1W80A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, bound to 2 peptides from synaptojanin170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
248
Chain Sequence
b'PGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 2 ALPHA 2 SUBUNIT
publication title Evolving Nature of the Ap2 Alpha-Appendage Hub During Clathrin-Coated Vesicle Endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 68
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1w80A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1w80A02
5CN2A 1KYUA 1NA8A 1VTOA 1KYDA 2A7BA 3H1ZA 1PZDA 3MNMA 1QNCA 1D3UA 1QN9A 1GYWA 2D0AA 2D0CA 3HS9A 2Z8UA 1YTBA 3ZHFA 2G30A 1B9KA 4PY5A 1QNAA 1R4XA 1MP9A 1QN3A 1QN5A 1YTFA 4ROCB 2DWXA 3EIKA 5IYCP 5CN1A 1NGMA 1QTPA 1KYFA 5IYDP 1JFIC 1PCZA 5IYBP 1TGHA 1VTLE 2YMTA 1OM9A 1CDWA 1NVPA 1QN4A 1QN8A 1E42A 1W80A 4WZSD 1QTSA 4ROEB 1QNBA 3OCIA 1VOKA 1TBAB 2E9GA 2MJ7A 2D0BA 1GYUA 1RM1A 1QNEA 4B0AA 1C9BB 3HS8A 2VJ0A 4RODB 3ZY7A 3VN5A 1KY7A 4BCXA 3OC3C 1TBPA 2IV9A 1IU1A 2DWYA 1GYVA 1QN6A 1KY6A 1AISA 1VOLB 1NH2A 1P4UA 1QN7A 3ASMA 2IV8A
chains in the Genus database with same CATH superfamily
2AHIA 3CW7A 3L9RB 3FOMB 1V5JA 3HLAA 1DBKL 4F5CA 2FRGP 4NAQA 3D07A 3VXMD 1S7TA 5AYUH 1LO3L 3L7FB 2C3GA 4JHVA 1PZDA 3IKKA 3U7AA 2J88H 3FMGH 1WTLA 4K3JH 2VXQH 3RX7A 5DDHA 1TQBB 2YZ1A 1MG2C 4DZBA 2VDQB 5JORA 5D7LD 3NCJL 2X1PA 1OQOA 1C5BL 4JUSA 5FAAA 1ZWIB 1AE6L 2FLBT 4ZSOB 3MRDA 4JPIB 3OKEB 4Z3FA 5TTRA 1DP0A 2BMKA 2R7EA 4KMLB 5IVXF 5GJSL 3DYOA 3S8GB 2FIKA 3CFEA 2AJ3A 3HS0C 1UOWA 2UZXB 4M5ZL 1DCLA 3NEEA 4N2GA 4Q6IC 3GXMA 4GS7B 2XQYG 5D5MB 4BA8A 2W9DL 4OAWB 1SVCP 4G11A 3DX6A 4PJHB 2VSMB 3BQVA 3KPTA 5LBGA 3GMQB 4KDVA 3ZL2A 1JDCA 3T71A 1JK8A 3V8OA 4HU2A 4JK0D 1EFXB 2M26A 4MMYB 5E4IA 1ZS8A 3NRFA 7PCYA 2DN7A 4U3XA 3D2UD 4FEIA 1KC5L 1A6TA 2H6PA 2X6UA 5K69A 3B1UA 3CWAA 3KBEA 2R2EA 4KO5A 5K33A 3GD1C 1A4BA 4D9RD 3ZIMA 4YDZA 2FGZA 4MS8C 4E5XB 1KOAA 3W81A 1ED3B 1XR9B 3FTZA 2OK0H 4HJIA 3ENOC 1I1AB 4OLUH 2CMRL 3AG3B 1CFQB 4NPJA 4IBQA 3GSNB 3W2DL 3B7SA 4DPAX 1S7QB 1OPGL 2B08A 2WQVA 4GI8A 3TYFB 1SLWA 5KAQF 1N39A 3J7HA 5KW9H 4DERA 5JUEH 1W0YT 2NCEA 1AHWB 3LJ3A 4WO4A 4QTIH 2WP3O 3OHXB 1P84K 4M8QB 4DVBB 2YD9A 2CIKA 1E8WA 1BBJA 1ZHKB 4UINL 2BX5A 1YQRA 5A43C 4ODVH 2VAAA 1XCTB 1XIWD 5HHOB 5L4MA 1OTUC 3FYEB 4PS7A 2QQNL 2FWOB 2PNDA 4MDIB 1ES0B 4XOBA 2BHYA 5B7EA 2G2PA 5CO1A 3IDJB 3LD8B 3QUXA 4LLVB 1S78D 3ULAB 5D1ZB 4KJYA 1GSKA 1GZHC 1A6PA 3QCVH 3KPSB 2XTLA 1KMGA 4E9LA 1L3WA 1MEXH 3GXNA 4AW7A 4OCNC 3CZGA 4ATTA 1MFBH 5IJBC 3PGCA 3FTVA 4BRVA 4JZOA 4IJ3C 1TCRB 3QIBC 1DEEB 3E8UL 3A4FA 5GS0L 4ZDHB 6CGTA 1SLUA 4EN3A 2XRAL 4XMVA 3QHTC 4ODBD 3HC4L 2QADC 4LOEA 3EDJA 4NC1E 4NKDB 3GK8H 2DMKA 3K6OA 3UDWC 5F0PB 4HJJL 3VFNA 1NFDE 3L2LA 2FT6A 5DS8A 5KUMA 3UW2A 4UQ2B 2Y7SA 4TKWA 2VQ4A 4IHBA 4HUMB 4JJ5A 4NLAA 4NZUH 5DD3L 4X6BB 3UZQB 5AW4B 1HZHL 3B2VL 1G84A 2XKSA 3RNKA 1BHGA 5CGYD 4KV5F 4NYLB 1JNLL 4MA8L 3LB6D 3W57A 1A4JB 1GSMA 1NBZB 1K4DA 4Y9BA 5GGQL 1TCMA 4OUOA 3NJIA 1X5GA 5LXGH 1G6RA 4PGCA 3P73B 4X7FC 2EIKB 1CYGA 1KYOK 3OAYH 1O7VA 4H25A 2XWJA 3D85D 3TEZA 5DA0B 3HBQA 4HMDA 4MJIA 4OGYH 5DC0A 4G8AC 4LLUB 4XWGL 3CFIC 4O2CA 4ZPTA 4KY2A 3EJZC 3NACH 3IFPB 3H7BB 1E4XI 4RGNE 4AT6A 2WXGA 3LIZL 4H88H 4DGYL 3UTTB 2DBLL 3VD3A 3FQ2A 4AJVA 3II1A 1VKXA 2EE9A 4FXGB 4YHMH 2ARJB 1GMEA 2B9BA 3PABB 5G4MA 4ORGA 4EI0A 4WAFA 2YPLD 2ZCLH 3KYKH 2DKDA 2Z4TA 4MJ5B 2TSBA 2X4OA 5IVZA 5AFAA 2VDNH 3HNTL 1EBAA 5FR3A 3W0WA 5HYFA 1E4JA 1A22B 3IF1A 3NCEB 4W6XB 5LGKA 1AHKA 1PZAA 2HRLA 1VCAA 1VPOL 1JF6A 2QELA 2VLJB 3FH5A 2D2CC 2VDLL 3KEDA 4AVIA 4PJBB 4JPSA 1DVUA 2Y36L 3C75A 3L3KA 5CEXB 2FDBP 5I5IA 4IBLT 2AXGB 3CU7A 4AMWA 4TRPL 2AI0H 3L1FA 2WK2A 1HT6A 3P9LA 3WFBH 5EU4B 4QRQA 1VACB 1C1EH 5H37A 5LVEA 1ZVHA 4HIHB 3O4LD 4C83A 2VL5B 4P2OB 5IB3B 3ULVC 1E3FA 3UTQA 1VFMA 2LU3A 3MOAH 1KN2L 2JE8A 3S2CA 1FVEB 3I6KA 4OLWL 3CXHK 4K7PY 4FQ2H 1D5ZB 4AYBA 2IQ9L 2ICEB 4XH2B 2I24N 2P5ED 1KJMA 3Q8CA 1OEZW 5HHME 2J8UF 3IN0A 4ELKA 3P11H 1CF8H 2QV2A 1YYCA 3RPIA 4JM0A 2UX6A 2ZOKA 3OKLA 4K23L 4WFFE 4XNBA 1R3HA 1EGJH 5BS0E 3QIUC 2HJKB 3FUIA 5CGYC 3LB6C 2WTPA 1IBHA 2BS9A 4LPVA 4Y4KB 4DGVL 2V2XB 2X0VA 5JNYB 4N0CD 4RZCB 3OPZH 2R69L 2HVBA 5CJQL 1A9BA 4J3OC 3G5ZA 1PCJX 1KBVA 2WW8A 3PDDA 5EBWB 4JQIL 4A2DA 1YEIH 2YUWA 1FNGB 1BVKB 4HWEH 2V0AA 1WISA 3BH8A 3IK2A 4N22A 5E9DB 3AAZB 5J3HD 2WTRA 2G9HB 3C6LD 5C8JA 4PJXF 2IFFL 3N1QC 1AVAA 4YXLL 4FL4B 1R3JA 1HILA 4HWNA 5I73C 1BQUA 4NCC2 2B15A 3PWLB 1BVLA 3QFGA 1F0LA 4XGZB 5DCCA 5IMOA 3RVTC 3HMWH 4OZ4A 2M83A 3CHRA 2M2DA 5GGTA 3JV6A 4ZMWA 3CGTA 1BZ9B 2FX9H 5CBAA 4NT6A 1OAJA 1F00I 3LQAL 5D7KE 3MV11 3IFLL 4Y2DB 1CDBA 3DXAA 3B5HA 4M61B 2K9FB 5GZOC 5DT1H 3V6ZA 4W9LC 2I9TB 3MLUL 2EIMB 5D1QE 4XX1E 5GJTH 1HNGA 1EZVX 3W39B 5EEWA 3D3VD 2MQ0A 1UASA 2XPGA 1ZHNA 5L88L 3QUYD 3QAZB 4BZ2H 2FJUB 4Y19E 3IRCA 5J6GB 4FMVA 3T6QC 5E00B 3GMOB 3D0VA 4K3EH 5DF0A 1JVLA 2FJGB 3FT2B 2FL5A 4PJCF 4Y5VC 5FDYA 3VD5A 1ZDSA 4LARH 3GM0A 3ATDA 1ONQA 4MX7B 3SCMB 3BRDA 4L3ED 2DQDL 4ODWB 3AGWA 3R0NA 4KVCH 3LTVA 2VUKA 5AYQA 2GEQA 5IVOA 3NN8B 2MQGA 5A2IH 3GZQA 3IE4A 2B59B 4KPHL 3TJPA 4BEIA 2NOHA 2CJUH 1KCLA 3SDAB 4L9LB 4PJAE 1HCYA 3N1PC 4PBVC 2XA8H 5A16B 3WUWA 1U8PA 4F7EA 1KBPA 4N1EA 1PY0A 4GKSA 1TPXC 1H15B 5GIRB 4OJDH 2WGXA 2D31A 4POZD 3HPLA 3Q44A 1N9PA 1YDPA 4N5ED 1QLEH 4EUPA 1NOFA 1BM3H 3FU9A 2UXFA 2I60L 4EIGB 3HMXL 3CSTA 4X98A 1YZZA 4NM4L 3WNPA 1WCQA 2DKMA 3KWWA 2YLHA 3VYPA 4FFYL 5DHVA 4JM2B 3DOHA 4JY6B 5I1JL 4MNQD 5L0QC 4EKXA 5GRJH 2IALA 4FZEH 4S0TD 5J3HC 2LFEA 5T1DH 4M7LT 5ICZB 3BHBB 4JFQA 4BJLA 2N56A 3HG5A 1RUPH 1WICA 5BV7L 3SHSA 1BF5A 3MTXA 5HDBF 5F7KC 1T6VN 3EFOB 4U4BA 5MI0C 2VDOH 5BRZD 1ZLSH 3BUDA 3SBQA 1EX0A 5C0RH 1AIZA 4NQDB 3MLPA 5DWUH 2ZWZA 1I8LA 5IHHA 1ERNA 1TTCA 1V7NH 3KVDD 1FRGL 2ZXWB 1FBIL 3GZKA 1NUDA 4FABL 5C70A 3CZFB 3KVQA 4NKIL 3MRGB 3H9SE 5A6LA 2GVYA 4ETQA 1UJTA 1JHKL 4MYPA 5I1DA 5EU6B 4ZAKC 1A4KB 2X4NA 3G6JB 1VLXA 3QUYC 3AQZA 1PG7H 4U6YA 4XODA 2FHBA 3K3QA 4JR9L 3ZW3A 4FMKA 1V10A 4PJGA 1DHKA 3L95B 3O6KL 3TO4B 1DJYA 3BMVA 4GQQA 1HEZA 2BVQB 3ML9A 5BMFL 4TXVB 3UJTH 5B3NA 4OZHB 1HHIB 1NM9A 1AKPA 4UWQB 4N8VA 3LV3A 5C07E 1F18A 4GW4A 4NO2A 2O6CA 3ARBB 1G9NH 1JWMB 3PQYA 4PV1C 1YY9D 3U36A 4NNYB 5F7EH 2H6UA 4JFZH 4JRYB 1SDAB 4G70B 4JZJB 2IOIA 3KJ6L 1CE1L 3OKYA 3REVA 2XIIA 4AQ8A 1S9XB 3DDGA 5LBSH 4J8QA 5B38G 3GHBL 1B4RA 2HJFA 5GRXG 2L7JA 2YKKA 4POZC 3TCTA 2WN2A 4XPGL 1TTRA 3WBDA 1J11A 1CR9H 4TLSA 3FXIC 3FFOA 4AI7A 4UQBA 5IVXA 3F62A 4RGOL 2BP3A 2DJSA 3RGVD 4FEMA 2JKLA 3GBNL 3IU3A 3SPGA 3ZR5A 4GG8A 4JFXA 3JWOL 2VAJA 4TVPE 1EO5A 1Q94A 2CCVA 2OXGA 3VXUD 2WUBL 3BSGA 1T4WA 5DK2B 5D5ME 4X8JA 2KLTA 5E6IA 3LH2L 4KI1A 5AL8A 8CGTA 2Z7WA 4HIJA 4CJ0A 1OK8A 1UT1A 4PJHE 2ITEA 3WMQA 2FR4A 3CH1B 4DK5A 2GJ6A 2BSCA 2WQWA 5AB0A 2VRQA 1JF5A 5KBMA 1IC0A 5A6IA 4MRQA 1VAHA 2HFFB 4ZS7L 2V7NB 2LE9A 3CHXA 2V3FA 3CE1A 4Q6IB 1ZVSA 1ETZA 1W0VA 3I3WA 2GITA 1F11B 5B3JF 5H94B 1PQZB 3MNZA 2VM4A 4BELD 5CF3A 1EAPA 1B0RB 1E5AA 3AFLA 1TJHH 2GSGA 3LEXA 3VXOA 5IB4B 1JG9A 1HHKB 3EADA 3OR6A 1ZLWH 2F53A 3S36H 1N6VA 2L04A 3ZE2B 1G7MA 2R5XA 4R5XA 1GKEA 4OQ1A 3EOAB 3D18A 3MYZA 4J2QA 4NGHL 4QHMB 3RTQD 5KSUB 4U1GC 1P6AB 1OWWA 5HJ3B 2X1XR 3HCVA 1I1YA 2Y1VA 1RZQA 2A1WL 2KT6A 2WNKA 3VQLA 4XI5D 3NAAH 1G4RA 1K2DB 3MLSL 4ACTA 4LPXA 3FB7A 2DL9A 1VESA 3ZYIA 3G6AA 2V3DA 4KI5E 4JFDA 1ADQL 1RVFH 2GPZA 5I71B 2WD0A 3LH9A 1A66A 3S3SA 1YY9C 2OZ4A 1YTFA 3A6CH 4LEOA 1EDHA 3RURA 3UAJA 2ZXAA 1YEJL 2YK1L 5T1MB 2NNRA 2R1XA 2V5MA 3QZWG 3G04B 1LWJA 2P45B 1IAKB 4EF3A 5AD0A 3KPSE 2IH1A 4GW1B 3C5ZC 3MRFB 4WW1B 1SHSA 1H6EA 2VR7A 2X09A 1E9PB 2HWZH 4LLMB 1PBYA 4NHCL 1XH1A 3VXMB 2V8MA 3L9BA 3BUTA 4UTBA 2VDMH 1PD6A 3RDTC 1ACCA 3L2MA 1U8NA 4NOFA 2PF6A 4MASA 3U0WH 3N6YA 1T2QH 3SOBL 1KBKA 2H26B 3OGCA 1J9TA 1SUJA 3V5HB 4NRXA 5I28A 1MW1A 5KSVB 5I8EB 4GKNB 1JNHB 2JI2A 1NL0L 3GPEA 3U30B 5T5FH 5D7LB 2VH5L 4JCMA 1SHWA 4CL7A 4DAGH 5IGXH 4LRNL 3UFIA 2XVLA 4XCYA 1XGYL 1CD1B 4L2YA 1IFGA 3MNVB 1N8OE 5HGHB 1QASA 3D06A 4B3EA 1WZLA 2D0BA 1FNHA 1TNMA 5I1HL 4TUOB 3CVHL 2DMGA 4ODSL 2UYLB 2JKRM 4K55A 2BRRL 4NC2B 1ILSA 4FQJH 3EUUA 1IEBB 4B5EA 5C9JB 1OAXL 2WLIA 4HKBB 2WLKA 2G0LA 1KY7A 1MAML 3ZTCC 1TFPA 4O4YH 1KCBA 2EYSB 4A2MA 1TZAA 1ZXKA 5JW4M 1LO3H 3TS8A 1IRAY 3FO9B 2PPCA 3UTTE 3D09A 3AG4B 1J05A 1L0PA 3D2UB 3QDHA 5DEFA 4NNXB 3RTQC 5BXFA 1HH6A 1QATA 3NCJH 1IC1A 1C5BH 4MCZA 2YN3A 1AE6H 2FLRT 4PV8A 4XI5C 2ZSWB 4XO8A 4NKOB 3S5ZA 1URIA 3IFOB 3MRPB 3RY5A 1V3MA 1R5VB 2X2YA 4G9FA 3NGBC 2VLJE 1U3HD 2EDBA 2X9ZA 3IJ7A 3GXUB 4JVUA 4PJBE 1D5MA 1FVCA 4M5ZH 1XF5A 1JZ7A 4HC1L 3S4SA 4PY7B 2VLRD 3U2JA 1OT4A 2W9DH 4N0UA 4DZ8B 4BGLA 4I87A 4EI5A 3WLBB 3CFBB 3UCQA 3BWAA 4UDUB 2FBRA 4AL8C 2J3SA 4BQ9A 1Q4NX 3GMNA 2WXNA 4GO9A 1VSCA 4QO1B 1JTPA 4LE8A 4FG4A 3PPSA 2EDMA 3MLVL 1XIWB 2VYRE 1KC5H 3DGGA 5EPMA 1KB9K 3QRGL 4DO4A 5CD5C 5FK9A 1ZV5A 5JHLA 1MCJA 4F15C 2WNXA 1ZTMA 3HI1B 2UY7A 4MJJA 3C60A 4E5XG 4ABQA 4YUEL 5L2KD 3ARWA 4KDTA 1YPZA 4B0MB 4QR7A 2CMRH 3FONA 3P0VL 3UGUA 3W2DH 4EOWH 4ZMAT 1OPGH 1E50A 4MJ2A 2XWDA 3MCLL 3ZDYB 2XXFA 2GABA 3MJ8B 4M43L 1DE4B 5FCSH 1UC6A 3GS0A 4OJFL 4UINH 1NICA 1QZNA 4D7BA 1GGIL 2W0FA 4E9XA 3G5WA 3GSUA 1K85A 3TO2A 3KPOB 2BNQA 2V5RA 2UX7A 3LSOB 2Q86A 2QQNH 3EJPA 3VW3L 4OT1L 4HDIA 2JKTM 1PEWA 2NOYA 4LKCB 1GS6X 5T3ZE 3VDCA 4PJXA 3WJLC 3PXHA 5E9NA 4C4UA 4J3XA 1AXSA 3IDIA 4R6UA 2AQ1A 1UWXK 3D85B 1JIBA 4HEMA 5K1VA 1A65A 3SBWA 4L5FL 3V6OE 1WZKA 2QQKL 1U95B 2BW4A 4RIRA 1GW6A 3FT4A 4X4KA 5C2UB 3NVQA 4M8RA 3GINA 5DFWH 1I7RA 5SX4H 2ZKMX 3E8UH 1SDDB 2HAZA 3DI3B 3PL6D 2XRAH 1AQ8A 1GOGA 1JJUA 1KCKA 2MMXA 3HC4H 5F1IA 3FOLB 1U3HC 3FQRA 4HV8A 4HJJH 1FO0L 2E47A 2YPLB 3C87A 4RSVA 3OJ2C 4M3HA 1QN6A 2OXHB 5DD3H 2UXVA 1DQVA 1DQKA 1FYTD 1HZHH 3B2VH 3W82A 2AQ2A 3NIGF 4DKTA 1JNLH 2AXFB 4MA8H 3QQDA 4YGVA 3D08A 3KDMA 5GGQH 3GEWB 4XN7A 4EJ1C 1IQDA 3IETA 4D8OA 3SPVB 3KGSA 4KO6A 4OBSA 4LSTL 5ACZA 2ZKWA 3N04A 2H3NB 5HDRA 4R5TA 1MHEB 1ZE3C 1WUZA 4X2UA 4B9PA 2Q3XA 2YPKB 5CBEB 4V1DA 3BUYA 4X5RA 2BM3A 4IBUA 2JKWA 2CG9X 3LIZH 2J43A 2VT0A 4FNSA 4LDLB 2JKNA 4OQTL 4DGYH 3K6SB 2DBLH 3AMLA 5DR5L 3O4LB 4R96A 2V2TA 3ZDWA 2APBA 3LQMA 3BVNA 4QHLB 4WQOA 2EXYD 3WKML 4UOW0 1P5VB 1S7VB 4XAKE 3CMGA 4G6FD 1S7SB 5I9QC 3HNTH 3V9CA 2C4FU 2E7MA 1IUZA 3EFDL 1L9PA 2P5EB 4Z7WB 3MGOA 4NFBA 4G80A 2CKBA 4XXDB 3PP3K 4UZSA 2AV7B 3U7WL 3VYOA 1H19A 1VPOH 5B21A 1G5AA 1WBZB 2VDLH 5BQ7A 5ESQB 3OKKA 3AS0A 4LOUC 1VADA 2RH0A 4IRZL 1TTBA 1UWEL 5FGBA 5LLIC 2Y36H 2VO5A 3QJVB 3TBTA 4IHOB 1H6FA 4F37F 2C9VA 3GB7B 1IGIL 4B41A 1UD6A 2OTPA 3EYUL 4TRPH 1MSPA 4YDLB 3BIKA 1JN6B 4CSSA 3T3MB 1HSBA 4WEEA 3K2IA 4X5PA 3RWCA 2DWDA 1ZT4B 4L1TA 1NGWB 3IJEA 4Y4HD 3FTYA 3PWPE 2PCFA 3VTMA 2OX5B 1UVQB 1M7IA 2XG5B 1WWAX 1C16A 4OLWH 3L8QA 4ZO9A 4Q9CA 5E8OA 2OLDA 3C6LB 2IQ9H 2XTJD 3PL6C 5JPMA 4JKPL 2OMYA 3EBHA 2WCSA 1OE1A 5E1HB 2MJ7A 4E9WA 2HN7A 4V33A 1DLFL 1JTOA 1QO3B 2CRZA 3KMDA 1XGUB 5K9OA 1X5XA 3QUZC 4K23H 3QWRD 5DK0A 4KTGA 4KKLD 5EU6E 3CZKA 3G6JE 1WZ1L 4R0LA 2WZPD 4Q11A 1FDLL 4Z78B 3QORC 3QJXA 4DGVH 2YKLL 4UAHA 1BQHB 2HZHA 3ZL4L 2FHFA 4I7ZC 4IKJA 4HJGB 4F7TA 1LE5B 1R3LA 2R69H 1SJHB 3MKGA 1H3TA 1J10A 2OPCA 3BYYA 3D3VB 4OZHE 1AGFA 4OZFG 1FFPA 3HNSL 4DF9A 4NS0A 3T4NA 2Z31A 4JQIH 4QGYA 3QUYB 2N4IA 1U93A 2ICWA 3V95A 3L9YA 2WZ6A 4OR1A 2DI9A 1BZ7B 1P4UA 4W9GC 4JDEA 1I8IB 5IG7A 5E2WL 2IFFH 4JRYE 1R5WA 4NSKA 5EULV 1QHOA 1QSFA 4YXLH 1I7UB 4C56D 5BVJA 3TA3A 3DVNA 3RLSA 2R2BB 4L3EB 1E28A 3BZEA 1ODUA 3OMZA 4N9GA 2DDQL 2F54A 4PJDF 2ZIDA 3X13B 1QLRB 2C3HA 4G1MB 1SVBA 1U41A 3KYAA 1F6AB 3LQAH 3IFLH 4PRPE 4LAJH 2Z8WC 4QHNA 3MLUH 5I6NA 3X11A 1TXKA 4ADGA 3JVFC 1ZV2A 4KQ4L 4XC1L 4N2LA 3ESVF 5L88H 4MSWA 3HZVA 3DX9B 1HI6A 3EHBC 1U91B 4NN5B 5AALA 5ABDE 1JCVA 5I0VA 5ETUB 3GLAA 4NUJA 1NBYB 1Q9UA 1LQSR 1GZQA 1S4IA 4I48A 4D3CL 1E3XA 2KKQA 1ZTXE 4OFKA 4Y4HC 4IBVA 1MHPH 1WAAE 2BINA 2ED7A 1U33A 3E3QC 4MNQB 3WTXA 2W65B 2BXYA 2DQDH 3QDJD 2K8MA 2BOBB 2NW3A 2CJTA 2L4OA 1XT5A 2F5AL 2XTJC 1XAUA 3RWEB 3H56A 4ZNCD 4KHTL 1JZGA 4KPHH 3QWOA 1T89A 2CUAA 4FCAA 4P5SA 5BRZB 4HKJB 1XBRA 1PY4A 3AY2A 3BAWA 2RD0A 4KJWD 5HHVL 5HGBA 1SYSA 2EJ1A 3G7TA 4IDLA 1OARL 4AE1A 4AYFB 2Q7AA 4XPBL 5DO8A 3VM5A 2XQ0A 4CVZA 5H2BA 2L3BA 2I60H 3SGJC 3HMXH 5J12C 4MXVF 1Z0MA 5HGDA 3QS3A 2PR4L 4RMTA 4FFYH 2OTUA 4FLRA 4D0CB 5I1JH 4Y0GA 5DQJA 1Q8MA 3HFML 5K1NA 5CU5A 1KZYA 2W0PA 3HHSB 5KBNC 3BVVA 3T4AA 2XVKA 5BV7H 1JL8A 4LSQL 4M3JA 4EEEA 2WXJA 2Y2YA 3SIKA 1C5DA 1OK0A 5EBLB 3FUNA 1UXMA 4K7PL 4GBXA 4UQAA 3QCUL 3VXME 4UUJA 4CGTA 3C5SA 4LFHG 1M3HA 4LKXA 5AAWC 1FRGH 4L8BB 4CVXB 1FBIH 2XA3A 4S2SB 4FABH 1NGZB 4NKIH 3FB5B 5HY9A 1KDIA 3ARRA 2VQUA 5LGHL 3ZRSA 1JHKH 5D6DC 4MNGE 3ABZA 4LSRL 3VXRA 1TYJA 2IAMD 5D7LE 3ZL1A 5HYEA 1RP8A 4NZTH 1QA9B 5J1AA 5D96C 5FW7A 1D9KC 3G6DL 2FIRT 1BX2A 3BKML 1OW0A 3FTGB 4JR9H 1XSKA 3RGVB 3O6KH 5SWQA 4AC2A 2R23B 4YL9A 1HDMB 3QJOA 2CA3A 3VDBA 5SWZA 5BMFH 3L3GB 1J0JA 3VXUB 4JHUA 4P8QA 4WSJA 2VTFA 2NW2B 4P9HL 4JFPA 1TSHA 2B8OT 4X8XA 1U8LB 2QMJA 3QI9C 3OSTA 5GGUA 4X7SL 1R4XA 2J6EL 1TO5A 4CW1A 4G6KL 3E7JA 3PJSA 3D4GA 3KJ6H 1CE1H 1C7SA 5KUKA 1QEWB 3RL2A 3I74A 3QNYB 3WFCL 1ZTXL 4KJWC 4R26L 2F5BL 4PQXA 3GHBH 4U6XA 4KWUA 3LIUA 4F9PC 5E94B 4ZUTB 4XPGH 5I1EL 2R4SL 4D9RE 2VJ8A 3IJHA 3NJLA 5IM7B 1CLYL 4RGOH 4ZS6D 1ZY9A 2HYMA 3GBNH 3CSPA 2OYPA 4EO5A 4DFIA 1U8MA 1K8DB 3JWOH 4FKKA 4E9VA 1I7TA 3RTQB 5E5RB 3S8WA 4YFLI 3ZN6A 2R8SH 2EYTA 1QFHA 2WUBH 1QD0A 3LH2H 1MNUH 4KZCA 2PP7A 4HX1B 3BN3B 4PN6A 4W6WB 4GIAA 3F64A 2NTFB 3NGBB 5B1CA 1ITBB 3BZDA 3H4FA 4WGVB 4H5SB 4UU9A 4AGOA 2FEEL 4RAHA 2QVKA 4KZ0A 2ZTBA 1CGSL 1QRNA 4IGBA 1WS7A 1TLKA 2FJFA 3DX7B 5CFHA 1U8QB 4P3DB 2CDEB 2P80A 3RILA 4J7RA 5DEJA 5AVXB 1W6WA 5CP7A 3Q9QA 3FS9A 2J20A 2PWHA 4I0PD 4FQQB 5E8NB 2VERN 4J1UB 4ZMXA 4XCFL 2YEQA 4B0MM 5E51A 4O02H 4N2NA 3ZE1B 4KKPA 4H1LH 1IBDA 5ANMA 4M62L 2A1WH 2E76C 4F15B 4MD5A 3L5WB 2GJPA 3GFUA 2O5XL 1AZRA 3E6HB 3ZDYE 4LHQB 3MLSH 2WCGA 4IU3A 1MNNA 3TWYA 3FT1A 2D0HA 5IFAL 2X1WL 1MFNA 2RIKA 1F41A 4WO4C 1A02N 3C8HA 1ADQH 4M3KB 1NFDF 2XIBA 2ZG1A 1VZHA 3CFCL 3EH5B 4LDEB 4HUWB 1ORSB 4NQXA 4MQSB 4WFHD 1IEAA 5B22A 2X2IA 3SE4A 3KBHE 3A0OA 1DIZA 1OSYA 1YEJH 2YK1H 3KGUA 3SE6A 2UZYA 3FQXB 2JQAA 5MEQA 3QISA 2VMCA 3GMPA 3QUXC 4GRWB 2RFXA 1QKZL 5D4QA 4M6OL 4QRSB 5GSVA 4L0YA 1N7ML 5C0EB 4NHCH 4H0GA 1D5IL 1XF4A 5DVMA 3UZVB 1EDYA 2DQUL 3PV7A 5AAPA 4DCQA 1LL1A 3SGKA 4AQZA 1TJXA 3EBAA 4QF1A 3BUIA 4NENA 1TZHB 4FOMA 2CLVA 4HHAB 3SOBH 2QFRA 3WXWL 4HW6A 4HZ1A 4K94C 4UDTB 4X0KB 1NL0H 4KX8A 1KPVB 1U92B 2E56A 2VH5H 4QCIB 1FH2A 1WHPA 3NRQA 3T6ZA 4LRNH 1KLUB 1AY1L 5LCVA 1EAJA 1XGYH 3WJMB 3EJSA 1X7SA 3TN0A 3AXLB 3SZKC 4QJ4B 5EA0L 1U3HB 5I1HH 2Q87A 3WKYA 3CVHH 4ODSH 5E08L 1W0WB 2BRRH 2X41A 3EH1A 2WYTA 2VLRB 1W9XA 1OAXH 4K71B 3W37A 3VFMB 5I16B 2V17L 1C12B 1EEYB 2CO6B 4LCVA 1OCRB 2VIRA 3WNJA 3K6DA 3NFSL 2YH5A 2W07B 4YLCA 1OGAA 5HGAA 5EU7C 3O4LE 1KCWA 1JGDA 2OR9L 4XAWL 1RP9A 3MTRA 2FLMA 4Y2OA 3FCTB 4Y9FA 3OWEA 3K71B 1LEGA 3CHOA 5J1TC 3Q2LA 1G9MC 2Z0FA 2VISB 5CCKL 4Z7WE 2WM0A 1BDYA 4OJCA 2FJHA 5L2KB 4PGJA 5DRWB 1REIA 3VWKA 1NMBL 1DBML 5J5EA 1FN4B 4AQAB 2XKNB 1Y0LB 3DXAD 3EYVB 3VRIA 2WCPA 4HC1H 3GUTB 1MDAA 1DVYA 1JWSB 1LNUA 4YE4L 3PJLA 3QJHA 4XMTA 1J5DA 2WZ0A 4EMZA 1XSIA 4NHUA 3NA5A 3IU4L 3SZ6A 2NX5E 5HI4C 3SOTA 2HPOA 3F7KA 4X7TB 4FNPA 5JIQA 1JZHA 2BY0A 1C08B 3MLVH 3WD5L 4M93C 3QRGH 3CTTA 1MCPH 2LAGB 3T0VA 4YSQA 4F92B 1UWXH 4QHKI 5KWYC 4TUKL 4F27A 1N59A 1SJXA 3WV0A 1AMYA 1R1CA 3FHEA 4F9PA 4GIOA 4L1BA 2AVFA 5HYSA 2YBRB 3NJHA 5FYJD 1E67A 3FF7A 4ZD3H 4YUEH 3BJ91 2HFGL 3IDYC 5TDNA 4BYHA 3MRIB 5KYWA 5IMMA 2H5UA 3LKQA 2VR6A 3L3IA 3MRHB 4DQOL 1DZ0A 3E80A 3ZHFA 3P0VH 1KGXA 2MHAA 2PYEA 2HMID 2VDKB 3B2MA 3GSXB 3PL6B 3E2HB 3MCLH 4XR8C 3S96A 4FYTA 1FWXA 1OCWL 3PDGA 1LYQA 4M43H 1HFUA 2IDFA 2YPVL 2ZWYA 4OJFH 3CDFA 3SKNB 3S35H 5AB9A 1XMEB 2EKJA 1GGIH 1FYTB 4ENZA 3OQ3B 3DBXB 3JWNH 2WIMA 3QO0B 5F1KC 4BKLB 2ADYA 3VW3H 2LGNA 4OT1H 5AW8B 1BWMA 5D6CB 4IL8A 1E3ZA 3VFOB 2DS4A 3CHSA 4PG2A 4YL4A 1RJLB 3FAXA 2EEAA 4J3OG 4O9HL 4KROD 2B77A 3HBZA 1KXTA 4L5FH 3MQIA 4BM7A 3MO1B 4AYID 2NY1D 1MHCB 2FECL 2QQKH 2BZCA 3WL9A 1NFKA 4HQQL 3MV8A 5DZ9A 4ZMTA 1HSAB 2XV6B 1D2PA 2JKJA 2LOEA 1RZ8A 4XCCL 3AZUA 2Q7YB 4PMEA 2EIDA 1ID5I 3RPJA 1FO0H 1JCKA 2YEZB 3AT8A 4HUUA 4X6DB 4G6FB 3RZCA 4HPYL 1QLFA 2Y69B 3BEWA 2VXTL 3FN9A 1URLA 3PP3H 1UXSA 2ROYA 1G7IA 5IFJA 1KCVL 5ISZA 2W9EL 3P4MB 2C9PA 3QJFA 3VFVB 5CILL 4RQQA 5HDWA 1JE6A 1XWVA 2ATKA 3F12A 3FO2B 5DQ9B 5TDPB 4LSTH 1ORQB 3W3BA 2C9RA 3GGWB 3N42B 5ID0B 4MNQE 3AABA 3UYRL 4PRAB 1CT8B 3TBVB 1FVDA 3GXDA 2BNRD 4DGIL 5FA3B 3CPLA 3OR7A 4OQTH 5DI8A 4GW5A 3PGFL 4M9PA 5CIPH 4K4KA 3PXLA 4K8RD 4Y4HB 4XZUB 1ANUA 1XXFC 3T65A 3WKMH 5BRZE 1A1MA 3KHQA 2XQYK 2OSLB 2EP6A 3U0PA 3EFDH 2XTJB 3VFSB 5F89A 5GHWL 4FJZA 2VB5A 3U7WH 2DWEA 5MERB 3NMEA 3QDME 4BKSC 2WWMD 2AJVL 1GGUA 2E7DA 4IRZH 1UWEH 3BXNB 2F0CA 3VD4A 5KN5B 3P77B 1WCBA 4C4KT 2OOXA 4W9KC 1UB5A 1IGIH 4PS4L 4R83A 1UA7A 2B3RA 3EYUH 4JHBA 3VI3F 3KL0A 5JO5B 4J6RL 1QW8A 2J1XA 3VXNA 5JOPD 4NAMA 5KBLA 3HUJA 3DX8B 5J12B 3SN6N 4PG9B 3B4NA 4XN2A 3ZGHA 1ODAA 5EN3A 1N5AA 2NY1C 4YR6A 4GRLA 5INDB 1PZCA 4CNIA 5ABZA 2L8AA 1WH0A 4B95C 1E9OA 1WFJA 3NJVA 1VFAB 4JFSA 1NZRA 1KNOA 1CZ8L 3BVTA 3RGHA 1QSED 4RSYA 1BF2A 3RWFB 2QZ5A 1SEBA 5E1GA 4JKPH 4BK8A 1TGHA 1I8LC 1CFSB 4C56B 1DLFH 2KQMA 2AJUL 3U9PL 4U3SB 3ILQC 2XN2A 4RDQG 1T5WB 5L7XL 2P46B 1CL7L 4OY9A 3N43F 4PP2A 3PWVB 3HR5B 3EJJX 3IVKA 4C58B 2YD6A 4QRAA 1OTSC 1WZ1H 3F5WB 1FDLH 4JPVL 1BQHG 4UMGA 4EJZA 2YKLH 2K78A 3ZL4H 2CJ3A 3BUPA 5GZND 2AEWA 2P24B 3QULB 3TNMB 1UZ6E 2ZWKA 5T1KB 4AW4A 2ZUQB 3T0WA 4BSWB 4M1CC 3HNSH 3NCYP 1KLGB 4XP5L 1SMOA 1X9UA 4JS7A 3H53A 5D96B 1O7DE 1PCXA 1UQSB 2RACA 2Z4QA 1VERA 2H7WA 2R27A 2Z0BA 4Q74A 3UPRB 1FIGL 2VJ0A 4K8RC 5E2WH 3RDJA 5TQ2L 1KIQB 5J11B 1FFRA 5I6XC 1H3PL 1UD3A 5DLLA 2XJLA 3VH8G 1S5HA 2GFBB 1TZ8A 4FCHA 3QDJB 2JELL 1INQB 1P2CA 1U8KB 5CEZD 1RK7A 5IHZB 2DDQH 3L3DB 5EBMA 3L54A 4BZ1L 1YN7B 2NY5H 2XWBA 1S7TB 4OF0A 2WWMC 3L7EA 4YZFE 2A9NL 3UPCA 2VC2B 2J12B 3JZ7A 1VGKA 4M4RA 3ASMA 2D7NA 4P2RE 1B9ZA 3A6OA 2UUDK 4KQ4H 1VRSA 4N2DA 2BSEA 1E5UI 2VJXA 1ZCRA 4XC1H 1HHGA 1N3CA 4N24A 2PCPB 3KD4A 1OAZL 1O9ZA 5JORB 2ZOLA 5E6IC 3SDXB 2IXQA 4O00A 2AJZA 2D0GA 4CBPA 5HI3D 4D0DB 4D3CH 5D2LE 1BFVL 5FEBA 3ULUE 4FD0A 4TNWK 2BMKB 4DVRL 1BFSA 2BIQA 5F0JB 1NAML 1NCOA 4UM8A 3NSFA 1CFMA 2F5AH 4AENA 1WFNA 1U2CA 5DMGC 1PG7W 4KHTH 3DMMA 3DX6B 2EUXA 2UZIH 4JMXA 3E9UA 5KBDA 1E4HA 1MVYA 3KH4A 4QKXB 2GK2A 5HHVH 1JTTA 2VNCA 1ZS8B 4YBQC 3ZE1E 5GRYA 5HHQA 1Z3RA 1OARH 3U46B 1MRCH 3ES6B 4KKRA 4XPBH 3MU3A 3PFUA 1KN4L 2OJEB 3WIAA 2R2EB 1TKWA 1JFIC 2P8LA 1AQDA 3TBYA 1CWVA 1U42A 2VR9A 2WKGA 2EYRA 1U2HA 2PR4H 4XNMB 4YSDA 3OTTA 1BIIA 1NFDA 2IAMB 2NYYC 2OMNA 5CZVL 3CU1A 5KVDE 5FYKE 1TLMA 3Q8BA 3HFMH 3JV4A 2IGFL 3CVIL 4KJQD 2E86A 1MVUB 3OX8B 3WIHL 3UAJC 1BMGA 3HB3D 1T0PB 4GRWE 1SFHA 3FF8A 2GKIA 4P05A 1HQ4B 2LLNA 4N68A 1WBYB 2VLKD 2IMNA 3WNLA 4Z6AT 1BBJB 3DIDA 4K7PH 4ALAL 2UWEA 3QCUH 3K81A 4I2XB 4XNZC 3Q1EA 5KYXA 3LXUX 3NH7L 2ADGA 3MUJA 3R0MA 4YBLC 4MJ6A 5IB5A 3B6SA 5DZOA 2BWQA 2FZ3B 5LGHH 3C60D 2FH6A 4HIIB 1YMHB 5AVZB 4LSRH 5B7FA 1A2YB 2MSPA 3X12A 2HX9A 4AY0A 2ENYA 5F7YC 2NNAA 2P3YA 4PJEB 1T7VA 3BKMH 3G6DH 3PGCB 1UT7A 3EJYD 4NN7C 3Q7JA 4JZOB 5DEZA 2FD6L 1JD9A 2FEDD 1EO7A 2WXLA 3IXTA 3RWJB 2WVSA 3GWJA 1CD0A 4XNXL 1W8EA 2V2WA 1BVNT 2VMDA 5TJWK 1A3QA 2LVEA 1SZNA 1FI8C 1YG9A 4FNTA 2I25N 4KFMA 4X7SH 4HUXA 2J6EH 2KZWA 3GRGA 3IBOA 3KJ4B 4NIYE 2UVFA 4WTXA 4G6KH 1FSKC 4HS3A 4YHNA 1FGVL 4QGTA 1K4DB 3N06B 3ATFA 4PWJA 3ULUL 4LHUA 1ZT1B 1ZTXH 5F1NA 4R26H 1VGEL 2F5BH 3WFCH 1AACA 5L2JA 1ACZA 1BJMA 4PHZA 4H25B 2XWJB 1EEZB 1OT2A 3ILPB 5INCB 4IRJA 2R4SH 3AM8A 4O2CB 1C7TA 4H0LC 4I0PB 1CLYH 1ZS2A 4AT6B 5L2KE 1NOAA 5I2IA 4MDJA 5HDQL 3EDKA 3LMJL 3OXRA 4LBEB 4M8VA 5J9PA 4FFYA 1BBDL 1VKXB 5DJ2A 4DUVA 1MP9A 2X89D 4CN6A 3O3DA 4EN2A 5EZLA 1PLGH 1THAA 4JE4B 5KJRL 2OS7A 1JD7A 3H9HB 5BS0A 4KJQC 3LHAA 2X4OB 2ZSVB 4NZFA 3Q8AA 3OM3B 5F88A 5AW7B 1CB4A 3KLQA 5ITFA 2DQCH 2V9RA 1RL1A 5HYJA 3AMKA 1TJMA 3FU5A 4ATWA 2NUPB 5GGSB 2XXMB 1QWNA 3ESUF 3T2QA 1CGSH 1IM9D 3H7LA 4BFBD 4NQVA 1D7BA 1J5CA 2PW2A 5KVDL 1KGUA 5FYKL 1P7KB 1R17A 3RI5K 4ANUA 5KTEL 4IBZA 5EDSA 2FJSA 3T2OA 4KKNA 3C60C 1ZD6A 4JO1L 3IAGC 1EVTC 4KDTC 4XNDA 2E27H 5DQDL 3CSYB 4M62H 4C83B 5SWSE 1SMDA 3UTQB 3EJYC 3S48A 3HAEH 2XWXA 4F2MB 2O5XH 3FFDB 1UT2A 4Z77A 2ZNWA 4Z7NE 4KRLB 2D9QB 1D3CA 5IEHA 5IFAH 4Y8AA 4K5OA 2Y8QA 4OFIA 3UBHA 1TITA 1E4XL 4ELKB 2AMGA 5D1QA 2WBKA 1FYTE 3CFCH 2CNYA 2QPFA 5LUMA 4FG6C 1FFOB 3E6FB 3GMRA 3SGEH 5D7EA 4B97A 3OMAB 4Y19A 5KVFE 1KCRL 3OZLA 4R7DA 4DN3L 1S7RA 1S8DA 2DKUA 2GJZA 2H6OA 4NO0A 1D5BA 1QKZH 2Y72A 2ZONA 4M6OH 2JI1A 4JFYB 1N7MH 1AFVL 1D5IH 4OF7A 3LKPA 1W72B 1JGUL 3GSVB 3LRHA 4HPOL 2DQUH 5E4AA 2GQHA 3N44F 2Y4SA 2RJMA 4YLQT 5BRQA 1GYAA 3T1FB 3MRMA 4RWHA 2N01B 3WXWH 1RJYA 2WTRB 3D25B 4CRPA 1D3UA 3BLKA 4X6DE 2V9QA 4PJAA 4ZTOH 1BVLB 1O75A 3OF6A 5IMOB 1AY1H 5EO0B 5DEGA 3UJIL 3ZQ9A 3VE0A 4KKAC 5I8CA 5IBLD 5EA0H 1ESOA 2FATL 3DSFL 3RQ3A 2RTTA 5G2NA 4PJIF 4HAGA 5E08H 3DXAB 3B9KA 5EWIL 2HX8A 2XN1A 3HTLX 2FX7L 3S3DB 3DRTA 2HFEB 1JRHL 2V17H 1AAJA 1I3GL 4Z7VB 3D12B 1BQSA 1ZHNB 1WD8A 2EVHA 3HW7A 1GMIA 2WY3B 3NFSH 1NBVL 4YDNA 1HESA 2G2RB 2BIPA 1BXXA 4JL2A 1M1XA 2OR9H 3MBXL 3I6SA 2H47C 4F7CB 5KG9A 4F8OA 4ES8A 4O02A 2Y6SD 1MZZA 2JIXA 5DJCB 2P9RA 4OCRL 3RKDC 5FIEA 5CCKH 1T66D 3ZHDA 1W8OA 3F6LA 1KSRA 4PYHA 4Y7MA 4ENEC 1NUGA 2F54D 4N0FA 1CI5A 3NIFB 1NMBH 1DBMH 4ZW5A 3U4KA 2ZUWA 4ZMYA 4MA3A 3R8BB 2CSPA 5I6KA 3H9SA 1AQHA 1ADQA 2GHWB 5FGBC 1JPFA 1MLBB 4I77L 4NBZB 1TU2A 2EVIA 4X5LA 3ZKQD 4GKSB 3D50A 4YE4H 5AKVA 4ODHL 5C0NC 5I8KL 4NDMB 5AKTA 2D31B 2E6JA 4Q6KA 1A6AA 4WX8A 1YDPB 4XZ4A 5EU5A 4LXFA 3IU4H 4EALA 4JDTL 4F2FA 1YECL 4X98B 3RWHB 4E9TA 3U4EA 2WO3B 2F08A 3WD5H 4F7MB 3KWWB 1F3DJ 2L7UA 4ELMB 2YGNA 3CQPA 1WQAA 3TFKC 3RL1A 4A67A 5C07A 2BCMA 1IFRA 2BVUA 2YR3A 4TUKH 4Z3EA 2VABB 1P0SE 2CPCA 4UBDD 3FPYA 1KJ3L 4KROB 1F97A 3L7FA 3T3PB 4B53A 2H0JA 4FI7A 2HFGH 1P53A 2NY1B 3HG0A 5FFLA 1CC3A 4RWYL 2EECA 4DQOH 2C9SA 2XZAL 4LB8A 2AQRA 3IT8D 4XMWA 2WYHA 1YN6B 1HNYA 4GO8A 3MBWB 1XL4A 4G8IA 1INDL 5IBLC 2FGTA 2VERA 4MXQC 2JXMB 4NBXB 2AVGA 4JPIA 4ZSOA 1OCWH 4R0LC 4OCYL 3OKEA 1EA9C 2O5NA 2YPVH 1FP5A 2HTLD 1CXEA 5GQBA 2WLNA 1BW8A 4X80L 4ETQB 2X70A 1I85A 3F3HA 2UZXA 3WY4A 4GAJL 1AIFA 4OSUL 3QYNA 2Z31C 4NZRL 5D5MA 1JUFB 2X4NB 2KMWA 3Q6FB 4OAWA 1LLAA 3CC1A 1DR9A 4PWFA 4PJHA 4L18A 1WWBX 4HLEA 3T4YB 4W9DC 3GMQA 4YSRA 2JB5L 4UT6A 5BPPA 1EFXA 4Z7OB 1HEZB 5C6TL 2NZIA 3ZMRA 4H2CA 4HQQH 4MMYA 3QDJE 5KYUA 2BNRB 2GG1A 1HYRC 2XV3A 4C7PA 3O6FD 4G8EB 2JV6A 2NXZD 2ITCB 3LV3B 3OXSB 5I19L 2VRKA 1ID2A 2X1OA 4LVEA 4ACPA 4XCCH 1NGMA 3IGFA 3X17A 5AKSA 4GFXA 3P69A 3B37A 5I6XB 4H0IA 1NIBA 1PCZA 4W9IC 2OA9A 3RU8L 4NKQB 1U9KA 4UNUA 2VXTH 2R1WB 2MWCA 1ED3A 1XR9A 3VXPB 3MXWL 1QN4A 1T0OA 1J9SA 5DJ0A 3OSMA 2W9EH 5KL0A 1I1AA 4ELDA 5CILH 1CFQA 1MJ7H 4YNYB 3GSNA 1W80A 2YUXA 1S7QA 1QNBA 1YNLL 3CNKA 4OJEH 3SDXE 3TYFA 4Z3JA 1X5AA 5IVXB 4J27A 4C54A 3OHXA 1P4BL 4M8QA 4DVBA 4JFXB 1KIUA 3UYRH 3FQTA 1CBVL 4HSCX 1XCTA 5HHOA 4DGIH 1OOAA 4OF8A 4X8JB 4MDIA 1ES0A 3PGFH 4HIJB 5CZKA 2AMUA 3IDJA 4LLVA 1ACXA 5D1ZA 4XE5B 3V55A 3LZNA 1XH3B 4P49A 4JPQA 3UGXA 1T89C 4MJ4A 3L13A 3KPSA 2HZMA 1J5IA 3ET9F 4JJHA 7FABL 1QSEB 3OC3C 5DFVD 3B56A 1ETZB 2IF7A 1IAII 5GHWH 3QVAA 1TCRA 1DEEA 3FQUA 4WTZA 4ZDHA 2B16A 2VWEC 3MNZB 3QH3A 2AJVH 1EAPB 2AABL 2HTLC 2GSGB 1H6UA 4NKDA 3HVDA 2VITB 1CXKA 3DHMA 1KIPA 4UQ2A 2DW5A 1G7MB 4LGRB 4KXZI 3T0DA 3ETTA 4X6BA 2X0UA 2EIZB 1EDQA 4MVBD 4N4YB 2ZUTA 3UZQA 3TURA 4UQIM 2QSVA 2H8PB 4J6RH 1LP9F 2ORBL 2W95A 4NYLA 3WNIA 4IMLA 1A4JA 4YHLL 1PFCA 1F8TL 4M29A 3T4AC 2IPTL 2GHZA 1PDKB 3P73A 1I1FB 3KBPA 3SDCD 1AHMA 1U30A 1JPEA 1S46A 3M46A 4P5TD 4F1ZA 2Q3ZA 1CZ8H 4I2XE 1JYXA 4GBXC 3PAZA 4LEOB 4HWBH 4N2KA 3SY6A 2AJUH 2D7OA 3U9PH 4NLHA 3UTTA 3RHWK 1FO0A 3KWXA 5L7XH 1QNAA 5DRZB 1A7OL 2ARJA 1CL7H 4Z23A 5AD0B 4QPEA 1TJIL 2IH1B 2IOMA 1EFQA 3UL4A 2V7HA 2ZUVA 2K7QA 4WVRA 3DPUA 4XNZB 4MJ5A 4N9OB 2WBWB 4JPVH 4PJEE 4U31A 3U83A 2EDEA 3NT0A 3LNIA 4HG4K 1NCAL 2UUDH 3O11B 4YBLB 2V6HA 3T0XA 4KVPA 1OW0C 2D73A 3GHPA 4R7XA 1KGCD 3APDA 1A4AA 2R15A 3HEIB 1F1GA 2VLJA 2YBGA 3PCYA 3QIWD 4PJBA 4XP5H 5KVMC 2EABA 1BVNP 5AUMB 3T2PA 5DJXB 3Q13A 4QAWA 1NCBH 3ZDZF 2J6WA 4H4NA 4TVUA 2AXGA 3TZVD 1FIGH 5CSBA 5CIPA 5BO1L 5TQ2H 1ZHBB 2O3OA 5CCHE 1ZSDA 4NKMB 4X5QA 5KYNA 3HPJA 1UZ8B 5BOPA 1W91A 3JVGA 4HIHA 2JELH 3HRZC 1SOKA 3PF2A 2X38A 3OAZK 3HKZA 2WLMA 4H13C 4P2OA 1CIDA 5DFVC 4Z3HA 3FQWB 4M00A 1F3DH 5C0BE 4BZ1H 1MPAL 2IPKB 1MDTA 1D5ZA 1ROWA 2OL3L 3V9FA 2DIJA 1I9JH 4TUJB 4XH2A 5J13C 3VD9A 1AXTL 2BOCA 1BG1A 1IAIM 35C8L 1DTUA 4HOWA 5A2FA 1ZIAA 1J05B 1Q90A 4U1HB 2AQQA 1PKQB 3ZR6A 4MVBC 3V52L 1OAZH 1OP5K 4JMNA 2ZXEB 2HJKA 3P3TA 4MCZB 3GBEA 2Y7LA 2NOBA 1TOXA 3GNML 4WZ9A 5BZDB 1BFVH 1UUNA 2V2XA 3EKCA 5JNYA 1XGZA 1SPDA 3MJ9L 4RZCA 1ETA1 1KB5L 3FCSA 1NAMH 2I07A 1D5MB 4P5TC 3DVIA 6PCYA 1U8JA 4WU5B 2WIIB 3MSPA 3HA0A 4WFHE 3VTTA 1FNGA 1BVKA 4IGBC 4TL5A 2IC2A 4F8QA 4HU8A 1NA8A 3Q0HA 3H6JA 3AAZA 3HB3B 1CXIA 4A2EA 1XD1A 2G9HA 2WXHA 5CUSL 3SGDH 1YA5A 3OAWA 2VLKB 1CCZA 3V6OA 3BP6B 2DQIL 3S2AA 4NRYB 2WWKO 1L9NA 3UTSD 1NIEA 4NB7A 4LCUB 1SMAA 4PFEA 4XGZA 3VFGL 2EE3A 1E2VA 2ZPKL 2ISDA 3DGGB 5EPMB 3LRLA 5I8OL 1HZLA 1KN4H 2YAOA 3NCXA 4F2ME 1BZ9A 1BIHA 1LMKA 5FFOA 2E8ZA 5JLZB 4Y2DA 2J8UB 3B7YA 3QIWC 5E7BA 4M61A 5SX5H 5DHEA 2I9TA 4AGQA 4DSYA 4FI6A 1NPJA 3N9GL 3W39A 4XWOD 1LWWA 1QACA 2IGFH 1TQCB 3CVIH 1SNRA 4HUCA 2C3VB 1MXGA 5FGSA 1G9NC 1S2EA 3GSWB 3QFDB 3WIHH 5E00A 3GMOA 2JJUA 3SE4C 4U4IA 3ISRA 2VXUL 4P48A 4FFVD 4ZO8A 2FJGA 3FT2A 1LO5B 1B3JA 3NIDF 4NP9A 5DA4A 4Z7QF 3ZPDA 4ALAH 1BYOA 2C3WA 3SCMA 5DJAB 2W0FB 3LNGA 2X0WA 4ODWA 4Q7DA 1EXHA 3DYPA 4ZFZB 2IWEA 1G9HA 4OCMC 2Y23A 1M9SA 1A14L 3OB0H 1BZOA 2Y3NA 3GJFH 1RZJL 2Q20A 3NN8A 4MJHA 4PJXB 1ZMYA 1QFUL 2B59A 3MV7E 3ZZ1A 1FGNL 1CDJA 2WGNB 3K8MA 4L9LA 3SDAA 5A16A 5F0LB 2F7RA 1ASQA 3IDNB 4XXCA 43C9B 4YDJB 3FT4B 3FU8A 5IV2B 4Y16D 2CDFA 5GIRA 1HE8A 5DUML 3WE6B 2FD6H 1RUAL 2WOBA 1I3RA 2K9UA 1MLCA 2NQ3A 3MACL 5F1IB 5LG1A 3BW9B 1A47A 1A1OB 3LN5B 5E0FA 4JY6A 4KUCF 4Z7VE 5BMPA 4G1EA 2AJYL 1FGVH 3IWUA 3KRMA 1L0XA 3MV01 2CHDA 5ICZA 4BH7A 1FZJA 1USQA 3PDKA 3ULUH 3LNFA 3WMSA 2J1WA 3WN6A 3MRRB 1B2WL 3QEGL 1IM9B 1VGEH 4PJCB 5ACZB 3RGBA 3EFOA 2C3XA 3F05A 2X9XA 2EDNA 4LLWA 3MV8D 1E4KA 3I85A 3I0WA 5FO8A 1WGOA 4YGAB 3WKQA 3UACA 5E8DL 1BFTA 5HDQH 3LMJH 1MI5D 3NIFE 1A9EB 1BBDH 4R96B 2YWYA 4WK0B 4TLTA 1DLHA 4AQOA 3RNQB 4XWOC 5KJRH 2J4WL 3RZCD 2IWKA 2R9HD 1QQDA 1XGRB 3WTYA 3ULXA 1CO1A 3LPOA 3UXFA 1TMCB 5EU6A 1A4KA 5DS2A 3G6JA 5HYQB 4JGUA 5I17B 4Y4FD 1ZAGA 2Y2WA 4B96A 5CZRA 3P9WB 1YTBA 2HT3D 3TO4A 3VA6A 4FFVC 2B4CL 4N8PA 1DDHB 3NRPA 4HD9A 4G72B 4OZHA 1EEQA 4V2BA 1Z3GL 4I13B 3V4PL 4ELME 5KVDH 5FYKH 4YEFA 3MLWH 3RWGB 5E2TL 3ARBA 5KTEH 5FKPB 2Z64C 3MNDA 4NNYA 3BIKB 1NCCL 5H37G 1HSBB 1I9IL 3NFNB 1PEZA 4Q4EA 4JRYA 3T3PE 4GXUM 5IW1B 2KUTA 2X40A 2QKIB 4JZJA 5HDBB 1B6DA 2EC9U 4ERSL 3NQKA 2XVGA 5LGYA 4WW2F 2W59A 1YQ2A 2YMTA 4Y16C 4BD4A 1NH6A 2QBWA 1CYXA 3LKNB 4HS6B 5C0AD 1I8AA 2JCCF 5I0DA 2HLAB 2EE2A 2I5YL 3KE0A 3TPKA 5I24A 1QBLL 3J8F7 4GG6E 5C0CE 4PRPA 1RK0B 2XZQL 2WQSA 2X2HA 1E4XH 5K9OB 2P44B 4PJ8D 2ATPB 2VO8A 2X5PA 5EU3B 3UPAA 5HVFB 3T0BA 4JRWA 5AOKA 2DF3A 5IMLB 1S6NA 5CNHA 1TTAA 2NY6D 4ZPVB 5DK2A 4BJUA 4GAYA 2WZAA 3TEXA 1KCRH 4ICXA 4L4TD 4JY4A 1X9QA 1QNIA 1SY6L 4PG2C 3AVEA 3CH1A 5C3TA 4F7TB 3BFWA 4S10A 1R3LB 4XOCA 4B0AA 2RQ8A 1WAAA 1Y1UA 1X5ZA 2VN4A 4NXKA 4OIIL 1AFVH 2HFFA 2V7NA 4RFOL 2BNRE 4Q6IA 1JGUH 2OM5A 1NFIB 1YJDC 4HPOH 4Q0XH 5JW5A 2PPAA 2ICWB 1G1CA 2G3NA 3FTUA 4M6AA 1PQZA 4YDIL 1RULL 2ARWA 1RURL 1U8HB 4HALA 4Y1AD 3Q1SH 1FLTX 3P3UA 3S5LB 4APQD 1IJ9A 1R5WB 5IB4A 1BV8A 1HHKA 4PGZA 3M8OL 3RZCC 5CD5D 2ENPA 3EOAA 2H0PA 3UJJL 3NCFB 3MRJB 3UJIH 2YAQA 3CFJB 2VDNB 1XGQB 2F54B 1AGEB 5C6PB 4BFGA 4ISVB 3SBPA 4WV1B 2FATH 1WWCA 5I6OA 1K2DA 3VJ6B 5EWIH 4FA6A 4UM9D 2FSEB 2K70A 3CVTA 1MFAH 2YJQA 2AXWA 4CMMB 2FX7H 3T0EA 1TZIB 2VZ1A 3X11B 4HOXA 4ZFFB 5PAZA 2XV2A 1TUPA 1JRHH 1CK0L 1I3GH 3JTTB 5JOPE 1AS8A 4MSWB 3VU1A 1NBVH 2HSIA 5T1MA 4NUJB 3MBXH 1GZQB 2D2OA 1FAIL 4S0HA 2OCCB 1DO6A 1IAKA 3ZT7A 4WW1A 4OCRH 2E6PA 5FW8A 2D3LA 3VXMA 2H5AX 1HXMA 4G7VL 4X6CF 2ZX5A 3DARA 3B1TA 4ZTEA 5A3ID 5BJTB 3O4OC 3WUWG 2H26A 3V5HA 5KSVA 3LPGA 4HSQA 4MNGA 4I77H 4CADA 3DLQR 5D7LA 3TOPA 3UIYA 1SXNA 4Z76B 2NY6C 1SBSL 4ODHH 3B83A 5I8KH 2BSED 1M56B 1CD1A 3JQOB 5HGHA 1X5JA 3IPBA 3MROB 4CVZB 4JDTH 1BXVA 4QMEA 1YECH 5A2AA 4TUOA 4TTDC 1H9VA 3KWUA 2JQMA 2CNZA 4GRLC 5C9JA 2NOIA 2Y2TA 3BIAX 5D7SL 4NXSA 2W38A 2YD3A 4LVOB 1KJ3H 4UZUA 3EGSB 4PJ5D 1JBJA 3FO9A 4N3UA 4WEMB 2IEPA 1VA9A 3E0GA 3DMMD 2Y5QA 1WO2A 5CEZE 3A4EA 2NR6D 4FQPA 2W8CA 3O6FB 4RWYH 3D2UA 2CHNA 4AVHA 1TDQA 2XZAH 4IU2A 4NNXA 5L4IA 5L8JB 1USZA 2NXZB 1C5DB 2CGYA 3M1BB 4HGWA 4LCCB 5E2JA 3C5XA 2E7LA 4JX0A 1UA3A 2MKLC 1INDH 4G8FB 3DO7B 2N7BA 1H6TA 4Z0BL 3K6NA 2OQJA 2ZSWA 4OCYH 5EHFA 4NKOA 2D03L 1JV2B 1UATA 3IFOA 2GT9A 3AB0C 3GM8A 3MRPA 4ZNEE 1MCCA 5D55A 5C0GB 1JNJA 1JZFA 3WY3A 3TNNA 1BLNB 4X80H 3ZUCA 1GA2A 1CFTB 1GYCA 4GAJH 4OSUH 3FL7A 4L2LA 4XVJH 4EQ2A 4NZRH 5KJ7E 1VFUA 2MKWA 3LEYL 4Z9KB 3EO9L 2XVBA 3D4YA 2JKSA 4DZ8A 1WA2X 4KV5E 5GGVY 1HHJA 1L0QA 1UZGA 4NQTA 2F18A 3CFBA 3OC8A 1CS6A 2KHAA 4QRUA 4TSAH 1KYUA 4UDUA 5DFTA 4P4RB 3VFWB 2X4PB 2KQNA 2JB5H 3FRUB 4QJ3B 4FFWD 4M6ML 5D2LF 5C6TH 3ULUF 2HTKD 3MR9B 5D1XD 3NP4A 4QO1A 5FHAL 3ASNB 3WIIL 1ILUA 2NY3D 4NO3B 1XIWA 2JJSA 1AG6A 4P2YA 4DEUA 3Q2CA 4JFPB 2EIBA 5I19H 3IGKA 5GGUB 2WXMA 12E8L 4XN1A 1D6VL 5A3IC 5KSBE 3SQOL 3TESA 5BZZA 4RBPH 2RBLA 4RGND 3RU8H 5FUOL 1J12A 3G08B 3KXFE 1GOFA 3LQZA 4HUVB 3L6FA 2V3EA 2YIHA 3HRZB 3MXWH 3ZKND 4CVUA 2ID5A 2Y6TE 4W4OA 1PKQE 1A6ZB 1FV1B 1H8NA 4TL4A 4U6XB 4EE2A 5AAMC 5J13B 1IBZA 1YNLH 2DLHA 2IQAB 1L4IA 1QLEB 3O2DH 4N25A 4WFGD 3BQUD 4F91B 4PY8I 1P4BH 5GPRA 3FT3B 1DE4A 2AEIT 3ZJAA 1TVHB 1RFDL 4YHYC 3ULVL 4J28A 4BQCA 4MMXB 4DEPB 1CBVH 4X9FA 3KPOA 4LMQI 3LSOA 1MFMA 1J0IA 1DO5A 4PRBA 2DEYX 3TVMD 4DPCX 1JZDC 1W15A 3KL3A 4FJYA 3CXDL 3DMMC 3SDCB 3UZEA 1YY8B 5GISL 3K1DA 4ROEB 2YD5A 2VLKE 4P5TB 3WTSA 2VDOB 3UP1A 7FABH 1U95A 5LQBL 3QRLA 4LHUD 4RGMC 4WEUD 1F1AA 4M6NH 1URZA 1MCEA 1SDDA 1Z9MA 1XB8A 5A2CA 4WI2A 4K5MA 4U05A 2AABH 1AD9B 3FOLA 2J8UE 2GI0A 1IT9L 3U79A 4NC1C 3RVUD 5ADPL 2AITA 4W9ZA 2QRCA 5TK2A 2OXHA 4MDRA 3QZOA 1A0QL 2CO1A 5KAQG 3TBBA 2ORBH 2AXFA 2VXVL 4WFFD 3Q2WA 4XP6L 1AR1C 4YHLH 1F8TH 4FFWC 4K0OA 4P2QD 3NFPB 3QIWB 2IPTH 5EEUA 4HK0B 3SPVA 4A7UA 3SPCA 1I8UA 2CO3A 1HKFA 1NANI 3TZVB 4UMSA 4JO2L 2YPKA 5CBEA 3QC5X 2OI9C 4J3SA 4UILL 3TIEB 1CMOA 3MRBB 1NM4A 3OAZH 2AJSL 4RGNC 3IWVA 1PNCA 4LLQB 1TIUA 2UZYB 1SXZA 4QYAA 2FCBA 3O4LA 1A7OH 2AGJL 1OF0A 2P5PA 2ZF8A 4QHLA 1A5FL 1TJIH 4OBRA 1P5VA 5CU9A 1S7VA 3CVDA 4PJ6A 2LAAA 1X3DA 1S7SA 2BSBA 2P8MB 4WKXA 4JCWA 1XZWA 2N1KA 4JFED 1EV2E 1NCAH 4ZYKB 1EMTL 4Z7WA 5AKRA 4DCQB 4XXDA 1OLLA 1QMUA 2AV7A 2IMMA 4HIXL 1XH2A 3X14B 4QF1B 2CLVB 1WBZA 1OP5H 5ESQA 4MWFB 1KJ2L 4WGKA 4U6TA 1JZ2A 3DOSB 1L3NA 4QLWA 2WB1A 2E74C 4IHOA 4E0RB 4PY5A 3GB7A 3CN1A 3TVMC 3NIGB 2WWOA 4E42B 5ECJE 4OD1L 1E5BA 3OLGA 4LLDA 3CFQA 1JN6A 3OB8A 5EZIL 5BO1H 4L4VE 3U4AA 3LZPA 4JG0L 5D9SB 4LPTA 1CU4L 2YA2A 1ZT4A 2ICWI 5FX3A 2NX5A 3CH8A 4OV5B 3LKRA 4PJCE 5E7FA 3GJEB 3K8LA 2XG5A 1UVQA 5TE7L 1K5NB 1MPAH 3QARA 4IRJC 5GGRB 3Q5TA 2OL3H 3AM8C 4RA3A 3C6LA 3RVVC 1RUQL 1AXTH 5AW6B 1YNKL 1L9RA 1ZPUA 3WFEL 35C8H 3LEVH 1YNTF 5HGAB 3UTSB 5AW3B 1BXUA 4BK5A 1XGUA 1JGDB 2F1EA 3V52H 2XTSA 1IGJB 1LEGB 1F1DA 3UTOA 3US9A 1I9EA 4OGXL 4PCKA 4TNEA 3FHAA 2E3VA 3GNMH 3QPQD 3EJRA 1BQHA 4NCDA 3MJ9H 4HJGA 4Z7NF 1KB5H 4ONOA 4PBWD 3KS0J 4PS3A 1JGVL 5BV7C 4I3SL 4MKTA 1YYMH 3ETBF 3S4SG 1RZFL 4FYSA 4V11A 3KPNB 1YAIA 2LLGA 2WBJA 2XCMC 3NCYS 5CZXD 2NY4C 3O6ML 4HWBA 2IH3B 1BZ7A 4YPJA 1OVZA 4DUWA 5CUSH 1M7UA 1I8IA 1BA9A 4HIQA 2PPDA 1I7UA 4WW2A 2DQIH 5HDBE 1OGPA 3W5NA 2QHLA 2R2BA 3VFGH 1P4IL 2YQ3A 4KH9A 1LEIA 4G6ML 5LKNA 2ZPKH 5I8OH 2BSSB 4OZFH 4MRCA 4TULH 2X3AA 3X13A 5BRPA 4A7TA 1QLRA 2VDMB 3NTCL 5B4MD 1KENL 4G1MA 4MZIA 1F6AA 1NLBL 2IDQA 4OJAA 5LG6A 2J8OA 4WK2B 3BMWA 2Q8BL 4P99A 4XHJD 4ZXBD 2YA1A 2NZ9C 5KYWB 4D7RA 3N9GH 4Y16B 3HN8A 3L3IB 3H9SD 4LESA 5D1QC 3VMNA 1FL6B 1Z9PA 5AB1A 4ODUB 2O61B 3HHMA 3ECQA 5H8DA 1U91A 3HG2A 3FC8A 2JWYA 1JXJA 2VE6B 4FG0A 4QKTA 5ETUA 1NBYA 2VXUH 5C0FB 1WJWA 3EYQC 3M1CA 3PDOB 1W16A 2CZNA 5AVYB 1OO2A 1NKRA 1R34A 3H54A 4MNQA 2A0LD 2YD0A 4OF6A 2FGWL 2W65A 3ZHNA 3IMVA 2BOBA 2QGCA 3ABMB 3JXAA 2JFCA 5ECGA 4M4PA 3RWEA 3ZQWA 3QAQA 3ARTA 1T21A 3SYAA 4AEHL 3DRQB 1E65A 1QFUH 4AH2B 3IJSB 5IOKA 1FGNH 1LK3L 5BRZA 4HKJA 4UT9A 3JWOC 3TBSA 4BQBA 4J3BA 3WL9B 5IZ7A 2GBTA 3MV8B 4PJDB 4GLRH 4AYFA 5DUMH 3CWTA 4M8UA 1RUAH 1KUMA 4CDGC 1XZ0A 1MI5B 4IRSA 3QDMA 1QSZA 3MACH 4PVBA 1WC7B 2AK1L 3DOIA 3VWJD 3BVUA 3RZCB 4S1RL 3TH4T 4D0CA 3B9KC 5DC4B 3CBRA 4Y4FB 3WNNA 1HE7A 3JTBA 3SYQA 4JRFA 2A9BA 2C5DC 2ZKXA 3AG1B 2AJYH 5HHNB 3RWIB 3U9UB 5MP6L 4RQQB 4GPVA 4OUUB 2CO7B 2CUHA 3F83A 3BOVA 3F12B 1B2WH 2ATKB 2CD0A 3QEGH 3PWNB 4X50A 2EEBA 1KGIA 2IFGA 4P9ML 4AYSA 3EXLA 2C34A 3U2SB 3E1ZA 1IBGL 1RV6X 1Z66A 4NJAL 4JQVC 5EBLA 4NUMA 5IK3A 1J87A 3BJLA 4HMEA 2XOTA 4BSJA 3F7PC 2KLSA 3BLPX 5B3JE 3CLFL 5B4MC 1AYOA 3NOIA 5E8DH 1A6WL 2XNAA 1TBPA 5AB2A 4S2SA 4LCYA 1WVZA 3FB5A 3T65B 3MUHL 2J4WH 3TIDB 2MNUA 5C0AB 3EZ8A 1QA9A 1ZPLA 2XY2A 5F3BA 3QC6X 2OTWB 2WB7A 2J73A 3LYRA 4AOFA 2FO4B 3RGVA 1S9WB 5K9KB 3O4OB 2B4CH 2CALA 4KMQA 1IL1B 1TEGA 3L3GA 4PJ8B 4OLXL 4CJ1A 1OALA 3PWJB 2A0LC 5E23A 1Z3GH 3V4PH 5K39B 1UOVA 1ZHLB 2NW2A 2NY6B 4Z0XB 5IQNA 3ESOA 3NSXA 1U8LA 2DLFL 4L4TB 4L8SA 5E2TH 3VX1A 2OZNA 1GY1A 3FB6A 2BOLA 3GJFA 4P23D 5I6MA 2BVOB 1NCCH 1M3JA 1I9IH 3VXNB 5FM5M 3FO1B 3Q5OA 3RVXD 2YS4A 2O5ZH 5E2UL 4ERSH 1QEWA 3DPTA 1E27B 3QNYA 3GXFA 1TQBC 1HXKA 2V5TA 4ZUTA 1W72H 4KX9A 2VKWA 3QUKA 2I5YH 1XEUA 4Y1AB 1QBLH 4APQB 5IM7A 3CVCA 3QXTA 2XZQH 1LILA 1K8DA 3WS3A 1V54B 3UBXB 1IM3A 4JUTA 2ZOTA 4LCIL 4P2RA 5E24E 4YSSA 1BAWA 4PP2B 3TXAA 3MI6A 1HEJC 1I85C 1OSPL 3WLWC 4HX1A 3WJJA 4GS7C 3ECBB 3EF7A 3AB0B 1KFQA 1SY6H 2NTFA 2BH0A 4EBQL 5D2LA 3APNA 4UV4L 1MWAH 4UM9B 3QQ9D 4G5ZH 4NN6B 3Q2NA 2ZXGA 4U1LB 2DYRB 4OIIH 2W92A 4H5SA 2IIJA 4RFOH 3ROOB 2VUYA 3FUFA 1M3IA 3KS0H 5HDLA 4DPRA 1SXBA 2VLMD 3PE9A 4LSDA 5C3LD 4JKNA 1YEEL 5EEYA 1H8LA 5JN5A 2JJWA 3DX7A 1U8QA 4JFUA 4UF7C 2CDEA 2Z4QB 1SLVA 4QOKD 4YDIH 1RULH 2O72A 4FQQA 1BVZA 1HHHB 5E8NA 4AXWB 4J1UA 1BQRA 1GYUA 4N6QA 1G7QB 3M8OH 1S5HB 1F2XK 4S1QL 3CIAA 3UJJH 2KZ1B 3HE6A 3T8XB 4UV7L 4Y2LA 5LNDA 2H32H 3QXUA 4EDWH 2EKSB 3L5WA 1I1AC 3B34A 4KK5C 1A7RL 4RODB 3N85L 4J3TA 3KYOB 4RNRB 4AV5A 1V3LA 1B0IA 3E6HA 4G3YL 4P5MB 3AS2A 3CLEL 2VDLB 3AC0A 4RRPM 3WGUB 3EH4B 2IV9A 1VGKB 4M4RB 2NYZA 4X7CC 1GTNA 3RVWD 5KS9F 3QUML 2DQTL 3MYJB 4LSPL 2ZUYA 1FA4A 1CK0H 4KI5C 4HUWA 1ORSA 4Q9RL 5JQ6L 4PPTA 2Z34A 3M1OA 4R4ND 1LVEA 2EO7A 1NC2D 2YUZA 2B5IB 2RR3A 1FAIH 4CN4A 1ZLDA 1ZKAA 2CK2A 4YHYB 2I85A 5D1ZC 4E9SA 3G3LA 4U0QB 3Q48A 3QFJD 1KTBA 2CRIA 1EO8L 4HCRL 2JCWA 4G7VH 2EUZA 3UZVA 1PCSA 4DWHA 4PJ5B 1C8PA 1DANT 2V92A 3WNOA 4LL4A 1O6VA 3ZZLA 3L4UA 2WTOA 2XHIA 5HD8C 3DMMB 2EC9T 1YEHL 4HHAA 3VI4E 4WIQA 5JPNB 4P4KA 3SKMB 3IDGB 4UDTA 4X0KA 2VRAA 1KPVA 4RGMB 1SBSH 1J8HD 5BUAA 1KLUA 3WJMA 1KGCE 3AXLA 1TKWB 4YIQB 3KAAA 3QQ9C 1WAPA 5E70A 1DDTA 5EF3A 2A9ML 5C09D 4FXTA 1BZQK 3GS7A 1W0WA 5F7DA 1NFDB 4C59B 2VLRA 5D7SH 4G7SB 2Z0UA 5EZOL 4IK7A 3B9DA 3VFMA 4TF4A 2WKOA 1ULVA 1I31A 3BYTA 5I16A 1C12A 1EEYA 4KXBA 2DWTA 5D1XB 2W07A 3O2WL 3RUGF 2NY3B 3AWGA 3W56A 4A68A 2FO1A 1EK3A 1YSOA 2BZDA 3FCTA 4BDVB 2PW1B 3BIBX 2YSTA 5FYJU 5IJDC 2VQ1B 1MOEA 3CZUB 3AT0A 2YXFA 2VISA 2D03H 3BD4A 4MB1A 3ARXA 4RGNB 3BSHA 5L2KA 4N2AA 4ZFOL 2AV1A 4ONHB 2BDNH 5KVEE 5DRWA 3L81A 3GKZA 1TZOA 4AQAA 2XKNA 5DC2A 3EYVA 4PTUB 3V4VL 3MZTA 1JWSA 1EPFA 2ZXBA 3UG5A 3V2AR 3EO9H 1J7VR 3A23A 3FUDA 5FUCE 4A6YH 3BQUB 3M6DA 1PLAA 2XUWA 3RY6A 4Q2ZB 3N0PB 3BGFB 3IXTB 3OHMB 4M6MH 5FV2A 1OAUL 1DL7L 4YHZL 5FHAH 3QJZA 3DETD 5I1AB 2R29A 1HXYB 4RISL 3TYGL 5GS1B 3BT2L 4OI7A 3JVGC 4YX2L 1GGTA 5JDJA 4MMZC 2WV3A 1QZ1A 3TVMB 1KY6A 3N5AA 1YMME 4P2OC 1UM5L 12E8H 2AKRB 1D6VH 5JIHA 2FQFA 1WZMA 3SQOH 2YBRA 3MODL 1GW0A 5LAPA 5FUOH 2NVMA 2WXQA 3UTSE 3MRIA 4TQPA 4RVBA 4W70A 4LHUB 4A66A 2DQFA 2B7DT 1G7HB 2J44A 3MRHA 4QTFA 4UQ3B 3SDAD 2Q76B 1QNZL 5FECB 4XAKD 4TSBL 4K9EL 3PL6A 3GSXA 1NCHA 4PUBL 3I02B 3EJCA 1AMXA 1AOZA 4RRPG 2X12A 3DECA 3OXRB 2ZP8A 1RFDH 4CC1A 3ULVH 2K7PA 4ONGL 3VG0L 2A3TA 3ALWA 3B3IA 4YSCA 2O6EA 1FYTA 3DBXA 5CJXC 5EZLB 2N7SA 4TNGA 1MFDL 4WTWA 1JYVA 3QO0A 4BKLA 4I1NB 3VFOA 3GZOA 4P2QB 3C9NB 1RJLA 1KCSL 5F88B 1XO8A 3CXDH 3DIFA 4X6FB 3D2TA 5GISH 5BV7B 1DBBL 4BH8B 2CQVA 1MHCA 1WIPA 3OMNB 5LQBH 1HSAA 4Q52A 1I75A 4UTCA 1BAFL 4QRRE 1HYSD 3PWPD 2H1XA 3D9AL 4QHKJ 2Q7YA 5JA8B 3PWUA 1DBJL 4HAFA 1IT9H 1NIFA 1ZV9A 4J3OH 4X6DA 5EC1A 4Y2DC 5ADPH 4X8GA 4UQEA 4JFEB 4WSKA 1IGFL 4XB7A 3TASA 1O7SA 1A0QH 3P4MA 3MOQA 3V0IA 1EZLA 3VQ2C 2VXVH 4XP6H 4FQHA 2IBZX 2NYKA 3QAZC 4N2HA 4N8CH 1YEGL 3CHQA 3FO2A 1I8KB 3RX5A 5DQ9A 5TDPA 3S9DB 1ORQA 2VZTA 3F65A 1P5UB 3ZDXE 5ID0A 5CWSB 4JCLA 4JN2B 4JO2H 1LD9B 1CT8A 4IKIA 4PRAA 5AL0A 4UILH 3SCMC 5K5YA 2YAHA 1A21A 1I1RA 2FE0A 2YXWA 3B9AA 5FA3A 2AJSH 1JK9B 5DMYA 5CP3A 1J1OL 2HJLA 4Q9QL 2CGZA 5EUOF 2NY5C 4HBCL 2AGJH 2GY5A 2VSKB 5SX4I 2I7OA 5I6LA 4FQLL 4BWWA 2HT4D 3CN0A 2OSLA 3SDAC 4L9LC 4K3HA 2HL8A 3M7FB 4I4WA 1R33A 2B3IA 4PJDE 3UBXI 5GSRB 3VFSA 4XXCC 3ZU8A 1NEZB 2XBDA 4HIXH 3O2DA 1MI5E 1LJMA 3FQNB 5A2LH 1HAUA 2W88A 5JW4Q 5MERA 1QN7A 4F8NA 3RB7A 1RJYB 1KJ2H 1P6WA 3BXNA 2IV8A 1V7ML 3P77A 5KN5A 2ARJQ 4XBEL 4PRPD 2XHNA 3ECUA 1VTOA 1KYDA 4M48L 2K8QA 2WZPA 5GGVL 4BUGA 4ZUUB 4XPAL 4OD1H 1F4WL 5DEGB 1MRDL 2XYBA 4K73A 5EZIH 5JO5A 5I8CB 2J21A 3TBCA 3S5YA 4JG0H 1LWVA 1CU4H 1NOLA 3DX8A 3L4YA 3ARED 4LOFA 3FB8B 1AJ7L 4B3VA 2X4SB 3GDCA 4BFJA 5INDA 2N0KA 3O6LL 1ADWA 3EGDB 4JFHD 2GC4C 3GKWL 4FE9A 5TE7H 1HYSC 2DQEL 4CU8A 3RWFA 1U8OB 2BIMA 1RUQH 3ZKXC 5CGTA 3STBA 1NGQL 4C56A 1YNKH 4RMSA 3MAWA 5FB8B 5EIIB 1OSZB 3WFEH 5CJOL 4U3SA 1M1XB 3CDYA 1T5WA 3O3BA 4OIBA 4O02B 1PF3A 2Y7OA 4B60A 4H1LB 2BWDA 3HR5A 4N5UA 5C0AE 2AS5M 1XVSA 1JI1A 4BFEA 1WV7T 4OGXH 3F5WA 3OG6B 4H0HB 4ZXBB 3V0WL 4MXVE 4GG6F 1OB1B 1JGVH 1OHQA 2P24A 2Z91B 2Z8VC 1J48A 2I9LB 4I3SH 5T1KA 3TNMA 3TO4C 4BSWA 2CKNA 3H9SB 4XCEA 4PP1D 5AVUB 5IUSA 3KH3A 5C08D 3ZSTA 3B2XA 1UQSA 3VI3B 3O6MH 3SB3A 2NOFA 4LVHB 3F0ZA 4IOIB 3UPRA 3ARBC 3MDJA 1WUNT 2MCPL 1A6AB 3MUUA 5EU5B 3IM1A 3H0TA 5J56B 1O6SB 3DTUB 2HT4C 3WMPA 2YARA 1T80A 5F7WC 2GFBA 4D7PA 1P4IH 3QDJA 3RP1A 4G6MH 3U4EB 1U8KA 4ORZC 4UQ9A 5IHZA 1OTTD 2GI7A 3L3DA 5IW3A 1YC8A 4DN4H 3X1EA 3NTCH 1ACYL 1KENH 4IBTA 4Y1AE 3V7AG 1NLBH 1YN7A 4YK4C 2O6PA 5DHYB 3MREB 4IOSD 3BWSA 4OI9A 5JMVD 2IG2L 1L6XA 1UGNA 5D7IF 4FFZL 3N43B 4TSCL 3TF4A 1E2ZA 2ZOWA 2X6CA 1IVLA 1DVTA 2PCPA 3S37X 1W2KT 1J86A 4G8IB 2DEWX 1WITA 4LDCA 2O30A 4H2AA 4GUQA 3SDXA 4D0DA 3VWJB 5MEND 1RIHL 4EDXB 1DQJB 3ZZSA 3CVHB 4WNQA 2AEPL 3GHEL 3HJ0A 4C8XA 4TMPA 2FGWH 2X70B 3FSOA 2PO6D 3QQXA 2NY0D 4WWKD 3VGDA 1AIFB 2H1LM 3KPLB 4NZDA 1AQKL 1MFEL 3Q8FA 2ADIA 3JV0A 4OLYL 4JO3L 4AEHH 4MBOA 1P9MA 5DMJB 1GYWA 1LK3H 2W0LA 1TO4A 4XC3L 3BD3A 4EAIA 4IKKA 4P5RA 3D69A 3V0VB 4BUHA 5KYUB 2R39A 1RD6A 3U46A 1F56A 3ES6A 3N2JA 4LO9A 2CU9A 4HJUA 1UACL 4HHWA 2OJEA 1F13A 1ZK5A 4L8CA 3ML8A 4LCWE 4TS6A 1Z9LA 2AK1H 3KCPB 1L9OA 3DDFA 4FF9A 3T0EE 4GAFB 3VDAA 4S1RH 1X4XA 4XNMA 2IAMA 4U1KA 1PFOA 4PP1C 3ULVF 1U0QA 2FUQA 2LTQC 5DJ0B 2FBOJ 5I71C 4Y5XB 1AXIB 1T03L 4LL9A 3T8VA 1MVUA 1VFOA 3OX8A 1DQTA 5F7FA 3VXTB 3H2WA 1XF2B 4P9MH 3ENCA 1FPTL 5DK3A 1IBGH 1HQ4A 3M17B 4NJAH 1OTTC 1WBYA 1KIUB 4H8WC 4P23B 5E6UB 2YJLA 4DW2L 1II4E 4I2XA 3FQTB 3CLFH 1PNDA 4PJ5E 1JP5A 3D1MC 1T83A 2OSYA 1A6WH 4OFPA 5GRVL 2ZYRA 1B0GB 3TFBA 4LK4A 3LOWA 4HXAL 3PG2A 2XG4B 2FZ3A 4J3OF 1MUJB 4A39A 5IQ9B 4HIIA 1UA6L 1YMHA 3IMBA 1VJSA 3K46A 1A2YA 1HWWA 1U3YA 2EUWA 3U30C 2PCXA 3O9WA 4PJEA 3OLDA 1DUZB 1OL0A 1IGYA 3K6IA 1FCGA 5IROD 3DPDA 3FQUB 4ZI8A 5FA4B 2APXA 4WY7L 3QH3B 5HVGB 3RWJA 3ZY7A 2JHJA 4OLXH 1N8ZA 4CFFA 3CDCA 3ZZQA 4MA7L 1FHNA 2Q10A 5I30L 1N70A 2ODIA 1F86A 1KIPB 1FC1A 2PO6C 5D4HA 1GGYA 5KEZA 2NY0C 4WWKC 4P57B 5IIEB 2DLFH 4PIBA 3NP3A 3HFFA 1KXHA 4HJTA 3WHE1 4MZ3A 4YFLF 5T5NF 2OSXA 4IMLB 5D1XE 4Z5RB 2OMTA 4G6JL 5E2UH 3G5YB 1NUFA 3ZQXA 1ZT1A 5JIIA 1LO4L 5GRVK 4ABUA 2BZ7A 3BLBA 1EEZA 2RGSA 3MLZL 3ILPA 5INCA 4QOKB 2A7BA 3CZNA 3OZKA 3INUL 5C0BA 5LXVA 3L17A 4HKXB 4HA1A 4XOEA 4I0PA 5F1SA 5FKAA 2E7LC 4FJ6A 3UBXG 5KSBF 1P7BA 5IB1B 3WNKA 4LBEA 2QT6A 2EXWD 1FO0B 2WQXA 3P2TA 3HC0A 1ZGLA 1G6RL 4LCIH 1T7ZA 2AW2A 2Z35A 4I1PA 4BIKA 1I3VA 3QEQD 3VRLF 4F8TA 3ARZA 2Z92A 2V7HB 3H9HA 4N0YL 1OSPH 1XF1A 3DIVA 1G0YR 1QPXA 3RIFF 2ZSVA 2HZSA 4WFGE 1HCZA 1THCA 3KW7A 3SY0A 4UV4H 3E9TA 5J57B 4WHYG 1WQVT 2AZAA 1XV8A 3RB5A 4ANKA 5F44A 3OV6A 2NUPA 5GGSA 2X88A 2WQ8A 3W11D 4PD4K 3ARFD 3C2AL 1YEEH 4DKEL 2YAMA 1UD8A 1XIWC 2JJSC 2DL2A 1NC2B 3VSVA 1P7KA 2J1ZA 1UYWL 4X5WB 4ODXB 1CPUA 4X4ME 4U1SB 4L9DA 4Y9CA 1S78C 1IAMA 2KS0A 5CIPB 5JDSA 1ZSDB