1W7XL

Factor7 - 413 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
52
Chain Sequence
ICVNENGGCEQYCSDHKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective and Orally Bioavailable Phenylglycine Tissue Factor/Factor Viia Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BLOOD COAGULATION FACTOR VIIA
total genus 11
structure length 52
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2004-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1w7xL00
2K2SB 3ZYGA 3QH0A 3HO3A 1URKA 1IOEL 4PH9A 4ZHAB 3KQCL 1NFXB 3MQEA 4CUFA 1EMNA 2DDUA 4ISHL 4Y79B 5CISA 1IGZA 2J95B 1IJQA 1IQFL 1OB1C 2Y82B 2P93L 1YGCL 2BOKL 3F1SB 1FSBA 1BF9A 4Z0KB 2B7DL 3SOVA 5L2YL 5FDQA 1PFXL 3V65B 1EPHA 1CX2A 3CA7A 4D0FA 4BTUA 4NA9L 1IQML 2WFXB 2FD6A 3CENL 2J34B 2RNLA 1I0UA 3BPSE 2P28B 2NPRA 3GCWE 1X7AL 2XBXL 1IQLL 1FAXL 1A3PA 2WPHE 2UWOB 4X8UL 3LTGD 2WPLE 4Z6AL 1DQBA 3M37L 1PGEA 1XFEA 2G00L 1XDTR 2VJ3A 1HCGB 4X8VL 1DVAL 2GD4A 4ZAEB 1DDXA 1N7DA 2PR3B 4BTIA 3PGHA 5IKRA 1XKBA 2XBVL 3N8YA 4RUTA 1CEJA 1HT8A 3NTGA 4A7IA 2EI7B 2AYLA 4CUDA 2BOUA 1P0SL 1PRHA 2VWMK 5JVYA 2BQ6A 3LAQA 3QMOA 1ATAA 2P95L 2I9AA 2OYUP 2BO2A 2W3IB 5E8DA 4RRYA 2WG3C 3N8WA 3TZIA 1G1QA 3Q3KB 1LQDA 1TLEA 3N8VA 1HAEA 2F9BL 2WYJB 4YZUB 1HT5A 2PHBB 2VH0B 1NFYB 2W2QE 1RFNB 4JZDL 1ZAQA 4X8TL 1MQ6L 5I46L 2Y38A 3NT1A 2XBYL 1IQJL 2XC5L 2Y81B 3RR3A 2P94L 1F7MA 1M1XB 3POYA 2Y7ZB 1IQNL 2MGRA 2XBWL 4X8SL 1ATDA 4CUEA 3CFWA 1EPIA 1CCVA 5KN5C 4BDWA 3R05A 5F1AA 4AQTA 5KIRA 4BXWA 1COUA 3TK6B 2XC4L 5JW1A 1NPEB 1IQKL 1W7XL 2P3FN 4RRXA 1JL9A 3K9XA 4Y6DB 1EPGA 1FFMA 3LC5B 4TGFA 3N8ZA 1N1IA 3DEMA 3KRKA 3TH3L 3GISX 3HS5A 1NFUB 1UZPA 2Y80B 3EGFA 2Y5FL 2TGFA 1F0RB 2WPIE 1W8BL 1CQEA 1CVWL 1JV2B 1KSNB 3ZYJB 3LTFB 1AUTL 3FBYA 3IITB 2UWPB 2Y5GL 1KLJL 3NTBA 2WYGB 1EPJA 5CKQA 5IKQA 3CS7L 2KL7A 1EBVA 1O5DL 2W26B 1NT0A 4JZFL 1EQGA 3Q7DA 4G1MB 3OLTA 4RS0A 4JZEL 1EQHA 2VWLL 1ATEA 2KV4A 1TPGA 3HPTA 1K37A 3SOBB 3N8WB 1HX2A 2W2PE 1KLIL 1C5MF 2BMGA 2PUQL 1MQ5L 2I9BA 2KB9A 4COXA 1APOA 1IP0A 3ASIA 4XLWA 3LIWB 3HO5A 3U7UG 1Z6EL 1IQGL 4NG9L 2EI8B 2WPKE 1YUGA 3P5BL 2BQWA 2Y5HL 4Y7BB 5L2ZL 1YUKB 3TGFA 4LMFA 4ZXYL 1DX5I 1WHEA 3ELAL 2ADXA 2J2UB 3BT2A 1JBUL 4YT7L 2W3KB 3M36L 4BXSA 1CCFA 2VWNL 1IGXA 2W2OE 4Z0LA 1K36A 3NJPC 2Y7XB 3KQBL 3ENSA 4Y76B 5JVZA 2VH6B 2BOXA 1P9JA 2CJIB 4Y71B 3N8YB 2K2TA 3LN1A 2WPJE 2FZZL 1L3YA 2H9EL 4YT6L 3BT1A 3U73A 4D90A 2P26A 1V3XB 4Y7AB 2UWLB 4O02B 4XBMA 4E1GA 4OTJA 1QFKL 1IQEL 4RRWA 1CVUA 1MOXC 1HREA 4OTYA 3KQDL 2FLRL 2JKHL 1EZQB 1NQLB 4ISIL 2BZ6L 1LPGA 2BOHA 2FLGA 4O1ZA 1SZBA 1U67A 5EGMB 5L30L 5JB8E 3FCSB 1F7EA 2RA0L 5CKMA 1UZKA 5COXA 4C16A 3SOQA 1F0SB 4ZH8B 3FFGL 2Q1JB 5JBCE 2MHPA 5JBBE 2VVVL 1ADXA 1HAFA 3HO4A 3ZYIB 1EGFA 3OLUA 2VVUL 1YO8A 3LN0A 1IQHL 1YUFA 1EMOA 1IVOC 2W2ME 3KCGL 1LPZA 2YGPA 3N8XA 2J4IB 2FLBL 1LPKA 4JYUL 5CKNA 1GK5A 4JYVL 2VVCK 1FE2A 2MGPA 3V64C 3KQEL 4MMYB 3SW2A 4RRZA 2P3FL 1HZ8A 2VWOL 1KIGL 2BQ7A 2D1JB 2WG4B 3F6UL 2YGOA 4XL1A 1FAKL 3GCXE 6COXA 3KK6A 2XC0L 3QCWA 5JBAE 2J38B 4M10A 1PTHA 1Q4GA 2P3TA 1G1TA 1WU1B 2P3UA 1NFWB 1PXXA 1NZIA 2WFTA 1KLOA 1UZQA 3IJEB 5IKVA 5K0HB 4D0EA 2W86A 4BDXA 5F19A 2P16L 1B9WA 4MMXB 1Z6CA 3HS6A 1HJ7A 1U8CB 1J9CL 1HRFA 1UZJA 4M11A 3LC3B 1EAIC 1APQA 1IOXA 4BTTA 1ATBA 3TK5B 5JB9E 4ZXXL 4MMZB 4FM5A 1DIYA 2EI6B 1G2LB 3HS7A 1TOZA 1FJSL 4LORA 3MDLA 2W2NE 1G1RA 2RHPA 1L5GB 1FF7A 2WPME 4CSYA 1IQIL 1LMJA 5IKTA 2J94B 1XKAL 3C9AC 1G1SA 2OYEP 1G2MB 2M74A 3H5CB 4NGAL 3TBDA 1WHFA 3KL6B
chains in the Genus database with same CATH superfamily
2K2SB 3ZYGA 3QH0A 3HO3A 1URKA 1IOEL 4PH9A 4ZHAB 3KQCL 1NFXB 3MQEA 4CUFA 1EMNA 2DDUA 4ISHL 4Y79B 5CISA 1IGZA 2J95B 1IJQA 1IQFL 1OB1C 2Y82B 2P93L 2H9EC 1YGCL 2BOKL 3F1SB 1FSBA 1BF9A 4Z0KB 2B7DL 3SOVA 5L2YL 5FDQA 1PFXL 3V65B 1EPHA 1CX2A 3CA7A 4D0FA 4BTUA 4NA9L 1IQML 2WFXB 2FD6A 3CENL 2J34B 2RNLA 1I0UA 3BPSE 2P28B 2NPRA 3GCWE 1X7AL 2XBXL 1IQLL 1FAXL 1A3PA 2WPHE 2UWOB 4X8UL 3LTGD 2WPLE 4Z6AL 1DQBA 3M37L 1PGEA 1XFEA 2G00L 1XDTR 2VJ3A 1HCGB 4X8VL 1DVAL 2GD4A 4ZAEB 1DDXA 1N7DA 2PR3B 4BTIA 3PGHA 5IKRA 1XKBA 2XBVL 3N8YA 4RUTA 1CEJA 1HT8A 3NTGA 4A7IA 2EI7B 2AYLA 4CUDA 2BOUA 1P0SL 1PRHA 2VWMK 5JVYA 2BQ6A 3LAQA 3QMOA 1ATAA 2P95L 2I9AA 2OYUP 2BO2A 2W3IB 5E8DA 4RRYA 2WG3C 2BT7A 3N8WA 3TZIA 1G1QA 3Q3KB 1LQDA 1TLEA 3N8VA 1HAEA 2YGQA 2F9BL 2WYJB 4YZUB 1HT5A 2PHBB 2VH0B 1NFYB 2W2QE 1RFNB 4JZDL 1ZAQA 4X8TL 1MQ6L 5I46L 2Y38A 3NT1A 2XBYL 1IQJL 2XC5L 2Y81B 3RR3A 2P94L 1F7MA 1M1XB 2KNIA 3POYA 2Y7ZB 1IQNL 2MGRA 2XBWL 4X8SL 1ATDA 4CUEA 3CFWA 1EPIA 1CCVA 5KN5C 4A94C 4BDWA 3R05A 5F1AA 4AQTA 5KIRA 4BXWA 1COUA 3TK6B 2XC4L 5JW1A 1NPEB 1IQKL 1W7XL 2P3FN 4RRXA 1JL9A 3K9XA 4Y6DB 1EPGA 1FFMA 3LC5B 4TGFA 3N8ZA 1N1IA 3DEMA 3KRKA 3TH3L 3GISX 3HS5A 1NFUB 1UZPA 2Y80B 3EGFA 2Y5FL 2TGFA 1F0RB 2WPIE 1W8BL 1CQEA 4GU4A 1CVWL 1JV2B 1KSNB 3ZYJB 3LTFB 1AUTL 3FBYA 3IITB 2UWPB 2Y5GL 1KLJL 3NTBA 2VRSA 2WYGB 2BSFA 5CKQA 5IKQA 1EPJA 3CS7L 2KL7A 1EBVA 1O5DL 2W26B 1NT0A 4JZFL 1EQGA 3Q7DA 4G1MB 3OLTA 4RS0A 4JZEL 1EQHA 2VWLL 1ATEA 2KV4A 1TPGA 3HPTA 1K37A 3SOBB 3N8WB 1HX2A 2W2PE 1KLIL 1C5MF 2BMGA 2PUQL 1MQ5L 2I9BA 2KB9A 4COXA 1APOA 1IP0A 1V1IA 3ASIA 4XLWA 3LIWB 3HO5A 3U7UG 1Z6EL 1IQGL 4NG9L 1KKEA 2EI8B 2WPKE 1YUGA 3P5BL 2BQWA 1QIUA 2Y5HL 4Y7BB 5L2ZL 1YUKB 3TGFA 4LMFA 4ZXYL 1DX5I 1WHEA 3ELAL 2ADXA 2J2UB 3BT2A 1JBUL 4YT7L 2W3KB 3M36L 4BXSA 1CCFA 2VWNL 1IGXA 2W2OE 4Z0LA 1K36A 3NJPC 2Y7XB 3KQBL 3ENSA 4Y76B 5JVZA 2VH6B 2BOXA 1P9JA 2CJIB 4Y71B 3N8YB 2K2TA 3LN1A 2WPJE 2FZZL 1L3YA 2H9EL 4YT6L 3BT1A 3U73A 2WZPP 4D90A 2P26A 1V3XB 4Y7AB 2UWLB 4O02B 4XBMA 4E1GA 4OTJA 1QFKL 1IQEL 4RRWA 1CVUA 1MOXC 1HREA 4OTYA 3KQDL 2FLRL 2JKHL 1EZQB 1NQLB 4ISIL 2BZ6L 1LPGA 1LK9A 2BOHA 2FLGA 4O1ZA 1SZBA 1U67A 5EGMB 5L30L 5JB8E 3FCSB 1F7EA 2RA0L 5CKMA 1UZKA 5COXA 4C16A 3SOQA 1F0SB 4ZH8B 3FFGL 2Q1JB 5JBCE 2MHPA 5JBBE 2VVVL 1ADXA 1HAFA 3HO4A 3ZYIB 1EGFA 3OLUA 2VVUL 1YO8A 3LN0A 1IQHL 1YUFA 1EMOA 1IVOC 2W2ME 3KCGL 1LPZA 2YGPA 3N8XA 2J4IB 2FLBL 1LPKA 1LMMA 4JYUL 5CKNA 1GK5A 4JYVL 2VVCK 1FE2A 2MGPA 3V64C 3KQEL 4MMYB 3S6XA 3SW2A 4RRZA 2P3FL 1HZ8A 2VWOL 1KIGL 2BQ7A 2D1JB 2WG4B 3F6UL 2YGOA 4XL1A 1FAKL 3GCXE 6COXA 3KK6A 2XC0L 3QCWA 5JBAE 2J38B 4M10A 1PTHA 1Q4GA 2P3TA 1G1TA 1WU1B 2BT8A 2P3UA 1NFWB 1PXXA 1NZIA 2WFTA 1KLOA 1UZQA 3IJEB 5IKVA 5K0HB 4D0EA 2W86A 4BDXA 5F19A 2P16L 1B9WA 4MMXB 1Z6CA 3HS6A 1HJ7A 1U8CB 1J9CL 1HRFA 1UZJA 2HOXA 4M11A 1V1HA 3LC3B 1EAIC 1APQA 1IOXA 4BTTA 1ATBA 3TK5B 5JB9E 4ZXXL 4MMZB 4FM5A 1DIYA 2EI6B 2HORA 1G2LB 3HS7A 1TOZA 1FJSL 4LORA 3MDLA 2W2NE 1G1RA 2RHPA 1L5GB 1FF7A 4GU3A 2WPME 4CSYA 1IQIL 1LMJA 5IKTA 2J94B 1XKAL 3C9AC 1G1SA 2OYEP 1G2MB 2M74A 3H5CB 4NGAL 3TBDA 1WHFA 2JJLA 3KL6B
chains in the Genus database with same CATH topology
2K2SB 3ZYGA 3QH0A 3HO3A 1URKA 1IOEL 4PH9A 4ZHAB 3KQCL 1NFXB 3MQEA 4CUFA 1EMNA 2DDUA 4ISHL 4Y79B 5CISA 1IGZA 2J95B 1IJQA 1IQFL 1OB1C 2Y82B 2P93L 2H9EC 1YGCL 2BOKL 3F1SB 1FSBA 1BF9A 4Z0KB 2B7DL 3SOVA 5L2YL 5FDQA 1PFXL 3V65B 1EPHA 1CX2A 3CA7A 4D0FA 4BTUA 4NA9L 1IQML 2WFXB 2FD6A 3CENL 2J34B 2RNLA 1I0UA 3BPSE 2P28B 2NPRA 3GCWE 1X7AL 2XBXL 1IQLL 1FAXL 1A3PA 2WPHE 2UWOB 4X8UL 3LTGD 2WPLE 4Z6AL 1DQBA 3M37L 1PGEA 1XFEA 2G00L 1XDTR 2VJ3A 1HCGB 4X8VL 1DVAL 2GD4A 4ZAEB 1DDXA 1N7DA 2PR3B 4BTIA 3PGHA 5IKRA 1XKBA 2XBVL 3N8YA 4RUTA 1CEJA 1HT8A 3NTGA 4A7IA 2EI7B 2AYLA 4CUDA 2BOUA 1P0SL 1PRHA 2VWMK 5JVYA 2BQ6A 3LAQA 3QMOA 1ATAA 2P95L 2I9AA 2OYUP 2BO2A 2W3IB 5E8DA 4RRYA 2WG3C 3N8WA 3TZIA 1G1QA 3Q3KB 1LQDA 1TLEA 3N8VA 1HAEA 2YGQA 2F9BL 2WYJB 4YZUB 1HT5A 2PHBB 2VH0B 1NFYB 2W2QE 1RFNB 4JZDL 1ZAQA 4X8TL 1MQ6L 5I46L 2Y38A 3NT1A 2XBYL 1IQJL 2XC5L 2Y81B 3RR3A 2P94L 1F7MA 1M1XB 2KNIA 3POYA 2Y7ZB 1IQNL 2MGRA 2XBWL 4X8SL 1ATDA 4CUEA 3CFWA 1EPIA 1CCVA 5KN5C 4A94C 4BDWA 3R05A 5F1AA 4AQTA 5KIRA 4BXWA 1COUA 3TK6B 2XC4L 5JW1A 1NPEB 1IQKL 1W7XL 2P3FN 4RRXA 1JL9A 3K9XA 4Y6DB 1EPGA 1FFMA 3LC5B 4TGFA 3N8ZA 1N1IA 3DEMA 3KRKA 3TH3L 3GISX 3HS5A 1NFUB 1UZPA 2Y80B 3EGFA 2Y5FL 2TGFA 1F0RB 2WPIE 1W8BL 1CQEA 1CVWL 1JV2B 1KSNB 3ZYJB 3LTFB 1AUTL 3FBYA 3IITB 2UWPB 2Y5GL 1KLJL 3NTBA 2WYGB 1EPJA 5CKQA 5IKQA 3CS7L 2KL7A 1EBVA 1O5DL 2W26B 1NT0A 4JZFL 1EQGA 3Q7DA 4G1MB 3OLTA 4RS0A 4JZEL 1EQHA 2VWLL 1ATEA 2KV4A 1TPGA 3HPTA 1K37A 3SOBB 3N8WB 1HX2A 2W2PE 1KLIL 1C5MF 2BMGA 2PUQL 1MQ5L 2I9BA 2KB9A 4COXA 1APOA 1IP0A 3ASIA 4XLWA 3LIWB 3HO5A 3U7UG 1Z6EL 1IQGL 4NG9L 2EI8B 2WPKE 1YUGA 3P5BL 2BQWA 2Y5HL 4Y7BB 5L2ZL 1YUKB 3TGFA 4LMFA 4ZXYL 1DX5I 1WHEA 3ELAL 2ADXA 2J2UB 3BT2A 1JBUL 4YT7L 2W3KB 3M36L 4BXSA 1CCFA 2VWNL 1IGXA 2W2OE 4Z0LA 1K36A 3NJPC 2Y7XB 3KQBL 3ENSA 4Y76B 5JVZA 2VH6B 2BOXA 1P9JA 2CJIB 4Y71B 3N8YB 2K2TA 3LN1A 2WPJE 2FZZL 1L3YA 2H9EL 4YT6L 3BT1A 3U73A 2WZPP 4D90A 2P26A 1V3XB 4Y7AB 2UWLB 4O02B 4XBMA 4E1GA 4OTJA 1QFKL 1IQEL 4RRWA 1CVUA 1MOXC 1HREA 4OTYA 3KQDL 2FLRL 2JKHL 1EZQB 1NQLB 4ISIL 2BZ6L 1LPGA 2BOHA 2FLGA 4O1ZA 1SZBA 1U67A 5EGMB 5L30L 5JB8E 3FCSB 1F7EA 2RA0L 5CKMA 1UZKA 5COXA 4C16A 3SOQA 1F0SB 4ZH8B 3FFGL 2Q1JB 5JBCE 2MHPA 5JBBE 2VVVL 1ADXA 1HAFA 3HO4A 3ZYIB 1EGFA 3OLUA 2VVUL 1YO8A 3LN0A 1IQHL 1YUFA 1EMOA 1IVOC 2W2ME 3KCGL 1LPZA 2YGPA 3N8XA 2J4IB 2FLBL 1LPKA 1LMMA 4JYUL 5CKNA 1GK5A 4JYVL 2VVCK 1FE2A 2MGPA 3V64C 3KQEL 4MMYB 3S6XA 3SW2A 4RRZA 2P3FL 1HZ8A 2VWOL 1KIGL 2BQ7A 2D1JB 2WG4B 3F6UL 2YGOA 4XL1A 1FAKL 3GCXE 6COXA 3KK6A 2XC0L 3QCWA 5JBAE 2J38B 4M10A 1PTHA 1Q4GA 2P3TA 1G1TA 1WU1B 2P3UA 1NFWB 1PXXA 1NZIA 2WFTA 1KLOA 1UZQA 3IJEB 5IKVA 5K0HB 4D0EA 2W86A 4BDXA 5F19A 2P16L 1B9WA 4MMXB 1Z6CA 3HS6A 1HJ7A 1U8CB 1J9CL 1HRFA 1UZJA 4M11A 3LC3B 1EAIC 1APQA 1IOXA 4BTTA 1ATBA 3TK5B 5JB9E 4ZXXL 4MMZB 4FM5A 1DIYA 2EI6B 1G2LB 3HS7A 1TOZA 1FJSL 4LORA 3MDLA 2W2NE 1G1RA 2RHPA 1L5GB 1FF7A 2WPME 4CSYA 1IQIL 1LMJA 5IKTA 2J94B 1XKAL 3C9AC 1G1SA 2OYEP 1G2MB 2M74A 3H5CB 4NGAL 3TBDA 1WHFA 3KL6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2S B;  3ZYG A;  3QH0 A;  3HO3 A;  1URK A;  1IOE L;  4PH9 A;  4ZHA B;  3KQC L;  1NFX B;  3MQE A;  4CUF A;  1EMN A;  2DDU A;  4ISH L;  4Y79 B;  5CIS A;  1IGZ A;  2J95 B;  1IJQ A;  1IQF L;  1OB1 C;  2Y82 B;  2P93 L;  1YGC L;  2BOK L;  3F1S B;  1FSB A;  1BF9 A;  4Z0K B;  2B7D L;  3SOV A;  5L2Y L;  5FDQ A;  1PFX L;  3V65 B;  1EPH A;  1CX2 A;  3CA7 A;  4D0F A;  4BTU A;  4NA9 L;  1IQM L;  2WFX B;  2FD6 A;  3CEN L;  2J34 B;  2RNL A;  1I0U A;  3BPS E;  2P28 B;  2NPR A;  3GCW E;  1X7A L;  2XBX L;  1IQL L;  1FAX L;  1A3P A;  2WPH E;  2UWO B;  4X8U L;  3LTG D;  2WPL E;  4Z6A L;  1DQB A;  3M37 L;  1PGE A;  1XFE A;  2G00 L;  1XDT R;  2VJ3 A;  1HCG B;  4X8V L;  1DVA L;  2GD4 A;  4ZAE B;  1DDX A;  1N7D A;  2PR3 B;  4BTI A;  3PGH A;  5IKR A;  1XKB A;  2XBV L;  3N8Y A;  4RUT A;  1CEJ A;  1HT8 A;  3NTG A;  4A7I A;  2EI7 B;  2AYL A;  4CUD A;  2BOU A;  1P0S L;  1PRH A;  2VWM K;  5JVY A;  2BQ6 A;  3LAQ A;  3QMO A;  1ATA A;  2P95 L;  2I9A A;  2OYU P;  2BO2 A;  2W3I B;  5E8D A;  4RRY A;  2WG3 C;  3N8W A;  3TZI A;  1G1Q A;  3Q3K B;  1LQD A;  1TLE A;  3N8V A;  1HAE A;  2F9B L;  2WYJ B;  4YZU B;  1HT5 A;  2PHB B;  2VH0 B;  1NFY B;  2W2Q E;  1RFN B;  4JZD L;  1ZAQ A;  4X8T L;  1MQ6 L;  5I46 L;  2Y38 A;  3NT1 A;  2XBY L;  1IQJ L;  2XC5 L;  2Y81 B;  3RR3 A;  2P94 L;  1F7M A;  1M1X B;  3POY A;  2Y7Z B;  1IQN L;  2MGR A;  2XBW L;  4X8S L;  1ATD A;  4CUE A;  3CFW A;  1EPI A;  1CCV A;  5KN5 C;  4BDW A;  3R05 A;  5F1A A;  4AQT A;  5KIR A;  4BXW A;  1COU A;  3TK6 B;  2XC4 L;  5JW1 A;  1NPE B;  1IQK L;  1W7X L;  2P3F N;  4RRX A;  1JL9 A;  3K9X A;  4Y6D B;  1EPG A;  1FFM A;  3LC5 B;  4TGF A;  3N8Z A;  1N1I A;  3DEM A;  3KRK A;  3TH3 L;  3GIS X;  3HS5 A;  1NFU B;  1UZP A;  2Y80 B;  3EGF A;  2Y5F L;  2TGF A;  1F0R B;  2WPI E;  1W8B L;  1CQE A;  1CVW L;  1JV2 B;  1KSN B;  3ZYJ B;  3LTF B;  1AUT L;  3FBY A;  3IIT B;  2UWP B;  2Y5G L;  1KLJ L;  3NTB A;  2WYG B;  1EPJ A;  5CKQ A;  5IKQ A;  3CS7 L;  2KL7 A;  1EBV A;  1O5D L;  2W26 B;  1NT0 A;  4JZF L;  1EQG A;  3Q7D A;  4G1M B;  3OLT A;  4RS0 A;  4JZE L;  1EQH A;  2VWL L;  1ATE A;  2KV4 A;  1TPG A;  3HPT A;  1K37 A;  3SOB B;  3N8W B;  1HX2 A;  2W2P E;  1KLI L;  1C5M F;  2BMG A;  2PUQ L;  1MQ5 L;  2I9B A;  2KB9 A;  4COX A;  1APO A;  1IP0 A;  3ASI A;  4XLW A;  3LIW B;  3HO5 A;  3U7U G;  1Z6E L;  1IQG L;  4NG9 L;  2EI8 B;  2WPK E;  1YUG A;  3P5B L;  2BQW A;  2Y5H L;  4Y7B B;  5L2Z L;  1YUK B;  3TGF A;  4LMF A;  4ZXY L;  1DX5 I;  1WHE A;  3ELA L;  2ADX A;  2J2U B;  3BT2 A;  1JBU L;  4YT7 L;  2W3K B;  3M36 L;  4BXS A;  1CCF A;  2VWN L;  1IGX A;  2W2O E;  4Z0L A;  1K36 A;  3NJP C;  2Y7X B;  3KQB L;  3ENS A;  4Y76 B;  5JVZ A;  2VH6 B;  2BOX A;  1P9J A;  2CJI B;  4Y71 B;  3N8Y B;  2K2T A;  3LN1 A;  2WPJ E;  2FZZ L;  1L3Y A;  2H9E L;  4YT6 L;  3BT1 A;  3U73 A;  4D90 A;  2P26 A;  1V3X B;  4Y7A B;  2UWL B;  4O02 B;  4XBM A;  4E1G A;  4OTJ A;  1QFK L;  1IQE L;  4RRW A;  1CVU A;  1MOX C;  1HRE A;  4OTY A;  3KQD L;  2FLR L;  2JKH L;  1EZQ B;  1NQL B;  4ISI L;  2BZ6 L;  1LPG A;  2BOH A;  2FLG A;  4O1Z A;  1SZB A;  1U67 A;  5EGM B;  5L30 L;  5JB8 E;  3FCS B;  1F7E A;  2RA0 L;  5CKM A;  1UZK A;  5COX A;  4C16 A;  3SOQ A;  1F0S B;  4ZH8 B;  3FFG L;  2Q1J B;  5JBC E;  2MHP A;  5JBB E;  2VVV L;  1ADX A;  1HAF A;  3HO4 A;  3ZYI B;  1EGF A;  3OLU A;  2VVU L;  1YO8 A;  3LN0 A;  1IQH L;  1YUF A;  1EMO A;  1IVO C;  2W2M E;  3KCG L;  1LPZ A;  2YGP A;  3N8X A;  2J4I B;  2FLB L;  1LPK A;  4JYU L;  5CKN A;  1GK5 A;  4JYV L;  2VVC K;  1FE2 A;  2MGP A;  3V64 C;  3KQE L;  4MMY B;  3SW2 A;  4RRZ A;  2P3F L;  1HZ8 A;  2VWO L;  1KIG L;  2BQ7 A;  2D1J B;  2WG4 B;  3F6U L;  2YGO A;  4XL1 A;  1FAK L;  3GCX E;  6COX A;  3KK6 A;  2XC0 L;  3QCW A;  5JBA E;  2J38 B;  4M10 A;  1PTH A;  1Q4G A;  2P3T A;  1G1T A;  1WU1 B;  2P3U A;  1NFW B;  1PXX A;  1NZI A;  2WFT A;  1KLO A;  1UZQ A;  3IJE B;  5IKV A;  5K0H B;  4D0E A;  2W86 A;  4BDX A;  5F19 A;  2P16 L;  1B9W A;  4MMX B;  1Z6C A;  3HS6 A;  1HJ7 A;  1U8C B;  1J9C L;  1HRF A;  1UZJ A;  4M11 A;  3LC3 B;  1EAI C;  1APQ A;  1IOX A;  4BTT A;  1ATB A;  3TK5 B;  5JB9 E;  4ZXX L;  4MMZ B;  4FM5 A;  1DIY A;  2EI6 B;  1G2L B;  3HS7 A;  1TOZ A;  1FJS L;  4LOR A;  3MDL A;  2W2N E;  1G1R A;  2RHP A;  1L5G B;  1FF7 A;  2WPM E;  4CSY A;  1IQI L;  1LMJ A;  5IKT A;  2J94 B;  1XKA L;  3C9A C;  1G1S A;  2OYE P;  1G2M B;  2M74 A;  3H5C B;  4NGA L;  3TBD A;  1WHF A;  3KL6 B; 
#chains in the Genus database with same CATH topology
 2K2S B;  3ZYG A;  3QH0 A;  3HO3 A;  1URK A;  1IOE L;  4PH9 A;  4ZHA B;  3KQC L;  1NFX B;  3MQE A;  4CUF A;  1EMN A;  2DDU A;  4ISH L;  4Y79 B;  5CIS A;  1IGZ A;  2J95 B;  1IJQ A;  1IQF L;  1OB1 C;  2Y82 B;  2P93 L;  2H9E C;  1YGC L;  2BOK L;  3F1S B;  1FSB A;  1BF9 A;  4Z0K B;  2B7D L;  3SOV A;  5L2Y L;  5FDQ A;  1PFX L;  3V65 B;  1EPH A;  1CX2 A;  3CA7 A;  4D0F A;  4BTU A;  4NA9 L;  1IQM L;  2WFX B;  2FD6 A;  3CEN L;  2J34 B;  2RNL A;  1I0U A;  3BPS E;  2P28 B;  2NPR A;  3GCW E;  1X7A L;  2XBX L;  1IQL L;  1FAX L;  1A3P A;  2WPH E;  2UWO B;  4X8U L;  3LTG D;  2WPL E;  4Z6A L;  1DQB A;  3M37 L;  1PGE A;  1XFE A;  2G00 L;  1XDT R;  2VJ3 A;  1HCG B;  4X8V L;  1DVA L;  2GD4 A;  4ZAE B;  1DDX A;  1N7D A;  2PR3 B;  4BTI A;  3PGH A;  5IKR A;  1XKB A;  2XBV L;  3N8Y A;  4RUT A;  1CEJ A;  1HT8 A;  3NTG A;  4A7I A;  2EI7 B;  2AYL A;  4CUD A;  2BOU A;  1P0S L;  1PRH A;  2VWM K;  5JVY A;  2BQ6 A;  3LAQ A;  3QMO A;  1ATA A;  2P95 L;  2I9A A;  2OYU P;  2BO2 A;  2W3I B;  5E8D A;  4RRY A;  2WG3 C;  2BT7 A;  3N8W A;  3TZI A;  1G1Q A;  3Q3K B;  1LQD A;  1TLE A;  3N8V A;  1HAE A;  2YGQ A;  2F9B L;  2WYJ B;  4YZU B;  1HT5 A;  2PHB B;  2VH0 B;  1NFY B;  2W2Q E;  1RFN B;  4JZD L;  1ZAQ A;  4X8T L;  1MQ6 L;  5I46 L;  2Y38 A;  3NT1 A;  2XBY L;  1IQJ L;  2XC5 L;  2Y81 B;  3RR3 A;  2P94 L;  1F7M A;  1M1X B;  2KNI A;  3POY A;  2Y7Z B;  1IQN L;  2MGR A;  2XBW L;  4X8S L;  1ATD A;  4CUE A;  3CFW A;  1EPI A;  1CCV A;  5KN5 C;  4A94 C;  4BDW A;  3R05 A;  5F1A A;  4AQT A;  5KIR A;  4BXW A;  1COU A;  3TK6 B;  2XC4 L;  5JW1 A;  1NPE B;  1IQK L;  1W7X L;  2P3F N;  4RRX A;  1JL9 A;  3K9X A;  4Y6D B;  1EPG A;  1FFM A;  3LC5 B;  4TGF A;  3N8Z A;  1N1I A;  3DEM A;  3KRK A;  3TH3 L;  3GIS X;  3HS5 A;  1NFU B;  1UZP A;  2Y80 B;  3EGF A;  2Y5F L;  2TGF A;  1F0R B;  2WPI E;  1W8B L;  1CQE A;  4GU4 A;  1CVW L;  1JV2 B;  1KSN B;  3ZYJ B;  3LTF B;  1AUT L;  3FBY A;  3IIT B;  2UWP B;  2Y5G L;  1KLJ L;  3NTB A;  2VRS A;  2WYG B;  2BSF A;  5CKQ A;  5IKQ A;  1EPJ A;  3CS7 L;  2KL7 A;  1EBV A;  1O5D L;  2W26 B;  1NT0 A;  4JZF L;  1EQG A;  3Q7D A;  4G1M B;  3OLT A;  4RS0 A;  4JZE L;  1EQH A;  2VWL L;  1ATE A;  2KV4 A;  1TPG A;  3HPT A;  1K37 A;  3SOB B;  3N8W B;  1HX2 A;  2W2P E;  1KLI L;  1C5M F;  2BMG A;  2PUQ L;  1MQ5 L;  2I9B A;  2KB9 A;  4COX A;  1APO A;  1IP0 A;  1V1I A;  3ASI A;  4XLW A;  3LIW B;  3HO5 A;  3U7U G;  1Z6E L;  1IQG L;  4NG9 L;  1KKE A;  2EI8 B;  2WPK E;  1YUG A;  3P5B L;  2BQW A;  1QIU A;  2Y5H L;  4Y7B B;  5L2Z L;  1YUK B;  3TGF A;  4LMF A;  4ZXY L;  1DX5 I;  1WHE A;  3ELA L;  2ADX A;  2J2U B;  3BT2 A;  1JBU L;  4YT7 L;  2W3K B;  3M36 L;  4BXS A;  1CCF A;  2VWN L;  1IGX A;  2W2O E;  4Z0L A;  1K36 A;  3NJP C;  2Y7X B;  3KQB L;  3ENS A;  4Y76 B;  5JVZ A;  2VH6 B;  2BOX A;  1P9J A;  2CJI B;  4Y71 B;  3N8Y B;  2K2T A;  3LN1 A;  2WPJ E;  2FZZ L;  1L3Y A;  2H9E L;  4YT6 L;  3BT1 A;  3U73 A;  2WZP P;  4D90 A;  2P26 A;  1V3X B;  4Y7A B;  2UWL B;  4O02 B;  4XBM A;  4E1G A;  4OTJ A;  1QFK L;  1IQE L;  4RRW A;  1CVU A;  1MOX C;  1HRE A;  4OTY A;  3KQD L;  2FLR L;  2JKH L;  1EZQ B;  1NQL B;  4ISI L;  2BZ6 L;  1LPG A;  1LK9 A;  2BOH A;  2FLG A;  4O1Z A;  1SZB A;  1U67 A;  5EGM B;  5L30 L;  5JB8 E;  3FCS B;  1F7E A;  2RA0 L;  5CKM A;  1UZK A;  5COX A;  4C16 A;  3SOQ A;  1F0S B;  4ZH8 B;  3FFG L;  2Q1J B;  5JBC E;  2MHP A;  5JBB E;  2VVV L;  1ADX A;  1HAF A;  3HO4 A;  3ZYI B;  1EGF A;  3OLU A;  2VVU L;  1YO8 A;  3LN0 A;  1IQH L;  1YUF A;  1EMO A;  1IVO C;  2W2M E;  3KCG L;  1LPZ A;  2YGP A;  3N8X A;  2J4I B;  2FLB L;  1LPK A;  1LMM A;  4JYU L;  5CKN A;  1GK5 A;  4JYV L;  2VVC K;  1FE2 A;  2MGP A;  3V64 C;  3KQE L;  4MMY B;  3S6X A;  3SW2 A;  4RRZ A;  2P3F L;  1HZ8 A;  2VWO L;  1KIG L;  2BQ7 A;  2D1J B;  2WG4 B;  3F6U L;  2YGO A;  4XL1 A;  1FAK L;  3GCX E;  6COX A;  3KK6 A;  2XC0 L;  3QCW A;  5JBA E;  2J38 B;  4M10 A;  1PTH A;  1Q4G A;  2P3T A;  1G1T A;  1WU1 B;  2BT8 A;  2P3U A;  1NFW B;  1PXX A;  1NZI A;  2WFT A;  1KLO A;  1UZQ A;  3IJE B;  5IKV A;  5K0H B;  4D0E A;  2W86 A;  4BDX A;  5F19 A;  2P16 L;  1B9W A;  4MMX B;  1Z6C A;  3HS6 A;  1HJ7 A;  1U8C B;  1J9C L;  1HRF A;  1UZJ A;  2HOX A;  4M11 A;  1V1H A;  3LC3 B;  1EAI C;  1APQ A;  1IOX A;  4BTT A;  1ATB A;  3TK5 B;  5JB9 E;  4ZXX L;  4MMZ B;  4FM5 A;  1DIY A;  2EI6 B;  2HOR A;  1G2L B;  3HS7 A;  1TOZ A;  1FJS L;  4LOR A;  3MDL A;  2W2N E;  1G1R A;  2RHP A;  1L5G B;  1FF7 A;  4GU3 A;  2WPM E;  4CSY A;  1IQI L;  1LMJ A;  5IKT A;  2J94 B;  1XKA L;  3C9A C;  1G1S A;  2OYE P;  1G2M B;  2M74 A;  3H5C B;  4NGA L;  3TBD A;  1WHF A;  2JJL A;  3KL6 B; 
#chains in the Genus database with same CATH homology
 2K2S B;  3ZYG A;  3QH0 A;  3HO3 A;  1URK A;  1IOE L;  4PH9 A;  4ZHA B;  3KQC L;  1NFX B;  3MQE A;  4CUF A;  1EMN A;  2DDU A;  4ISH L;  4Y79 B;  5CIS A;  1IGZ A;  2J95 B;  1IJQ A;  1IQF L;  1OB1 C;  2Y82 B;  2P93 L;  2H9E C;  1YGC L;  2BOK L;  3F1S B;  1FSB A;  1BF9 A;  4Z0K B;  2B7D L;  3SOV A;  5L2Y L;  5FDQ A;  1PFX L;  3V65 B;  1EPH A;  1CX2 A;  3CA7 A;  4D0F A;  4BTU A;  4NA9 L;  1IQM L;  2WFX B;  2FD6 A;  3CEN L;  2J34 B;  2RNL A;  1I0U A;  3BPS E;  2P28 B;  2NPR A;  3GCW E;  1X7A L;  2XBX L;  1IQL L;  1FAX L;  1A3P A;  2WPH E;  2UWO B;  4X8U L;  3LTG D;  2WPL E;  4Z6A L;  1DQB A;  3M37 L;  1PGE A;  1XFE A;  2G00 L;  1XDT R;  2VJ3 A;  1HCG B;  4X8V L;  1DVA L;  2GD4 A;  4ZAE B;  1DDX A;  1N7D A;  2PR3 B;  4BTI A;  3PGH A;  5IKR A;  1XKB A;  2XBV L;  3N8Y A;  4RUT A;  1CEJ A;  1HT8 A;  3NTG A;  4A7I A;  2EI7 B;  2AYL A;  4CUD A;  2BOU A;  1P0S L;  1PRH A;  2VWM K;  5JVY A;  2BQ6 A;  3LAQ A;  3QMO A;  1ATA A;  2P95 L;  2I9A A;  2OYU P;  2BO2 A;  2W3I B;  5E8D A;  4RRY A;  2WG3 C;  3N8W A;  3TZI A;  1G1Q A;  3Q3K B;  1LQD A;  1TLE A;  3N8V A;  1HAE A;  2YGQ A;  2F9B L;  2WYJ B;  4YZU B;  1HT5 A;  2PHB B;  2VH0 B;  1NFY B;  2W2Q E;  1RFN B;  4JZD L;  1ZAQ A;  4X8T L;  1MQ6 L;  5I46 L;  2Y38 A;  3NT1 A;  2XBY L;  1IQJ L;  2XC5 L;  2Y81 B;  3RR3 A;  2P94 L;  1F7M A;  1M1X B;  2KNI A;  3POY A;  2Y7Z B;  1IQN L;  2MGR A;  2XBW L;  4X8S L;  1ATD A;  4CUE A;  3CFW A;  1EPI A;  1CCV A;  5KN5 C;  4A94 C;  4BDW A;  3R05 A;  5F1A A;  4AQT A;  5KIR A;  4BXW A;  1COU A;  3TK6 B;  2XC4 L;  5JW1 A;  1NPE B;  1IQK L;  1W7X L;  2P3F N;  4RRX A;  1JL9 A;  3K9X A;  4Y6D B;  1EPG A;  1FFM A;  3LC5 B;  4TGF A;  3N8Z A;  1N1I A;  3DEM A;  3KRK A;  3TH3 L;  3GIS X;  3HS5 A;  1NFU B;  1UZP A;  2Y80 B;  3EGF A;  2Y5F L;  2TGF A;  1F0R B;  2WPI E;  1W8B L;  1CQE A;  1CVW L;  1JV2 B;  1KSN B;  3ZYJ B;  3LTF B;  1AUT L;  3FBY A;  3IIT B;  2UWP B;  2Y5G L;  1KLJ L;  3NTB A;  2WYG B;  1EPJ A;  5CKQ A;  5IKQ A;  3CS7 L;  2KL7 A;  1EBV A;  1O5D L;  2W26 B;  1NT0 A;  4JZF L;  1EQG A;  3Q7D A;  4G1M B;  3OLT A;  4RS0 A;  4JZE L;  1EQH A;  2VWL L;  1ATE A;  2KV4 A;  1TPG A;  3HPT A;  1K37 A;  3SOB B;  3N8W B;  1HX2 A;  2W2P E;  1KLI L;  1C5M F;  2BMG A;  2PUQ L;  1MQ5 L;  2I9B A;  2KB9 A;  4COX A;  1APO A;  1IP0 A;  3ASI A;  4XLW A;  3LIW B;  3HO5 A;  3U7U G;  1Z6E L;  1IQG L;  4NG9 L;  2EI8 B;  2WPK E;  1YUG A;  3P5B L;  2BQW A;  2Y5H L;  4Y7B B;  5L2Z L;  1YUK B;  3TGF A;  4LMF A;  4ZXY L;  1DX5 I;  1WHE A;  3ELA L;  2ADX A;  2J2U B;  3BT2 A;  1JBU L;  4YT7 L;  2W3K B;  3M36 L;  4BXS A;  1CCF A;  2VWN L;  1IGX A;  2W2O E;  4Z0L A;  1K36 A;  3NJP C;  2Y7X B;  3KQB L;  3ENS A;  4Y76 B;  5JVZ A;  2VH6 B;  2BOX A;  1P9J A;  2CJI B;  4Y71 B;  3N8Y B;  2K2T A;  3LN1 A;  2WPJ E;  2FZZ L;  1L3Y A;  2H9E L;  4YT6 L;  3BT1 A;  3U73 A;  2WZP P;  4D90 A;  2P26 A;  1V3X B;  4Y7A B;  2UWL B;  4O02 B;  4XBM A;  4E1G A;  4OTJ A;  1QFK L;  1IQE L;  4RRW A;  1CVU A;  1MOX C;  1HRE A;  4OTY A;  3KQD L;  2FLR L;  2JKH L;  1EZQ B;  1NQL B;  4ISI L;  2BZ6 L;  1LPG A;  2BOH A;  2FLG A;  4O1Z A;  1SZB A;  1U67 A;  5EGM B;  5L30 L;  5JB8 E;  3FCS B;  1F7E A;  2RA0 L;  5CKM A;  1UZK A;  5COX A;  4C16 A;  3SOQ A;  1F0S B;  4ZH8 B;  3FFG L;  2Q1J B;  5JBC E;  2MHP A;  5JBB E;  2VVV L;  1ADX A;  1HAF A;  3HO4 A;  3ZYI B;  1EGF A;  3OLU A;  2VVU L;  1YO8 A;  3LN0 A;  1IQH L;  1YUF A;  1EMO A;  1IVO C;  2W2M E;  3KCG L;  1LPZ A;  2YGP A;  3N8X A;  2J4I B;  2FLB L;  1LPK A;  1LMM A;  4JYU L;  5CKN A;  1GK5 A;  4JYV L;  2VVC K;  1FE2 A;  2MGP A;  3V64 C;  3KQE L;  4MMY B;  3S6X A;  3SW2 A;  4RRZ A;  2P3F L;  1HZ8 A;  2VWO L;  1KIG L;  2BQ7 A;  2D1J B;  2WG4 B;  3F6U L;  2YGO A;  4XL1 A;  1FAK L;  3GCX E;  6COX A;  3KK6 A;  2XC0 L;  3QCW A;  5JBA E;  2J38 B;  4M10 A;  1PTH A;  1Q4G A;  2P3T A;  1G1T A;  1WU1 B;  2P3U A;  1NFW B;  1PXX A;  1NZI A;  2WFT A;  1KLO A;  1UZQ A;  3IJE B;  5IKV A;  5K0H B;  4D0E A;  2W86 A;  4BDX A;  5F19 A;  2P16 L;  1B9W A;  4MMX B;  1Z6C A;  3HS6 A;  1HJ7 A;  1U8C B;  1J9C L;  1HRF A;  1UZJ A;  4M11 A;  3LC3 B;  1EAI C;  1APQ A;  1IOX A;  4BTT A;  1ATB A;  3TK5 B;  5JB9 E;  4ZXX L;  4MMZ B;  4FM5 A;  1DIY A;  2EI6 B;  1G2L B;  3HS7 A;  1TOZ A;  1FJS L;  4LOR A;  3MDL A;  2W2N E;  1G1R A;  2RHP A;  1L5G B;  1FF7 A;  2WPM E;  4CSY A;  1IQI L;  1LMJ A;  5IKT A;  2J94 B;  1XKA L;  3C9A C;  1G1S A;  2OYE P;  1G2M B;  2M74 A;  3H5C B;  4NGA L;  3TBD A;  1WHF A;  3KL6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...