1W80A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, bound to 2 peptides from synaptojanin170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
248
Chain Sequence
PGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 2 ALPHA 2 SUBUNIT
publication title Evolving Nature of the Ap2 Alpha-Appendage Hub During Clathrin-Coated Vesicle Endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 68
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1w80A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1w80A02
1D3UA 1QN6A 1KYDA 5IYBP 1QNAA 1PZDA 1QN8A 2D0CA 1KY7A 1QNCA 1NA8A 1OM9A 1IU1A 1KYFA 2E9GA 4BCXA 3EIKA 3ASMA 1W80A 1C9BB 1YTBA 1PCZA 1KYUA 1QTSA 1VTOA 3ZHFA 2Z8UA 1NGMA 4ROCB 2D0BA 1E42A 2D0AA 3OC3C 1TGHA 2MJ7A 4WZSD 3MNMA 1YTFA 3OCIA 3HS8A 1QN5A 1QNEA 3ZY7A 1QNBA 3HS9A 2VJ0A 1VOKA 1CDWA 1QN4A 1QN3A 4ROEB 3VN5A 1GYVA 1P4UA 1QN9A 2G30A 1JFIC 1KY6A 5IYDP 2DWXA 5CN2A 2DWYA 1TBAB 1VTLE 3H1ZA 2YMTA 1GYWA 2A7BA 4PY5A 1VOLB 2IV8A 4B0AA 1NH2A 1MP9A 5IYCP 1RM1A 1B9KA 1TBPA 4RODB 1AISA 2IV9A 5CN1A 1QTPA 1R4XA 1QN7A 1GYUA 1NVPA
chains in the Genus database with same CATH superfamily
4F7EB 1ZANL 1NBVL 4C56E 5DLMH 1A21A 5LNEA 1AD9A 1HKLL 4KO5A 3GB7B 1UEMA 4I9WE 4Z7QF 2ZXGA 3O6KL 1UHVA 4ZX5A 4WENB 2WBWB 4LRNL 3TWCH 1GC1L 4KNUA 4UQAA 4LEOB 2AEQH 4NC2B 1Y18B 3P0YH 2YD9A 4QHNA 4YIQB 1P1ZB 4A7GA 4FKKA 4N2DA 3VD9A 3GSRA 1M42A 1T2XA 2AQSA 1E43A 3DUSA 4FFZH 5ALCH 1IGYB 2HYMA 3DBSA 3GSNH 5BS0E 4MRBA 2EXYC 1Z9SB 1HILB 3MXWH 1FQ9C 1YQMA 4TSBL 1OB1A 5ANME 4AUYA 1HHGB 3QJTB 5I17B 4UBDC 3KPOB 4K8RC 3S35L 3HPJA 2FQFA 1IARB 1O6TA 2BFVH 5I5IA 4G6MH 4U05A 3SCMD 2P5WE 5INDA 4ROCB 2Z7YA 2C26A 4RGNC 2AEOA 3A4AA 4P5TB 3HNSL 4PJDE 1YEKH 2DQ6A 1KJMA 4FQXA 1JK8A 4G80A 4JHVA 4ZXBC 3UBXA 4NO0B 4HMDA 4LCUB 4PJAA 4N8VA 1BQHB 2PO6D 4HBQA 3CHQA 2VISB 3MJ9A 3VMOA 3NIGF 3IVKA 4AM0B 5FM8A 2R0LL 1A3LH 4UAOB 4U7MA 2XVLA 3EYOB 1OGAD 1HHIB 2NW3A 1LE9A 3NFSL 2BSRB 1MNUH 3IDUA 4UT7H 4ZOCA 3VGAB 5C71A 1ICTA 5GS2D 4JO3H 5JQ6L 4G2AA 4EQ2A 4M7ZB 4YWGL 4HDIB 2E6JA 4Q6IB 1NLBL 2C9RA 4AQZA 4FNSA 1E28A 5DZPA 1MAJA 3EBGA 1EJOL 5L8LB 1KTKE 1AGEA 1N6QL 3B7UX 1WJWA 3Q13A 4EALA 3HG3A 5E03A 1NMAL 4DFHA 4RMTA 1G7MB 4D0CB 4KZDL 4R3SB 1QZ1A 4X7TA 5F88B 1A7QH 2PYFA 3J07A 1CGUA 2E7CA 2XT1B 4P49A 3D85B 2Z4QA 4JPVL 5C08A 3BDBA 3ARDB 4JM2B 3UTSB 3VD2A 1PG7X 5J8OA 2I69A 4ONGL 1Z9MA 2VLKE 3VRIB 3MUUA 2VIRB 1DJXA 2IQ9H 1FA4A 2G2PA 1OW0A 4M56A 2GUOA 2ZX5A 3U1SL 4OM0H 4WU5A 3UGXA 3DBXB 1XIWC 2E7BA 4WW1A 2VLLA 1QRNA 3B9EA 4P23A 1N5YL 4BDVB 2XQYK 2GSGB 4H8WL 3TE5A 5KBDA 1B6UA 5DSCB 4JGNA 3ARFC 3IXTB 4BSVB 5A7BA 2V8QA 1IAMA 4ZK8A 1D6VL 4RRPM 3RWCB 4M1CC 4NQSB 2VB5A 4A6YB 2ZP0T 3M07A 2HFFA 1ZJAA 4UIKL 1SDAB 4C56B 2HZMA 5B1JA 3QDME 3QQ4B 1HE7A 4LF3B 4OFYA 4AENB 5DVOA 3DWTA 2PCPA 1ZXKA 3ATAA 32C2A 3JV6B 4DHLA 5IOKA 1U3HC 5LWYL 4IJTA 1RZJL 3V4UL 4CVXB 1LO3H 4ZX4A 1RZ7H 2VLRA 3SKJH 1AHWB 4WW2A 4JE0A 3IETB 1OXYA 3TYGL 1GMEA 2B5IC 4EF3A 5BS0B 3NZUA 2DLIA 2VDOB 4DT2A 2KQNA 1Q0YL 2PCFB 4AJYV 1JD9A 3O0LA 2XPGA 5ANMB 4L4TA 3TBVB 3AADB 3DRTA 1BZ9B 1JGLL 4OF0A 5FW6A 3IDIB 4MSWA 1QR1A 1QNEA 2D31B 4AUJA 3FU7A 4PGDB 5B7FA 3X17A 3KYOA 5DZAA 4OZHE 3V0WL 1A9BA 3SKNB 2EDOA 4PJDB 4UTBH 3ENOC 1KNOA 2NY5C 1NANH 2E74C 3CVHB 3ZDZF 1R3IH 1T5WA 4ADIA 1NC4B 1NL0H 1MXDA 2Z7UA 2ICES 4TNGA 1QKZL 3ARBA 5CMAB 2Y3AA 1BWWA 4BH8A 1SVZA 5HYSA 4V1DE 4JCWA 2L0DA 2Z91B 4HSCX 5DLLA 2IOOA 2ADIA 3QFJB 5CP3H 1WISA 2IIJA 3GO1L 5ANHA 1OB0A 2XWJB 1SJVA 4UOQA 4S1DD 1RM1A 3DRQB 4GW4B 3MFFB 3A67L 3VI4A 4GAAA 3CV5A 4LSVH 1YECH 3K6IA 2YC1B 4L4JA 1OSYA 4PJ8D 2ENSA 5LN8A 3FTXA 4WZ9A 4LOEA 4IKIA 2CDEA 1NIEA 5FUOH 1CG9B 4HK0A 3IMUA 5K33A 1UD5A 1T0NB 1WZLA 1M6UA 3QE5A 4M6ML 4UQCA 2YAOA 3V2AR 2VDLL 1TCMA 1WD9A 5HHNB 4A04A 4Z7IA 1A3QA 5D1QE 5EU6E 2XXGA 4GYBA 3VSTA 4LIQL 2EIDA 4LQ1A 3VX0A 4KY1H 2DLTA 3WLBB 3CLFL 3NP3A 4JPIA 1D9KD 2JPIA 2Z8RA 1MFCL 3JQOB 4H8WC 5EO9A 3UJJH 2VLKB 2WXOA 4AIEA 4OB5H 3EGDB 2ZXBA 5CFAA 1RULL 2GJ6D 4H8VA 2ICEC 5F3BB 4Y1AA 4DZ8B 4RFEB 4QOKD 1FFNA 3OZ9H 2VDPB 4DP6X 1J10A 3QUXD 4R96A 3HCVB 3QEQD 4E41E 4Z6AT 3IS0X 4AGOA 4QRAA 1EXGA 3UL4A 5CZXD 4NRZB 2LW3A 2YUZA 4I77L 1MWAH 4O2CB 3U82B 3MV11 2WBJD 1EDYA 3FAXA 3D7PA 2EDJA 2WVVB 4LDOB 3QDMB 5DU7A 5EHFA 1D2OA 5T1MB 3RVVD 4CC4A 1K2DB 2JCCE 4ZTOH 3EJZC 2DBLL 3P0VH 1E3XA 2NNXA 4XNMA 5EEWA 4UV4H 5JHLA 3HI5H 5E8NA 5I6PA 3MX0B 5LAXB 5IW1A 2OJ1A 3ZTEA 4KJQC 2DMKA 1LJMA 3N85L 4F2FA 2ZOKB 1O9VA 1CTOA 3ZLQC 3MU3A 1TZIA 5CD3B 5T3XH 4RAVA 4CW1A 1F1AA 3N1GC 4KOCA 3LN4B 3SO5A 3PWJB 4N2BA 3PDDA 1L0QA 4O2FA 2VITB 5JR1H 2FYYB 2H3NA 3REVB 1A4JB 2IWGA 2ID5A 3FKUS 4HKJB 4TL5A 4L1SA 5F9WC 1KN4H 2PXYC 5FF6B 2OP4L 5IB5B 1NBCA 4OZHB 2P8LA 1RQ5A 3RGHA 1TTGA 1T1WA 1MVFA 3PWVA 3UDWA 5KL0A 1WRFA 3MACH 4ADJA 1RMFL 1R3JA 5LQBH 2DQCL 5HDWA 5IBLC 1TCRA 3OJDA 3HJ0A 1TVBB 4G1EB 4GQQA 4A55A 1MCWM 5KYUB 3SD5A 4TOYL 4HJJH 5GISL 4PY5A 2EO9A 1TFPA 4JO1L 3VTMA 5E24E 4QRPB 3SKUD 4C54A 3NYKA 5DUBA 4V1DB 1GS8A 2K7PA 4WGWB 4Z7UA 5AVSB 2J1ZA 2DMBA 1CFMA 2C9QA 5I1JH 4YSDA 4HIHA 1IFGA 2H0EA 3MA7B 3QDAA 5FXCH 3TO4D 5F7NC 1RU9L 4MNQD 5EOQL 4KK6C 2JHNA 1GGCH 5L2JB 2IALA 3H0TA 2VXVL 5BJTA 5AN4A 1L9MA 1J1OL 2O3OA 4M5YL 3PDOA 5C0EB 2FX9L 3BKYL 4ZPTB 3D09A 2PWEA 2VAJA 3W39A 1DE4B 1ZMYA 2FLBT 4FOMA 4NT6A 4HWEL 4YXKH 1A6PA 3KPSA 4UM8A 4WI4A 1O6SB 3OH6A 2A74C 2GKIA 1SJHB 4OZGA 3TTYA 3ULVF 1LEKB 2WAQA 3QULB 4JHUA 4JDTH 2H6PB 4LHUG 3MJ7B 2NWVA 2ED6A 3TH2T 5D1QB 3MFGB 5EU6B 5HHQB 2ATKB 2OSYA 4QWWD 3L3DB 3V5HB 4BHUI 4G9FD 3GNML 3GK8H 3LVEA 4JFFD 5A2LH 4NHUA 5J11C 2RACA 2N4IA 2GHWB 3DPDA 1AXIB 5BZZA 5F9OL 3O45B 4U3HA 2FECI 2GTZA 3SDCB 2BVOB 3QPQD 1DO6A 3V6OA 2KS0A 4PJ7F 5JMOC 3IE4A 1HZKA 1TMCB 1KC5L 2DQUL 3QZWG 3WO3B 1JL8A 3D05A 3FO1B 1EUUA 2B9BA 4JG0L 4LMQI 4E41B 5FYKL 4TUJB 4H7VA 3KWWA 5F1NA 4KROC 5GRYA 2J55A 1T6BX 3W0WA 3ULUF 3HUJE 4ZUSA 3EFOB 4KDTA 4M4RA 5I71C 1D7FA 3CDGA 1DLHA 5JPMB 5ACMA 4UQEA 1IX2A 2VRAA 5CBAA 1H9VA 2Y7NA 3TN0A 2WBXA 1F4WH 3L3HA 3SQBB 5C2UB 3EDJA 2BY2A 4NP4H 2QELA 2PW2A 4YLCA 2WK2A 1WFNA 2JCCB 6FABL 5IJDC 2C3XA 4X5QA 2YAHA 1RPQA 4UT6A 3CD4A 1YYCA 3O9WD 3DUHA 4QRUB 3MRIA 1BVLB 2FJGB 5HJBA 5FYKD 1K5NA 4KMTH 3T0EA 3HPLB 3S2AA 3BT2L 4D0BB 1EJ8A 3LXBA 4YLQT 1ZLVH 1BFOA 1U8HA 3LEYL 4HEME 4Y2OB 2R2HB 1C16B 3HAEH 4G8FB 1ZLWK 5K9JL 1I8MB 1BOGB 3OJ2C 2LFGA 5DD5L 5CCGE 3V4PA 5C6TL 4JPWH 1NDTA 3MLWL 4B0MB 2KH2B 5C07D 5ILTH 2VLJD 1CDGA 3IYLW 1CD8A 3QPKA 4PJEA 3NJLA 4XAWH 3WTTA 3ETBJ 4Y2DC 5E4AA 5LXVA 2HKFH 2IC2A 2WNKA 1PCXA 3LSOB 5DA4A 1ES0B 4KTDH 2X9YA 2R69H 2HKPA 4F27A 1XCWA 4F7CB 2I26N 1JE6A 2ALWA 4WHDA 1GTFA 1F3JB 5TE7L 3TF4A 4IEFA 3STBA 5IGXH 1VFUA 3QXTA 2Q1EA 1G6RL 1BMGA 4B3VA 1PVHA 1R4XA 3QORB 1MFEH 2PKDA 3U0TB 1YC8A 4NO5B 4PM1A 2NSQA 2CRZA 5LBGA 5J0BA 2OCJA 1RUAH 5CP7B 2C9PA 1S7WB 4GXVH 1QATA 3CWUA 3I0WA 4TTGA 1UWXH 2Y69B 1IILE 4PLOB 2EDLA 3QUGA 4K3DH 4M1DL 3VXRB 5KYWB 5IB4B 1ILUA 5AW5B 2OXGB 3OKDB 3KVDD 4F91B 2NY2C 2ETWA 3O8XD 2E46A 4J23A 1KJ3L 4F5CE 1FN7A 2FBOJ 1K72A 4HUUB 1RZPA 4HFUL 3SKOB 1NGYB 1VKXB 2W9LA 3WXWL 3T9WA 5LG6A 5EA0H 2IXQB 2LVEA 2DQMA 1DJGA 5FA4A 5KVFL 2EVFA 5FECB 4X0KA 2R0ZH 3UG3A 1KXVC 1IC7H 4HUWA 2VDRB 4UTAA 1EGJL 3FFCA 1EJ6A 4HJTA 2VNCA 2YPVL 1QFWI 2Y07L 3VD4A 5K93A 1QSFD 5JXAH 2WAHA 5C0CE 4IYKA 2QQLH 3DV4A 3P9MB 2A83B 2K8QA 3DIVA 3ZE0E 4F93B 3VXUE 4HIQA 3BGAA 2COVD 4ODWB 2M83A 3HRZB 4U0RC 3RPIB 1GHFL 2VQUA 4JREB 5HXMA 1NC2A 1ZCRA 3CCHB 3UAJD 4GUCA 2HVKA 3HUJB 1BAFH 4M7LT 1TQUA 1U8LB 1WITA 1YYMH 2IJ0C 2BNRD 1JZ3A 2OZ4H 2YRLA 4AYMC 2NVMA 3QG7H 1N64H 3WGUB 4KKLC 3MPCA 3CDZB 1SNRA 5TE4H 2EZ0D 3CDYA 4I2XA 3KPRA 5T1LA 3VXQB 4GG6B 1YZZA 4YXHL 4J12A 4KJPD 1YEDB 3PP4H 2FECL 3IDXL 3FQRA 4OD1H 4HHWA 2X4RB 1CLZH 2CK2A 4W4OA 3MTRA 4L4VA 5LNGA 4KZEL 4R2GC 1M7DA 4OSUH 1GPOL 1RY7B 2NYZA 4EN2A 2R23A 5FKPB 4RBPH 5IQOA 5BNXD 2YKKA 1QSVA 2ZWNA 4NKIH 4YSCA 2CKBA 1UXWA 2XG4B 1YEFH 4X9YA 3T3MF 2NUTB 1ZGLB 1TZAA 3QEGL 1YN6A 5GGUB 3UOAB 1PGRB 1TTCA 4NO0D 3N9GH 1HOEA 3S97C 4IBZA 4BZ2L 3O2WL 1FH5H 2AZAA 3C08H 4JFPA 4X6EB 4L1LA 1R33A 3MRQA 3DSNA 4Q58C 4YBLC 4P5KB 3BHBA 1E4XH 2A73B 3CVBA 5FYJU 1SXCA 4EPSA 3CLEL 5DMGD 3R7RA 3CZSA 1CGTA 3QWOA 1I9RL 1NKOA 1ZK9A 4NQCA 3VWKB 2B2XH 3DPBB 1JZ7A 4AOFA 1QABA 1F11A 1F58L 1R24B 4X8GA 3QZBA 5ENWA 5IMOB 1KCUL 2ZXWB 5ECGA 4ZW6A 3EOTL 5TFSL 1HT6A 1JZ2A 3LH2L 3NP4A 4PJAE 4BYHA 4LAQL 5DO8A 2G4EA 1RFDL 3AM8A 3DDGA 3DJ9A 2R0KH 3ZMNA 5GS0L 2JOIA 2ZX8A 4G42A 4KBPA 2WOYA 1DBKH 1DQJA 2QDWA 3PXJA 4PRDB 2UWEA 2QZQA 2EJ1A 3KL3A 3HE7A 5C09A 3TX4A 1OPOA 4ODTH 3WIHL 1MCWW 5JHDA 1EBPA 1E5AA 2RHEA 3ARDD 3HMWL 4KNQA 4JM2D 3UTSD 5SV3A 4PRBB 2OOXA 1NPNA 1T5KA 3DUUA 1EDQA 1IEAA 1N0LA 4A6YL 2J25A 1C5BL 3ESUF 5PAZA 1JPFA 3MBWB 2FIKB 4BGDA 1H8LA 3DMMD 1CFTA 2ZT9C 1JVLA 3NRPA 4NRYB 1I8LC 5DFWH 4EI5C 5B38A 1SVCP 4ZUVA 5DD3L 3FO0H 1H3TA 4D0DB 4PIBA 5AEAA 4L48A 5GS0D 3UBGA 2R9HC 1JMXA 3KE0A 2QHRH 4M48L 2R51A 1W72L 1XF5A 4N2IA 1RERA 3VFUA 2VLMD 2A6DA 4ZFOB 4ANXA 4R8WH 2C1OB 1IC4L 5C08E 2VDOL 5DDHB 4YO0A 4YXLH 1UJ3A 2XFXB 3D33A 3H9HA 3PXHA 3ZE0B 4P5TC 3VXUB 3CWTA 2G30A 2JKTM 1W91A 4C56D 2PTTB 3QDJA 3VCLB 4P99A 3QNXA 4NUGL 4UOJA 3EBAA 1P7KB 2IAMA 4I9WD 1QR4A 5I1KH 2V5YA 4FQHB 1OP3H 4WFFD 3BISA 2J56A 3EKCA 4XBGA 4UAOC 2AC0A 2BDNH 5E2VL 1QRNE 5EORH 1BF5A 4UQ3A 3WNPA 1F13A 1T2QL 3K6DA 5IBUG 1XF1A 1YQVH 4JM0A 4TQHA 2Q87A 3RDJA 1DUYB 3L7EA 5F1OB 1PLBA 3L1GA 4KRPC 5GIRA 3CVHL 3MUGA 3LPGA 3A6CH 3O11A 4IHOB 1J8KA 1QFWL 4MJ6A 1YAZA 5HDQL 2HFGL 1JWSB 3VE0B 4BWUA 1KCBA 4OCXH 5DMYA 4JFOA 5C8JA 5I1IH 3WCYA 1HYRC 2APVA 3KXFA 4FFVD 4M3JA 3RB7A 1AD9B 3VXMD 1CQKA 4EAKA 4HPYH 1AISA 4OKVA 4DO4A 3KR3L 4M5ZH 4Z7VF 1IC5H 1WHPA 3SE6A 4FZ8H 1FG2A 4QHNB 2VLRE 3D0LA 3QHFL 3GSRB 1S78D 3DUSB 1J5OL 3EJUA 5I9QB 2DQTL 3EYQD 1K2YX 4LSQL 4L05A 3UTQA 1MCPH 4EI0A 3MOBL 1GRWA 2CHNA 1H6UA 1AZBA 2JTYA 4IQHA 4QG5A 1OB1B 4L4TE 4AVKA 5IUSA 3G5XA 4ZMOA 4R0LC 3W3BA 3E9UA 3HPJB 5KS9A 3CHRA 3EYSH 3QFJD 2GJJA 4HQQH 1KBKA 4WI2A 5INDB 4M62L 2FH6A 4TNWK 1O5PA 2OJEA 4ODVH 2FWSA 5ELIA 2WZPA 2WTRA 4XPBH 5L2KE 1JTTA 4JB9L 4KX8A 3O3DA 4FLOA 3KWVA 4FQXB 1BCIA 1JK8B 4N3TA 1KYOJ 2V2WB 4G80B 4JVUA 5AVZB 5HHXL 5C7ZA 4BQ9A 3I6LE 5IK3A 1CXLA 3UBXB 3ZHFA 1AXTH 4PJAB 3IU3A 1FO0A 4N8VB 3IVKB 4TVPH 3SOTA 5HYEA 3OAWA 4M6NH 5IQ7L 2NW3B 4K8RH 1TUOA 2VDPL 1LE9B 2FKFA 1C08A 2NLVA 4X5LA 2EVIA 1SOKA 2O1AA 3L4VA 2ZXCA 2LAGB 4K73A 2H9GA 2ROXA 1E28B 2XV3A 2NXZB 1IMHC 1YPZF 1F90L 4JHAL 5I15L 3FUDA 4KVNH 1KJVA 2VLKD 1AGEB 3VI4E 2OFQA 1C4GA 5EZOL 3SE8L 2A77H 3WHE0 3W11D 5EDSA 1NCWH 5BMFL 3FT9A 2CRIA 4JG9A 3VQLA 1QSZA 4TL4A 4X7TB 5AVXB 3UTPE 5FUZL 2IFFL 5KJ4A 4WO4A 4F57H 2PCXA 3OXRA 3MJGX 5KVGE 1MN4A 2MPAL 5GXBB 1IKFL 2P28B 5FGBA 3CVTA 2Z4QB 3D48R 5C08B 3K1DA 5I0VA 1HHJA 4XBEL 2WIIA 2VMDA 3VXTA 3G6AA 4QLWA 5JA8B 3Q1EA 1RURL 4KDWA 4QIRA 1J8SA 2CBQA 3QDMD 4U1IA 3A4DA 1ADWA 2GUOB 2WTPA 4WU5B 2NLJA 2ZICA 1ASQA 1JCVA 4WW1B 5B7EA 5BPPA 2VLLB 3Q5TA 1C7TA 1G4MA 1QRNB 4OF5A 4P23B 4WAFA 3B34A 1MW1A 3H55A 3MLSH 4JZOA 4X42A 4K71C 4GG8A 1LO5A 2BZ7A 1HZHH 1MY7A 3NCXA 1XZ0A 1A1MA 2EKSA 3H42L 3LKNA 2EDKA 1CLOH 2J5LC 3ZZQA 1TF4A 5I74B 2HFFB 2DQHL 3GD1C 3KS0J 2J4WL 2IBZY 2VZVA 1OZUA 2A1WH 3RI5F 3W37A 5DC4B 2PCPB 32C2B 3NCEB 2RTTA 1ZLEA 3B8YA 4I7ZC 3H2QA 3LPOA 4AQAA 2VLRB 5DO2D 2VZ3A 3JZ7A 4WW2B 1FC1A 4NNPH 2EO7A 1H5BC 4JFEE 4DGIL 1PJ9A 4G6KL 5E2TL 4PRNA 4QRPD 3MBEA 1RZGA 3D52A 5CEZD 1N26A 4DQAA 2XPGB 4V1DD 4L4TB 2NY7L 4DTGL 3DRTB 1IFHL 3WN6A 4IRZA 4GAJH 4MSWB 3WHXA 3WLWC 1QR1B 5GS3A 3ZQWA 3FU7B 3IKCA 4W93A 4XC3H 3EIFA 3KYOB 4WU7A 1T04A 4XOAA 5BVPH 3MGTA 1OPGL 1A9BB 2EIBA 5CCKL 2RBLA 2CGZA 5LGHH 1KNOB 2ZG3A 3UEZA 2OKMA 1QMUA 2CE6A 1T5WB 2F7QA 3RDTA 3ARBB 4W68A 3MC0A 4BH8B 2D03L 4U1KA 3U7YH 5HYSB 4QXVA 2O5ZH 3CSFA 3QBTB 2X3CA 1RZKL 2EXTA 3FQUA 1XR8A 4EMZA 4P48A 2ADIB 1A6UH 3IDNA 5D1QD 4JL1A 4XWOD 5EU6D 4DKTA 4F15B 2NY1C 3VGHA 4BD4A 1YEIL 2H6UA 5EFIA 2AK4A 2NY5H 3KGUA 3V6BR 1MEXH 4UNUA 3VI4B 3SGDI 5GGTL 1P7BA 3KPSE 1HWGB 4O2EA 3E2HB 3BWUF 4QRQA 2CDEB 3EDKA 4BE6A 3L13A 4HK0B 4OZGE 3D7QA 2JQZA 2FGWH 4JUSA 1KB5L 2EIEA 3SGJC 3GUTA 4X6CF 2WXRA 1BG9A 2DJ4A 4RMQA 3WV0A 4E41D 2R29L 3BKMH 3DSFH 1ET8A 5EIVA 1CXIA 4JPIB 4FAAB 5DVKA 3X1EA 4HT1H 2HJFA 2YD0A 1XGTA 1NMCB 2YWZA 4K7PL 5EO9B 3UGEA 2OR9L 3SDXF 4CU7A 2B3IA 4LVOB 2ZG2A 3BAWA 2P46B 3ZTNH 3EF7A 1TLMA 4PGCA 1M7IA 3V6OE 3VG9C 3NEXA 3VXPA 1UKTA 3GTNA 5I1LA 1AVAA 1L3NA 3KHQA 4Y1AB 3ZL2A 4XBPA 1FFNB 5DGRA 3C2SA 3S7GA 2HVBA 3T4NA 1NVPA 1ECYA 5DRWA 4B5EA 4AW7A 1F1DA 4N2FA 4R96B 4I5BA 1DVFA 2CUIA 4NENA 1NUGA 5DHVB 5IR1A 4TNVF 1NLDL 4RQQA 2DM2A 1BJ1H 3W0WE 5I82A 1EVUA 1U8NA 3B3BA 1ZAGA 3FCGA 4JQIA 3CDFA 4ZQTA 3D9AL 3WTVA 4TSAH 5KVEE 1NDMA 1QUPA 1C1EL 1BOYA 2H0JA 4MA8H 2FQGA 5HDLA 2PR4L 3CK0H 2B39A 3H9ZA 1T03H 1E7VA 4JUTA 1TQBC 4P9HC 5DUPH 1MJUL 4LLDA 4XNMB 1HOCA 2OYMA 2WP3O 4HCIA 5E8NB 5IW1B 3IFNL 2WNWA 3LHPH 4B9KC 2QTEA 1FAIH 1EXHA 3F6LA 4JFEB 4MLSA 3T0EE 1HL5A 2X4OA 4RWHA 4DKFH 5IUCA 1N10A 2ZOUA 2R7EA 4PGBA 3OG6B 5T1DH 1GVIA 1YMHA 2APTA 1BAGA 3DHMA 1DQKA 4NBYB 1GIGH 1FDLL 3KLSA 4RAVB 4CW1B 4MHHG 3H2PA 5DQJA 4ZFGH 4GIOA 3TA4D 4O2FB 4G5ZH 1A7OL 2H3NB 3SDCC 3W5MA 3BUBA 3IDYB 3PWLA 4X7DC 3OGOE 3D5OF 2VAAA 1K6QH 3ZE2E 2P8LB 3US1A 1T1WB 3PWVB 3RVTD 2Z1KA 1RZKC 2VDRL 5B8CA 1MQKL 1R3JB 4MXWH 5EU5A 1TCRB 3OJDB 3GM0A 1EMTH 4OFPA 1M7XA 3VXRD 2EO1A 4Z7NE 2GTQA 5CM1A 2BNQA 4XPGH 3V0IA 2Z8VC 3LN9A 3MV8A 5AB0A 3CZUB 3DVNA 4ODSH 5DUBB 5HGAA 4HBCH 4B9GA 4K5LA 4HS8L 5AFAA 3NFNA 1AFVL 4HIHB 3ZYIA 3PDKA 3NPSB 4XPAL 5DC0A 1DTUA 2HTLD 1V5JA 1P9MA 3QIBC 4JN1H 4O9HL 5HTSA 2QRDA 4YQXL 2IALB 3H0TB 2ZYHA 4GP4B 4JFUA 4B7LA 5BJTB 2NQDA 2VH5H 3FTWA 5BZXA 3FB8A 3QP3A 3PDOB 3LIZL 4AEHL 3AREC 5F3FA 4X9FA 3W39B 2HX8A 4BINA 5BUAA 4NT6B 5IT2L 1MJ7H 3GSVA 4UM8B 3KPSB 1A65A 4G7VH 4R9HA 4B6ZA 5EUKA 3OG4B 5C6PB 4OQTA 3PGCA 2YEQA 4OZGB 1L7TH 1WAPA 1P69B 3TL5A 4IRJC 5CN1A 3QI9C 2O5XH 1VHPA 1MNNA 3FTGA 3HC2A 3BN3B 4NRXA 4XMLH 2A4CA 4Q56A 1N7ML 1P84J 1O7DC 1RZFH 3EO9L 3UBXI 1J86A 3FFCE 1HXKA 1KGIA 3PWNA 4NHUB 4E9RA 4F24A 4UYQA 4ZMVA 1IEBA 5I75B 2WVUA 2GTZB 2ZOOA 5CJQH 4S1SH 3U4BH 2P48B 4PJ5A 5GZNC 1E4JA 3F8UB 5D6DC 3OV6A 4L9LA 4ZT1A 4TUUA 5CWSA 5FCUH 3QORC 4HCRH 3NH7H 5F44A 3AVEA 3KWWB 1BFTA 5F1NB 3W0WB 5BO0D 3QH3A 3O4LA 4XP5H 1FJ1A 4ZUSB 2HLEB 2QV4A 4M4RB 4BZ1L 5I6NA 5DZOA 3CDGB 4WFHE 1QFWM 3GKZA 3JTSA 4NGHL 3ILQC 1CFQA 1DLHB 1DR9A 1JNLL 3JBG7 4WJG3 3II2A 5FHAH 5CBAB 1U2YA 3TN0B 5T5NG 3HNVH 3L3HB 5C3LD 2RD0A 4JKPL 3THMH 1OE1A 3P9WB 3V52H 2PW2B 4YFLI 2H8PA 1ZOXA 2ZONA 3HNTL 3N40P 2Z4TA 3F2LA 3NIFF 2ZUYA 4I2XE 4CU6A 3KPRE 1OE3A 3GSOA 4BFRA 3IRZA 5DVLA 2CXGA 4J5VA 3MRIB 1N39A 2V9UA 5CZVL 1FFPA 4NIYE 1K5NB 1DVSA 3T0EB 4PLNC 1NINA 1RKRA 4FHKA 4L4VE 4JPKH 1BFOB 1U8HB 2E6QA 3BQUB 2XTJC 5AOKA 3VWKD 3JT2A 3V4PB 3CZNA 1J5IA 2VKXA 3KVQA 2BHZA 1FYHB 5EC2A 4W9JC 2CGRH 2YD4A 2Y3NA 1DVQA 2AEIT 4OCWH 4PJEB 5HHVH 7FABH 4S0SD 2N7SA 2X1XR 4IU3A 3ZE2B 3MLXL 3L5IA 1CQYA 4R4FH 4D8PA 1WGVA 4NJAH 2YFOA 1C7SA 4JRLA 4LZKA 2WWKO 3ATDA 4JREC 1DJHA 4YN3A 3IN2A 5FUCE 3FMGL 4N26A 4ZFOL 1OT1A 5EIIA 3KM1A 1GYWA 1PG7L 1YY9D 1KZYA 3AB0B 4NQCE 2F8VA 3C09B 4IEFB 4J8QA 4FFZA 2IDTA 3BH8A 4PB9H 2R56L 1R3KA 1TJHH 2B7DT 4YZFF 1NH2A 5ALBH 2CR3A 1CO1A 3VGFA 2ZP9A 2DKUA 1KFQA 3F7PC 1WV7T 4H88H 2J3SA 1KIQA 3QJXA 4F3FA 1FSKC 4XNUL 5I26A 2F1AA 4RISH 3WSQH 1RZ8A 2M2DA 3FULA 2UWEE 1WPCA 3LKPA 4U1MA 5C09E 3FS9A 2IDQA 3E38A 4HD5A 1S4IA 4NFCA 4TM9A 1DQIA 1ID2A 3BN9C 5JHDE 2V17L 1B0RA 4O02A 2CUHA 2FSEA 2RALA 1X5AA 2XZCL 3JTBA 1I8IA 3UYRL 1S46A 1QTYT 4P4KA 4YDLC 2VDQH 1J0KA 4P5MA 3VXUD 3UTZA 5AAWC 4M8RA 4Q9RL 1G9NH 3KH4A 2DQGH 4PY8J 3NJXA 1ZLSH 4NEHB 2AABH 5FA4B 3ZQ9A 1IAII 3EHBC 4K3EL 4X0KB 1A7RH 1UUNA 4HUWB 1H3UA 3FFCB 3IJ8A 3VGBA 4X2UA 3X12A 4AC2A 1F45A 5GRXG 3ULAB 4NCC2 5CLZA 4OCRL 3JVGA 1R5WA 3KBEA 3RL1A 3ECWA 4YS4A 3CQPA 1WK0A 5KTEH 1DBAH 4DH2A 5F70A 4IJ3B 1A14L 1NIDA 1NOAA 1LQSR 3LZPA 2JB5H 4ZFZA 3ZZSA 4OCSL 5IROA 3Q7JA 1L9OA 3IGUA 3QDJE 4IGBA 1MZZA 2QVTA 1U41A 1NC2B 1RZIA 2HVKB 1RL1A 4QD2E 2C1PA 4M02A 2Z35A 1KDJA 4Z7WE 3CQFA 2CCLA 4O4YL 3JWOL 3DVGA 2DIEA 4OGXL 2DWSA 2Q86A 4QUOA 4F58H 4A2HA 3LS5L 1RAMA 2V6HA 4I2XB 1YEEH 4GRWH 3KPRB 4OLXL 5T1LB 3P3RA 1WFJA 2ZXQA 3GSWA 3MJ9L 5CLYA 5EOCJ 3RVUC 3A0OA 3FFOA 3FQRB 3KXFE 1JNNH 3F7LA 1I75A 2VO8A 1IKOP 4PS4H 2BVQA 5AZUA 4L4VB 2A9MH 2KC0A 1M7DB 1KPUA 1LWJA 4OVUA 1OP5K 4BK5C 2R23B 4ZUUA 3IFOA 4GUOA 1P1VA 2UVEA 3BVUA 5D71H 2CKBB 1UXWB 5F71A 4AWJC 1DQLH 2Y36L 4FQXD 3ZOAA 2VTFA 1YN6B 4TVSa 3N41B 4YPGA 1NAKH 2E7LC 2ZAGA 2XZAL 4XP1H 5K9KA 1KLGA 3VMNA 2P3YA 4JFPB 4ZO6A 2BY0A 3MRQB 3DSNB 3I2CH 1W16A 1TTAA 3TBTA 4GBXA 5F0JB 3BHBB 4X6FA 3NMEA 3EO0A 4DPRA 4PS8A 5KS9E 1BQSA 1G1YA 1LXMA 1TETL 4Q9QH 1TPXB 1U3JA 5C7XL 1ZSHA 3HOGA 1C12A 4NQCB 4JO5A 3PLYA 3NSJA 1GY2A 2NY4C 1PSKH 4PW3A 5FKAA 5JIIA 3QJVB 1F11B 2NXZD 1DBML 1IGTA 5ENWB 3T4AC 1FL3A 2YEZA 4P3CH 1NUFA 1QBLH 1YNKL 4HAFA 2NZ9C 2A38A 2W81C 4PRIA 4DGUA 1MJ8H 5G4NA 1DEEA 2TRYA 1HS6A 2F18A 4DO5A 3D07A 4G42B 4DF9A 3TEZA 1DQJB 2UWEB 4Z7QE 2VCOA 3HE7B 4ZUTA 5C09B 3TIEA 1QNIA 3KLHC 2UXGA 1M3JA 5C08D 5JHDB 4UTBA 4XTRC 4Y5VA 1E30A 4K5MA 1WO2A 5SWQA 4P2OD 1FHGA 4EVNA 3DUUB 1IEAB 1XMWA 1XTLA 4EIUA 5TE6L 1JPFB 4Z95H 1A7PL 3AY4C 1CFTB 1X9UA 5I9QC 4AVHA 1CYXA 2G5RA 3WI9A 5B38B 2Z0FA 3OSMA 4ZUVB 5DJ8A 4I18C 2ZXEB 2RGSA 2X88A 4OZFG 4FQ2H 5E70A 4LU5H 3O6FA 4LB8A 1XB8A 1QRND 4P23D 5IBTL 1XF5B 5CP3A 1DP0A 4XXDA 3RWJA 4IMKA 3W57A 2PPEA 5F7WC 3VFUB 2A6DB 4M4PA 4P59H 4B0MM 3WD5H 2R15A 4N8CH 4PJFF 1TTUA 4YO0B 1DFXA 1UJ3B 3INUL 1GY1A 2B4CH 4PD4J 3H9HB 2VSCA 4PW9A 4LNRA 3QDJB 3PP3K 3JWOC 4LPTA 3QNXB 5E2UH 3QZMA 3WFEH 4OFYD 3WIFA 2ZOLA 2IAMB 4PS3A 4DVRH 3TA3A 3O6LH 1MQ8A 4B7IA 3BPNC 3RWEA 2NNCA 4XXCC 3MBXH 3KRMA 5AYUL 1CWVA 4X6DA 4YEFA 1J5DA 3MLYL 4XBGB 2VLRD 4UQ3B 2H0FA 4Z7WB 3ZUNC 1QN9A 3FT0A 2Y72A 2NY0B 3L7EB 1IAIL 4JFQA 5GIRB 1TDQA 3MROA 3MUGB 4U3CA 3V9CA 2XQ0A 3L3OA 2DZEA 1LDPL 4WUKH 1PLGL 3O11B 2WCSA 2WVSA 5KSAA 4MJ6B 2FBRA 2OR7A 4L4TD 4LEXL 43C9A 1VTLE 4JFOB 4KXAA 5C8JB 4PJCF 5CD5C 3KXFB 4GMSL 4RGMB 1W0YT 3HLAA 4OKVB 5E0QA 5EU7E 5A2AA 1UZ6F 2Y06H 5HI4D 4I0PC 1UT1A 3NT0A 2EDRA 5GGSY 1WIPA 3GMQA 5SX4I 4KK8D 1FG2B 2ZIDA 3HE6C 1PF3A 3D0LB 3BFQG 3DVIA 4MA1C 2DQIL 2OJZH 3L4ZA 2YXFA 1MI5A 4OT1H 2N56A 3I6LD 5DURB 2HKHH 1MWAA 5J5EA 3UTQB 3ARBD 2HRPL 4N4YB 5IJKA 4DEUA 4JNXA 3TT1L 3TEUA 4LPXA 1IGMH 3GHEH 3SOBH 3QDGA 2ZF9A 1VLXA 1ACZA 3G5XB 3UAAA 3PL6A 3BPCA 3B37A 4G8IA 1PZ5A 1YEJH 2F58L 5KS9B 3L95A 5KVGL 2GK0A 2QVMA 3SE4C 3SYPA 1F4AA 3NA9H 4Q0XH 5F1SA 3GXIA 3G6DL 2OJEB 1QBML 3Q1SH 3UC0H 3N43B 1H3PL 2WTRB 1GZHC 3TOPA 4FXLA 3O3DB 5BO1L 4WFEE 2FLRT 4LRIA 1KWGA 2VW6A 5H4YA 5IK3B 3ZTDC 4PJXA 2P4AB 1PCMX 3MJ6A 4XX5A 3IU3B 1FO0B 4M7LL 3UZVA 2FJUB 3QUZC 4FTDA 4Y9FA 1UUSA 1DSYA 3UTPD 3B9KC 3H6AA 3DYMA 1G0DA 3IB4A 1RV6X 2VRKA 1SMOA 4FXTA 4X80L 4YEEA 1C08B 5I74C 4GQ9H 5IHUL 3AMLA 4YHKL 3KJ6H 3UROR 2K1MA 4TMPA 4TQIA 2QQNH 2YA2A 2LVCA 5KN5A 4PI2A 2XG5A 2H9GB 1H6EA 2Q7NA 2QGCA 1NGMA 3LKQA 2AK4E 2CUAA 1H6FA 4WW2C 2F5AL 3VNYA 2J7LA 3DROA 1KJVB 3MYJA 1VEOA 3ZKXB 2OPCA 3EJYC 4MAUL 4EOWH 1CGYA 4KNTA 2G4GA 4Y1AD 3OCIA 3SPVA 1MG3C 1OKEA 4WO4B 5JHLL 3OXRB 5A7EA 1EVTC 3U0PA 3IPEA 1ZGLM 1HEJC 4J4PD 1KCLA 3RZCC 5AENA 3P3SA 4YFEA 5E4EB 2PABA 1IBYA 1HHJB 2E8ZA 2ENQA 3UGUA 5T33H 2WIIB 3IDJA 1XR9A 3G6AB 4HZLA 3VXTB 4DCQA 5KVMC 1HX0A 3WE1A 1PW3A 2WKGA 3ZDZE 3CHSA 4KZ0A 3OHMB 4TS6A 3T0WA 2B77A 2IF7A 4U1IB 1VACA 3QW9A 2NLJB 4XMZA 1RUPL 2XKNB 1NIAA 3E7JA 4UUJA 2AJSL 3KYKH 3WMQA 5A6MA 4KZCA 4IKNA 3EYUL 4PG2C 2ZUQB 2CO4A 2EXWD 3QNZA 4JZOB 5DI8A 3NQIA 3AQDA 1LO5B 4M7KH 1KTLA 4GEJA 1VCBC 2OMXA 4MS8D 4Q89A 3DLQR 1XZ0B 1A1MB 2EKSB 5F7DB 4F15C 3LKNB 2PLTA 4LESA 4OF6A 1TEGA 4KKCD 4I8DA 2F68X 3IE9A 4KX9A 3NEOA 5KBKA 3QRFM 2XZQL 1X5JA 2W59A 3K0YA 5GRVL 3LEXA 2JJSA 1WAAA 4JL2A 4WY7L 2ZNXA 3MYZA 2DY2A 1W6WA 1ZHLA 5FLUA 4FNLH 2MQCA 4AQAB 1SBBA 2R83A 5FX3A 4ERSL 2OL3H 4ALAL 4WX8A 2VDMH 1ZHBA 4F8OA 5I0ZA 1YLBB 3MREA 1JUFA 1Q1JH 1I1AA 4PRNB 5CZKA 1DQVA 1TNNA 2E27H 3MBEB 4BFFA 1RZGB 1PD0A 4JDVA 1WS8A 3ZMEA 2UXTA 5GSRA 1NMCC 3GXTA 4IU2A 4LDCA 3WHXB 4LSUH 1FPTL 3IKCB 4BM7A 2FWLB 4WU7B 1T04B 3MGTB 4YC2C 1A9VA 2VR7A 2RH0A 3P1VA 2IBZX 4KC3B 1R5IA 5DZLA 4CSTA 3RPKA 2X1WL 2AQPA 1SLWA 2EYTA 2VZTA 3HAEA 4RLDA 3CXDH 3RDTB 2I60H 4RDQF 4XN8A 4U6YB 3MV8E 4U1KB 2CLZA 1TT6A 3ARGA 3QO0A 1MIML 3RA7H 2VERN 5CR1A 3BRDA 1OAYL 1WWCA 3FQUB 1XR8B 4MMZC 2Y7QA 2G9HA 2FHFA 3IDNB 1Q90A 5GRUL 3UIYA 2MJ7A 5KWYC 4YLBA 3T71A 2E0PA 2VSKB 3MO1A 4M7JH 3U0WL 43CAA 4DKEL 2X38A 5BQDA 4UT9H 5CEXA 5EFIB 1P0SE 2AK4B 2R69A 1IQWH 3N42B 5DJXA 4PY8I 5IG7A 4DNLA 5KVEL 4AH2A 4H8HA 4KJYA 1U42A 1E9PA 4ZMAT 5CGTA 2DEWX 4O2EB 4X98A 1D7CA 2VUOA 1FH2A 2Y2WA 4WJKB 4QRQB 3AQXA 4UT6L 5GGQH 2JLLA 4ICXA 1DL7L 5GRZA 3GUTB 4KI5F 3NCBB 4OH2A 3ARQA 2B1HL 3D50A 4XE0A 2AERT 2VXUL 5EU3A 1ZT1A 5I1GL 1OALA 4MNGA 2I5YL 2Y7MA 1VIWA 2BMKA 3H8NA 4L5FH 4OR1A 1U8MA 2B1AH 4XN2A 4AE1A 2Q7YA 1DSFH 1PPIA 2HJFB 4GRLC 1XGTB 3V4PL 4GW5A 1E7UA 1CIDA 5D1XA 1XB6A 3GQFA 3KGRA 3NCWA 4PGCB 1M7IB 4PJ5E 4ZW8A 4RFNB 3VXPB 1F41A 1RIVL 3WIIH 2IMNA 4L9DA 4XBPB 1U58A 2EVGA 5A3ID 5JIPA 2HG5A 5GGVY 1E9OA 2QSCL 2FT7A 3A5VA 5DRWB 4XCFL 4I5BB 1KTRL 1N70A 4EXPX 1DVFB 4NENB 1R0AH 5IR1B 3BPLB 4RQQB 3QNFA 4Y4HA 3T0ED 2XVKA 4A7UA 3IKKA 1E2VA 3JT0A 3O4LE 3V4VH 4I3RH 1U8NB 1UOLA 4QHPA 2FQDA 4J6RH 2XWZA 2MCPL 1SXNA 2XLLA 5FK9A 3GMMA 5T1JA 2IDCA 4H0IA 5AB1A 3U79A 1NDMB 4AQ8C 3S3JA 3VRJA 4YDKH 1ZLUK 3WFDL 1PBYA 2AV7A 2Q7AA 4RA3A 5EG6C 2J21A 4J3OD 4LLDB 5F96L 3IRPX 4JZJA 1HOCB 4ZPVA 3U4EA 3ULVE 2NY3C 1BYOA 1KCRL 1NA8A 4XMPH 4X6CA 2XYBA 3PUUA 2NX5D 2X4OB 1AGBA 2CWRA 2XV6B 1U6AL 2IOIA 5IFAL 2R7EB 4PGBB 1RI8A 1YEHL 1VERA 1YMHB 1ADQH 1UOWA 3EJQA 4HJ1A 2NDGA 4BCZA 5AKSA 5DQJB 4TQEL 3EZ8A 4LVHC 4K3JH 2CPCA 1HC1A 4N5ED 2WXJA 1X9QA 3PWLB 4P9HH 5JW4M 2VAAB 1EHLL 1MVYA 4KI1A 1CL7H 2EDDA 4ZW5A 1X4XA 5LLIC 1A02N 4G6JH 5B8CB 1HTYA 2CMRL 4UTAL 3OH9A 5EU5B 1B2YA 3U9PL 5D72H 2KBGA 4X9BA 4CVZA 1KN2H 2BNQB 2WP3T 1OANA 1IBBA 1RK0A 3MV8B 4BBWA 5I1EH 3DVNB 5HGAB 4JRYA 5JQHC 4J2QA 5E6ID 3MRRA 3NFNB 3TN0C 3S36X 3B8SA 1E5CA 5DRZA 1WEJH 4PBXA 1IE5A 2BZCA 2P7TA 5CIPH 1AAJA 3X1NA 1AZZC 1JNHA 2PW1A 3MRNA 4EAIA 1LWWA 1W6LA 2G60H 2FJFA 3FB8B 3FFCD 4EO5A 3NTCH 5D4JA 1IZKA 1J11A 1MCJA 1ZEAH 3GLZA 3GSVB 4XPHH 4W6YB 3ZTJG 2UX7A 4YUEH 2H5AX 1CDYA 2Y7OA 3BQUC 3CWSA 5EUKB 5PCYA 2ZKMX 1SBSH 3PGCB 3K74B 3C5ZA 3K1KC 5BZDA 2Y1ZA 3WFCL 2EDYA 1NC2D 3HC4L 3FTGB 1OL0A 3SPJA 1P4LA 4NRXB 4FNPA 4WFHD 2JQAA 2H3KA 3WNMA 3PWNB 1KXQA 3BUQA 1IEBB 2CKBL 4HJSA 1CK0H 4TF4A 3O81A 4PRHA 4PJ5B 2EDHA 3RBSA 1XBDA 4AL8L 4LSDA 2CHWA 3KPRD 1GZPB 4WNSA 4C4KO 4DN3L 4FI6A 2BWDA 1AHKA 4L9LB 4W9ZA 1JFQH 3X3FL 2Q8AL 2K0RA 4EN3C 5CWSB 1PY9A 1IAIM 1HIML 3QH3B 1DQML 3O4LB 1BQUA 3QWNA 4L4VD 4AMKH 1FJ1B 2G0KA 3RWDA 1VKLA 2CHZA 3QZWA 5JDSA 5D7HA 4DFIA 1JDDA 3JTSB 2ZYRA 4XODA 5HBBA 1CFQB 5D7JB 5I18H 4FYRA 1EXUA 5GGRY 2B8OT 1KB9J 2H8PB 1ZJBA 1CU4L 4KPHL 2F7LA 3GSOB 1EIBA 5ECJE 2FATH 1SLUA 4A37A 3DPUA 3GRWH 4OJAA 4HG4J 4DP9X 3TJEH 3PAYA 4GSUA 1BG1A 1M6OA 3KWUA 1FFPB 3OLEA 5F0MB 5GJTH 3H3BC 5CS7A 3AQYA 2CR6A 2EE3A 4NQCD 2X7LA 4EIBA 2PCYA 2ZWYA 1OAXL 4OCYH 3N06B 4DVBA 2BIHA 3T1FB 1NPUA 3LQAL 3I50L 5EC2B 1FGVH 1TQVA 2GYSA 4LLWA 2ZKHH 1ECZA 3KMDA 4IU3B 2QPSA 3GBNL 3O8XC 4DZBB 4GQRA 4D8PB 4ANKA 1HAUA 4H25A 4U3XA 1PEWA 1DLFL 2ARWA 2VJXA 3G6JF 4D9RD 2YWYA 3T2NH 3DX0A 3KEDA 3HE7D 5EIIB 4BFOA 2LHAA 4UNIA 5JHDD 1LP9A 3BH8B 2VZUA 1R3KB 3GSNB 2JI3A 4N0UE 3CG8A 4M03A 3FU9A 4WSGA 2E7DA 3MOQA 1JPST 3WFZA 4PRIE 5BOZG 3B2XA 5KBPA 1PG7W 4PAZA 4ZX3A 1KIQB 4H4NA 4F3FB 1G43A 5CSGA 4IS6A 5J06A 1RZ8B 5DRNA 3LKPB 4U1MB 2IWFA 2DLHA 2ZKYA 3U9UA 1MDAA 4LASL 1B0RB 4O02B 2CO3A 1G9ML 2FSEB 2HT3C 2WWKT 1N2RA 1I8IB 5CILH 2L7JA 3US0A 4P4KB 4P5MB 4WIQA 4YHNA 3UTZB 2WY3B 1QRKA 3QDJD 3A3YB 4FQIL 3JXAA 3NGBC 1MSPA 3ZIMA 5GJSL 1JTOA 1FE8L 1KEML 3X12B 4RA0C 5AWNL 4ODUB 1F4XH 2QSVA 1QO3A 5KANG 2AHIA 2NY0D 3GTVA 4YHZH 4M9PA 1R5WB 1NCCH 1WBZA 2H6OA 5FUCC 3RL1B 4RCAA 3RRQA 2NYYC 4UU9A 4ZFZB 2FQEA 4IBLT 4ZXBA 3MV01 4Y4KD 3L3KA 4IGBB 1DVYA 2A9AA 2BH0A 1RZIB 3VFWA 5E2JA 2IADA 1OAJA 3OMZA 1AQDA 1LO0H 3APCA 4KTYA 4NOFA 3RPBA 2C1PB 2Z35B 1OE2A 4X6DE 4D3CH 3NACH 1C5CH 1CE6A 1MCOL 4XI5D 2X05A 4ZYKA 1FUNA 1K3ZA 3BGFC 2JJTC 1KBPA 2XV2A 3DVGB 5ADPL 4BKLA 1OVZA 2Q86B 1QBBA 3AS3A 5DURD 1HDMA 5FM5O 4MBOA 1YJDC 2RB8A 1FO0L 1TJMA 3GSWB 3RGVD 1JV2A 2V0AA 4LLMA 2IFGA 4EUPH 3ZE1E 1S8DA 1BZEA 2MNWA 1YNTF 4N8UA 3FZUD 4NWUL 4OI9A 2BVQB 3KLLA 1OGSA 3OTTA 1ILSA 1KPUB 1ZD6A 2VC2B 4WDIA 2X4SA 3O0RL 3IFOB 4HUMB 4ZUUB 3O3AA 1F00I 2WZPD 3VQMA 4GO6B 4XPTL 1NGPH 4JO2H 2D3JA 3ZDYE 2A99A 3ARSA 4XP6L 3QZPA 1Z9PA 5F1KC 1Z5YD 3U48A 2JXMA 1MI5E 1WP6A 7CGTA 4YPGB 4HCGA 4P06A 2XN9A 5K9KB 1M1XA 4OI7A 1VGEH 1KLGB 1GXEA 5CSBA 3QDGE 3TBTB 4FYTA 1QWHA 4GBXB 4NZFA 4X6FB 4LLVA 2WWOA 5AW4B 1JG9A 3EO0B 3QC5X 2VE6A 1XIWA 4F8NA 2IAMC 4PMEA 3UW2A 1C12B 3PAUA 3GKWH 3QQ9D 1D6EA 3QRLA 1GGUA 1RUKL 4HLZG 1AO7D 1JZJA 1BVZA 3GSXA 3NJKA 4K55A 1GGBH 5FKAB 3FTVA 4E42A 1IGTB 3ABKB 3ARFA 4J3TA 3Q0HA 5GGSA 3SZKC 1FL3B 4FHBD 1WHOA 2YEZB 5EBMA 3RWGA 1IGCL 3H3PH 1XGPA 4PJXE 1KMGA 1Q72H 4X8JA 4PRIB 5T3XE 3ZR5A 1SJMA 1INEL 5IMLA 4WK0B 1NFKA 1KLFA 1DEEB 4U4BA 1NGZA 1SOSA 4LK4A 4XMKH 3SGEI 4LOUC 4WO4D 3UJIL 4PGJA 1SEQL 4NZRL 1PLCA 2O6DA 4UB0L 1VPOH 1U3HA 2HLAA 4ZUTB 3TIEB 3CW7A 3LCYA 4FEIA 2D7MA 1NOLA 1PY4A 1YMMA 4Y5VB 2BC4A 2PPDA 1MIEH 5SWQB 1KYOK 3MRDB 4EVNB 5SWZE 1MLBA 1V3KA 4V2CB 4HX1A 3OKNA 3NUKA 5INCA 1UXMA 3KPNA 4NKMA 4U1GB 3WYRA 4KK5C 5DJ8B 1E5BA 5JUEL 4WNJA 2G2NA 1KBBA 5F8RC 3P4MA 3O6FB 1YUKB 3LZFH 4OCLC 3UO1L 1EEZA 4NLAA 1B3IA 1QFPA 3K7UA 4HAKA 4XXDB 3RWJB 4DGYL 1YCSA 3SQOL 1E6OH 3CLWA 5HGDA 2IWEA 3OB0K 1X5FA 2HUEA 1NFDA 5I30H 3K6SA 5TGBA 1LO2L 2JKJA 4WWID 4IRZL 3WIFB 2ZOLB 4IM8A 3TA3B 2EDEA 1BVKA 5EF0A 1MFAH 3NJJA 4KO6A 1YNLH 3RWEB 4HWBH 5D96B 2J8UF 4X6DB 2XVBA 1ZVHA 1UM4H 2XA8H 5DWUH 5E6ZA 3FRPG 5E99H 1DCLA 1F86A 2KZKA 3LQZA 4JFQB 2V4LA 3MROB 1W0WA 3ATFA 2IPUK 3L3OB 5E00A 4FCAA 4XP4L 5FS5A 5DD1L 3QYMA 2IG2L 5KSAB 3MBED 1UM6H 3JWDH 1FLRL 3ASWA 1YPZE 3ZE1B 43C9B 1JGEA 3OLPA 3I9GL 4QKTA 3O4OC 5J6SA 3MLUH 1WAAE 3ULXA 3HLAB 4KKAD 5FGSA 2AK1L 5DRXA 5DEZA 1EZVY 1ZANH 3GMQB 3ZDYB 1HKLH 4WFED 1KDIA 3K2MC 3O6KH 1MI5B 4KHXH 5C0NC 3M88A 1GC1H 2CK0L 1MWAB 1Y0LA 4PWFA 4M93C 1HJBC 5E5LA 5LNDA 3ILPA 2PTUA 4HU8A 3QDGB 2YQ2A 3PL6B 1U21A 3BPCB 3HS0C 4G8IB 1B2WL 1PZ5B 4MLIA 3L95B 2ICEA 1XGZA 2GK0B 4DP4X 2ADFL 2BSTA 3L1FA 3S96A 4IOIA 2XWXA 1T89C 3CAFA 2YD2A 3S35H 2AK4D 5HP5A 1BMWA 1OOWA 4DUWA 1MFBH 2W9DH 2ZUVA 3WNJA 4AGQA 5DWPA 2NCEA 1AHMA 2JWYA 2X6CA 1U3YA 5JQIB 5F7BA 4Y16A 4R90L 4PJXB 35C8H 3FUMA 4HIJA 5ESAA 3UZVB 4K9EC 3DJTA 3MV9A 4XOEA 1R46A 4C4BA 4CC1A 4ENED 3KLKA 4NZTL 4XO4A 1EHXA 2H5UA 3ISRA 2FTAA 2K6WA 3QIUC 2WZAA 2WO4A 3PHAA 3D1MC 5EU7C 5KN5B 5GRJH 4FJZA 1CD1A 2BS71 2XG5B 1P2CA 4OD2A 4TTDD 1AI1L 3NFSH 1MFUA 3TIDA 3LKQB 2CD0A 4JQIL 1I1RA 3NJMA 1OTSD 3DROB 5MP6H 4R97C 4WXAA 5BV7C 3FN0L 4QEGA 3MYJB 5EIQA 4OAWA 1C9BB 2NR6C 1NLBH 3WFBL 4LFHD 2N1KA 3TFKC 5IEHA 2WTOA 4QNPF 1OTUC 3MA9L 1NGQH 1X3DA 3SPVB 4CA4A 2GITA 3J7HA 4PJHF 3NABL 5TF1L 1DVFD 3EBHA 2YOAA 1WAEA 2D4DA 4N0CC 3U0PB 4E9WA 5C9JB 4L0YA 1Z5HA 5BXFA 4KZDH 4MNGE 4TULH 1ASPA 2ZCZA 4XNAA 3C60C 4M3KB 1ZT4A 4TSCL 3IDJB 4HZLB 1XR9B 4QHUA 3WOVA 4DCQB 2DTML 1NCNA 2ITCA 1XGQA 1NSNH 3QPXL 4POZD 3TVMC 1EEYA 3I85A 3GI8L 5D1XE 4I1PA 1VACB 3MMEA 1NBZA 3RDTC 1FV1A 4IBYA 4MDJA 1T5XA 3K2UL 4UUJB 4CGUB 4OFVA 3BAIA 3K80A 4ONGH 4QAWA 5LDUA 3VDCA 4JY6A 4H8QA 4EQ3A 3QNZB 3J2PA 4NUJA 3PNWA 5I8EA 5DI8B 3U1SH 5I2IA 4HOZA 5KW9L 3L16A 1WH0A 1KTLB 4AKQA 2OMXB 1BX2A 4QRFA 3SO3B 1N5YH 4DKDC 4IBUA 4XH2A 3BVTA 4ZD3L 4RH4A 5GRVK 1RJCA 2A74A 3LEXB 2WBKA 4N2NA 1FNLA 1GA2A 4N2CA 2JVUA 3CC5A 2AV1A 1CMOA 1D6VH 5IFHL 1UWEL 4PTUA 5SWSA 2WB7A 1X5YA 3BPOB 1WC7A 5F7EH 5IJCC 2YARA 5DD0L 4CKVX 1ZHLB 4W9GC 5AYTA 3VYPA 5I1CL 3N1MC 5AW0B 5KSBF 3S98A 5HVGB 3FUIA 3PIQA 5DVPA 1ZHBB 1XL6A 4X6CE 2D2CC 3L4XA 1JGDA 3IFPA 3MLZL 4K2UL 4KUZH 1SN2A 4PPTA 3ZDXF 4YDIL 3MREB 1JUFB 1I1AB 1SJEA 3V4UH 3QXAA 2BNQD 4JHWH 3WHE1 1C47A 4W1TA 4HJHA 3T0DA 3MV8D 4JDVB 1KLUA 2YBGA 4PJ6A 5GSRB 4OQTL 4P05A 1INDL 3QJUB 2IDSA 4HLZH 3X11A 1Q0YH 3S8GB 4IU2B 3HMXH 5D7SL 4ZI8A 2YKLL 2WCGA 1WZ1H 3RKDC 4KV5E 4P0DA 4NUPA 4G6AC 4PCTA 2CBPA 2Y0SA 3ERXA 2WJ5A 1R5IB 1QNAA 4MB4A 5TTRA 1Q94A 1E9QA 1CN4A 3BPLC 3KYMA 2ZKXA 5IQLA 2EYTB 2J57A 3HAEB 4PR5A 1OAQL 1EBAA 3S37X 3ZJAA 2CLZB 3ARGB 3QO0B 3H7BA 4JRYE 1AY1L 2HMID 4LSPH 2PWGA 2G9HB 2Y7QB 5GHWL 3LKSA 2BIOA 4YHLH 3O2VH 4AYBA 2X0UA 1XGYH 4AYID 3FQYA 4Q11A 3MO1B 43CAB 5HI5C 4OGAD 1JOIA 1VTOA 5CEXB 2Y7LA 2UVFA 5DFVC 1YEGL 5DJXB 1I9IH 5IG7B 3WJLA 4L8BA 4KJYB 1BGXH 1NZRA 1E9PB 2EDNA 4PJ5D 3F58L 3WTXA 4YHMH 4X98B 3VFPA 2E4TA 3FPXA 1SOQA 5KYXA 3NZHH 3GMRA 3A67H 5DJ6A 3FO9A 2ICCA 5F7HA 4B9CA 3TBSA 1TYJA 1A1OA 1WZKA 4OGYH 4MQSB 4TUOA 5EU3B 4BA0A 1IKNC 1ZT1B 3BVNA 4P57A 4MNGB 3O4LD 1RIUH 4WK2B 1JZHA 2BMKB 2H0PA 3F0ZA 3C6SA 1U8MB 2Q7YB 2ZZUT 1KXQE 3RHWK 1X5XA 2XSKA 4RWYH 4GW5B 1OWRM 2Q8BL 3GBLA 4GMTH 5D1XB 4PRHE 3BGMA 1CBVL 4WQOA 3IDMA 4FMKA 3HIZA 4NPJA 5D7KE 3VXNA 4WTWA 1MFCH 1MG2C 1S5HA 1U58B 4AEIH 4R7LA 1NGXA 1E9OB 5DLML 3T0AA 2N59A 4PJGF 2VQTA 1P84K 5I24A 4Y4HB 2BSBA 5D1ZC 1P9MC 3TWCL 3HBZA 4TV3A 3DOHA 2QQKH 3IU4L 3OQRA 2A4ZA 1Z9OA 2DS4A 1ZS8A 3DXAA 2OV0A 4MQXD 4FFZL 4LHQB 3GMMB 5FK9B 1FIEA 1VZHA 4HV8A 4NPYA 5ALCL 1YEWA 4U7SA 4BFGA 4N0FA 3VRJB 4I77H 1MRCH 2AV7B 3F12A 2EXSA 2KZ1B 4FG4A 4ZMLA 2J44A 2FD6H 3LDBC 4HH8A 4JZJB 4ZPVB 1JI2A 3U4EB 1J7VR 5FFGA 1BREA 1RVFH 3QCUH 4LSSH 4X6CB 4FLSA 2X2IA 1SMDA 1KXVA 2DBLH 1AGBB 4KKBC 3V0VB 4L8CB 3FUJA 1NH6A 2F08A 3V9EA 5I8CA 1WTLA 4O02L 1YEKL 1UD2A 2BX5A 1PIGA 2A9DA 2BO0A 4Y8DC 3N85H 3I0XA 3EXJA 5GGRA 4C57C 1A3LL 2WD0A 3RWFA 4JS7A 5EN3A 2H32H 2EEAA 1QLEL 4AM0Q 1MNUL 1KBVA 4JO3L 4CKQA 1AH1A 3DX4A 3WNLA 4CVZB 5AZ2H 5ETUA 3M8OL 2P9RA 3UBFA 1RK0B 1RMFH 2DQCH 2W0LA 4NNXA 4JRYB 2J20A 2IAAC 5D7JC 3MRRB 4WNQA 2OZNA 1N3AA 1OCOB 2I25N 3EJCA 1U33A 1NWOA 5DRZB 5EBWA 3ELAT 4TOYH 4YHML 4GUQA 3BJ91 2EDBA 2P7TB 4JFDA 4NQVA 1JWUA 1JNHB 1KT2A 2B9AA 2PW1B 3MRNB 3NIFE 5DEFA 5GZOC 3VUAA 4ACTA 1A7QL 2FJFB 3KD4A 4FLHA 3ULVC 2CGYA 2ADJA 5EOQH 2XRAH 2PN5A 3S34L 1AGCA 2EDFA 1SQMA 3BP5A 1J1OH 5FYKU 2BIQA 3RBGA 4CSPA 4JRXD 4XZUA 5BUPA 5IROD 3C5ZB 1U92A 1KGYE 5BZDB 3QDHA 4IGBD 1M3QA 3BEVA 1EZSA 1LDSA 4UNTA 4OM0L 2ZX6A 4TVPE 4WGKA 1HXMA 1P4LB 3B4NA 2VC2L 4M8QA 4WHYH 3DOIA 1I53A 1AIFA 3IRCA 3Q6FA 1UC6A 4HIXL 4MMYA 1N19A 4NN6C 4PRHB 4HPHA 2N1TE 5LB1A 4RGNE 3ULUC 4OLZH 4KX7A 5C0AA 1H15A 3EGSA 3V0DA 2B1OA 2WNXA 1Y6NR 4N6QA 4YZFE 1HCZA 3DJZA 1DQTA 3O41A 3CWGA 1MY5A 5HJDA 1BWMA 4L3CA 4P46C 1Y07A 4FMFA 2PUQT 1EO8H 1KC5H 3HW7A 2FT6A 2JJVA 4OI8A 3DX9A 1LO3L 3CX5J 3RWDB 3IGAA 3QZWB 5JDSB 1RZ7L 3TJHC 3SKJL 3UJTL 5IHHA 4JJHA 1EXUB 1MFVA 4MVBC 3H56A 3AUWB 1ACYL 4NHCH 4YIQA 4ABVA 4CRPA 1XGUA 3L9BA 4P4KC 1H6TA 4WEMB 4EI5A 1I8LA 1M6OB 4J3UA 5L0QB 4NS0A 3GRBA 3MODL 2J88L 4C4KT 2ERJC 4L2YA 1OK8A 3DX6A 4HLEA 1TENA 4ABQA 5BOJA 1AQ8A 4KMQA 4YZWA 3KW7A 5AW9B 5AW3B 2X7LB 4Q4EA 4X4KA 4UTBL 5KBLA 3FB5A 4WLCA 3DARA 3S2CA 5D2NC 4DVBB 1R3IL 4CN4A 4YE0A 4E9SA 4TNWF 4PJBA 2E4FA 3HN5A 3BP7A 3BAJA 3LEYH 4MA7H 2XN9E 4LLWB 3VJ6A 5HD8C 5K9JH 4PRID 5DD5H 2HT4D 1JMZA 2LR4A 1A9EA 3MLWH 1UEYA 4H25B 3DO7A 3TF7C 2PP9A 3DX2A 2YA0A 4JW3A 5E8EA 1MFMA 5DJYA 1N59A 3C8DA 1E3FA 4KRMB 5FHBL 4FXKC 1E67A 1LP9B 3HKZA 1W0VA 1NCDH 3N1FC 3VDBA 4DP0X 1I1YA 3MLRH 2QSQA 1PU0A 4LCIH 4OVVA 5F6HJ 2ZWSA 4LSVL 2XI9A 4BGLA 3I6SA 5FWQA 3RY6C 3NIFB 1J1XL 3OXSA 4FD0A 3WKNA 1UA7A 4PBVC 3DETC 5FUOL 3O6FD 2VN7A 3VM7A 3WDHA 4IS6B 3D2UA 4RGOH 3P02A 3QYCA 5DRNB 1I1FA 3FCBA 4D0CA 5LG1A 3AROA 3U9UB 1YMME 2OM5A 1CCZA 1N2RB 2YA3A 1M71A 3PF2A 2DM7A 2IDUA 1TZOA 1WICA 4YHNB 2OAAA 3FU3A 4FMVA 2FYVA 3UJJL 2DD8H 5CJOL 5E1AA 4OB5L 2YGVA 2XICA 1MPAL 4XT1C 3TA3D 3PUCA 4E0RA 1A25A 1KJ3H 4YBQC 4LGRB 3EJSA 4R0LA 3OZ9L 3LH9A 5KBMA 1A4KA 2DTSA 3KEHA 1UT9A 3B2VL 1A3RH 4G8EA 2GC7C 2HLFD 2MOGA 4JBSA 2YOCA 5G5DA 3T4YA 1QO3B 4GBXC 4N2EA 3G6JA 1WBZB 2V2TA 2VMCA 4RGNB 1JGVL 1EGJH 4UU9B 1MWAL 1T1XA 1UADC 2LFEA 3U4AA 3V7MA 2Y07H 2YMXH 3LB6C 4Q14A 4ZXBB 3SDYH 2DKMA 3RP1A 1BV8A 3L3KB 4OLWH 3OPUA 2XXMB 2JNZA 3MAWA 1QNZH 4XVJH 1KB3A 3VFWB 4ZTOL 5F7KC 2IADB 1EAJA 1AQDB 3CHXA 5AKVA 1U2HA 2QL1A 4TXVB 4DK6A 4FQQA 2FUVA 1CE6B 3HI5L 2Z1PA 4ZYKB 1QA9A 5MHSE 2YPLA 1DFBH 1MI5D 4QRRA 4PD4K 4BKLB 3MRJA 1HH9A 1HDMB 4AW4A 3BCDA 3FRUA 3MCLH 3O3UN 5DVMA 3WY4A 5T3XL 4PMFA 4DKAA 4BK8A 1JV2B 2VM9A 4LLMB 5DFTA 3RG1C 3QDGD 1GTNA 5JR1L 2OW6A 1S8DB 3IBOA 3PL6D 3CZKA 3L08A 1Z3GL 3KZ8A 2Y4SA 1BM3H 2OMTA 1KN4L 2BHYA 4WDIB 4XCYA 2X4SB 2XVGA 3K4DA 3O3AB 3KW8A 3AQZA 3MACL 5HI3D 1XVSA 3UERA 2X10A 5A2CA 5LQBL 2XWTA 1IM9D 1UB5A 1AGDA 2Z8WC 1E90A 1G1OA 2NXYC 4IMKC 2JXMB 5DGQA 2P5WA 2APFA 2E75C 4HJJL 4QXUL 4WEEA 4ECNA 4LPUA 2XN9B 1YJDH 5FYLD 1M1XB 2XQYA 4OLUH 2A6IA 4Z3IA 1A5FH 1ZVSA 4QLRA 5I1JL 2P47B 4XHJC 4ORGA 5E0FA 5IQ9A 2PP7A 4LLVB 2FGTA 2VE6B 3BQVA 1XIWB 1M3IA 4X4YA 3O2WH 1GGCL 2Z31C 1JYXA 2OL3A 3QK0A 4H2CA 1D6EB 4FC3E 3GSXB 4E42B 1HYSC 3CLEH 3ARFB 3FHQA 4QJ5B 5GGSB 1NCBL 1S5IH 3P2DA 4YXKL 5EBMB 3RWGB 1B9ZA 1XGPB 3U30C 4JG1L 4X8JB 1UKQA 3V8OA 3MV9E 5IMLB 1SOXA 4BQBA 4DOHE 1KLFB 5KSAC 1NFIA 1NGZB 4U6VH 1EUTA 1KCUH 1SY6H 1MRFH 2BVUA 1F2XK 5TFSH 3D39A 1U3HB 2HLAB 4LAQH 4PJIF 2OA9A 4QRTA 5KZCB 4A7QA 1Q1PA 3GJEA 1OGTA 2EEDA 1YMMB 4BEIA 2CO6A 1WE5A 1FVCA 2BC4B 4KTEL 2WGXA 2B5IB 3MUY1 2QREA 1H5BA 1L6XA 1SN5A 1MLBB 3B2DC 5EEZA 2WQWA 4HX1B 4XP9L 3EYVA 2DAVA 3OKNB 4KFZC 3WIHH 2CU9A 5INCB 9CGTA 3KPNB 1D5BA 1VZGA 4NKMB 3HMWH 2BP5M 2W0KA 4DWHA 2R4RL 2JE8A 3OKOA 4A6YH 5IJKC 4ZMNA 3P4MB 2EUVA 4NQXA 3W38A 1EEZB 1IB5A 2LLNA 1DANT 4XC1L 5DD3H 2PPAA 4UT9A 3BRGC 4KH9A 5ICYA 1R5VA 5HGDB 4O5LL 4OZFA 4J2XA 1OHZA 2ZD0A 1W72H 2H45A 2X6MA 3K6SB 2DDQL 5TGBB 2W95A 4LRIC 1UYWH 2AQRA 1F3RB 1E4XI 1BVKB 3BYYA 3ES6A 1W8OA 3MKGA 1BBJA 2VM3A 3E6HA 3EG9A 4E9TA 5HDBF 4PS7A 1U30A 2HTKD 3LQZB 4Y19A 1W0WB 5E00B 1OAKH 4Z3FA 3CIQA 3IM1A 4MASA 4QPEA 2ORBH 3DURA 2CJ3A 2PWFA 4JKKA 4P2RA 3HN3A 4HJ0D 3S36L 5IESH 1WCQA 4JPWL 3QZNA 4N2LA 5DEGB 1JGEB 5ILTL 5IBUB 3ZL4H 1GW6A 4LSTL 5F7YC 3IFLH 2ZAHA 4XAWL 3FN9A 4N9OB 5SWSE 3EFDH 2HKFL 4OCMC 3SGJA 5DRXB 2BCKA 2YAQA 5L6YL 1JXKA 4PWIA 4XVTH 4KTDL 8CGTA 1IAOA 3HFMH 4TKWA 2R69L 1WCBA 3KR3H 4OY9A 3V4VA 3GBEA 3ZHLA 1Y0LB 4XB7A 1YN7A 3R4DA 5FB8B 5IGXL 3UZEC 3ILPB 3R7QA 2WW8A 3ILEA 5ADOH 3BUTA 7TAAA 3ARGD 5DXWA 3U7AA 3IJYA 3HR6A 3ZZ1A 3LNIA 2J8OA 4LSQH 1IQDA 4LBAA 5JXEA 3P4NA 5IVZA 1PKOA 2ICEB 3MOBH 4ORZC 5HJ3A 3U25A 1RUAL 1RUML 2EE2A 2BSTB 4GXVL 3AMKA 4MCMA 4IOIB 3FSVA 3V10A 2E47A 5AAMC 4Q9BA 1KIRA 1CBJA 1X4YA 3OMIB 1Z66A 4K3DL 4YSEA 1X4ZA 1ODUA 1XXFC 4Y16B 3TCXA 5C0GA 4HHGA 4PV9A 1D7BA 4HIJB 5ESAB 2MH4A 3MV9B 1E3ZA 2ZJSH 4DOHB 2HX9A 3RFZA 4Y4FC 2JHJA 3UX9B 1FRGL 3D3VA 5FW8A 5I1AA 4KHTH 3SYCA 5EA0L 5DUJA 2JJSC 2KERA 1QEXA 1F97A 2R0ZL 4QY8A 2VXTH 3B2UD 2OSLA 1IC7L 4W9DC 1HSBA 1CD1B 5A2BA 3T6XA 1MCEA 2HRHA 1P2CB 4OD2B 5IQ7H 1ET7A 5T1KA 1E4KC 1SDYA 3CFUA 3RX5A 4EDWL 3E8UH 2BVYA 1JHKL 4OAWB 5D1XD 1I1AC 2DIBA 2IBGA 2QQLL 5IVOA 1DVTA 1AMXA 4HF5H 1KY7A 3TBBA 3X1FA 5IEHB 2J12B 1QSED 2GITB 4L23A 5F9WB 2FVNA 1U36A 5CIPA 5EUOF 1YA5A 4Y4HD 5F9DC 5BXFB 1YYML 5FUZH 2IFFH 1ZT4B 4I0KA 1M2OA 3MLTA 4AGLA 4QHUB 3ZYJA 3FSZA 3PDGA 1L5GA 1IKFH 3ALPA 2ITCB 1XGQB 4F1SA 5BV7H 2ARJA 1EEYB 3NIDF 4XBEH 3MMEB 1NOFA 1NBZB 4LQFL 3FBQA 1FV1B 5MENA 4MDJB 4Z1PA 3TT3H 1T5XB 1RURH 4PP1C 3PP4L 2AXJA 3EJTA 1NBYA 3OC3C 1CVSC 3IJSA 1U8IA 4JY6B 1TZHA 4OD1L 3QIBA 5DMKA 2DQJL 4NUJB 3PNWB 5I8EB 1JZ5A 4HGMA 1CLZL 5I2IB 4OLVL 5FM4A 3VFOA 3LAFA 3HR5A 3BESR 3AREA 4NKIL 4S1QH 5C70A 4XH2B 3T0VA 2BERA 3SYAA 1YEFL 2C9AA 3DXAE 4JKLA 3AGWA 4YHPA 1BVNT 3VG0L 4MB1A 4DERA 2F7IA 3GXNA 2A74B 1LNUA 3C6LC 4ZZFA 1DDHA 3QIWC 2FX7H 1E0OB 2AV1B 3CC5B 4FI7A 1C16A 4ZMWA 4PTUB 5SWSB 4XMWA 1WC7B 2CO1A 3OC8A 1NDGA 1RHHA 4DULA 3C08L 3WMSA 5CEZH 2DQHH 4PI0A 3CFEA 4IRJA 2ZUXA 3QI9A 5C0JA 4OZIF 2OCFD 3G9VA 1IVLA 3PIQB 1E4XL 4KI5E 4N2AA 5EIIG 1UOVA 1JGDB 3IFPB 1HN1A 4MCYA 2MHAA 1SJEB 2BVTA 1TBAB 3QXAB 5J11B 1NQBA 2B2XL 4L29A 5AZEH 3S5LA 3AU1A 1KLUB 2V5RA 5JMVD 4QHLA 3RAJH 3T04D 2QVIA 3F5WA 5GZNA 4MZIA 5E2TH 2C3VB 5D6DA 4HEPG 4GRWE 2Z65C 5K59F 2D0HA 4P04A 2WYHA 3GRWA 5LBVA 4APQC 1BF2A 2NY7H 3UTTA 3VFNA 4DTGH 3GDBA 4UV7H 1IFHH 2R0KL 1DJWA 5JIHA 4DN4L 1QFUH 1NMBH 2AAAA 1ND0A 2EUWA 4QMEA 5BMNA 4RRPA 1VESA 1Q94B 1E9QB 4ODTL 4WSKA 1G0XA 3KYMB 1IBGL 3AT9A 4PR5B 4N20A 1EBMA 4R5VA 3EXLA 1S7UA 3OBAA 5CCKH 4MDRA 1C5DA 5FPIA 2DM3A 2V37A 3UC2A 3NVQA 3H7BB 4P2YA 2CCWA 4NO3A 2CRMA 4WRLA 3TH3T 1NTDA 3LKSB 4G5AA 3QJRB 4NM8L 2D03H 2P43B 3FO0L 4JFDE 2IH9A 2PNDA 4LAJH 4Y9GA 2YUXA 3BWUC 4ZAKC 4RMRA 5A3IC 1DN2A 1M9SA 2KI6A 4PLKD 5LXGL 2HPOA 4RFOH 4L8BB 4DO6A 5LGJB 4XX1E 3ARTA 2WZ5A 4PRHD 1V55B 4HOMA 4WJ5A 3T8VA 1ID5I 4HGWA 2XN0A 3LHAA 3VFPB 5D7KD 5KYXB 1CZ8L 1I82A 3GMRB 3KCPA 5DJ6B 2ZWKA 3FO9B 5IJBC 4HAGA 1S7SA 5DT1H 3HVDA 3TBSB 1A1OB 1TZGH 1KZQA 5I1KL 4TUOB 1TJGL 3BFWA 3BVNB 4M43L 4P57B 2W94A 3AXLA 4B60A 1N0XH 1HQ4A 3BO8A 3V7AE 3VGEA 1KB5H 2BDNL 1VGKA 3C6SB 2BIPA 2KYIA 3AW5A 1YQVL 4KQ3H 1C8PA 2Q3AA 2R29H 4A38A 3ARXA 3KPPA 5D5MF 5IV2A 2APXA 3BGMB 3A6CL 3I3DA 1HWWA 5L4JA 3IDMB 5C0AE 1BXXA 3VXNB 4GNKB 3ZHKA 3HZMA 1MKFA 1S5HB 1KPVA 1MF2H 4OCXL 3L4TA 2OR9H 4PSPA 5I1IL 1NGXB 2D73A 3MZTA 2HUHA 4HPYL 5DJCA 1J05A 2YD3A 3RLSA 3UCRA 1IC5L 4MDIA 4J3BA 1V3JA 3CVSA 4MTMA 3BSHA 3BDYH 4YMPA 1ZS8B 3S9DB 3DXAB 4ZUWA 4YFDB 2DWXA 4HV8B 4NPYB 4DK5A 4QYOA 4KXCA 4N0FB 1U8KA 2NY2B 5MEQA 2DB8A 3DC0A 1MCPL 4AQ1C 1NAMA 3F12B 3UFIA 5EZPA 5AAWA 2HB0A 3JV0A 4K7PX 1Z0NA 3C5ZC 1ZLUH 3EYSL 1XL4A 2VXQH 3JYCA 4HQQL 3CXFA 2QADC 3FT2A 3II3A 2D9QB 1JRHI 4ODVL 2UZYA 3R0MA 2C3GA 3Q2LA 4XPBL 1LVEA 2ZOWA 5I8CB 3P11L 1KB9K 5HYJD 4PJBE 2LTQC 4GRWB 2YSSA 1AXTL 5GGRB 5LVEA 4HG4K 2F1BA 2WPGA 4PV8A 3ZKMC 4EUPA 1XH3A 3NBNA 3RWFB 1BM7A 3AABA 3WKQA 4K8RL 1W9XA 3CFIC 3GMLA 3U6XS 5FAAA 3PJNA 4R5XA 2Q3XA 2J1WA 2C4FT 2GW5A 2VQ4A 1P7HL 5ETUB 5JZ7C 5I6XC 3VFSA 1JIBA 3HZYA 5E1IA 5ICUA 2AMGA 4MKTA 3TV3H 4NNXB 1HHHA 3M46A 4FNQA 5CINL 2NT0A 3VW3H 5EPMA 4KVNL 4WNQB 4DAGH 2A4EA 1WUNT 2EXYD 4GEIA 5EBWB 1PZSA 2A77L 1EEUA 2O5NA 4ZO7A 1SFDA 1NCWL 4JFDB 4NQVB 1JWUB 5DHYA 1KT2B 5GRWA 4E5XG 4UBDD 4K8RD 1DBBL 1MCIA 5CJXC 1AFVH 3HG1A 4F57L 4XPAH 2ADJB 1AJ7L 1G7IA 1V54B 3DGDA 3O2DH 1XSJA 4YQXH 2AGJH 5L0QC 1AGCB 4QYAA 1SEBA 3BP5B 4RGND 4L1HA 1U2CA 3MDJA 4BKSC 2DLGA 4X7SH 1IBZA 5JW4Q 3AT8A 1MLCA 4XZUB 4ZXBD 1EFQA 1U92B 1NGWA 2E7LA 4MRQA 5C0CA 1AOZA 3BEVB 2GBAA 2WKOA 1HXMB 4XR8C 4YBLB 2P80A 4BV1A 1HQRA 5C3IA 4FJ6A 2PTTA 4M8QB 1NM4A 3K2KA 5B1KA 4N6RA 1AIFB 3MLSL 2AXGA 4HKXB 3Q6FB 1OAZL 3F7QA 1HZHL 3G5YA 3G6JE 3P54A 4MMYB 4DP5X 4ZMZA 5CGYC 1BZQK 4X9GA 2W5PA 3NSYA 5C0AB 4PJDF 1AS7A 1H15B 1I9EA 1CLOL 3EGSB 4LLYA 4GKLA 1RUQH 4YSUA 3T4AA 5AVTB 1MHEA 4MGXA 3O41B 4HJIA 2WUBH 2ZWZA 4ANWA 4L3CB 3L3JA 4HMEA 4HS6A 4A67A 2AJ3A 4MD0A 4OLYL 5HSHA 3DX9B 3IGAB 5EF3A 3W2DH 5DYOA 4NNPL 1TO4A 3R18A 3COOA 1FNSH 2DM4A 2YPLE 3BD4A 4QRRE 2B20A 3ULUH 4BZ1H 2VERA 4X8XA 4RODB 4TUKH 1XCTA 2XN9D 3LTVA 4RIRA 1XGUB 1A22B 4L8SC 2AJZA 3AY4A 5H37H 4FHJA 4C4UA 3E0GA 4EI5B 1I8UA 3W5NA 1J8HA 1L9PA 4I18A 5J1AA 3KNBA 4HWBA 1XIWD 2AEPL 2FAUA 3DX6B 5KUMA 5K9QG 4XC3L 5E8DH 2YRZA 2WWMC 4XAKE 3ECVA 3FB5B 5LGHL 1H3XA 4BUGA 1UCTA 2HCZX 4ODHL 3ARFD 3FHAA 4AI7A 4PJBB 4U1LA 4NI6A 3BP7B 2IPTH 4M1CD 3H53A 3TEWA 1ZE3H 1KIUB 1U91A 3VJ6B 3OPZH 2O5ZL 5TF0A 2J5WA 2WQXA 2V2WA 1A9EB 3U7WH 4AZ8A 1K4DA 4P3DA 1A6UL 4G3YH 5K39A 4CL7A 3RTQC 3DO7B 3MRBA 1G7JA 4XXCA 1U3HD 5E8EB 2L7UA 5DJYB 1N59B 4TRPH 5KZCD 3RVXC 3ZU8A 5I5RA 2XA3A 1YMMD 2AITA 1PX3A 3QNYA 4NQEA 1W0VB 2NY5L 4KRPB 2PR9A 2X53A 1I1YB 2F8OA 1MEXL 4S0HA 3DO3A 4QDGA 3LVTA 3OKEA 3H9YA 1JRHL 4OJFH 2NTFA 3O3BA 5D9SA 3NRQA 2VN4A 1PG7H 5F89A 4Z18A 4IKJA 3OXSB 2R56H 3VD3A 2FGWL 1THCA 2Z34A 1SMAA 3D34A 4F7KA 3D39E 1B6DA 3D2UB 2CJSA 4OBSA 4I0PA 3WEXA 1OOAA 1I1FB 2X2HA 3BKML 4GIPD 2X6AA 3DJSA 3HE6A 3DSFL 2AJXH 5E7BA 4XWGH 3CFNA 4CC0A 1M71B 5FO9A 1GZQA 2HX7A 5E1AB 1NCTA 3ZTNL 1F56A 5KAQF 4U33A 4E0RB 2WJ7A 1JZ8A 1BPLB 4R0LB 1A4KB 4Q9RH 3S88H 1BIIA 3SBWC 4G8EB 4CN6A 5G5DB 5BW7C 3T4YB 3SE4A 5MHSD 3SKMA 4L3EA 3G6JB 4ICWA 2ZTBA 5IF0A 2V2TB 4OZHF 1B4RA 1GZHA 3WO4C 3BAKA 1O9ZA 4XN9A 1T1XB 2TAAA 4MX7A 4N2KA 3NJFA 4QHMA 4OCRH 1ZDQA 4NKQB 2HWZL 4MA8L 1T20A 3VYNA 3CK0L 1Z6JT 3QUZA 1T03L 1A14H 3B9KA 2WXMA 4FLRA 3L5HA 3VFTA 4J6IA 4FQQB 2MCG1 1CGSL 5C6WH 2RAMA 4APXA 1QA9B 4AIOA 2UV3A 4Y19E 3CN0A 2YPLB 4QRRB 3CGTA 3S37L 3MRJB 1HH9B 2NNAA 5I5JA 4F8PA 4L5FE 3FRUB 3Q01A 1GIGL 4P2RE 2X1OA 4AVIA 2YAPA 4OQ1A 3TO2A 4ZFGL 4O4YH 1ETB1 2X4UA 3DTXA 3LS5H 4A2EA 3ZX1A 2UXFA 2OMTB 4PCKA 2NY6C 4XCYB 4JQXC 2GVYA 1I7ZA 1BD2A 4XNBA 4MXWL 2XWTB 1UB5B 3RZCA 1A6WH 3HAEG 1AGDB 3GINA 4PHZA 2P5WB 4WI7A 3WXVH 2EE6A 4FTVE 1INQA 1GGIH 1MFDL 3D69A 2BXYA 5L2KA 1XSIA 4ODSL 3MV9D 3QT2A 2A6IB 4HBCL 4P4RA 1ZVSB 2VKWA 2C7FA 5JTWA 5IQ9B 3K8MA 4ORGB 1KGUA 1S3RA 1JHTA 4AQOA 3JV5A 2V5TA 3EJZD 2AKRA 2Y6SC 1E42A 1FHNA 4JN1L 2H1PL 4X4YB 1QWNA