  1FKP A;  1S6Q B;  4XO0 A;  2H54 B;  2WVD A;  4RW4 B;  1NK4 A;  2ZC4 A;  3QWP A;  2KU7 A;  1NH7 A;  3M8Q A;  3B6B A;  2V6A A;  1ZAW A;  3KLV A;  3DMJ A;  1X4B A;  3AB2 B;  2BW2 A;  4IRC A;  2C3M A;  3PX0 A;  3GON A;  1SH2 A;  2IDL A;  3WDO A;  5KFZ A;  4RKU C;  1HHS A;  2ZC3 A;  1JKH A;  1FKP B;  1F1B B;  1NXI A;  1XMB A;  4ES2 A;  5CAA A;  2JWN A;  1W2I A;  2BRL A;  4Y2C A;  4X84 A;  4FBU A;  2OP5 A;  1PSD A;  1FWL A;  3MR2 A;  2CQB A;  4B3M J;  1JKH B;  1U0S A;  1RIS A;  4C7Q A;  1PIL A;  4YME A;  4KTQ A;  2OTL S;  3TWZ A;  3F41 A;  3UR3 C;  2M5Y A;  3ZZZ A;  3TJ9 A;  2DNZ A;  1HNX F;  2IMO A;  5EWE A;  3ENW A;  1WHV A;  1HBM A;  3DKD A;  3NL0 A;  1XEZ A;  3R97 A;  4WP8 A;  1SKR A;  1RWV B;  1NK5 A;  2M52 A;  5LJ5 Y;  5KAK A;  1U6B A;  3AD8 C;  2M2B A;  4LJM A;  1IBC B;  2DK2 A;  3IG1 A;  3H0P A;  1HBM B;  5ITH A;  3X3U A;  2E9Z A;  2QX0 A;  3IO1 A;  1K1Q A;  3ONQ A;  1SB6 A;  4FN5 A;  1R0C B;  1T9T A;  4WYW A;  2FJW A;  1HWI A;  5K20 B;  4MH8 A;  1EET A;  4CYU B;  4OHV A;  2R7U A;  3PG9 A;  2R8H A;  1NBE B;  1IQZ A;  2COL A;  3HJF A;  3AXM A;  1UA1 A;  2IRY A;  1F5C A;  2V8P A;  4Q44 A;  1N5S A;  3EXY A;  3BDE A;  1EET B;  5D8H B;  3FDS A;  3W60 A;  3V6J A;  3HT0 A;  1RE1 B;  4LRE A;  2IHR 1;  2UUA F;  5B0F A;  1RAA B;  3QWU A;  4OZ0 A;  1TUW A;  5J2Q A;  1VDH A;  4TYA A;  1UWB A;  3KK3 A;  1TKT A;  1NK7 A;  4IOC Q;  2CJQ A; 
#chains in the Genus database with same CATH homology
 2DYA A;  3FBF A;  3NGT A;  3EM1 A;  2AZ3 A;  3BBF A;  3FKB A;  1U8W A;  3B6B A;  1B4S A;  3Q8Y A;  2DXF A;  1B99 A;  1VYA A;  3ELH A;  3EVO A;  3EVW A;  1S59 A;  5BXI A;  3BBC A;  4DZ6 A;  3ZTR A;  1UCN A;  3FCV A;  3FCW A;  4AND A;  3Q89 A;  1LWX A;  2VU5 A;  1BE4 A;  1NDK A;  1NHK L;  3GPA A;  3L7U A;  1HLW A;  4W98 A;  1HIY A;  4DI6 A;  2NCK L;  1BUX A;  1NDP A;  3BH7 B;  3VGS A;  3VGU A;  1WKL A;  3ZTQ A;  4EK2 A;  1PAE X;  4C6A A;  3GP9 A;  2DXD A;  1NSQ A;  1MN9 A;  2B8P A;  3EIC A;  3ZTP A;  3NGS A;  1MN7 A;  3FC9 A;  3MPD A;  4FKY A;  1NDL A;  5CAA A;  2B8Q A;  4O0N A;  1WKJ A;  3BBB A;  2DXE A;  3Q86 A;  3G2X A;  2BEF A;  1NUE A;  1K44 A;  4ENO A;  3EJM A;  1PKU A;  4UOF A;  4F36 A;  5C7P A;  3FBC A;  1NLK L;  1JXV A;  1XIQ A;  1F3F A;  2HVE A;  4ANC A;  1WKK A;  3VGV A;  4DUT A;  3ZTS A;  1KDN A;  3WX8 A;  3FBB A;  1LEO A;  1W7W A;  5IOL A;  3VGT A;  3BH6 B;  2DY9 A;  3VVT A;  3Q83 A;  3ZTO A;  1HHQ A;  1NSP A;  1NDC A;  4CP5 A;  2BX6 A;  1XQI A;  1NCL A;  3ETM A;  3EE3 A;  1ZS6 A;  1NPK A;  4UOG A;  3EMT A;  4UOH A;  1NSK L;  1S5Z A;  3EVM A;  3JS9 A;  3DDI A;  4WBF A;  4KPC A;  3VVU A;  4F4A A;  2AZ1 A;  3PRV A;  3Q8V A;  1EHW A;  4S0M A;  3DKD A;  3PJ9 A;  4FKX A;  4ANE A;  3NGU A;  3ENA A;  3R9L A;  1S57 A;  1F6T A;  2HVD A;  2HUR A;  3Q8U A;  1NB2 A;  5CAB A;  1BHN A;  4HR2 A;  3B54 A;  3FBE A;  3NGR A;  2ZUA A;  2CWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...