1W82A

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/inhibitor
total genus 110
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1w82A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1w82A01
1RE8A 2BILB 2WEVA 3E87A 5AR7A 4LV5A 3DU8A 2W4OA 5AR5A 4FZFB 3QFVA 3QKKA 3W32A 4RX5A 3QRIA 5ANDA 4ZTHA 4MBLA 4FGBA 4USDA 2VTSA 3NNXA 4GJ3A 4NYEA 4EH5A 5DR9A 2BHEA 2BPMA 4ZK5A 1JWHA 3RINA 4L68A 3NCZA 4RJ7A 4BTMA 5I0BA 2I40A 4FTIA 3MPTA 5J1VA 4FIIA 2QKWB 1PXLA 4FEXA 4NL0A 4Z3VA 4IZYA 4EOSA 4AQCA 3MV5A 1YHWA 4DEEA 5CEPA 1ZOHA 2C6LA 3NMUF 3PRFA 2BIKB 4AGWA 4FZDB 4U80A 1FBNA 1IA8A 4PY1A 4LM5A 2NO3A 4O0XA 3OOMA 4GH2A 1CKPA 1PXNA 5HLNA 3MVJA 5CVHA 5I4NA 3VULA 5KMJA 5CSWA 3EZRA 4XP3A 4R5SA 3SOCA 5FBNC 4B7TA 3SGCA 2XS0A 3GU6A 4OBOA 3QZHA 3HMIA 4CYJA 4S33A 1OPLA 2XIYA 3KQ7A 4IJPA 4XP0A 1O9UA 4I4EA 4MH7A 3QZFA 2NRYA 2YM8A 3QCSA 4L46A 4CD0A 5D11A 4D2PA 5GJDA 5EW9A 3ZUTA 3SG9A 2BIYA 3MS9A 2CGVA 4M7IA 4C02A 3PG3A 3WILA 4ANOA 2O65A 3CCNA 4OR5A 4JR3A 5HOAA 3KU2A 2JBOA 5GNKA 1DS5A 4YMJA 3NUXA 5H8BA 4BDKA 2CCHA 3L9LA 2IZUA 2VWYA 1PHKA 4EH8A 4PTEA 3SLSA 2W5HA 3JUHA 3Q96A 5AIRA 4DH3A 3RBWA 3LMGA 5HI2A 1ZYCA 4L7SA 1YXVA 2CLQA 4BF2A 4ALWA 1BKXA 4BCMA 4FKPA 5IQBA 4UYAA 3C0HA 5DRDA 3OEZA 4FE2A 4Z7HA 3LOKA 4G17A 4JG7A 4JDKA 2R7BA 4QYGA 5L2TA 1REJA 4NJDA 4BCFA 4EHGA 4GEOA 4ZSAA 4E5BA 2UW0A 1PJKA 5GZAA 2UZWE 3NNVA 1QL6A 2RIOA 4O6EA 5AR2A 3TNPC 5IQGA 3EN4A 2X7OA 2GS6A 5J9ZA 3DBEA 4KUJA 4QNAA 3NAYA 3DS6A 2CLXA 2X8IA 2OIQA 3VBXA 3SW7A 5DEWA 2XYUA 1KOAA 5HX6A 5AUXA 5HBJA 4OUCA 3BIZA 4W4YA 4JQ7A 2BRNA 4C3RA 2ERZE 3WIKA 3RPOA 4FT9A 2QURA 5HE2A 4P7EA 4E4NA 5AJQA 1Z9XA 4QP3A 2WTWA 3DTWA 3N4UA 5AMNA 2PZPA 4FSTA 4C37A 5HU3A 2XNEA 4IFCA 4JX7A 5DLSA 4EOQA 3W1FA 5LVNA 2O8YA 3C4CA 4EI4A 5IDPA 5LVPA 2UZEA 1YI4A 3KCFA 3DJ5A 4UV0A 2HOGA 3VUKA 2W5AA 2WIHA 4O7NA 4BCGA 4TL0A 4MX9A 2X4FA 3BQCA 1G8AA 4G6OA 1ZMUA 5CZIA 5FQDC 3IPHA 2X2MA 3UG1A 3W18A 4QTAA 2H8HA 2RG6A 5A4CA 1OIRA 1YXSA 4DFUA 3F5GA 3ORIA 3QZIA 2IJMA 4QOXA 4C4GA 5A14A 5EQYA 1UNGA 3NUSA 4PL3A 4QP9A 4C38A 3FHRA 2BKKA 4PTGA 3C9WA 5B2LA 2C6MA 4TNDA 5TO8A 2RKUA 3MBLA 5C4KA 2YM7A 1JKSA 2BFYA 1MRUA 4TRLA 4XBRA 3R0TA 3PZHA 3NX8A 4RGJA 3FDNA 4IANA 3ID6C 1ZXEA 4FIGA 3DAEA 3LLTA 3PZEA 3QC9A 3CE3A 5E1EA 3EQDA 3THBA 4JS8A 4O1OA 4CT1A 4O7LA 5GIOE 4J99A 5M53A 3MY1A 4WT6A 3EL7A 3RCJA 3HAVA 5CSXA 3RHXA 3QALE 4FKSA 2BFXA 3KF4A 3KC3A 2C5XA 4A06A 3PRIA 1PKGA 2WMUA 5BPYA 4U8ZA 1J1BA 5KMLA 2YFXA 4AAAA 2VTHA 1KV2A 3FYJX 4FV7A 4U79A 5CSVA 1TQPA 2JBPA 3CD8A 3L8SA 4K2RA 4WNMA 5EM8A 3RGFA 4C8BA 4D4VA 2CNUA 4CTCA 2XKFA 3FEGA 3UZRA 3V51A 3W8LA 1VZOA 5M4UA 4KS8A 3CGOA 3CSVA 2BAKA 2J0IA 5CAVA 2YEXA 2P3GX 2VGPA 4S32A 4YTHA 3T3VA 5A4EA 4RJ6A 5EW8A 2QU6A 4ZTLA 4EQCA 1H26A 4HVDA 4CXAA 1H1RA 2R64A 1OPKA 4H39A 4YPDA 3KK9A 2IZSA 4FK3A 3BBTB 3OZ6A 1CTPE 2C30A 3ZXZA 5ACKA 5LCKA 3NW7A 2ITOA 5AP2A 4BWKA 5FD2A 3KVWA 3F2NA 3O96A 4D2WA 1Q99A 4X2KA 3C5UA 4BCIA 1QMZA 2WQOA 3A7FA 5DBXA 5C1QB 3SXRA 4AU8A 4C4IA 2I0EA 3WF9A 4YZDA 4P4CA 4CFFA 1ZARA 4FKTA 5BVEA 3UVPA 4BWXA 4EWHA 4O0WA 2UZUE 1SZMA 3TV7A 3AC1A 3OCTA 1KSWA 4HCUA 2QC6A 3R7EA 2YM5A 5JGDA 3FL4A 4UN0C 3B2TA 4MEDA 2VTIA 3QWKA 4QMOA 5DEYA 4KKHA 5IH6A 4B4LA 4BHZA 4OTPA 5IA5A 2BUJA 3V3VA 3F6XA 5LJJA 3EHAA 5AP1A 4WG4A 1Q62A 3TI1A 3CXWA 2W9ZB 3Q3BA 4ZIMA 4XG7A 4DYMA 5L2SA 4OAUC 4NUSA 2X9EA 4HYHA 5DH3A 3HV4A 2WTKB 3OBJA 5J9LA 3HV5A 2XVDA 4GFMA 5L8JA 4J95A 2W1EA 4RG0A 4DEBA 2CDZA 3KXHA 3OS3A 4M14A 4NKSA 2HZNA 3Q4UA 3ULZA 3IK3A 3R2YA 1Q4LA 1Y8YA 2HW7A 5CI7A 5ETFA 5K3YA 3VS3A 3ZSIA 4ARKA 2CNVA 5D1JA 2WMTA 2W5BA 4J8NA 3C50A 5FTOA 4IX4A 2IVSA 4FTNA 1VYZA 3HZTA 4FNZA 4AW1A 4FNXA 3UP7A 1KE6A 2XBAA 2ZMCA 2ZVAA 5AUYA 1FQ1B 1FINA 4OTQA 2R3OA 3ZFXA 4Y83A 3EKKA 2W7XA 3TDWA 1PXKA 4RBLA 2PMOX 3KGAA 5E9EA 3MFUA 3UMWA 3EQHA 5DIAA 3VBQA 1MRVA 2A1AB 4IVCA 2GQGA 4F1OA 5LMKC 1GZNA 2BKZA 5K4IA 4O86A 4WNOA 3EN6A 4YO4A 3DA6A 3DNDA 4JT3A 2GNLA 2JLDA 3FLWA 2OIDA 2I0HA 3FLYA 1WBPA 3IDPA 2VO3A 3KFAA 1OBDA 4I6FA 5E90A 5E8TA 3MY5A 5IH5A 3TZ8A 5E8UA 4ANLA 5HTIA 2GS2A 2QD9A 3GT8A 3QUEA 2Y0AA 3ERKA 4JG6A 4QP7A 3RPVA 1U4DA 4R5YA 2XNPA 3LXLA 2HWOA 3QUPA 2ZDTA 2YLEA 2WTKC 4K1BA 5LQFA 3R1SA 1ZYSA 4LRKA 2WTIA 2RF9A 4FIHA 4YBJA 4BDEA 4YR8A 4NEUA 4XCUA 4I41A 3NR9A 5E8VA 4Q2AA 1HCLA 5HD4A 3D4QA 1P5EA 3LLAA 4FEUA 3A8XA 5D9HA 4WG5A 3A7JA 3R9DA 1K9AA 2R3MA 3EOCA 3R9OA 4O7VA 2ZDUA 3FBVA 4R78A 3MFRA 2VTOA 2WU6A 4CMOA 4D0XA 5KHWA 3DXPA 1XO2B 2OJIA 3NW6A 5KKRC 5CF4A 4UWYA 2I0YA 2XIXA 4NH1A 2RGPA 3D83A 4BDCA 3CJGA 4XLVA 2UUEA 4XBUA 1OL5A 1HOWA 2GHMA 2ITUA 4RJ4A 3TTJA 2G9XA 4AXAA 4CVAA 1UU7A 2OJFE 2QI8A 4IE9A 1NY3A 2C6OA 1Y8GA 3DKFA 2IPXA 3ZM9A 4HCTA 1YW2A 4WUNA 2W4JA 4QYFA 2B9HA 1H27A 3E7VA 3FV8A 3VQHA 4ALVA 5BQ0A 4YZ9A 3REPA 5L2IA 1YOMA 2F7ZE 5H3QA 4E6CA 3CPBA 3U4WA 2IZRA 2I1MA 2BTRA 4FOCA 3BGZA 3R8PA 4DAWA 5CXZA 4J7BA 2CPKE 4WKQA 4H1MA 2BRBA 3RPRA 2GNIA 5JRQA 1KOBA 4X6RA 4U43A 3ROYA 4CZUA 1ZYDA 3BV2A 2OXXA 4IVAA 3A60A 4NWMA 4F9BA 3TXOA 3PA3A 3QHWA 5AX3A 4O7TA 1Q3DA 2G01A 4BCJA 4RVMA 3EFJA 5LARA 5KE0A 4DCEA 4PMSA 3UJGA 3ACJA 1BX6A 3ET7A 5FWKK 4H05A 3WOWA 3DGKA 3EN9A 2GU8A 3RAHA 3G0EA 3PY3A 3NUPA 4RVTA 2OFVA 3VN9A 2UW3A 4ZZMA 4KWPA 2EXCX 5ANEA 1R3CA 4FTKA 4CLJA 2YDJA 3WE4A 3GU5A 5HG7A 2XMYA 4V01A 2PTKA 3DQWA 2QU5A 3KEXA 1OL7A 3KRXA 2G2FA 4EJ7A 2JAMA 2VNYA 3ZS5A 2OZOA 5E8WA 5IEYA 3AT2A 4RX7A 4QYHA 3OD6X 3OWKA 4KKEA 3VF9A 3Q5ZA 3LQ3A 4N4SA 4FL2A 4ANSA 4ZSEA 4TWPA 3R9HA 3F5UA 4XG8A 2V22A 4D2RA 3GU4A 1XBAA 4X3FA 3GB2A 1FVRA 3P7AA 4QMYA 1UU9A 4UWBA 2ETMA 3MWUA 2ITNA 5HU9A 5DHJA 3HV3A 1JAMA 3PVWA 5HEZA 3VVHA 2PZIA 4WBBB 4EBVA 5AR8A 2GFCA 5AUVA 1WMKA 4YTCA 3KRRA 5J7HA 2Y4PA 3DAJA 3DJ6A 4BDGA 3A62A 4R7HA 4QTCA 3H9OA 5EFQA 5JFSA 4WOVA 4BVUA 3VUMA 1H8FA 5HORA 3E3BX 4IX5A 5AADA 3D5WA 3I7CA 2J7TA 2WIPA 2Z8CA 2FSLX 4FG9A 4GK2A 3P86A 1RJBA 2PMLX 2PUUA 4LI5A 5EW3A 2QO2A 3NLBA 2QO9A 3KVXA 4U7ZA 2ZV9A 3TKUA 4BZNA 2FSMX 4XNEA 3ZEWA 4F6UA 2BZHB 3U6JA 3CY3A 3WF6A 5CALA 3VS4A 1ZOGA 3PWDA 4BBMA 4EOPA 3DBFA 1WBTA 5IUIA 1MP8A 3PJ2A 1ZZLA 5HBEA 3E3PA 4AGCA 4C3FA 3LFBA 3QQJA 2OI4X 3ZZWA 2C0TA 5IQDA 4NSTA 2HAKA 1PXJA 2ITPA 2YIYA 3VWAA 4DLJA 1Q3WA 3IDBA 5IMXA 4PDOA 3G5DA 3EYHA 4IDVA 5A6NA 1WBSA 3TCPA 2ITWA 3OHTA 2XM9A 2OU7A 2HY0A 3HA6A 3E8CA 5AV2A 4AFJA 5CEOA 1SVEA 3DV3A 4PQNA 4AGUA 4DG3E 5EI6A 4IBMA 3N4VA 5TE0A 3HDNA 4UBAA 2G1TA 5KMOA 5BMMA 5B2MA 5IQFA 5DMZA 3FXXA 5AA9A 2R4BA 3P1AA 1W7HA 4RVLA 5EOBA 1XHAA 1ZZ2A 4FT0A 2UV2A 3RM7A 3MFSA 3Q60A 4HCVA 3F82A 5HNBA 4BGQA 1NT2A 3OCSA 2IVUA 3ATSA 5F1ZA 5CQUA 3NYNA 3VUHA 3RZBA 4FTMA 2PWLA 5AV0A 3D2KA 4YGAA 4RC3A 2WFYA 3PJ1A 2C69A 4WRSA 3VS6A 5K5NA 1M52A 3NAXA 1B39A 2J4ZA 2VTQA 4UMQA 3W8QA 2UZLA 4AZSA 4O82A 1OUKA 1SMHA 2RFNA 1OKWA 3HRCA 3BKBA 3DXQA 4IB0A 4ZS0A 3UQGA 4AA5A 3LM5A 3UYSA 2Z60A 3VAPA 4XG2A 4IADA 3DKOA 5AP4A 2C5VA 1YOJA 5FXRA 3A7HA 3I5NA 3RALA 5CAPA 4RRVA 2GDOA 2EWAA 4YO6A 2O0UA 3F69A 3AC3A 3MVMA 4HZRA 1FOTA 1DAWA 4FKLA 4MQ2A 3UIUA 2I7QA 3Q2MA 4GT4A 3P0MA 4OBQA 4OAVB 2JC6A 3PJCA 4A4OA 4ACMA 4D55A 4FT3A 4HGSA 3V01A 3ZBFA 3ZOSA 4CT2A 5K9IA 2HZ4A 4KSQA 4YJPA 3LMHA 4MYGA 2WMXA 4ASEA 4AOIA 2R3FA 4FV5A 5ICPA 3LFFA 4YURA 4HGTA 3FZTA 3VUIA 1NVRA 4TZRA 4EK6A 2G2HA 5G1XA 2B0QA 3R04A 3R8VA 2OG8A 1KE7A 4DTBA 4QMLA 5M56A 3LJ1A 1UU3A 3BLQA 3OXIA 4MCVA 2F9GA 2UZDA 5IISA 3WZKA 3I5ZA 3G15A 4MD8E 4V05A 2HXLA 3NIZA 3VRYA 3DBCA 5C03A 3H4JA 2GNFA 4CCUA 2QG5A 3ZONA 1OPJA 3D5XA 1DM2A 1UVRA 3LFNA 4LL0A 2GNHA 4WSYA 2YACA 5DOSA 4W9WA 1LEZA 2A27A 3V6SA 4E8AA 4CKRA 2CN8A 4A4LA 3CC6A 4XV3A 4J71A 4OTWA 4S30A 3DTCA 5CAUA 2C6TA 4CEGA 5CT0A 4S31A 1IEPA 3COHA 4IX3A 3W2SA 5JGBA 3ENHA 4X3FB 5DGZA 3R83A 3QC4A 2GTMA 2F57A 4CV9A 2VWUA 3R8LA 4U5JA 4AFEA 4PPAA 5IH4A 3T8OA 3Q53A 1G3NA 3GENA 4IWDA 5ANJA 4M3QA 4CFWA 3KMUA 3O0GA 4FKJA 5TOZA 1OITA 4DGMA 3FZPA 3UNJA 1YDRE 4HOKA 4NTTA 4QMTA 3RNYA 3NEWA 4PMPA 2B7AA 5M09A 3UYTA 1CSNA 2YERA 1K2PA 3FZSA 4FVRA 4L67A 2WHBA 1PMNA 3RJCA 4C2WA 5FXQA 2JITA 1M7QA 3SW4A 2Y4IB 1J7UA 2PMNX 4CV8A 4GRBA 3RKBA 1RQQA 4E5WA 5IPJA 3EH9A 3V04A 2YABA 5IKWA 2VWZA 2YDIA 2ZOQA 2Y7JA 4BB4A 3O51A 4IAKA 4APPA 4PF4A 3TV4A 5ETCA 3U55A 4O96A 4P5QA 5LWMA 3FI3A 3E7OA 2UVXA 4JLCA 4ZSJA 1XQZA 2OW3A 4BTFA 5IQCA 5FEDA 1GIHA 2XK6A 3QQKA 3LE6A 4ZSLA 4DEDA 4NFMA 4F9AA 1IRKA 4P5ZA 3TDVA 4EC8A 1VJYA 4DINA 1PF8A 1U54B 2DS1A 4BKYA 5EKNA 5ANGA 3RHKA 2RG5A 1Q5KA 2VTPA 1J7IA 4E6DA 2EB2A 4EYJA 5L6WL 1XH9A 1M2PA 4EUUA 5HNGA 3QBNA 3JVRA 5HO6A 5LVMA 3RZFA 2UZTA 4LL5A 4FF8A 4FIEA 2WTVA 3FC1X 4BZOA 4XRJA 4PDSA 4R8QA 2R3HA 2B54A 5FP6A 2YCQA 4XG9A 4AW5A 2QOOA 3GCUA 3FZOA 3I6WA 3PA5A 2Y4IC 3EWHA 4MXAA 4NM0A 3ZC6A 3QKMA 3IOKA 5HCZA 3AG9A 3COKA 4X2NA 4RQVA 4CGAA 4MD9E 3GCQA 3KREA 4LGDA 4RX8A 4UMTA 2VZ6A 5CXHA 2PVMA 5AAFA 3KMMA 3R7YA 3MH1A 4GW8A 1OL2A 2WMBA 4XJ0A 4RA4A 5HHWA 1PXPA 3COIA 2YJRA 4G5PA 5HG8A 2YM6A 3VJNA 1UWJA 4MXOA 3RMFA 4A9TA 4O1PA 2VWVA 3FQEA 5I3OA 3TM0A 3NUYA 4IC7A 2WMWA 3QRTA 2GS7A 3SAYA 4C4HA 3O71A 4JBPA 3BBWA 3CQWA 4O2ZA 1OIUA 4O2PA 1OL1A 3M42A 4A07A 3Q2JA 2X6DA 2VN9A 4EUTA 3U4UA 4YZMA 2BDWA 2PVKA 5A4LA 4CZTA 4DF3A 5BVOA 3C4EA 4I6QA 4G6LA 4QP8A 2F4JA 4DGOA 5CSHA 4BI2A 2J0MB 3BEAA 4G6NA 4IW0A 4FV0A 4HYUA 4QP4A 3DDPA 1UV5A 3PXYA 1UWHA 1XWSA 5C8MA 4F65A 5DFPA 3S4QA 3DLSA 3F3UA 2HK5A 5HLWA 3QTWA 3TKIA 2XUUA 3UPZA 5A46A 1PYXA 3I81A 3O23A 4QMMA 4YBKA 1H0VA 2ZJWA 3TZMA 3WZDA 4AZFA 3EN5A 3UNKA 3CTHA 2ITQA 2OIBA 2XNOA 4Z16A 2PZRA 1H00A 2BTSA 3BE9A 1QPEA 4QQ5A 3V5QA 3TG1A 3T9IA 3IO7A 1V0BA 4JDHA 3MY0A 3RTPA 4HYIA 5CLPA 3PXKA 4AT3A 5F9EA 1PRYA 4IVBA 2IVVA 2PVFA 3LXNA 5M57A 2JDVA 2Y6OA 2QO7A 2YWVA 3Q9YA 1E1VA 1Q8WA 3RWQA 5FLFA 4ERKA 4J96A 3HAMA 3MA3A 2B9IA 3DOGA 2RFSA 3EQBA 3BU5A 3E62A 2NPQA 4YJSA 4O0VA 3F7ZA 3VNTA 5AX9A 4AT4A 4QMPA 1U59A 4FT7A 5HVKA 4LOOA 1SYKA 4I5MA 1Y57A 3R1QA 4LG4A 2VWBA 3FZ1A 4XG4A 3T3UA 4BTJA 1YXUA 3Q9WA 2X0GA 4G31A 4TNBA 5EM7A 2WELA 5B0XA 4HYSA 2VX0A 5HX8A 4FNYA 4MXZA 2NNWB 5DYJA 3UNZA 3BWFA 4O7SA 4HGLA 4HPTE 4U45A 4BIDA 5I3RA 2BRGA 3Q6UA 4FTCA 4RT7A 4F9YA 4FEVA 1BI7A 5HIEA 5L2WA 2RSVA 4M0YA 2AC3A 4IB1A 4L01A 4RLLA 3DY7A 4MQ1A 1PXIA 5E8XA 3LW0A 3BU3A 3UVQA 4BDAA 3GBZA 4G9CA 4N0SA 4BYIA 2DUVA 5IEXA 3AMBA 4AA0A 1LPUA 4AG8A 4RQKA 4LUEA 3WYYA 1MQBA 4R3CA 5AV1A 4K77A 3TN8A 4ENXA 4O6LA 4USFA 2E9OA 4IM0A 4BDDA 3ZO3A 4B0GA 3ZXTA 4BICA 3HDMA 1TKIA 4FIFA 4B9DA 3GU7A 1FVVA 3GFEA 3FSKA 2OF2A 2UVZA 3U9CA 2WMRA 5DT0A 4CMUA 5KHXA 4O84A 2C0IA 2VWIA 2HCKA 3CKXA 3OCGA 3UPXA 4WBOA 4A9SA 4ZEGA 4ZY5A 3LVPA 4F4PA 3Q04A 3E88A 3P5KA 4KRDA 4JG8A 4O0YA 5JFWA 2YJSA 4AX8A 3RVGA 4ZJJA 1J3HA 4BR3A 3QCXA 3BE2A 4YC6A 5CY3A 5BMSA 4G3FA 5DPVA 2J6MA 3TNHA 5TKDA 4JRNA 3VRZA 4PRJA 1KE5A 4RC4A 4Y95A 4TKSA 2A2AA 2VWWA 1A9UA 4QYEA 4B6LA 2HZ0A 2VTMA 2KULA 3TJCA 2OF4A 3TACA 1M14A 3RWPA 3VS0A 2BZIB 1UNHA 3V6RA 4J53A 3PG1A 3N4TA 5DR6A 3WF7A 3AC8A 5BVKA 2WMAA 2G2IA 2WMQA 4EONA 1H1QA 2C5OA 1APME 2ESMA 2X81A 4AN9A 2NP8A 3PSCA 4C62A 5J7BA 4L52A 5B2KA 4ITHA 2IW6A 4KIKB 4HVIA 3KXZA 3IOPA 4RFZA 2V62A 3BWJA 5HD7A 4I6HA 3RPSA 4N6ZA 4TWCA 1WBVA 3NUUA 3LXPA 1QCFA 3OY3A 5G6VA 5C27A 3RAWA 4BI0A 5BNJA 3QQFA 2YZLA 4EHZA 3KMWA 3HKOA 4U9AA 4RSSA 1IASA 4CG8A 4D1SA 3QGYA 4QTBA 2WNTA 2O64A 3LJ0A 1L8TA 3JYAA 3FPQA 2B9FA 3MPMA 3OTUA 5KMMA 4L3PA 3WF5A 3DZQA 2JIVA 5JSMA 1ND4A 3LCKA 5H9BA 1ZAOA 4UXLA 1IG1A 2E9VA 4G34A 5T6KA 4BI1A 4OLIA 1UNLA 3GC7A 2GCDA 2EXMA 4TYEA 3BYSA 4E20A 2R5TA 3I7BA 4L00A 2X7GA 1L3RE 1XH8A 4D2SA 4AW0A 4X21A 4KINA 1E9HA 4EOLA 1J7LA 1XH4A 1H4LA 4BTKA 1UU8A 4EZ5A 2P33A 3R00A 5CENA 3ZBXA 2QODA 1UKHA 4ZAUA 3MGYA 4YZCA 5CVFA 5JGAA 2R3RA 5F4NA 1M2QA 2R7IA 4F08A 3R1NA 2YLFA 4D0WA 4KIQA 1H24A 5BVDA 2C1AA 4O21A 4FBXA 1YWVA 4HZSA 4X7QA 5CVGA 5L2QA 4QD6A 2Z2WA 5D12A 3D14A 3G6GA 5IUHA 1SNXA 3HEGA 4LFIA 5JMSA 3NDMA 3M2WA 2PHKA 4GK4A 3KXGA 3F7WA 2QHMA 3IW7A 5BVFA 4PL5A 4R3PA 3EYGA 3Q4CA 4EORA 1YWNA 3AT4A 4L44A 1FVTA 3PP0A 4TTHB 3FWQA 4RWIA 4TXCA 4ZTRA 3U9NA 4EH4A 4YNOA 4AWIA 2LGCA 3QQGA 3F61A 3AT3A 2B9JA 3UO5A 3ZO2A 4EKKA 4D9UA 4TWNA 4KIOA 4TN6A 5FP5A 5FRIA 1J1CA 5C8NA 2W05A 1VYWA 4DBNA 3GU8A 1LEWA 5FEEA 3ZM4A 1OIYA 1RDQE 2R3PA 2WMSA 1QPDA 3ZC5A 5IF1A 1KV1A 4KRCA 3PA4A 5KNJA 1AD5A 3BZ3A 2WQNA 4G3DA 3QF9A 4I23A 1ZYJA 3LFCA 4CFVA 3G9LX 3ORPA 3PE1A 5CU4A 2O2UA 5CWZA 5CX9A 2Z7QA 5HE0A 3VS2A 1GIJA 3NYXA 3BI6A 3H30A 4I24A 1GIIA 3QTXA 2C3LA 3BPRA 3O8TA 4UMRA 3LHJA 1ZMWA 2J51A 4YJNA 3ZU7A 3DK7A 4Y5QA 1GOLA 3POOA 4JJRA 3W55A 2PVNA 4JDJA 3QQLA 3E63A 3ALOA 1GZOA 4YNEA 3JR1A 5HQ0A 4GL9A 4H3BA 5KKRB 3T9TA 3F9NA 3AC4A 4QMXA 2YITA 3CY2A 3BYVA 3LXKA 3TNIA 1URWA 4IZ7A 5AP7A 4F7JA 4FUXA 3CEKA 5HIBA 5ETAA 1UKIA 2V7OA 4O0UA 3BLRA 1J91A 3NWWA 4XMOA 4EOKA 4MWIA 1O6YA 4DFZE 4LV8A 4Q9ZA 2XNGA 3QZGA 4MK0A 3UC4A 2UZOA 2B1PA 3S0OA 3KF7A 3G33A 3EFWA 2WGJA 2B53A 4X2JA 3EQGA 2V5QA 4MBJA 5EI8A 3VBYA 4ZSGA 4FTTA 4C61A 4CRSA 4PDYA 2QKRA 4Z7GA 5IEVA 4QP6A 2Q0BA 5L6OA 4BZDA 5J95A 3HA8A 2HENA 3O17A 5LCJA 4M15A 3EB0A 1V0OA 4IB3A 5LMAA 2VX1A 3P23A 4C59A 5CT7A 3SVVA 4H36A 5M51A 3G0FA 4OBPA 4JAJA 3ZRKA 4FG8A 4L6QA 3PXRA 3RAKA 2YIQA 3FLQA 1XR1A 4GVAA 1DAYA 2XF0A 4QT1A 3LFAA 4IDTA 4O0SA 4JI9A 3TT0A 3E93A 3EJ1A 5CEIA 4ZLZA 3QX2A 4KB8A 4RX9A 3COMA 3P78A 2QCSA 4IMYA 5AV3A 5FM2A 5FDXA 1SNUA 4FSQA 4FTOA 2BCJA 3GGFA 1WVWA 3ZEPA 1Q8TA 2W1HA 3NYOA 2CKOA 2PUIA 2RFDA 3AC2A 3QD2B 4D5HA 3G6HA 2QQ7A 3BYOA 4IJ9A 2PSQA 4LMNA 2BRHA 3OXTA 3ORMA 4FI1A 3ORXA 1B38A 5EYMA 1O6KA 5AUTA 4RA5A 5BVWA 1YHSA 3LCDA 2CKPA 2J2IB 4RC2A 5CF6A 3QTZA 1YQJA 4L42A 4DT8A 4FVPA 3GCVA 4GMYA 3ZTXA 4ZLOA 4YJTA 2XNBA 4NIFB 4FKRA 1G5SA 2QOHA 3FLNC 2XKCA 3TUCA 5HG5A 5BUIA 1URCA 4XYFA 3RK7A 5FBOA 4PX6A 3SG8A 4DITA 5DR2A 4MD7E 3POZA 2XZSA 3KL8A 3TTIA 4S2ZA 4C7TA 1WBOA 1M7NA 3QAME 4M0ZA 5FG8A 4F9WA 1GZKA 3E8DA 3E8EA 1XBBA 3NRMA 4WO5A 4WNPA 5L4QA 4RIOA 5FUTA 3PVUA 5ANKA 4O7ZA 4FV9A 5CI6A 5T68A 3ZCLA 5CQWA 3BCEA 3ORZA 4RVKA 5C9CA 4G9RA 2CMWA 3UGCA 2OBJA 4WD5A 3QTIA 4YHJA 2YCFA 3ORNA 4U81A 2UVYA 4CFNA 3EFKA 4AACA 4FTUA 2VGOA 4ERWA 3LQ8A 3AGLA 5DN3A 3MSSA 4D58A 3MH2A 3P79A 4TWOA 3DFCB 3EKNA 4YJQA 5HE3A 2EU9A 3C51A 4RIXB 2JKMA 4MHAA 5C8KA 1XH7A 2H9VA 3BU6A 4N6YA 2F2UA 2UW8A 2VX3A 2WTDA 3ZRLA 3ZUVA 4AE6A 4ANMA 1OBGA 2ZMDA 3A8WA 4IB5A 3NVMB 1R39A 5AWMA 5JZNA 3P9JA 1JSTA 1STCE 1PXMA 2GTNA 3A61A 2W96B 3B8QA 2YHVA 3PPJA 4BDBA 4BGGA 4UZDA 2XEYA 2JDSA 3R02A 1OUYA 3P08A 2Z7RA 5HVYA 4ZLYA 3MESA 3HMPA 5KZ0A 1JNKA 4L43A 3KULB 5IU2A 5CU3A 4AOJA 2Y6MA 3BQRA 3PWYA 3PP1A 4EQMA 5HZNA 1BL6A 3OWPA 1MUOA 3QD0A 4EH2A 3GVUA 4YSJA 2V55A 4F9CA 3O2MA 2P0CA 4Q9SA 4OW8A 2GFSA 2OWBA 2KTYA 4GCJA 2R3NA 4FMQA 5D7AA 3A7IA 4IM3A 4UZHA 2XRUA 3UO6A 2R3GA 3NIEA 2J0KA 4AUAA 4LQMA 3UP2A 4TPTA 2C3KA 5AP3A 4YJVA 2C0OA 1GY3A 2E2BA 4I20A 4FX3A 3JXWA 4FSZA 3SXFA 3FXWA 3VW8A 2B55A 4H58A 5L3AA 5F20A 4JIKA 4F0GA 1R0PA 4L7FA 4QP1A 3HLLA 5HIDA 4CQEA 3FYKX 2XJ0A 4FZ7A 5AUZA 4M13A 4RJ3A 4C4FA 2OGVA 5KBQA 3UOKA 3E64A 4I5HA 5JFXA 5KMIA 4YC8A 4FV1A 1U54A 1PKDA 4N70A 2HWPA 2JKOA 3FKLA 4PDPA 5HTCA 4F7SA 2XB7A 1REKA 2WZJA 4TYHA 4QMNA 4U97A 3FY0A 4QP2A 3OFMA 2HIWA 2JAVA 4L3LA 4YJOA 1PW2A 3PUPA 4PPBA 4EYMA 3JS2A 4ITIA 4E4MA 4YJRA 4EZ7A 4AZWA 1S9JA 4I21A 3SRVA 4NK9A 4QMWA 3U54A 3SX9A 2C1BA 3R22A 4PTCA 2PUNA 1YOLA 3B2WA 5DG5A 4F09A 4FYOA 4D9TA 3UIMA 2X8EA 5M44A 3IW6A 3WYXA 4G3CA 3S1HA 4X2FA 3Q4ZA 4M69A 2VO0A 4QMZA 5CYIA 3TUDA 2BDFA 5I9ZA 4ZY6A 1CKJA 4DLIA 4O81A 3IONA 4DTAA 1OKZA 2ZB0A 4OTIA 3GC9A 4XS2A 4GSBA 5J5SA 1H1PA 5EM5A 3A4OX 4ZXTA 2W9FB 1ZRZA 3BX5A 4HVHA 1OECA 4OTHA 4U0IA 4R7IA 3GNIB 4QQTA 4HPUE 4FTJA 2WMVA 4FT5A 1OVEA 1OIQA 2VTTA 4KIPA 5LMBA 3O8UA 2UZBA 4F6WA 3UE4A 5A4QA 3DKGA 2PZ5A 4E26A 1SM2A 5J5TA 5K4JA 3DJ7A 3EQIA 4RIYB 2REIA 5TR6A 4DEIA 4J1RA 4DN5A 4NM5A 1T45A 3ZLSA 3R28A 2JIUA 4J52A 3V5TA 4APCA 1W82A 1ATPE 4GYIA 3UBDA 1A48A 4LOPA 3DDQA 4YSMA 4I0SA 5KO1A 2ZB1A 4CMTA 3LCOA 2ZV2A 1WZYA 4C4EA 3HRFA 1WCCA 3C4XA 3PIYA 2OJJA 4I5PA 4QPSA 2W1FA 3N9XA 2OJ9A 2W1IA 1YDSE 3PJ3A 2WO6A 4OTGA 2XCHA 3ZYAA 2GSFA 1CKIA 4CLIA 3HMNA 4UMPA 3DXNA 3VS5A 5EQPA 4RZWA 3ATTA 4AZEA 4BGHA 3I6UA 5JN2A 3ZLYA 4K9YA 1NVQA 3HV6A 2J0JA 1H07A 2F7XE 3FE3A 4HGEA 1HCKA 4KD1A 5L6PA 1H0WA 3TL8A 2VTRA 2FB8A 3EQFA 4M67A 1JVPP 3IGGA 3PIZA 4JBQA 4QYYA 3G90X 4YHTA 3ZSGA 4AZVA 4OGRA 2OSCA 3WZUA 2XP2A 4AP7A 4ZMEA 4RFMA 3U87A 4BY9E 4FA2A 4NT4A 5IMEA 3BELA 3MVLA 5LXMA 3UQCA 2VUWA 4P90A 1Y91A 4L53A 3GCSA 4BIBA 4JIAA 4PNKA 4DEAA 3FC2A 3PPZA 4IZAA 5BX0A 1JSVA 1YKRA 3ANQA 2PVJA 2BRMA 3L8PA 3R63A 4G3GA 1JKKA 4FSNA 5E8SA 4USEA 3AGMA 3V8TA 2UW7A 3AMAA 3C1XA 4O7YA 3HV7A 3QKLA 3AD5A 3VUDA 3MIAA 3FL5A 3FSFA 4D2VA 4FEWA 4U42A 4MXYA 3ZH8A 4O0TA 3EQPA 2PMIA 3MW1A 2CSNA 4EK8A 4ZZNA 3PLAE 4E4XA 4C35A 4L45A 4ZZOA 2HXQA 3NCGA 2FSOX 3R01A 2C6DA 2BVAA 4BC6A 4IWQA 5GINE 1E1XA 2DWBA 3AOXA 5M06A 4IVDA 5CZHA 1R0EA 2ITZA 4FZ6A 3F66A 3ANRA 2WQMA 1ZLTA 5ANOA 1H25A 4FTQA 2JKKA 5CNNA 4F0IA 3FMKA 3R7UA 3QYZA 2W1DA 5EYDA 1P4OA 1H1SA 3ODYX 3V8SA 2ITXA 3OG7A 2XKEA 3UOJA 5K0KA 5FEQA 3L9PA 1XH5A 5F94A 1KUTA 2OKRA 4X3JA 5EK7A 1GJOA 4TYHB 3K54A 2PL0A 4C2VA 2XIZA 4E93A 4OTRA 2GQSA 2VWXA 4GU9A 3VC4A 4EK5A 3NW5A 5HTBA 3QTUA 2W99B 3W2RA 5KMNA 5K0XA 2XIRA 4F63A 3SRVB 3S3IA 5IA3A 5EDPA 4O38A 2WTCA 2OO8X 3R9RA 4FKOA 3ZUUA 1K3AA 3CS9A 2XM8A 3I79A 3L8VA 4K33A 3H0YA 2CGXA 1Q41A 3D7TA 2YA9A 3KCKA 1W83A 3D94A 4CRLA 4BDFA 2YIRA 3SV0A 4TY1A 5M55A 3VHKA 4M69B 3TUBA 3GXLA 2J9MA 3SD0A 3V8WA 2QOIA 3CTJA 5AM6A 3VO3A 3CIKA 2OFUA 4WG3A 3OROA 1ZY4A 1OL6A 4X2GA 4YTIA 1OKVA 3FQSA 3I4BA 2YM4A 3CTQA 2A19B 3IKAA 4FSMA 2FH9A 5JT2A 3RAIA 4I5CA 1ZY5A 3UG2A 3HECA 2W0JA 2R2PA 5IDNA 4KIKA 1OM1A 5EYKA 4ITJA 5BUJA 4ASZA 2FSTX 3NVKI 1W0XC 4FV6A 2AUHA 2IN6A 5CNOA 4FOBA 4GS6A 3BHYA 1ZYLA 4IEBA 4W4XA 5AA8A 4HJOA 4EC9A 3NS9A 1M17A 4LGGA 5DWRA 3CR0A 4GKIA 3OT3A 3F3VA 3QTQA 5IA1A 2QR7A 2GHLA 3PFQA 2QONA 4DFNA 1RW8A 2OICA 3OC1A 1JLUE 4G1WA 4EH3A 3QA0A 5DT4A 2YISA 3H9RA 3BEGA 2JD5A 3FLSA 3SDJA 4A7CA 2UW5A 5HO7A 4DFXE 4AW2A 2E9UA 2JGZA 2UW4A 5EHYA 2W4KA 3EQCA 4K11A 3QCYA 3FPMA 1ERKA 3HMMA 3UDBA 4MAOA 1CM8A 4LOQA 2WOTA 4ASXA 4O91A 2J90A 3Q32A 5BYYA 4M8TA 3NSZA 4MXXA 1R78A 2VV9A 5IUGA 3TEIA 4K0YA 3PXFA 2XEZA 3BHVA 3MFTA 2XH5A 4M66A 4M68A 3RCDA 2QVSE 4AS0A 4BDIA 5DE2A 5EDQA 4GK3A 4ZOGA 4MF1A 1JQHA 1OZ1A 1I09A 3C7QA 3HRBA 2X6EA 2W1ZA 4Z9LA 3V5WA 4IFGA 4EKLA 3PY1A 4V0GB 1AQ1A 4RJ8A 4ZTQA 3VS1A 4DH8A 1V1KA 1NW1A 5AIKA 3FZRA 3M1SA 2CGWA 3WE8A 5JK3A 3ENMA 1BYGA 3NPCA 4FR4A 4JR7A 4O0RA 4W8EA 5EM6A 4UB7A 3WI6A 3OW4A 4RIWB 3RM6A 4OT5A 4W4WA 3VQUA 3K3JA 3QCQA 1P2AA 2VU3A 3BV3A 4MF0A 4D5KA 3UIXA 3RP9A 3IECA 3NZ0A 4ZP5A 4BCNA 4NM3A 2QR8A 4W8DA 3LFQA 1FPUA 5EHOA 5C01A 3OP5A 3UMXA 3F5PA 4YPSA 5CAOA 4IAFA 4PV0A 2JDOA 4FKQA 4YUQA 2UW6A 2WPAA 1U46A 2QOLA 3OTVA 4I4FA 5HICA 3RPYA 2QNJA 4FL3A 1AGWA 2PVYA 3C0IA 4FTLA 4DEGA 4B8MA 4FV8A 2PE1A 1IAHA 3OY1A 4IX6A 3JY9A 2WKMA 3KKVA 4R3RA 1PXOA 4CNHA 3WIGA 4HVGA 4NZWB 4WUAA 5LMKA 3VUTA 3R1YA 3ZO4A 2XK9A 4GU6A 5CU6A 3LFEA 2EUFB 2ONLC 2P4IA 2X2KA 3HGKA 4IXPA 4H3QA 5E8ZA 5H8EA 5CAQA 4F7NA 3MH0A 4ZJIA 3SQQA 4E73A 1VR2A 4UALA 3ELJA 4JQ8A 4DTKA 4EEVA 2ITTA 2OZAB 4BCOA 3SA0A 4G2FA 4ACCA 4HW7A 5FDPA 1YXXA 3EMGA 2CHLA 3VJOA 3LFSA 4JXFA 3PSBA 3KXNA 3FHIA 3MTLA 3P7CA 5EH0A 4HNFA 2Q83A 3DKCA 5M4IA 4F6SA 4XX9A 3ORTA 4BBEA 5JZJA 1NVSA 4LMUA 5EG3A 4BCKA 2YWPA 5HE1A 3W10A 3DBDA 4A4XA 2R9SA 2A4LA 4FSUA 2Q0NA 3V5LA 1B6CB 2JDTA 2C6KA 3CJFA 3KN6A 5D41A 3ORLA 2O3PA 3PTGA 4GT3A 3I0QA 2YDKA 3D7TB 4NKAA 2XYNA 4CFUA 4K8AA 4BYJA 3OT8A 4JOAA 5EDRA 3ZLWA 4A9RA 2GMXA 1JKLA 3FMEA 3Q52A 3W16A 4HNIA 4UMUA 2WB8A 2VNWA 1TQMA 3W2QA 4XG3A 3BHUA 3HL7A 4ANBA 2CCIA 3LZBA 3FLZA 4KBAA 2GHGA 3VHEA 4DBXA 4IM2A 4PP7A 3OXZA 2GQRA 4CYIA 2HW6A 4J97A 4WRGA 4O83A 1A06A 1H28A 3KB7A 3OWLA 3RI1A 3VBVA 4DCAA 4UY9A 1P14A 2ZM3A 4FSWA 3PY0A 4QO9A 4Z55A 3CBLA 3D9VA 3HYHA 1YDTE 4PL4A 3W2OA 1X8BA 2XA4A 4FV3A 4WIHA 2E9NA 3D5UA 3FMDA 1XH6A 2ZM1A 3GOPA 4K18A 3QYWA 3ETAA 3FKOA 2JKQA 3D0EA 3QXPA 4U6RA 1CMKE 4IAYA 2RL5A 3F3WA 4YU2A 3BLHA 3K3IA 4YLLA 4D2TA 1KWPA 5CEKA 3UTOA 1Y6BA 1OGUA 4DA5A 4JNWA 5A3XA 3WBLA 1TQIA 2V0DA 4AN3A 5CU2A 1T46A 4MNEB 4I1ZA 2Z7SA 4L3JA 4F0FA 4C33A 3P7BA 4PNIA 2HY81 3VS7A 4ASDA 5D10A 3RK5A 1IA9A 4NCTC 4Q5EA 1WVYA 2Z02A 4ID7A 3TNQB 3D5VA 3W2CA 3HP5A 4KKGA 4XLIA 4E6AA 2A0CX 5AR3A 5I9XA 3O7LB 5HBHA 4EWQA 4ACDA 3WARA 2H34A 3BYUA 2BALA 5IG1A 1LUFA 2HZIA 2BMCA 3UOHA 4QPMA 4R77A 3U6IA 4WA9A 4PMTA 1ZMVA 1SVGA 5AP6A 3F5XA 3FUPA 4RMZA 2AYPA 5E8YA 3VBTA 5A4TA 4IZ5A 2PVHA 3N51A 3H10A 4MNFA 4NIFA 2P2IA 4D4RA 2J5EA 5CF5A 1H01A 4RZVA 4LUDA 2PVRA 4E7WA 4TYIA 3TIYA 2R3LA 4GV1A 3UODA 4XRLA 2HYYA 1O6LA 3G9NA 4BCHA 1JOWB 3R7GA 2B4SB 1Q61A 5DRBA 4FG7A 4FL1A 3R7IA 4AN2A 5BYLA 3NUNA 3GFWA 2F49A 3QX4A 3ORKA 3Q4TA 3R2BA 3L9NA 4J98A 2XK4A 1U5QA 3BRBA 1JKTA 2OJGA 3NNUA 3TIZA 3RK9A 5AUUA 1PMUA 5JQ8A 5IA4A 3UC3A 3CPCA 4I0TA 4R1YA 3ROCA 4BIEA 4C36A 4EH6A 5IQAA 4JBOA 5HCXA 3MB7A 2Y8OA 4Y5HA 3QD3A 3KA0A 2WQBA 4IWPA 4EOOA 3BHTA 4H3PA 5TF9A 5ITAA 2IVTA 3UOLA 2R0IA 1YXTA 1DI9A 2UZNA 4NW6A 5T3QA 3A99A 4RIXA 4ONAA 2XCKA 1YI3A 3VW6A 4GT5A 3U6HA 2ZYBA 4E6QA 2C5NA 4U41A 2PK9A 4RLKA 5GZ9A 5C26A 4GFGA 3TWJA 4QMUA 5L8LA 5DI1A 4U44A 1CDKA 3FMHA 2XK8A 2VO7A 4PWNA 4EJNA 3HX4A 1NXKA 4FK6A 2X7FA 4ACGA 4KSPA 3PJ8A 4CCBA 4BN1A 2RFEA 3KULA 1PY5A 4H1JA 3HNGA 5KMKA 3GQLA 3DK3A 4FYNA 1YHVA 2VRXA 3MDYA 4QQJA 4XEYA 4Y73A 5HCYA 4G5JA 2O63A 1LR4A 3OUNB 3OW3A 3MI9A 4KNBA 2AC5A 4O22A 1M2RA 5IZFA 1WFCA 4TW9A 4EH9A 3E92A 4PMMA 5TT7A 2OXDA 3FMLA 4Y8DA 5B7VA 3ULIA 5AFVA 3OCBA 2IZTA 4FZAB 4OTFA 1QPJA 3LCSA 4NTSA 2F7EE 4XUFA 3U51A 5AAGA 2R3KA 2XKDA 4DH1A 5FTGA 2I6LA 4NM7A 2JEDA 5IQEA 4R7BA 5ANIA 2ETRA 3TZ7A 4DFLA 2WU7A 3DPKA 4BCQA 5AM7A 3TJDA 4DHFA 4AGDA 4WSQA 1BMKA 4QNYA 4QMQA 2EVAA 2W17A 4ORKA 1MQ4A 2XNNA 3E5AA 3QRUA 2ITYA 2C5YA 2E9PA 3DCVA 4LGHA 3R8ZA 5HVJA 1KE9A 2GNGA 3PDTA 4II5A 4KAOA 3PIXA 2PVLA 4S34A 2C4GA 2OK1A 3Q6WA 2ZAZA 3HVCA 3PPKA 4ZY4A 4EZ3A 3O7LD 4EQUA 1OMWA 4DFBA 3EIDA 4TYGA 4I22A 3C0GA 4ZTMA 4ACHA 5KBRA 5C4LA 3MVHA 2C68A 4IAAA 4R6VA 2CKQA 1WBWA 3SC1A 2R0UA 3QL8A 2B52A 4QMVA 3S2PA 5GZ8A 3IS5A 2GNJA 3PYYA 2ITVA 5BVNA 2NRUA 4W9XA 3LM0A 3SXSA 1Q8UA 3QRKA 4U3ZA 3R8MA 3AD6A 5IQHA 4KABA 3LQ5A 5LVLA 3DK6A 4XV2A 3A2CA 2C47A 3NUAA 3I1AA 4IWOA 5J87A 3C4WA 3QTSA 3UZTA 3G2FA 3E8NA 2IO6A 4BHNA 5CSPA 3OUKA 2BHHA 3OVVA 4GIHA 1BI8A 4TT7A 2QLQA 4ZS4A 3JVSA 3KRJA 4NU1A 5IQIA 1PMVA 3PSDA 4BKJA 1R1WA 2R3IA 3WF8A 4QPAA 4RWLA 2UW9A 3KRLA 1IAJA 4FV2A 4XP2A 1GZ8A 4I0RA 4XHKB 4GYGA 3F3ZA 4OT6A 3MYGA 4QTDA 4ZMFA 5IA0A 4CFXA 2LAVA 5HG9A 2EXEA 4FV4A 3D7ZA 3R21A 4YZBA 3OBGA 3GI3A 2VTLA 4PPCA 4RIYA 4JRVA 3FQHA 3IW8A 4XOYA 5KUPA 1BLXA 4I6BA 5JKGA 4ANNA 3GC8A 5HNIX 3MN3A 3MTFA 4KA3A 5FGKA 3UVRA 4GIIA 5ETIA 3OEFX 2C6IA 3KXMA 4YZNA 5BUEA 3WZJA 4FTAA 3C13A 1GAGA 2YCSA 3H9FA 3A7GA 3KY2A 2FVDA 1YVJA 2ZM4A 4YTFA 4IH8A 4CKIA 3OOGA 4Q5HA 5ACBC 2WTJA 5E92A 3HMOA 3UO4A 3DNEA 5DVRA 5J9YA 2ACXA 3AMYA 3CGFA 3FJQE 5GJFA 5E91A 4CQGA 4JQEA 4FIJA 4I93A 4OTDA 4FSRA 4JX3A 3C4FA 3D2IA 1OB3A 1Z57A 5AP5A 2PPQA 3PE2A 2P55A 3WZEA 4LYNA 3CD3A 2JIIA 3MH3A 3NNWA 4MBIA 4JL9A 4BDHA 3IW5A 3ITZA 3MB6A 3ZDUA 4WNKA 2VTNA 4BKZA 5HO8A 1XJDA 3QQHA 1FGIA 3R7OA 5AV4A 4D4SA 4FKVA 5K5XA 3UQFA 2IW8A 2J0LA 3LJ2A 2IW9A 2XK3A 1JPAA 2BR1A 3LFDA 5BYZA 2EB3A 3I60A 2VD5A 4XOZA 2XBJA 1F0QA 3JY0A 4LRJA 4BCPA 4QRCA 3FI8A 3PVGA 4KBKA 3ZFYA 3FAAA 4B8LA 4YLJA 3NGAA 4O7WA 3AC5A 4P2KA 3FI4A 3AD4A 3HUCA 1Z5MA 4DH5A 4JAIA 5HLPA 2ZV8A 4KBCA 2XK7A 1PMEA 2WXVA 4DC2A 1F3MC 3DT1A 3HUBA 4U3YA 2VO6A 4L9IA 5EYCA 2HELA 2QOFA 2Y9QA 3QD4A 5E1SA 3MIYA 3Q9ZA 3QA8A 5LOHA 5I9YA 4IACA 2CN5A 2R3JA 3O50A 1YI6A 2H96A 4YHFA 3LKMA 2BZKB 3KN5A 1I44A 5JEBA 3MA6A 3BHHA 4R1VA 2PY3A 4LRMA 3B8RA 5CEQA 2FO0A 2X8DA 3OMVA 4YLKA 5I9UA 1EH4A 3QRJA 4BL1A 3QQUA 4G16A 3LIJA 5CS6A 3IG7A 3QXOA 2R3QA 5H2UA 5GJGA 5KZIA 4AE9A 5CU0A 3V5PA 1H08A 3ACKA 4UXQA 4MXCA 4EHVA 1XKKA 4XG6A 2WOUA 4C34A 4I94A 4UWCA 4O27B 4A9YA 4EL9A 4MTAA 1S9IA 3RNIA 3ZHPC 3H3CA 4RJ5A 4C0TA 5JQ5A 2FA2A 3F88A 3R6XA 4M84A 4CSVA 4ENYA 2V7AA 3VBWA 2PZYA 2WAJA 3PXZA 3KXXA 5AEPA 5HKMA 3V5JA 3MPAA 1JBPE 4GG5A 1V0PA 3L1SA 3KRWA 4E3CA 3CQEA 4D1ZA 1Q8ZA 2GPHA 2X1NA 4CKJA 1P4FA 2JFMA 4C4JA 2O5KA 2PUPA 2X39A 3W2PA 3P4KA 2W1GA 2X4ZA 5EKOA 4FTRA 5CASA 5I9VA 5DA3A 1DI8A 3QLGA 3VF8A 2QOKA 4GFOA 1YRPA 1WVXA 4WHZA 4EOIA 3TV6A 4F99A 3DBQA 2ERKA 3IDCA 2G15A 3R30A 5FXSA 3GUBA 3ZSHA 3R8UA 2J50A 4BFMA 3FKNA 4AOTA 1Q8YA 3FI2A 3I0OA 2VTAA 4NFNA 4EH7A 2ZV7A 3G51A 5EHLA 4E1ZA 5A9UA 3K2LA 4JBVA 4DGLC 3GC0A 1G8SA 1Q97A 5J1WA 3DB6A 3ODZX 4ZJVA 5GIPE 4FKWA 4IIRA 2IG7A 3A4PA 3MJ2A 2YM3A 3QWJA 4IAIA 2C6EA 2YAAA 4F1TA 2OLCA 4MVFA 5KCVA 3ZRMA 4FC0A 2FYSA 4FKGA 3SHEA 3OWJA 4E5AX 2XJ1A 3EZVA 4EK4A 2CJMA 3CKWA 3CP9A 4GUEA 4U40A 4UYNA 2QOCA 5EI2A 2WQEA 5EOLA 4FEQA 3EFLA 4FKIA 4F64A 1VEBA 3GOKA 2XJ2A 1UA2A 3EN7A 3TNWA 2F2CB 2XIKA 3UIBA 4AZTA 5HGIA 2J5FA 4DH7A 2W1CA 3CQUA 3S95A 3K5UA 4ALUA 3F2RA 5LVOA 3F2AA 4YP8A 2ONLA 4PP9A 3EL8A 3C5IA 5E7RA 4DGGA 2IWIA 4B99A 2C3IB 2FUMA 3DB8A 4DT9A 2YCRA 2SRCA 5FTQA 4AT5A 5CANA 2QOQA 4V0GA 2YN8A 3BYMA 3PXQA 3K5VA 5JFVA 4C58A 3QLFA 3QHRA 3AXWA 3R71A 5D7VA 3R73A 4BRXA 4D1XA 2H6DA 4BWPA 4M97A 4F7LA 5AAEA 1JSUA 4FGRA 4RIWA 2XNMA 1WAKA 3SOAA 4Y72A 4BDJA 2CKEA 4EK3A 3CLYA 3FMNA 3ZLXA 4D4YA 1OI9A 4KS7A 5JH6A 3ZDIA 4FVQA 5HESA 2DQ7X 1LP4A 3ALNA 3DAKA 4UEUA 2UZVA 4X0MA 4AF3A 4CZYB 4RFYA 1W84A 4YC3A 3O8PA 4NW5A 3Q5IA 1WBNA 3DFAA 4CTBA 2Z7LA 4DG0E 3QGWA 4D28A 4E4LA 1IR3A 3DZOA 4FICA 3SKCA 2ETKA 3GEQA 3ZFMA 2QOBA 4DG2E 1F5QA 4O7RA 4YJUA 3FXZA 4C57A 2CNQA 5CTPA 2CGUA 2PE0A 5JRSA 3UZPA 4DFYA 3GCPA 5CEMA 1BUHA 1FMKA 4RWKA 4IHPA 4ZTSA 3R9NA 4JVGA 4W4VA 1W8CA 4QTEA 4G3EA 5J79A 2OZAA 4V04A 2BZJA 4EBWA 4UX9A 4GJ2A 3ZMMA 3M11A 4NJ3A 1BL7A 3PLSA 4EOJA 4K6ZA 4XH6A 4HVSA 5KX8A 4N57A 4FNWA 2VAGA 3EQRA 1H1WA 1OKYA 1YWRA 3FMMA 3U8WA 1KE8A 3D15A 3IQ7A 3BGPA 2QG7A 2PYWA 1SVHA 3Q9XA 4QQCA 4C3PA 5EQEA 1PYEA 1XBCA 2WEIA 3KK8A 4IAZA 4X3FC 5FM3A 3PVBA 3MJ1A 4TYJA 2PE2A 2I0VA 2XRWA 5L8KA 4FUYA 4XV1A 4Y85A 3L8XA 1MRYA 2FGIA 5E4HA 5AR4A 4NCTA 5DT3A 5M4CA 5IA2A 5DNRA 3QUDA 5F95A 2JDRA 3S00A 4F70A 4DEHA 2YIWA 3H0ZA 3NYVA 4GKHA 2WD1A 4L8MA 3TZ9A 4FSYA 3IGOA 4I3ZA 4A9UA 3TKHA 4I92A 4DGNA 1FGKA 1Q24A 2OXYA 2YAKA 4ZTNA 1W98A 3QU0A 5AUWA 4CG9A 2BAJA 1NA7A 1U5RA 3JPVA 3L9MA 4BBFA 4EHEA 1FMOE 4GG7A 4IQ6A 5I5ZA 2OH0E 4MWHA 3R7VA 5I9WA 5M07A 3FMJA 4DE4A 3W33A 2BROA 1TVOA 5J8IA 2YZAA 2PU8A 3IW4A 5CF8A 2PULA 5M4FA 4CFMA 2W06A 3LAUA 4RWJA 5LWNA 4FODA 2C3JA 3DLZA 3LPBA 4MNEA 4ANQA 2X9FA 5H8GA 5M08A 2QLUA 3QTRA 4MKCA 1GNGA 1ZWSA 2YIXA 3C4ZA 2VTJA 3BGQA 1ZOEA 2X2LA 2DYLA 3VIDA 3AQVA 3LMIA 4FKUA 3FY2A 5AP0A 4RPVA 3ZO1A 2OH4A 4EOMA 4F1MA 2BAQA 3II5A 4Y46A 4JDIA 4QMSA 4X6QC 3ZZEA 2BDJA 2QHNA 4M12A 5A54A 3DQXA 1Y6AA 1QPCA 3GQIA 3GP0A 3VUGA 3OF0A 4AA4A 5A6OA 5GHVA 3HP2A 2JFLA 4PUZA 2P2HA 4IC8A 4GUBA 3LCTA 4GVJA 4XV9A 4J8MA 3F3TA
chains in the Genus database with same CATH superfamily
1RE8A 2BILB 2WEVA 3E87A 5AR7A 4LV5A 3DU8A 2W4OA 5AR5A 4FZFB 3QFVA 3QKKA 3BL7A 3W32A 4RX5A 3QRIA 5ANDA 4ZTHA 4MBLA 4FGBA 4USDA 2VTSA 3NNXA 4GJ3A 4NYEA 4EH5A 5DR9A 2BHEA 2BPMA 4ZK5A 1JWHA 3RINA 4L68A 3NCZA 4RJ7A 4BTMA 5I0BA 2I40A 4FTIA 3MPTA 5J1VA 4FIIA 2QKWB 1PXLA 4FEXA 4NL0A 4AXDA 4Z3VA 4IZYA 4EOSA 4AQCA 3MV5A 1YHWA 4DEEA 5CEPA 1ZOHA 2C6LA 3NMUF 3PRFA 2BIKB 4AGWA 4FZDB 4U80A 1FBNA 1IA8A 4PY1A 4LM5A 2NO3A 4O0XA 3OOMA 4GH2A 1CKPA 1PXNA 5HLNA 3MVJA 5CVHA 5I4NA 3VULA 5KMJA 5CSWA 3EZRA 4XP3A 4R5SA 3SOCA 5FBNC 4B7TA 3SGCA 2XS0A 3GU6A 4OBOA 3QZHA 3HMIA 4CYJA 4S33A 1OPLA 2XIYA 3KQ7A 4IJPA 4XP0A 1O9UA 4I4EA 4MH7A 3QZFA 2NRYA 2YM8A 3QCSA 4L46A 4CD0A 5D11A 4D2PA 5GJDA 5EW9A 3ZUTA 3SG9A 2BIYA 3MS9A 2CGVA 4M7IA 4C02A 3PG3A 3WILA 4ANOA 2O65A 3CCNA 4OR5A 4JR3A 5HOAA 2XALA 3KU2A 2JBOA 5GNKA 1DS5A 4YMJA 3NUXA 5H8BA 4BDKA 2CCHA 3L9LA 2IZUA 2VWYA 1PHKA 4EH8A 4PTEA 3SLSA 2W5HA 3JUHA 3Q96A 5AIRA 4DH3A 3RBWA 3LMGA 5HI2A 4FRFA 1ZYCA 4L7SA 1YXVA 2CLQA 4BJJB 4BF2A 4ALWA 1BKXA 4BCMA 4FKPA 5IQBA 4UYAA 2X0PA 3C0HA 5DRDA 3OEZA 4FE2A 4Z7HA 3LOKA 4G17A 4JG7A 4JDKA 2R7BA 4QYGA 5L2TA 1REJA 4NJDA 4BCFA 4EHGA 4GEOA 4ZSAA 4E5BA 2UW0A 1PJKA 5GZAA 2UZWE 3NNVA 1QL6A 2RIOA 4O6EA 5AR2A 3TNPC 5IQGA 3EN4A 2X7OA 2GS6A 5J9ZA 3DBEA 4KUJA 4QNAA 3NAYA 3DS6A 2CLXA 2X8IA 2OIQA 3VBXA 3SW7A 5DEWA 2XYUA 1KOAA 5HX6A 5AUXA 5HBJA 4OUCA 3BIZA 4W4YA 4JQ7A 2BRNA 4C3RA 2ERZE 3WIKA 3RPOA 4FT9A 2QURA 5HE2A 4P7EA 4E4NA 5AJQA 1Z9XA 4QP3A 2WTWA 3DTWA 3N4UA 5AMNA 2PZPA 4FSTA 4C37A 5HU3A 2XNEA 4IFCA 4JX7A 5DLSA 4EOQA 3W1FA 5LVNA 2O8YA 3C4CA 4EI4A 5IDPA 5LVPA 2UZEA 1YI4A 3KCFA 3DJ5A 4UV0A 2HOGA 3VUKA 2W5AA 2WIHA 4O7NA 4BCGA 4TL0A 4MX9A 2X4FA 3BQCA 1G8AA 4G6OA 1ZMUA 5CZIA 5FQDC 3IPHA 2X2MA 3UG1A 3W18A 4QTAA 2H8HA 2RG6A 5A4CA 1OIRA 1YXSA 4DFUA 3F5GA 3ORIA 3QZIA 2IJMA 4QOXA 4C4GA 5A14A 5EQYA 1UNGA 3NUSA 4PL3A 4QP9A 4C38A 3FHRA 2BKKA 4PTGA 3C9WA 5B2LA 2C6MA 4TNDA 5TO8A 2RKUA 3MBLA 5C4KA 2YM7A 1JKSA 2BFYA 1MRUA 4TRLA 4XBRA 3R0TA 3PZHA 3NX8A 4RGJA 3FDNA 4IANA 3ID6C 1ZXEA 4FIGA 3DAEA 3LLTA 3PZEA 3QC9A 3CE3A 5E1EA 3EQDA 3THBA 4JS8A 4O1OA 4CT1A 4O7LA 5GIOE 4J99A 5M53A 3MY1A 4WT6A 3EL7A 3RCJA 3HAVA 5CSXA 3RHXA 3QALE 4FKSA 2BFXA 3KF4A 3KC3A 2C5XA 4A06A 3PRIA 1PKGA 2WMUA 5BPYA 4U8ZA 1J1BA 5KMLA 2YFXA 4AAAA 2VTHA 1KV2A 3FYJX 4FV7A 4U79A 5CSVA 1TQPA 2JBPA 3CD8A 3L8SA 4K2RA 4WNMA 5EM8A 3RGFA 4C8BA 4D4VA 2CNUA 4CTCA 2XKFA 2NYAA 3FEGA 3UZRA 3V51A 3W8LA 1VZOA 5M4UA 4KS8A 3CGOA 3CSVA 2BAKA 2J0IA 5CAVA 2YEXA 2P3GX 2VGPA 4S32A 4YTHA 3T3VA 5A4EA 1ST0A 4RJ6A 5EW8A 2QU6A 4ZTLA 4EQCA 1H26A 4HVDA 4CXAA 1H1RA 2R64A 1OPKA 4H39A 4YPDA 3KK9A 2IZSA 4FK3A 3BBTB 3OZ6A 1CTPE 2C30A 3ZXZA 5ACKA 5LCKA 3NW7A 2ITOA 5AP2A 4BWKA 5FD2A 3KVWA 3F2NA 3O96A 4D2WA 1Q99A 4X2KA 3C5UA 4BCIA 1QMZA 2WQOA 3A7FA 5DBXA 4DHJA 5C1QB 3SXRA 4AU8A 4C4IA 2I0EA 3WF9A 4YZDA 4P4CA 4CFFA 1ZARA 4FKTA 5BVEA 3UVPA 4BWXA 4EWHA 4O0WA 2UZUE 1SZMA 3TV7A 3AC1A 3OCTA 1KSWA 4HCUA 2QC6A 3R7EA 2YM5A 5JGDA 3FL4A 4UN0C 3B2TA 4MEDA 2VTIA 3QWKA 4QMOA 5DEYA 4KKHA 5IH6A 4B4LA 4BHZA 4OTPA 5IA5A 2BUJA 3V3VA 3F6XA 5LJJA 3EHAA 5AP1A 4WG4A 1Q62A 3TI1A 3CXWA 2W9ZB 3Q3BA 4ZIMA 4XG7A 4DYMA 5L2SA 4OAUC 4NUSA 2X9EA 4HYHA 5DH3A 3HV4A 2WTKB 3OBJA 5J9LA 3HV5A 2XVDA 4GFMA 5L8JA 4J95A 2W1EA 4RG0A 4DEBA 2CDZA 3KXHA 3OS3A 4M14A 4NKSA 2HZNA 3Q4UA 3ULZA 3IK3A 3R2YA 1Q4LA 1Y8YA 2HW7A 5CI7A 5ETFA 5K3YA 3VS3A 3ZSIA 4ARKA 2CNVA 5D1JA 2WMTA 2W5BA 4J8NA 3C50A 5FTOA 4IX4A 2IVSA 4FTNA 1VYZA 3HZTA 4FNZA 4AW1A 4FNXA 3UP7A 1KE6A 2XBAA 2ZMCA 2ZVAA 5AUYA 1FQ1B 1FINA 4OTQA 2R3OA 3ZFXA 4Y83A 3EKKA 2W7XA 3TDWA 1PXKA 4RBLA 2PMOX 3KGAA 5E9EA 3MFUA 3UMWA 3EQHA 5DIAA 3VBQA 1MRVA 2A1AB 4IVCA 2GQGA 4F1OA 5LMKC 1GZNA 2BKZA 5K4IA 4O86A 4WNOA 3EN6A 2IF8A 4YO4A 3DA6A 3DNDA 4JT3A 1W2CA 2GNLA 2JLDA 3FLWA 2OIDA 2I0HA 3FLYA 1WBPA 3IDPA 2VO3A 3KFAA 1OBDA 4I6FA 5E90A 5E8TA 3MY5A 5IH5A 3TZ8A 5E8UA 4ANLA 5HTIA 2GS2A 2QD9A 3GT8A 3QUEA 2XAMA 2Y0AA 3ERKA 4JG6A 4QP7A 3RPVA 1U4DA 4R5YA 2XNPA 3LXLA 2HWOA 3QUPA 2ZDTA 2YLEA 2WTKC 4K1BA 5LQFA 3R1SA 1ZYSA 4LRKA 2WTIA 2RF9A 4FIHA 4YBJA 4BDEA 4YR8A 4NEUA 4XCUA 4I41A 3NR9A 5E8VA 4Q2AA 1HCLA 5HD4A 3D4QA 1P5EA 3LLAA 4FEUA 3A8XA 5D9HA 4WG5A 3A7JA 3R9DA 1K9AA 2R3MA 3EOCA 3R9OA 4O7VA 2ZDUA 3FBVA 4R78A 3MFRA 3W0QA 2VTOA 2WU6A 4CMOA 4D0XA 5KHWA 3DXPA 1XO2B 2OJIA 3NW6A 5KKRC 5CF4A 4UWYA 2I0YA 2XIXA 4NH1A 2RGPA 3D83A 4BDCA 3CJGA 4XLVA 2UUEA 4XBUA 3VONA 1OL5A 1HOWA 2GHMA 2ITUA 4RJ4A 3TTJA 2G9XA 4AXAA 4CVAA 1UU7A 2OJFE 2QI8A 4IE9A 1NY3A 2C6OA 1Y8GA 3DKFA 2IPXA 3ZM9A 4HCTA 1YW2A 4WUNA 2W4JA 4QYFA 2B9HA 1H27A 3E7VA 3FV8A 3VQHA 4ALVA 5BQ0A 4YZ9A 3REPA 5L2IA 1YOMA 2F7ZE 5H3QA 4E6CA 3CPBA 3U4WA 2IZRA 2I1MA 2BTRA 4FOCA 3BGZA 3R8PA 4DAWA 5CXZA 4J7BA 2CPKE 4WKQA 4H1MA 2BRBA 3RPRA 2GNIA 5JRQA 1KOBA 4X6RA 4U43A 3TYKA 3ROYA 4CZUA 1ZYDA 3BV2A 2OXXA 4IVAA 3A60A 4NWMA 4F9BA 3TXOA 3PA3A 3QHWA 5AX3A 4O7TA 1Q3DA 2G01A 4BCJA 4RVMA 3EFJA 5LARA 5KE0A 4DCEA 4PMSA 3UJGA 3ACJA 1BX6A 3ET7A 5FWKK 4H05A 3WOWA 3DGKA 3EN9A 2GU8A 3RAHA 3G0EA 3PY3A 3NUPA 4RVTA 2OFVA 3VN9A 2UW3A 4ZZMA 4KWPA 2EXCX 5ANEA 1R3CA 4FTKA 4CLJA 2YDJA 3WE4A 3GU5A 5HG7A 2XMYA 4V01A 2PTKA 3DQWA 2QU5A 3KEXA 1OL7A 3KRXA 2G2FA 4EJ7A 2JAMA 2VNYA 3ZS5A 2OZOA 5E8WA 5IEYA 3AT2A 4RX7A 4QYHA 3OD6X 3OWKA 4KKEA 3VF9A 3Q5ZA 3LQ3A 4N4SA 4FL2A 4ANSA 4ZSEA 4TWPA 3R9HA 3F5UA 4XG8A 2V22A 4D2RA 3GU4A 1XBAA 4X3FA 3GB2A 1FVRA 3P7AA 4QMYA 1UU9A 4UWBA 2ETMA 3MWUA 2ITNA 5HU9A 5DHJA 3HV3A 1JAMA 3PVWA 5HEZA 3VVHA 2PZIA 4WBBB 4EBVA 5AR8A 2GFCA 5AUVA 1WMKA 4YTCA 3KRRA 5J7HA 2Y4PA 3DAJA 3DJ6A 4BDGA 3A62A 4R7HA 4QTCA 3H9OA 5EFQA 5JFSA 4WOVA 4BVUA 3VUMA 1H8FA 5HORA 3E3BX 4IX5A 5AADA 3D5WA 3I7CA 2J7TA 2WIPA 2Z8CA 2FSLX 4FG9A 4GK2A 3P86A 1RJBA 2PMLX 2PUUA 4LI5A 5EW3A 2QO2A 3NLBA 2QO9A 3KVXA 4U7ZA 2ZV9A 3TKUA 4BZNA 2FSMX 4XNEA 3ZEWA 4F6UA 2BZHB 3U6JA 3CY3A 3WF6A 5CALA 3VS4A 1ZOGA 3PWDA 4BBMA 4EOPA 3DBFA 1WBTA 5IUIA 1MP8A 3PJ2A 1ZZLA 5HBEA 3E3PA 4AGCA 4C3FA 3O5AA 3LFBA 3QQJA 2OI4X 3ZZWA 3AKKA 2C0TA 4DDGA 5IQDA 4NSTA 2HAKA 1PXJA 2ITPA 2YIYA 3VWAA 4DLJA 1Q3WA 3IDBA 5IMXA 4PDOA 3G5DA 3EYHA 4IDVA 5A6NA 1WBSA 3TCPA 2ITWA 3OHTA 2XM9A 2OU7A 2HY0A 3HA6A 3E8CA 5AV2A 4AFJA 5CEOA 1SVEA 3DV3A 4PQNA 4AGUA 4DG3E 5EI6A 4IBMA 3N4VA 5TE0A 3HDNA 4UBAA 2G1TA 5KMOA 5BMMA 5B2MA 5IQFA 5DMZA 3FXXA 5AA9A 2R4BA 3P1AA 1W7HA 4RVLA 5EOBA 1XHAA 1ZZ2A 4FT0A 2UV2A 3RM7A 3MFSA 3Q60A 4HCVA 3F82A 5HNBA 4BGQA 1NT2A 3OCSA 2IVUA 3ATSA 5F1ZA 5CQUA 3NYNA 3VUHA 3RZBA 4FTMA 2PWLA 5AV0A 3D2KA 4YGAA 4RC3A 2WFYA 3PJ1A 2C69A 4WRSA 3VS6A 5K5NA 1M52A 3NAXA 1B39A 2J4ZA 2VTQA 4UMQA 3W8QA 2UZLA 4AZSA 4O82A 1OUKA 1SMHA 4DHIB 2RFNA 1OKWA 3HRCA 3BKBA 3DXQA 4IB0A 4ZS0A 3UQGA 4AA5A 3LM5A 3UYSA 2Z60A 3VAPA 4XG2A 4IADA 3DKOA 5AP4A 2C5VA 1YOJA 5FXRA 3A7HA 3I5NA 3RALA 5CAPA 4RRVA 2GDOA 2EWAA 4YO6A 2O0UA 3F69A 3AC3A 3MVMA 4HZRA 1FOTA 1DAWA 4FKLA 1W2DA 4MQ2A 3UIUA 2I7QA 3Q2MA 4GT4A 3P0MA 4OBQA 4OAVB 2JC6A 3PJCA 4A4OA 4ACMA 4D55A 4FT3A 4HGSA 3V01A 3ZBFA 3ZOSA 4CT2A 5K9IA 2HZ4A 4KSQA 1XMMA 4O4BB 4YJPA 3LMHA 4MYGA 2WMXA 4ASEA 4AOIA 2R3FA 4FV5A 5ICPA 3LFFA 4YURA 4HGTA 4AXEA 3FZTA 3VUIA 1NVRA 4TZRA 4EK6A 2G2HA 5G1XA 2B0QA 3R04A 3R8VA 2OG8A 1KE7A 4DTBA 4QMLA 5M56A 3LJ1A 1UU3A 3BLQA 3OXIA 4MCVA 2F9GA 2UZDA 5IISA 3WZKA 3I5ZA 3G15A 4MD8E 4V05A 2HXLA 3NIZA 3VRYA 3DBCA 5C03A 3H4JA 2GNFA 4CCUA 3TMOA 2QG5A 3ZONA 1OPJA 3D5XA 1DM2A 1UVRA 3LFNA 4LL0A 2GNHA 4WSYA 2YACA 5DOSA 4W9WA 1LEZA 2A27A 3V6SA 4E8AA 4CKRA 2CN8A 4A4LA 3CC6A 4XV3A 4J71A 4OTWA 4S30A 3DTCA 5CAUA 2C6TA 4CEGA 5CT0A 4S31A 1IEPA 3COHA 4IX3A 3W2SA 5JGBA 3ENHA 4X3FB 5DGZA 3R83A 3QC4A 2GTMA 2F57A 4CV9A 2VWUA 3R8LA 4U5JA 4AFEA 4PPAA 5IH4A 3T8OA 3Q53A 1G3NA 3GENA 4IWDA 5ANJA 4M3QA 4CFWA 3KMUA 3O0GA 4FKJA 5TOZA 1OITA 4DGMA 3FZPA 3UNJA 1YDRE 4HOKA 4NTTA 4QMTA 3RNYA 3NEWA 4PMPA 2B7AA 5M09A 3UYTA 1CSNA 2YERA 1K2PA 3FZSA 4FVRA 4L67A 2WHBA 1PMNA 3RJCA 4C2WA 5FXQA 2JITA 1M7QA 3SW4A 2Y4IB 1J7UA 2PMNX 4CV8A 4GRBA 3RKBA 1RQQA 4E5WA 5IPJA 3EH9A 3V04A 2YABA 5IKWA 2VWZA 2YDIA 2ZOQA 2Y7JA 4BB4A 3O51A 4IAKA 4APPA 4PF4A 3TV4A 5ETCA 3U55A 4O96A 4P5QA 5LWMA 3FI3A 3E7OA 2UVXA 4JLCA 4ZSJA 1XQZA 2OW3A 4BTFA 5IQCA 5FEDA 1GIHA 2XK6A 3QQKA 3LE6A 4ZSLA 4DEDA 4NFMA 4F9AA 1IRKA 4P5ZA 3TDVA 4EC8A 1VJYA 4DINA 1PF8A 1U54B 2DS1A 4BKYA 5EKNA 5ANGA 3RHKA 2RG5A 1Q5KA 2VTPA 1J7IA 4E6DA 2EB2A 4EYJA 5L6WL 1XH9A 1M2PA 4EUUA 5HNGA 3QBNA 3JVRA 5HO6A 5LVMA 3RZFA 2UZTA 4LL5A 4FF8A 4FIEA 2WTVA 3FC1X 3W0RA 4BZOA 4XRJA 4PDSA 4R8QA 2R3HA 2B54A 5FP6A 2YCQA 4XG9A 4AW5A 2QOOA 3GCUA 3FZOA 3I6WA 3PA5A 2Y4IC 3EWHA 4MXAA 4NM0A 3ZC6A 3QKMA 3IOKA 5HCZA 3AG9A 3COKA 4X2NA 4RQVA 4CGAA 4MD9E 3GCQA 3KREA 4LGDA 4RX8A 4UMTA 2VZ6A 5CXHA 2PVMA 5AAFA 3UDSA 3KMMA 3R7YA 3MH1A 4GW8A 1OL2A 2WMBA 4XJ0A 4RA4A 5HHWA 1PXPA 3COIA 2YJRA 4G5PA 5HG8A 2YM6A 3VJNA 1UWJA 4MXOA 3RMFA 4A9TA 4O1PA 2VWVA 3FQEA 5I3OA 3TM0A 3NUYA 4IC7A 2WMWA 3QRTA 2GS7A 3SAYA 4C4HA 3O71A 4JBPA 3BBWA 3CQWA 4O2ZA 1OIUA 4O2PA 1OL1A 3M42A 4A07A 3Q2JA 2X6DA 2VN9A 4EUTA 3U4UA 4YZMA 2BDWA 2PVKA 5A4LA 4CZTA 4DF3A 5BVOA 3C4EA 4I6QA 4G6LA 4QP8A 2F4JA 4DGOA 5CSHA 4BI2A 2J0MB 3BEAA 4G6NA 4IW0A 4FV0A 4HYUA 4QP4A 3DDPA 1UV5A 3PXYA 1UWHA 1XWSA 5C8MA 4F65A 4AQKA 5DFPA 3S4QA 3DLSA 3F3UA 2HK5A 5HLWA 3QTWA 3TKIA 2XUUA 3UPZA 5A46A 1PYXA 3I81A 3O23A 4QMMA 4YBKA 1H0VA 2ZJWA 3TZMA 3WZDA 4AZFA 3EN5A 3UNKA 2ITQA 2OIBA 2XNOA 3CTHA 4Z16A 2PZRA 1H00A 2BTSA 3BE9A 1QPEA 4QQ5A 3V5QA 3TG1A 3T9IA 3IO7A 1V0BA 4JDHA 3MY0A 3RTPA 4HYIA 5CLPA 3PXKA 4AT3A 5F9EA 1PRYA 4IVBA 2IVVA 2PVFA 3LXNA 5M57A 2JDVA 2Y6OA 2QO7A 2YWVA 3Q9YA 1E1VA 1Q8WA 3RWQA 5FLFA 4ERKA 4J96A 3HAMA 3NFFB 3MA3A 2B9IA 3DOGA 2RFSA 3EQBA 3BU5A 3E62A 2NPQA 4YJSA 4O0VA 3F7ZA 3VNTA 5AX9A 4AXFA 4AT4A 4QMPA 1U59A 4FT7A 5HVKA 4LOOA 1SYKA 4I5MA 1Y57A 3R1QA 4LG4A 2VWBA 3FZ1A 4XG4A 3T3UA 4BTJA 1YXUA 3Q9WA 2X0GA 4G31A 4TNBA 5EM7A 2WELA 5B0XA 4HYSA 2VX0A 5HX8A 4FNYA 4MXZA 2NNWB 5DYJA 3UNZA 3BWFA 4O7SA 4HGLA 4HPTE 4U45A 4BIDA 5I3RA 2BRGA 3Q6UA 4FTCA 4RT7A 4F9YA 4FEVA 1BI7A 5HIEA 5L2WA 2RSVA 4M0YA 2AC3A 4IB1A 3W0SA 4L01A 4RLLA 3DY7A 4MQ1A 1PXIA 5E8XA 3PFYA 3LW0A 3BU3A 3UVQA 4BDAA 3GBZA 4G9CA 4N0SA 4BYIA 2DUVA 5IEXA 3AMBA 4AA0A 1LPUA 4AG8A 4RQKA 4LUEA 3WYYA 2XANA 1MQBA 4R3CA 5AV1A 4K77A 3TN8A 4ENXA 4O6LA 3W0PA 4USFA 2E9OA 4IM0A 4BDDA 3ZO3A 4B0GA 3ZXTA 4BICA 3HDMA 1TKIA 4FIFA 4B9DA 3GU7A 1FVVA 3GFEA 3FSKA 2OF2A 2UVZA 3U9CA 2WMRA 5DT0A 4CMUA 5KHXA 1VLRA 4O84A 2C0IA 2VWIA 2HCKA 3CKXA 3OCGA 3UPXA 4WBOA 4A9SA 4ZEGA 4ZY5A 3LVPA 4F4PA 3Q04A 3E88A 3P5KA 4KRDA 4JG8A 4O0YA 5JFWA 2YJSA 4AX8A 3RVGA 4ZJJA 1J3HA 4BR3A 3QCXA 3BE2A 4YC6A 5CY3A 5BMSA 4G3FA 5DPVA 2J6MA 3TNHA 3P5JC 5TKDA 4JRNA 3VRZA 4PRJA 1KE5A 4RC4A 4Y95A 4TKSA 2A2AA 2VWWA 1A9UA 4QYEA 4B6LA 2HZ0A 2VTMA 2KULA 3TJCA 2OF4A 3TACA 1M14A 3RWPA 3VS0A 2BZIB 1UNHA 3V6RA 4J53A 3PG1A 3N4TA 5DR6A 3WF7A 3AC8A 5BVKA 2WMAA 2G2IA 2WMQA 4EONA 1H1QA 2C5OA 1APME 2ESMA 2X81A 4AN9A 2NP8A 3PSCA 4C62A 5J7BA 4L52A 5B2KA 4ITHA 2IW6A 4KIKB 4HVIA 3KXZA 3IOPA 4RFZA 2V62A 3BWJA 5HD7A 4I6HA 3RPSA 4N6ZA 4TWCA 1WBVA 3NUUA 3LXPA 1QCFA 3OY3A 5G6VA 5C27A 3RAWA 4BI0A 5BNJA 3QQFA 2YZLA 4LV7A 4EHZA 3KMWA 3HKOA 4U9AA 4RSSA 1IASA 4CG8A 4D1SA 3QGYA 4QTBA 2WNTA 2O64A 3LJ0A 1L8TA 3JYAA 3FPQA 2B9FA 3MPMA 3OTUA 5KMMA 4L3PA 3WF5A 3DZQA 2JIVA 5JSMA 1ND4A 3LCKA 5H9BA 1ZAOA 4UXLA 1IG1A 2E9VA 4G34A 5T6KA 4BI1A 4I6LA 4OLIA 1UNLA 3GC7A 2GCDA 2EXMA 4TYEA 3BYSA 4E20A 2R5TA 3I7BA 4L00A 2X7GA 1L3RE 1XH8A 4D2SA 4AW0A 4X21A 4KINA 1E9HA 4EOLA 1J7LA 1XH4A 1H4LA 4BTKA 1UU8A 4EZ5A 2P33A 3R00A 5CENA 3ZBXA 2QODA 1UKHA 4ZAUA 3MGYA 4YZCA 5CVFA 5JGAA 2R3RA 5F4NA 1M2QA 2R7IA 4F08A 3R1NA 2YLFA 4D0WA 4KIQA 1H24A 5BVDA 2C1AA 4O21A 4FBXA 1YWVA 4HZSA 4X7QA 5CVGA 5L2QA 4QD6A 2Z2WA 5D12A 3D14A 3G6GA 5IUHA 1SNXA 3HEGA 4LFIA 5JMSA 3BLAA 3NDMA 3M2WA 2PHKA 4GK4A 3KXGA 3F7WA 2QHMA 3IW7A 5BVFA 4PL5A 4R3PA 3EYGA 3Q4CA 4EORA 1YWNA 3AT4A 4L44A 1FVTA 3PP0A 4TTHB 3FWQA 4RWIA 4TXCA 4ZTRA 3U9NA 4EH4A 4YNOA 4AWIA 2LGCA 3QQGA 3F61A 3AT3A 2B9JA 3UO5A 3ZO2A 4EKKA 4D9UA 4TWNA 4KIOA 2AQXA 4TN6A 5FP5A 5FRIA 1J1CA 5C8NA 2W05A 1VYWA 4DBNA 3GU8A 1LEWA 5FEEA 3ZM4A 4AAYA 1OIYA 1RDQE 2R3PA 2WMSA 1QPDA 3ZC5A 5IF1A 1KV1A 4KRCA 3PA4A 5KNJA 3KIOC 1AD5A 3BZ3A 2WQNA 4G3DA 3QF9A 4I23A 1ZYJA 3LFCA 4CFVA 3G9LX 3ORPA 3PE1A 5CU4A 2O2UA 5CWZA 5CX9A 2Z7QA 5HE0A 3VS2A 1GIJA 3NYXA 3BI6A 3H30A 4I24A 1GIIA 3QTXA 2C3LA 3BPRA 3O8TA 4UMRA 3LHJA 1ZMWA 2J51A 4YJNA 3ZU7A 3DK7A 4Y5QA 1GOLA 3POOA 4JJRA 3W55A 2PVNA 4JDJA 3ML1A 3QQLA 3E63A 3ALOA 1GZOA 4YNEA 3JR1A 5HQ0A 4GL9A 4H3BA 5KKRB 3T9TA 3F9NA 3AC4A 4QMXA 2YITA 3CY2A 3BYVA 3LXKA 3TNIA 1URWA 4IZ7A 5AP7A 4F7JA 4FUXA 3CEKA 5HIBA 5ETAA 1UKIA 2V7OA 4O0UA 3BLRA 1J91A 3NWWA 4XMOA 4EOKA 4MWIA 1O6YA 4DFZE 4LV8A 4Q9ZA 2XNGA 3QZGA 4MK0A 3UC4A 2UZOA 1OGYA 2B1PA 3S0OA 3KF7A 3G33A 3EFWA 2WGJA 2B53A 4X2JA 3EQGA 2V5QA 4MBJA 5EI8A 3VBYA 4ZSGA 4FTTA 4C61A 4CRSA 4PDYA 2QKRA 4Z7GA 5IEVA 4QP6A 2Q0BA 5L6OA 4BZDA 5J95A 3HA8A 2HENA 3O17A 5LCJA 4M15A 3EB0A 1V0OA 4IB3A 5LMAA 2VX1A 3P23A 4C59A 5CT7A 3SVVA 4H36A 5M51A 3G0FA 4OBPA 4JAJA 3ZRKA 4FG8A 4L6QA 3PXRA 3RAKA 2YIQA 3FLQA 1XR1A 4GVAA 1DAYA 2XF0A 4QT1A 3LFAA 4IDTA 4O4DA 4O0SA 4JI9A 3TT0A 3E93A 3EJ1A 5CEIA 4ZLZA 3QX2A 4KB8A 4RX9A 4FJVA 3COMA 3P78A 2QCSA 4IMYA 5AV3A 2IEWA 5FM2A 5FDXA 1SNUA 4FSQA 4FTOA 2BCJA 3GGFA 1WVWA 3ZEPA 1Q8TA 2W1HA 3NYOA 2CKOA 2PUIA 2RFDA 3AC2A 3QD2B 4D5HA 3G6HA 2QQ7A 3BYOA 4IJ9A 2PSQA 4LMNA 2BRHA 3OXTA 3ORMA 4FI1A 3ORXA 1B38A 5EYMA 1O6KA 5AUTA 4RA5A 5BVWA 1YHSA 3LCDA 2CKPA 2J2IB 4RC2A 5CF6A 3QTZA 1YQJA 4L42A 4DT8A 4FVPA 3GCVA 4GMYA 3ZTXA 4ZLOA 4YJTA 2XNBA 4NIFB 4FKRA 1G5SA 2QOHA 3FLNC 2XKCA 3TUCA 5HG5A 5BUIA 1URCA 4XYFA 3RK7A 5FBOA 4PX6A 3SG8A 4DITA 5DR2A 4MD7E 3POZA 2XZSA 3KL8A 3TTIA 4S2ZA 4C7TA 1WBOA 1M7NA 3QAME 4M0ZA 5FG8A 4F9WA 1GZKA 3E8DA 3E8EA