1W82A

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/inhibitor
total genus 110
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1w82A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1w82A01
2Q83A 4F0IA 3Q6WA 3QF9A 4QO9A 5AR7A 3TIYA 1QPCA 2W1ZA 4CNHA 4BDKA 3JPVA 3LXLA 2WTDA 4GG5A 3UP2A 4Z7HA 4IH8A 4L67A 3KRRA 4NW5A 2WHBA 4L7SA 3OCTA 2IJMA 3PA4A 3QKMA 4G6OA 4XMOA 4BCJA 3COIA 3H3CA 2I0HA 4KBAA 3LFSA 4JXFA 4M14A 4BY9E 3ZFMA 4YZCA 2PMLX 2BRMA 2YA9A 4O96A 5HCZA 4RA4A 2VWWA 5DWRA 3R7GA 3FI2A 4ZLYA 3HP2A 1I09A 3ALNA 3KULB 4O1PA 3ORIA 5JMSA 4FL2A 4CMTA 5FBNC 3MIAA 2IVUA 3OXIA 3AC4A 4YLLA 4KUJA 4O2ZA 2Y4PA 1TKIA 3QD2B 4AT4A 4W8EA 3RP9A 4BCMA 5CU0A 2QLUA 3NWWA 3MW1A 5AR5A 2OKRA 3LZBA 4Q9SA 3EQIA 3U4WA 4C2WA 2YACA 5LVMA 4GS6A 5KMLA 3AC1A 2XK6A 3L9NA 3NGAA 4I6BA 2XKCA 2HOGA 3NW6A 3FXWA 2CN5A 1QCFA 2UZTA 2JGZA 4D1ZA 3JS2A 4FYOA 4DG3E 3MV5A 3I81A 3CGFA 3VBTA 2QO9A 3AT2A 4NFMA 4FIJA 3ZLYA 5IUGA 3CKWA 3EYHA 5EK7A 3BGPA 2J0MB 3LCOA 1OL2A 3NNXA 4KD1A 2EUFB 4RIXA 3WF9A 1NW1A 3D5VA 3FLNC 3BRBA 5EKOA 2W5HA 3FSKA 3MFTA 4ZK5A 3CSVA 3AOXA 5FG8A 4EKLA 1PMVA 3C4FA 3FKNA 4DTAA 5TF9A 4CG9A 3R30A 2EXEA 3UVRA 2JC6A 3R7EA 5HX8A 2OJJA 5GJGA 3SC1A 4FEWA 4G5JA 5HTCA 2VX0A 4IZ5A 4CFUA 5IH6A 2UW5A 3FZPA 4YZ9A 4BIDA 3NDMA 4O84A 3W2SA 1GZOA 2QO7A 1KWPA 4WBBB 3DLSA 5L6WL 5L8LA 4APPA 2JAMA 3ORMA 2G1TA 5J87A 1UWHA 3KA0A 4AZEA 3U54A 3BLRA 2Z2WA 3IKAA 4Q5EA 3CC6A 5CAOA 4WIHA 2CMWA 3E3PA 4FTLA 5BYLA 3BBWA 3ORLA 4FEXA 1GIIA 3PXKA 4RZVA 4BTFA 3HDMA 5IA1A 2OJ9A 4GFGA 5KHWA 3ATTA 4JJRA 4EOLA 1LP4A 1UWJA 5B2KA 5CEOA 4G6LA 3EQDA 3MH2A 4C4HA 3UDBA 1T46A 1LPUA 1Q8UA 5CAPA 2VWUA 3NPCA 5F20A 2CNUA 4GEOA 3VBYA 3TDVA 4RX7A 3W2OA 2B9IA 4E73A 4TYJA 3SW4A 3VS4A 4L6QA 4HYUA 2WTVA 4EK3A 4JT3A 4PWNA 4DFUA 3TNHA 4FSMA 4LGGA 4XP2A 4YTHA 5AP6A 4BWXA 5E7RA 4C3RA 3LOKA 4JR7A 2IWIA 4MBLA 4L43A 5DR6A 2PVJA 4BBMA 5B7VA 4JR3A 3ZZEA 1CKIA 3VUIA 4RJ7A 4IB5A 5DEYA 3UPZA 3KULA 3RPYA 1KE9A 5CT7A 2CCHA 3KL8A 5KUPA 5IDPA 5JFVA 4RQVA 4QRCA 5A54A 4MQ2A 4EBWA 4D5KA 4O86A 3C51A 3P7AA 4YC3A 1R39A 5IQIA 3UNKA 1GZKA 1V0BA 4BKJA 2H9VA 4F4PA 2OICA 3EFWA 4B7TA 1OBGA 4DA5A 3KRXA 5D7VA 2XIKA 4C0TA 1NXKA 2C30A 2JDRA 3PJ8A 4E6CA 4F1MA 3HV5A 4CQGA 4NKAA 3W16A 1FMKA 4DT8A 3VS3A 3E3BX 4G9CA 1ZXEA 2VTMA 4O38A 3UOKA 2JBOA 4U79A 2YHVA 5HE1A 5CXHA 2GMXA 4FV4A 3MS9A 1YWRA 1UKIA 2C5VA 1XQZA 2WMRA 3FZTA 1HOWA 4ALWA 4QQJA 3T3UA 1BYGA 4YBKA 5BX0A 4F1TA 4D4SA 4KA3A 3F5GA 4IVAA 4K11A 3Q04A 1Z9XA 4M66A 4KS8A 4XOYA 4RX8A 3L8SA 4YURA 5I5ZA 4LFIA 2PVNA 4TYIA 5CWZA 4A9TA 2W06A 2YM8A 4BCKA 2IZSA 3UOHA 1CTPE 3P4KA 2YIXA 4B9DA 5LQFA 3QQJA 3GVUA 3OUNB 4RLLA 4IZYA 5IUIA 4YZBA 5EDRA 3HAVA 3ACKA 3PZEA 4II5A 2ITQA 3WBLA 2VTOA 5FBOA 4DH1A 3BQCA 3GCSA 4JBOA 1J1CA 2X81A 4RWIA 3QLGA 5K0XA 3AD6A 4S33A 3UZTA 2PZ5A 2BTRA 4I4EA 3V5WA 5HE3A 2VO3A 3BYVA 4BWPA 1J91A 5EQYA 2BKZA 4YJNA 1LEWA 1XH4A 4C57A 3L9LA 3UYSA 4YC8A 4ITIA 5ACBC 3S2PA 4AT5A 4EHZA 1H08A 5CLPA 4F9AA 1FBNA 2CKOA 3NVKI 3SG8A 4F70A 3R7YA 2BZJA 4U45A 4B99A 3DB8A 1PJKA 2JLDA 4AGWA 3FE3A 3EQPA 3TACA 4F9CA 4MXAA 5LWNA 4OR5A 1U5RA 3I1AA 1XWSA 3UBDA 3WE4A 3ITZA 5DGZA 4FT5A 3QTQA 1URCA 5AV2A 4OBPA 5FWKK 4GG7A 5I9ZA 2V0DA 4BL1A 3LW0A 1ZARA 3H0ZA 3C50A 4BCPA 3W2CA 4ZY4A 2VGOA 3EIDA 3UG1A 2XKDA 4GUBA 2B4SB 4YNEA 4YHTA 4ZS0A 2XK9A 3RPSA 3TG1A 4CTBA 4JDJA 5FXSA 5DT3A 4QYYA 2UZLA 5HNBA 4O2PA 3GU7A 2E9UA 1JOWB 1YI4A 1IA8A 1Y8GA 2OW3A 3C0GA 3DAJA 3FMJA 3O51A 3LLAA 5HIBA 3TUBA 4G3CA 3BYUA 3KMMA 4QYFA 5A14A 3TUCA 3GC0A 3BGZA 4ACHA 1TQIA 4BCNA 4F99A 5IF1A 1JVPP 2BR1A 4L00A 4HVIA 5KNJA 2GNIA 2R9SA 3R01A 1QPJA 3FY2A 2SRCA 2J0KA 3BHHA 3CP9A 3F88A 4CCBA 2VTLA 2HZ0A 4TY1A 3Q2JA 2EVAA 4CMOA 3RAKA 3V6SA 4KRDA 4FV0A 4YP8A 1UNHA 4F6UA 1KOAA 2UW9A 1R1WA 4Q9ZA 4C38A 2BZIB 3NCZA 3TNPC 2VNYA 5CSHA 2GQSA 5C9CA 1ZY5A 2P0CA 2I7QA 4PP7A 3GOPA 4JVGA 4M84A 4FSTA 4NK9A 5EI6A 4EH4A 4DTKA 4UALA 5FQDC 3PSCA 4EUUA 2J0IA 4O7NA 2I0EA 2BVAA 3DCVA 4F7JA 4DH3A 1SVHA 3PXYA 4AWIA 2PUNA 3VC4A 1URWA 1GY3A 2R3RA 3FMEA 1H25A 4LGHA 1Y6AA 4QMOA 5BYZA 4BVUA 3DNDA 5KMOA 1HCLA 4FTMA 3DXQA 3MESA 2OI4X 4FKIA 4O27B 3KXZA 3O8TA 3ODYX 3I5ZA 3Q6UA 4WG4A 3RHKA 3QUDA 2Y7JA 4IM0A 4H3PA 3UG2A 4BN1A 4I5PA 3QD4A 5LWMA 4IBMA 4UXQA 3O50A 4C62A 3IW7A 2HXQA 3LLTA 4D1SA 3JVRA 3PUPA 4BC6A 4EYMA 4QTEA 3FLQA 4BKYA 3AC2A 4MNFA 3PY3A 4EK6A 5C8KA 1YXUA 5CANA 4W4WA 3IW8A 5CZHA 3NMUF 3PE1A 4QMMA 2AC5A 3FC2A 4L42A 3FC1X 2FSTX 3BELA 3BKBA 3SKCA 2BDJA 4KBCA 3UYTA 5M4CA 4I5HA 3ERKA 3O17A 4WKQA 3WILA 4F9WA 4KIKB 3NYVA 2ITUA 2VTSA 1QL6A 4FTAA 1H24A 5JQ8A 5DN3A 2QR8A 4MF0A 3VIDA 4J71A 2QI8A 4IZAA 3PPJA 3ZOSA 3I0OA 2VO6A 2A1AB 2R7IA 4X3JA 5D10A 3ZSHA 2NPQA 3ZUUA 2CKEA 3O2MA 2R3HA 3DQWA 2GS2A 4FKGA 2BFXA 5I9YA 2VWBA 3WZJA 3FY0A 5CENA 3FUPA 4F7SA 4Q5HA 4GT3A 4NCTA 5I3OA 4IEBA 4BDJA 1R0EA 4MF1A 4TRLA 4AOIA 4HNIA 1NA7A 4S34A 5CF4A 3OOMA 5LOHA 2X2MA 4JS8A 5KZ0A 4ASEA 4D2PA 4FKJA 4U42A 2WD1A 4XX9A 4NWMA 4OAUC 1GIJA 3W8QA 3A7GA 2HWOA 3S95A 5G6VA 1WBPA 4ZJVA 3IGGA 4PPBA 5A4CA 2DWBA 5LCJA 2OXDA 2IO6A 3NSZA 2P55A 5JZJA 3L9PA 3FEGA 4NZWB 4JI9A 4NH1A 4IAZA 4YTIA 2ETRA 3HUCA 3DJ5A 3DJ6A 2C6EA 3NUPA 4IZ7A 3R1QA 2DYLA 2PL0A 4BTJA 2YCQA 3MH1A 4HZRA 4I3ZA 3PXZA 4KIQA 2XNMA 3FXXA 4IHPA 4QP2A 3BI6A 5AFVA 5HIEA 3GU5A 4EORA 1H27A 2ZMCA 4UWCA 5LVNA 3C0IA 3KXHA 4X3FC 1PF8A 2OG8A 4R8QA 2YABA 3I6UA 3WARA 1V0PA 4IIRA 3MH0A 3PLSA 4R5YA 5HG8A 3P5KA 3CR0A 3PP0A 1VEBA 2QONA 1H1PA 1BX6A 4R3CA 3G33A 4TN6A 1XJDA 2R3MA 3U4UA 5HLNA 4GH2A 3KXNA 4ZSEA 3PP1A 5I9VA 2VO0A 2VTJA 5BVKA 2WEVA 3ZONA 2XIYA 3DOGA 3QTSA 4DBNA 5JQ5A 4GYGA 4E5AX 3A8WA 2HZNA 4NW6A 3DJ7A 4IWDA 4UX9A 3PXRA 4G1WA 3DBEA 3FPMA 3BYSA 5FP6A 4D58A 3RMFA 3E7OA 1IA9A 3MSSA 4ZZNA 2WU7A 3OUKA 4FIIA 4I41A 4IM2A 5HCYA 2X2KA 4NKSA 5HIDA 3ZLWA 3IW5A 4FTKA 3MI9A 1YHSA 4W4XA 1Q8ZA 3E64A 5EM8A 4UYAA 3HGKA 3K54A 4JRVA 1OKYA 5KBQA 4Z55A 1YHVA 3LMHA 4LV8A 4GVJA 2YAAA 3OWJA 4KKGA 5J7HA 4DEBA 2CLQA 3E7VA 4FG7A 5J1VA 1O6YA 4YPSA 5ETIA 4N6YA 3PJ3A 4MXXA 2HAKA 2WMUA 3D94A 3WZUA 3R63A 3PVUA 4JBQA 4DGOA 4CLJA 3IPHA 1J7LA 2WMVA 3TZMA 3UGCA 4HPTE 2UZBA 5J9LA 3PE2A 3ZDIA 5CEQA 2C3KA 2WOTA 4H58A 2VWZA 4FNXA 4AFJA 5E9EA 4R7BA 4HJOA 5BVEA 1MQ4A 5H2UA 2C6TA 1KE5A 4H05A 2VX3A 4YJUA 4CRSA 4E5BA 5CZIA 5JT2A 4FK3A 5F9EA 4J99A 3SLSA 2FGIA 1VZOA 1M2QA 1F3MC 3KN5A 4N70A 1H26A 2HK5A 4OTRA 4KSPA 5BMSA 3MN3A 2YM4A 5DG5A 2XNEA 4E26A 2VN9A 2J5EA 3IOKA 3KXXA 3EL8A 5B2LA 4KWPA 3SOAA 3IONA 3Q2MA 2FO0A 4RGJA 4ZEGA 4G6NA 5T3QA 3Q52A 5IQBA 4FKVA 2QURA 3G0FA 5IDNA 2WTWA 2UW3A 1PXOA 4QTDA 3WZEA 2W96B 5AAGA 4W4VA 5E8SA 2BROA 2PUUA 3WYYA 5IMEA 3OTUA 4NL0A 2C6KA 4I0SA 5E1SA 2W4JA 2VV9A 3P78A 3H9FA 3EHAA 3F2AA 2GHGA 4LYNA 4R3PA 1F0QA 3MVJA 4FV6A 3G9LX 4M68A 2B55A 3OCGA 3B8RA 4U7ZA 4EOIA 5AP3A 3OTVA 5H3QA 4O7WA 1A06A 3A4PA 4FL3A 2C0OA 4QMZA 2XNNA 2WAJA 4QP8A 3R7VA 4KIPA 3GI3A 3CEKA 5BUEA 1IG1A 2BTSA 5EDQA 2RGPA 4K9YA 1H8FA 4K77A 5EOBA 4CXAA 3AT3A 3QRTA 3WIKA 5ETCA 3LM0A 4TWOA 3PPKA 5I9WA 4RBLA 3JYAA 4F6WA 3NNUA 4CFNA 1JAMA 5HG9A 1PYXA 4M7IA 3UP7A 2YIRA 3UZRA 2UZNA 4V04A 4GW8A 4UZDA 2BFYA 2HZIA 2ZV2A 5EW9A 3KMUA 3CTJA 2CGUA 3UE4A 3NYOA 5T68A 2Z8CA 3V5QA 4MEDA 5AUVA 4Y83A 4XG8A 4IAKA 2H96A 4AOTA 3I0QA 2X6DA 3LJ1A 4O6LA 5EFQA 4ZY5A 2F9GA 1WBOA 4LL0A 4WG5A 3PJ1A 4P4CA 1RDQE 4G17A 5CTPA 4HYHA 4DGLC 1GZ8A 5K3YA 1VYZA 4EYJA 3PY1A 5AV1A 3TEIA 5L2IA 3FLYA 2VZ6A 3FMKA 3QFVA 4ZTNA 2BDFA 4YO6A 3K2LA 3S1HA 4PY1A 3WI6A 5GZ9A 1PXJA 2PUIA 4I93A 3P86A 2NRYA 3ULIA 1OUYA 2UZWE 3FQEA 4CMUA 3BHVA 4D4RA 1M7QA 2PMNX 4IAYA 4UWYA 3REPA 4I5MA 3D15A 5DI1A 4ANOA 4ZAUA 5HCXA 4YO4A 3QQGA 2IN6A 3RPRA 4CCUA 4RPVA 4A4LA 3QA0A 3DV3A 2VGPA 3F9NA 5GHVA 4DH7A 5CAVA 2OXXA 4F08A 5DOSA 4AU8A 1XH6A 4FV2A 2IPXA 5AWMA 5IUHA 4D4YA 2OIBA 1NY3A 4A4XA 3U51A 3W2PA 3AGLA 2IG7A 3UODA 5E8VA 2XBAA 3EYGA 3OW4A 4EONA 5A4QA 2PMIA 2GNLA 2X8IA 3LCSA 4U3ZA 5KMIA 3DK7A 5DR2A 3P7BA 4AZWA 1FMOE 2OIQA 2RKUA 4MTAA 2GCDA 4ZTMA 4FI1A 4PP9A 4R3RA 4DEDA 1PMEA 3DS6A 3RJCA 5KKRB 2W99B 3ZO3A 3COMA 1Q8TA 3ORPA 4BI0A 1H1QA 5AUTA 3HUBA 3PLAE 4YNOA 4E93A 2I40A 2XM9A 4YJPA 5CI7A 3ZEPA 5CXZA 1JWHA 3D0EA 3G90X 3HMMA 3RCDA 4C33A 5E8WA 3F7ZA 4PV0A 2GPHA 2C0IA 4WSYA 4CGAA 2RIOA 4GJ2A 3ZYAA 4FZDB 4ENXA 4PL4A 2WIHA 3HMIA 4RG0A 4RJ3A 4USEA 3L1SA 2X8EA 4S30A 5HBHA 4XV9A 3P7CA 1CSNA 1K2PA 4U0IA 2ESMA 4ERKA 2X1NA 2YIQA 1REJA 5GJDA 3PRFA 3LFEA 3C4EA 2QR7A 1DS5A 4O21A 3R9HA 4TYHA 3KCKA 4GT5A 1PRYA 3PVWA 3R0TA 1OL7A 4ZZOA 3BV3A 2Z02A 3ZXZA 5CAQA 1OIYA 1XBBA 4XRJA 3MY1A 1JKKA 4H3BA 4BI2A 5I3RA 2X4ZA 3G51A 4FV3A 4EH9A 4L3PA 2ETKA 4BYIA 1O9UA 1IEPA 1SVGA 4BWKA 3HLLA 1OM1A 3OD6X 1AGWA 2UW8A 4BDHA 3IDCA 3AGMA 3G0EA 4FSRA 3CY2A 2JKOA 3VJOA 2Z60A 3V5PA 1GIHA 2WMQA 3EQGA 2QG5A 3RK5A 4APCA 2E9NA 2XP2A 4YSMA 3BCEA 4EOPA 4WT6A 4IB1A 4KBKA 1ZMWA 2GNHA 2JITA 4FTNA 4RRVA 2IW8A 1YI6A 4EI4A 3DAEA 5IEYA 3R8VA 4C35A 3PG1A 1PY5A 4FVRA 4IB3A 1XH9A 3SGCA 5IQDA 5CYIA 4I0TA 5DFPA 1BUHA 4DHFA 2O63A 2QOFA 5E8TA 3W2QA 4OTDA 4BDGA 2H34A 2GS7A 2YERA 3QCQA 3G2FA 3UIMA 3FKOA 4JIKA 2PUPA 3CD3A 2PZYA 3R1YA 4FGBA 5K0KA 3RI1A 3TKHA 4CRLA 3TKIA 5C1QB 5JFXA 5HOAA 4FBXA 4CYJA 5AV3A 2F57A 1FPUA 2QOBA 3LQ5A 4NM0A 5AADA 4FNZA 4AA5A 2WQNA 1GZNA 3MIYA 3NNVA 3OZ6A 4FTIA 2GU8A 1W84A 4CZTA 4WUNA 2EU9A 2XH5A 2Y4IC 2YJSA 3NIZA 1SYKA 3KY2A 4G2FA 3DQXA 2ZM3A 1Q8YA 4QMTA 5HVYA 3OT3A 2J0JA 5AM7A 2OK1A 3N4UA 2C1BA 3ZC6A 2X7GA 3F2RA 2R7BA 5H8GA 3FQSA 1YKRA 3QYZA 1UU7A 5AA9A 3FI8A 5AUXA 4D1XA 3GGFA 3R2YA 3PSDA 3PY0A 3RALA 4WOVA 1O6LA 1ZOGA 3QCXA 1STCE 4GCJA 4DC2A 3EJ1A 1JQHA 3KMWA 2HENA 4XNEA 2B52A 5DH3A 2UVZA 3F2NA 3R2BA 4EC8A 1SMHA 3BLQA 5CALA 2R3QA 4UMPA 2B9JA 4FIFA 5J8IA 3VS0A 3N51A 4PDOA 2WXVA 3OMVA 1ZOHA 4YZMA 1S9IA 1OKWA 1WVYA 4EH7A 2OF2A 4AG8A 4YU2A 4AFEA 3FAAA 3PVBA 2J0LA 4ITHA 2UVYA 2XNPA 3RK7A 2EB3A 4XLIA 2R3PA 3NUYA 3QQKA 4E6QA 2F7EE 2ZDTA 3QQUA 1DM2A 2HIWA 3NYXA 3RVGA 4Z7GA 2IZRA 3QUPA 4FYNA 2V62A 4MWIA 2WMBA 4U3YA 3UMXA 4D9TA 3HMNA 4E4LA 4GYIA 2QHMA 5L2SA 5AAFA 4ZY6A 3NX8A 3VRZA 3FI4A 4S32A 3CQUA 4Q2AA 2PTKA 2PVFA 2ZDUA 4YJTA 2XM8A 3ZBXA 4H36A 4FSYA 1XR1A 1U54B 3DAKA 1GNGA 4QMSA 1K9AA 3F5PA 4OTWA 3GT8A 2GTMA 4Z9LA 4X2KA 3SW7A 5IH4A 5JN2A 1APME 1ZOEA 4JQEA 5AIRA 5HICA 4EL9A 4PPCA 5DYJA 3C0HA 2WMAA 3DNEA 3QBNA 3QZFA 3TZ8A 4I1ZA 4NYEA 3A99A 5HHWA 3R1SA 4UZHA 4ENYA 4BZDA 4W9WA 3DKGA 4FZAB 1J7IA 2XIZA 4HVDA 1G3NA 2WQEA 3MVMA 1F5QA 4Y85A 4J98A 3GP0A 2ZM1A 1A48A 3QC9A 4YHFA 5LARA 4PX6A 3OEZA 4OLIA 3KU2A 5GIPE 2RFEA 3VUDA 3F6XA 5FUTA 3MY5A 1YRPA 1PXIA 1ZZ2A 2YAKA 2O3PA 3V8TA 4C4JA 4O22A 1I44A 3S00A 4JDHA 2C5YA 4FNWA 2W9FB 4FG9A 2CKQA 1CKJA 4LMUA 4YHJA 2CLXA 3E63A 4NU1A 4EK8A 1PXMA 3MJ2A 5E8YA 4HOKA 5HG7A 2WQOA 4EC9A 1XKKA 5AX3A 1KV2A 2R3OA 4GJ3A 4C4GA 1LEZA 1JKLA 4FV9A 5JGBA 2WGJA 3R02A 4L68A 2VTIA 4ACDA 3R9NA 2RF9A 3RPVA 1B39A 4IX5A 3GQIA 2WTKB 5FEEA 4EKKA 3G9NA 2CKPA 3EFJA 3QQLA 4OGRA 2AC3A 4U8ZA 4ZP5A 4F7LA 4MYGA 5KZIA 5HKMA 3UIXA 2ZYBA 2OH4A 1H28A 2C4GA 3QTXA 5JH6A 1XH5A 2GNGA 4TL0A 2Y0AA 3D5WA 1LR4A 3KVWA 4YBJA 5A3XA 1MRYA 3QL8A 4QNYA 3UVPA 4BBFA 4BDFA 5HLPA 4C58A 2R64A 4C37A 4YMJA 2WKMA 4JAJA 4AN2A 2PE1A 4FTCA 3ZRKA 3AC8A 4FTQA 2HWPA 3KN6A 2W1HA 3E5AA 3KCFA 4NTSA 3OG7A 5CU2A 5AUZA 4ACGA 5DVRA 3SV0A 3VO3A 3VUGA 4D2VA 2PULA 3FZOA 5IQHA 2WPAA 2XIRA 3ATSA 3SX9A 5CEMA 3EQCA 4F63A 2GTNA 3GCQA 4PPAA 4AP7A 4R7HA 4BCIA 2YZAA 2ZM4A 4IE9A 4YUQA 4YJOA 5A9UA 2ZV7A 5KMKA 3QTIA 4L01A 2A4LA 2B1PA 2Z7QA 4HGLA 3VHEA 1ZYLA 5AEPA 5EW8A 2OZAB 3LJ0A 2O8YA 2Q0BA 3NZ0A 4O0YA 3Q9XA 3RTPA 3VS2A 5HEZA 3UNJA 4A06A 4M69B 2CJMA 5J9YA 5B0XA 3HNGA 4FV7A 3DK6A 5LCKA 3DY7A 4XH6A 1GAGA 1YDSE 4YZDA 3BV2A 5AIKA 4RC3A 5M55A 4TWNA 3W32A 2ITZA 1OL1A 2R4BA 4JG8A 4XBRA 3HECA 3O7LD 4AX8A 2XNOA 5BVDA 4FKPA 2E9PA 5F95A 1WFCA 1L8TA 4CLIA 5JRQA 5CEIA 3FLWA 1H0WA 4ANLA 3HA6A 1Y6BA 4BTKA 4HGEA 4AUAA 4L9IA 3W8LA 5EG3A 3Q60A 5HZNA 3O96A 3VULA 3U6IA 4RJ5A 3QXOA 5J95A 4J8NA 4G31A 5ANIA 3GNIB 4D0WA 2OGVA 3FI3A 3GC8A 3KRJA 2XEYA 1WCCA 4QTAA 4N6ZA 1CMKE 3ELJA 1KSWA 4LRMA 5M53A 5CVFA 1PXLA 3UQFA 4DGGA 3CPBA 2QODA 3LHJA 4H39A 4DFZE 4F0GA 2CNQA 4GUEA 4EBVA 3Q9YA 4CYIA 4C8BA 4CT2A 1CDKA 3R6XA 4MXZA 2WIPA 4FZFB 4IC7A 5LVPA 5J1WA 3FLSA 4MBIA 4MXCA 4BIBA 4XUFA 3RAIA 3VQHA 5ICPA 3BIZA 5EM6A 3GCPA 3VW6A 2JKQA 2C6MA 3LVPA 4J7BA 3TZ9A 4KKEA 2CDZA 3V8SA 5LJJA 3IGOA 1JSTA 4PMPA 3O8PA 1U59A 4N57A 1M52A 2Y9QA 2ITXA 4ITJA 2YM3A 1OGUA 2P2HA 2EXCX 3AC5A 2XJ0A 4MQ1A 4QNAA 2C3JA 3S4QA 3T9TA 4EJ7A 2PYWA 2G01A 4DG0E 2W1IA 3CJGA 2WMXA 4GMYA 3FHRA 5J5TA 4OTGA 5GIOE 4X2FA 3LXNA 2QLQA 2QOIA 5FTQA 4KNBA 4GFOA 4FTOA 2QOLA 3PIXA 4DFBA 3R9RA 1WBWA 5FDXA 2IZUA 2CPKE 4C4EA 4D9UA 4QPAA 3DBDA 3RM7A 1YXVA 4YPDA 3TL8A 4K33A 3QALE 3I6WA 4FSQA 1WBTA 4FGRA 4CV9A 4IANA 3VNTA 4AACA 4DEIA 5IZFA 3MPAA 3T9IA 3I7CA 3SXFA 4LUDA 1P5EA 3TTIA 2OWBA 4R5SA 3R8PA 1UA2A 2BCJA 3M1SA 4J1RA 3PTGA 3D7ZA 3B2TA 3BEGA 4DTBA 4LRJA 4RZWA 5CU4A 5EM7A 3R7OA 3TWJA 5M4IA 4D2RA 5DA3A 4BYJA 3R7IA 3ORXA 4X3FB 4BCFA 1FOTA 2W0JA 4FKQA 2W9ZB 4UBAA 4ZSGA 4U81A 4AT3A 2W4KA 3DK3A 3KF7A 5HI2A 3SDJA 1W83A 1ZMVA 3C4ZA 2UW0A 2XMYA 4FVPA 4RT7A 3QX2A 4A9SA 2V7AA 3QKKA 3R8LA 4D28A 5JZNA 3ZRMA 4M3QA 2BKKA 2O5KA 5BQ0A 5JKGA 4WO5A 2EB2A 3A7IA 3V8WA 5EHLA 3S0OA 3SA0A 3MYGA 2C6DA 4M15A 4I6HA 3IW4A 4MNEB 4GK3A 4NCTC 2XCKA 4I22A 4QMVA 2BZHB 1ZYSA 2RG5A 3NAXA 4BFMA 4IADA 4FV5A 2WOUA 2YM5A 4RVTA 5HGIA 4PL5A 2ONLC 4L45A 4MD8E 4OTFA 5H8BA 4YJVA 3MPTA 3QTRA 5K4JA 4IQ6A 2ONLA 2HXLA 3RK9A 3EN6A 4TWCA 4TXCA 1FVTA 3BU6A 4G3EA 4DEAA 4ZTQA 1WMKA 4PF4A 4MK0A 4ANNA 4UYNA 5KCVA 2ZB0A 3M11A 1VJYA 3LQ8A 4GSBA 3GEQA 3RKBA 4EH3A 5L2TA 3DPKA 1RJBA 5C4LA 1H0VA 3FWQA 4QQCA 1NVRA 4RVMA 5EYKA 3VS1A 2ZJWA 2VO7A 3CJFA 3H30A 3UIUA 2WO6A 4UMQA 3ZEWA 4QMQA 5CAUA 4A4OA 1KUTA 3R8ZA 4USFA 3ID6C 3EMGA 3MA3A 3BPRA 4FTTA 4GV1A 4ZLOA 3TNWA 5HO7A 2QKRA 4DE4A 2VWXA 3BLHA 1YHWA 3QD3A 3MDYA 1OKZA 4IDVA 5HVKA 4A7CA 3LCDA 4ALUA 2DS1A 3F61A 3PPZA 4MBJA 5JFSA 3M42A 4O0UA 4HVSA 5BVFA 2QCSA 3FSFA 4LMNA 2PVMA 3R83A 3KC3A 3DGKA 4H1MA 4QMWA 5DMZA 2OF4A 5DT0A 3HRFA 4PTCA 4OTHA 4BDEA 4LOOA 2XUUA 3C4CA 4JNWA 3C4XA 2UW6A 5AP0A 1Q97A 2YDIA 4FC0A 4XV1A 2H8HA 3ORZA 2DQ7X 2XRUA 3LFDA 5AM6A 5AR2A 3H4JA 3SAYA 3W2RA 3WIGA 1ZYJA 2IZTA 3I79A 4DN5A 4K8AA 2HYYA 2P2IA 2X4FA 3CBLA 3D14A 3DFCB 3WF5A 4HW7A 3BYOA 5M09A 4M8TA 4EHGA 2F7ZE 1DI8A 4M97A 5BNJA 3U6JA 1IAHA 1P4FA 4PRJA 2REIA 3EZVA 4FEQA 1MP8A 4I20A 4OT6A 1KOBA 2XF0A 4O6EA 1ND4A 4EQMA 4X6RA 4J52A 2R2PA 2XB7A 2PU8A 3NUAA 4YJQA 5TE0A 4AZVA 3DTWA 5EYDA 3EKKA 3UOLA 4BDBA 4E5WA 4ZSAA 5L8KA 5DLSA 3NIEA 4ZJIA 1YI3A 3SVVA 2G9XA 3LFBA 4KIKA 3UPXA 4E4MA 3QZHA 4IC8A 3HYHA 4HYSA 5D11A 4EQUA 2W5BA 2E2BA 2BAJA 5DBXA 2B9HA 3F5UA 2YJRA 5IA2A 5CVHA 4O81A 4JIAA 4AW1A 2BALA 4EOQA 2P3GX 5TR6A 4OUCA 4OTIA 1GOLA 1ZRZA 1ZYCA 3MJ1A 2YWVA 4NJ3A 3RZBA 2JBPA 4ALVA 3AT4A 5BVOA 4QTBA 2OO8X 2GFSA 2W5AA 3H0YA 4NIFB 3C5IA 1OPKA 1UNGA 1OIRA 4Y95A 1ATPE 3HKOA 4CTCA 5HNIX 4O7YA 3QTZA 2WTCA 3QGWA 4S2ZA 4FT0A 3CIKA 3FJQE 4H1JA 3SHEA 3ZUVA 5IEXA 2PPQA 3IDBA 4TWPA 5LVOA 3FMMA 1WAKA 4ZTSA 2C47A 4L3JA 3VRYA 4TYEA 3KRLA 2F49A 2QHNA 5LMAA 4P90A 4ARKA 5AV0A 3ZXTA 2I6LA 1TQMA 3MTFA 4UEUA 3Q4UA 3GFWA 4CT1A 2F2CB 1W98A 3LE6A 5AUUA 3ROCA 2JFLA 3D7TB 2WQMA 1RE8A 3I7BA 5JSMA 4DFLA 3OW3A 2OZOA 3ZM4A 1FQ1B 3GUBA 3OCSA 3TDWA 5CSXA 3TT0A 3UO4A 4FG8A 5IMXA 4KB8A 2OIDA 4FKUA 4M13A 3Q3BA 4CG8A 4UB7A 2FB8A 4YLJA 4FOCA 3VN9A 4CVAA 4N0SA 3P23A 4U41A 4AW0A 3U9CA 3VF9A 5L2WA 5ANOA 5ITAA 4Y5QA 4HGSA 4EK5A 2IW6A 3UMWA 1FVVA 1PKDA 2IVVA 4XJ0A 3SXSA 2BPMA 3KXGA 3KXMA 4WG3A 3R9OA 4DF3A 3MFUA 3KF4A 2AYPA 4OBQA 4DEEA 1H1WA 3U87A 3D83A 5IPJA 2UZVA 4K0YA 4XRLA 3ZDUA 3BU3A 4E6DA 4TKSA 2C6OA 2XNBA 3VUTA 3ANQA 5HX6A 3R71A 4NM3A 5ANEA 3EB0A 5HESA 2QKWB 3EQBA 4LL5A 3E8DA 1WBNA 2BHHA 4K2RA 4E6AA 3RCJA 4NSTA 3THBA 3R22A 4C34A 3F66A 2UW7A 3F3TA 3AMAA 4L44A 3V51A 4QT1A 1TQPA 3GCUA 4EOKA 3EWHA 5HE0A 3OOGA 4C3FA 4WD5A 3BZ3A 3GENA 4ZJJA 3E93A 1E1XA 3SXRA 4O7TA 3QHWA 4NJDA 3OBGA 1ZZLA 3A60A 3Q9WA 3UO6A 4UV0A 4GU6A 1U5QA 2C5NA 3FKLA 2XK3A 3DT1A 1V1KA 4IWOA 3E8EA 2V22A 3GBZA 3K3JA 5EYMA 4E8AA 4FKWA 4IJPA 2JDVA 4NIFA 1Y8YA 3QZIA 4JX7A 4RX5A 1K3AA 2JEDA 5AX9A 3FL4A 3ROYA 4TT7A 2J6MA 3I4BA 4G9RA 3QCYA 4P2KA 3TJCA 3ZTXA 3BYMA 4PMSA 3QZGA 5D7AA 4FODA 4EQCA 2I1MA 3V01A 5DE2A 3E8NA 3PVGA 3RZFA 2VTQA 5CU6A 4AZSA 2JAVA 1PXNA 4O7SA 1FINA 1W7HA 5JGAA 5LMKA 1QMZA 3LJ2A 5AMNA 5AJQA 4O1OA 5ANKA 4JG7A 1UNLA 4YTFA 2NO3A 2RL5A 5TO8A 3JR1A 3BWJA 3PFQA 3D7TA 4J96A 2W1CA 3IK3A 2QNJA 3QA8A 2X0GA 5K9IA 3BQRA 4QP9A 3POOA 3U8WA 5EQPA 3KB7A 2CN8A 3IW6A 5FXQA 5K4IA 3HAMA 3BEAA 1XO2B 5L6PA 3KREA 1H07A 4F64A 1NVQA 4GRBA 3WE8A 3OP5A 5DR9A 4MD9E 1PMNA 1JLUE 2JIIA 3L9MA 2IVSA 4XHKB 2A19B 3CTQA 4G34A 4JDIA 4CV8A 5JFWA 2CHLA 5IA5A 2G15A 2QOKA 3BHUA 3NLBA 3MFRA 4IVDA 5IG1A 2WTIA 5EI2A 4M12A 1OIQA 1Q61A 2ZVAA 1H1RA 4FSZA 2DUVA 2Z7RA 4O0WA 4FSNA 5HO8A 3PA3A 4BDDA 3F3WA 5A46A 4AA0A 5KMMA 4ZTLA 4O83A 4ZIMA 3LFQA 4YTCA 1H4LA 3R04A 4IAFA 2I0YA 3IO7A 5ETFA 4P7EA 4AW2A 3NS9A 4BDAA 3AD4A 1Q4LA 2R3GA 3MB7A 3RNIA 4TW9A 4FNYA 1LUFA 3MTLA 1OITA 2QOCA 4FUXA 3AMYA 4X2JA 3FZSA 5E8ZA 3KQ7A 2WZJA 2YCRA 2R0IA 2Y4IB 1GJOA 3AG9A 5AUWA 4B0GA 3U55A 3MB6A 4DBXA 2BDWA 1H01A 3P0MA 3FMDA 5FEQA 3TXOA 4BZOA 4O7VA 1SVEA 4BDIA 1H00A 3GFEA 2XA4A 4FKLA 2YM7A 3M2WA 3RBWA 1W82A 1XBCA 3FQHA 3PSBA 1RW8A 2IVTA 3RAHA 4TYGA 4U80A 4BTMA 2PVRA 5AP1A 5IA0A 3P9JA 1R78A 2C3IB 3QTUA 1ZYDA 5ANGA 1J1BA 3KFAA 4GL9A 3PA5A 4QP1A 3HV3A 4RIXB 4EOSA 4CFXA 4FOBA 4LUEA 4WBOA 1AD5A 4FT3A 4NT4A 3OWKA 3ZSGA 4AN9A 5I0BA 2JKMA 4O82A 2B0QA 4MXYA 4XG7A 4ZLZA 4AE6A 2Q0NA 4ANMA 4A9YA 3OY1A 5A6OA 4EJNA 2V5QA 4YGAA 2GQGA 2XIXA 2ZV9A 4PUZA 3DTCA 3WYXA 4BGGA 3PWDA 5D1JA 3MY0A 2BIKB 2C1AA 3TNIA 3ZO4A 4Z3VA 5AR4A 3CD8A 5GZAA 4Y5HA 5L4QA 3FLZA 4KRCA 4NM7A 4XP3A 2VTNA 4QMPA 1KE6A 4EH2A 2YZLA 3LFFA 3OWLA 1PXPA 4XS2A 5FM3A 5E1EA 3KK9A 1KV1A 3QD0A 1X8BA 4QYEA 2ACXA 4X6QC 4CD0A 2UZEA 2CGVA 3JXWA 2HZ4A 5FM2A 1JKTA 5LXMA 3NCGA 2C69A 2YIWA 5EOLA 3K3IA 3OXTA 3VS5A 3ODZX 4IM3A 4FIEA 5KKRC 3VVHA 4O7RA 5L2QA 3UOJA 3S3IA 4B4LA 1WVXA 3HP5A 4AGDA 5HU9A 4CFVA 3MFSA 3Q4TA 2ITYA 1M14A 2WTJA 2WU6A 3DZQA 3QUEA 4K1BA 4RVKA 5FD2A 2BRBA 4TNDA 2G2IA 4KAOA 4F1OA 3QLFA 5HBJA 1UU3A 3EL7A 4XYFA 1BL7A 3BBTB 3PJCA 4UWBA 3FPQA 3VAPA 4BGQA 4EOJA 3UQCA 3AQVA 1MRUA 3RWPA 2LGCA 3G5DA 4RX9A 2JKKA 5TOZA 3HV7A 4I24A 2YWPA 4BI1A 3GU4A 3P79A 3WZKA 3LCTA 4U44A 3MPMA 3D2IA 1ZWSA 4IWPA 3EQHA 2W1DA 4FF8A 1CM8A 4E4NA 3HZTA 1G8AA 4WHZA 4FIGA 5BVNA 3GC9A 5CT0A 4IVCA 1DI9A 1DAWA 1E9HA 2BZKB 3QAME 4B8LA 4M0YA 2XVDA 3F3ZA 5F1ZA 3R1NA 4GK4A 1BKXA 5FLFA 3A62A 3QQHA 5ACKA 3R00A 4FE2A 3JVSA 4WRSA 5CF5A 2PK9A 4CKRA 3DKCA 2RFSA 1JNKA 3CTHA 4OTQA 5I4NA 2X9EA 5IQGA 4QPMA 4J95A 5C03A 4GIHA 1ZY4A 3CY3A 4XG9A 5EM5A 4E4XA 2BAQA 3OWPA 5CSVA 5IA4A 3QU0A 3C9WA 5FXRA 2RFDA 3C4WA 5ETAA 1YQJA 4HGTA 3GQLA 1P2AA 4C36A 5CF6A 5FP5A 2J5FA 5CS6A 2X7OA 2F4JA 4F6SA 3TM0A 4AOJA 2G2HA 5G1XA 3MVHA 3TTJA 2ITPA 4F09A 3EN9A 4BR3A 4TNBA 1CKPA 4U6RA 4IAIA 3OCBA 4LM5A 3V04A 3VBWA 5LMBA 4AS0A 3DFAA 2ITTA 3UQGA 4D55A 2ZV8A 2FSMX 3PXQA 2X7FA 2LAVA 4DCAA 1FGIA 3QX4A 1ZLTA 5BVWA 3ZMMA 1Q8WA 3DKOA 2ERKA 4FT9A 4JDKA 4RWKA 2J4ZA 2RFNA 4U40A 4CQEA 5A4TA 5BUJA 5EH0A 2VRXA 2Y6MA 3FZRA 4F9YA 2OFVA 4I0RA 4D5HA 4BCQA 1M2RA 3BE2A 3PIZA 1FVRA 1OMWA 4C2VA 4FT7A 5EW3A 3DB6A 2G2FA 2YFXA 4RWJA 3KK8A 4OW8A 3ZC5A 4FSWA 4JRNA 4R1VA 3ENMA 1S9JA 4PTGA 4AZTA 4V05A 2PVHA 4P5ZA 1W0XC 2R3KA 1JKSA 2O64A 4RC2A 4RJ4A 1V0OA 4C4FA 3VHKA 2XK7A 2UZDA 5T6KA 3G15A 2WNTA 5L6OA 2VTHA 3OF0A 4AZFA 4C4IA 4WSQA 4Y73A 5IU2A 3NYNA 3UTOA 5E4HA 4FSUA 2J7TA 5ANJA 5IQAA 5C01A 3UO5A 4ZOGA 1PYEA 5AR3A 3W33A 4XG2A 4ASZA 4ONAA 2X39A 2C6LA 3VJNA 2B7AA 2H6DA 3IQ7A 5AUYA 3WOWA 2B9FA 4XP0A 4BZNA 4CKJA 4UY9A 2R3IA 4R77A 1OIUA 2FVDA 2YDJA 4CEGA 2NRUA 4ANBA 5EQEA 5CEPA 2R0UA 2R5TA 5KHXA 3AD5A 3ETAA 2XK4A 2YCFA 2NNWB 5D9HA 2BRNA 2Z7SA 2FYSA 2PVYA 2I0VA 3O8UA 3ANRA 4IDTA 4L53A 5CU3A 1XH7A 2PE2A 2BIYA 5K5XA 1DAYA 3Q5ZA 2ITNA 2BMCA 2QOQA 3C7QA 1FGKA 4JLCA 3Q32A 4A9UA 3D5UA 3VF8A 4E7WA 1PW2A 3SQQA 4JQ7A 2J51A 1JSUA 4W8DA 1UKHA 3HL7A 5IEVA 3G6GA 4UMUA 3N4VA 4PNIA 1UV5A 3FMHA 2QO2A 5B2MA 4PTEA 2F7XE 1YOLA 5DRDA 4PDSA 1WBVA 2R3JA 3ENHA 3EOCA 4EEVA 4EZ7A 3H10A 5CVGA 5HQ0A 5GINE 4W9XA 4LGDA 4GIIA 1E1VA 3IOPA 3DLZA 1U54A 3BX5A 4XV2A 4HZSA 5M44A 3COHA 3VS6A 1YXTA 1Z57A 4O7LA 1PKGA 1EH4A 3DBFA 4XG6A 4HVGA 3CKXA 4LOQA 2BHEA 2P4IA 2QVSE 4BDCA 2GDOA 2HY0A 3CCNA 4RFMA 5GJFA 3IECA 4RJ6A 3VUHA 4DG2E 4PMTA 2C3LA 4FR4A 4QYGA 2EWAA 2OU7A 3ORTA 3TUDA 3LM5A 3OEFX 1T45A 2FSOX 1B38A 3HV6A 4QYHA 1Q24A 5FTGA 4HCUA 2YCSA 3A7HA 1B6CB 3NEWA 1XHAA 3DXNA 2W4OA 3KVXA 3ORKA 4IX3A 3F3VA 3SOCA 3QKLA 3V6RA 2C5OA 2FH9A 2X2LA 2OJGA 3KGAA 3HX4A 2VD5A 2ZMDA 3TV6A 3U6HA 5M08A 3CQWA 4AW5A 1UU9A 3RGFA 4BCOA 2OH0E 4NM5A 3H9RA 2GSFA 3HDNA 2AUHA 3C1XA 5C27A 3VBQA 3DA6A 1SZMA 3BU5A 4YC6A 3COKA 3ALOA 2PVLA 4G16A 5E92A 4DEGA 4IXPA 3FL5A 3LFAA 5CF8A 4QP4A 4C59A 5DEWA 2V7OA 4FZ7A 1YWNA 4IVBA 2VTAA 3HV4A 3QCSA 4FICA 2OFUA 2XJ1A 2PHKA 3ORNA 3FYKX 3R73A 5CI6A 3UC3A 2WTKC 3VS7A 4R1YA 4IW0A 5CQUA 3CGOA 2W1FA 3DBCA 3HMPA 3TZ7A 5F4NA 1Q41A 2ZB1A 4EH5A 4YSJA 2CGXA 3EN4A 3F3UA 1KE7A 5CSPA 1REKA 2FSLX 4R6VA 5DIAA 3R8UA 4EHVA 5BYYA 3R21A 3GXLA 3PG3A 4G3FA 4XLVA 4BB4A 4RMZA 1M2PA 5KBRA 4O91A 5EI8A 5I9UA 2GQRA 3D5XA 3VUMA 2UVXA 4BGHA 4F0FA 1OBDA 2P33A 4QOXA 2PZIA 4YJRA 5IH5A 2PVKA 3OXZA 5GNKA 5DHJA 4L8MA 2QOOA 4RC4A 3MVLA 1OL5A 3OHTA 3RWQA 5AAEA 5IA3A 5CY3A 2OXYA 3SRVB 4CSVA 1G5SA 5C8NA 2PY3A 3EN5A 4X7QA 3ZLXA 1O6KA 4O7ZA 3G6HA 2PZPA 3KEXA 5IQFA 2J2IB 4GVAA 4ASDA 5AP2A 4ANQA 4FMQA 5EHOA 4GKIA 4ZMFA 1PHKA 4ASXA 5GZ8A 3CXWA 5HU3A 3VUKA 4WNKA 4FKOA 2OZAA 4V0GB 4FEUA 5AP4A 4GT4A 4AXAA 4E20A 5IKWA 4U97A 4JX3A 2ETMA 1A9UA 3O71A 4M69A 4MCVA 2X8DA 3FYJX 3POZA 3U9NA 1YVJA 3ET7A 3HEGA 4ZTHA 4CFMA 3N4TA 3E62A 4IX6A 4C02A 2C0TA 4IACA 5KE0A 3N9XA 2WB8A 3PJ2A 4TPTA 1WBSA 4UMTA 3O7LB 5A4EA 4GFMA 4RJ8A 1PXKA 4I94A 4LQMA 2ITWA 2OJFE 3I60A 5AV4A 1JBPE 3Q53A 4N4SA 5IQCA 3FBVA 2UV2A 3QXPA 2QOHA 4UMRA 4X21A 3DZOA 4F9BA 4EZ3A 3ACJA 1RQQA 1XH8A 4OBOA 4QPSA 1P4OA 2C68A 4JAIA 3ZBFA 4BIEA 4EH6A 3IS5A 1OZ1A 3CQEA 3ZS5A 5C8MA 4HCVA 1OVEA 3AXWA 3MWUA 3LIJA 4FIHA 1Y91A 4AE9A 5C26A 1Z5MA 3OFMA 1Q62A 4O0RA 2VNWA 4X0MA 5DPVA 2B53A 2R3FA 1PMUA 4ZXTA 2YDKA 2RG6A 2XKEA 4I6FA 5K5NA 5KX8A 3D4QA 3F5XA 5C4KA 2CNVA 1NVSA 2YIYA 2WMTA 2OBJA 1OPLA 1J7UA 3AC3A 3WF6A 3HA8A 3GOKA 4Y72A 1M17A 5FDPA 2J9MA 1IASA 3FZ1A 2WFYA 4UXLA 3W18A 4IFCA 2JFMA 4O0XA 4FA2A 2PSQA 4RIOA 3P08A 1U46A 4H3QA 5H8EA 1IRKA 5J79A 3OS3A 4WNMA 3R7UA 4DLIA 4FUYA 3BGQA 4BHNA 4AGCA 1BI7A 3ULZA 3A7JA 3TJDA 4XBUA 5J7BA 4LOPA 5A6NA 4PL3A 2BRGA 3AMBA 3RINA 3SD0A 4ZMEA 3ZHPC 3NR9A 3HRBA 1SM2A 4PDPA 4GU9A 4NTTA 2YLFA 2BUJA 1J3HA 5CASA 1MUOA 4DINA 2VTRA 2YLEA 4FZ6A 3A4OX 3ZM9A 3CLYA 4PMMA 2W1GA 1BMKA 2O0UA 4FKTA 5CNOA 3SRVA 2YEXA 4ZZMA 3T3VA 4BICA 1QPDA 4DGNA 2KULA 2HCKA 4NEUA 5M4FA 4U5JA 4MXOA 1ERKA 4EH8A 4MX9A 4BCGA 3GU8A 2JDTA 1MQBA 5FRIA 2JIVA 5HO6A 3IDPA 2HY81 3HMOA 3QGYA 3ZUTA 3L8PA 4DFNA 1KE8A 3QC4A 2WEIA 2BAKA 5M56A 4FKRA 4V0GA 5HVJA 4WRGA 3L8XA 2YITA 3A2CA 5F94A 5E8XA 3I5NA 4I23A 1YXSA 4D2WA 4RFZA 4X3FA 2ERZE 4QMUA 2QQ7A 2XJ2A 4AGUA 4DH5A 4G3GA 5KO1A 1OB3A 1OI9A 5L8JA 4FV1A 3RNYA 4X2NA 2BRHA 4Y8DA 3L8VA 4TZRA 3QRJA 4ZSJA 2XRWA 1XBAA 3ZO2A 5CQWA 5J5SA 4M0ZA 2EXMA 3VBXA 2W05A 2XNGA 3E87A 4TTHB 3R9DA 1OPJA 5AP5A 1QPEA 3E92A 2ZOQA 3LFCA 4OAVB 3JY0A 3QWJA 4JBVA 4CKIA 2ITOA 3O23A 4L46A 4QTCA 3UIBA 2E9VA 1YWVA 3NNWA 4LRKA 4MNEA 4ZS4A 4EZ5A 2CGWA 4OT5A 4XG4A 3LCKA 4RIYB 4QMLA 1Q99A 5KMNA 3DXPA 1ZMUA 3VQUA 2VWYA 3A61A 2BILB 4KIOA 2XZSA 3D2KA 5EKNA 4JBPA 3QYWA 5JGDA 1Q5KA 5M4UA 4D0XA 5E8UA 3LKMA 3UNZA 3LMGA 4IMYA 3ZCLA 3PZHA 4DITA 4R78A 3ZFXA 5DT4A 3BHTA 3A7FA 4MKCA 5LVLA 3RHXA 4PNKA 3EH9A 3GU6A 3BHYA 5I9XA 2VTPA 1SNXA 4EUTA 4QMYA 1VR2A 5CNNA 2X9FA 3DBQA 1OECA 3FHIA 3EN7A 4ORKA 4EK4A 4KS7A 4CZYB 3C5UA 4BRXA 4AN3A 3NUNA 4QMNA 2FUMA 3PDTA 5D12A 4O0SA 3T8OA 5M57A 3Q9ZA 5AP7A 4RLKA 4MHAA 2JDOA 3LQ3A 1G8SA 3WF8A 2E9OA 2J50A 4CZUA 2X6EA 5M07A 3QQFA 3UJGA 3ZH8A 2QU5A 4S31A 1VYWA 3LXPA 4I21A 3TCPA 3DDPA 4QP7A 4J8MA 4EHEA 2QU6A 5FGKA 3IG7A 3ZFYA 3ZO1A 4AF3A 3RM6A 3TV4A 4RIWB 5H9BA 3DU8A 1H1SA 3E88A 5HORA 2VWIA 5HTBA 4KINA 4C61A 5M06A 2F2UA 4E3CA 2VAGA 3R8MA 2GS6A 4JQ8A 3UVQA 4Y46A 2R3NA 4YR8A 1U4DA 3FXZA 4ZSLA 2OJIA 2GFCA 2Y8OA 2PZRA 4U9AA 3P1AA 4MD7E 2B54A 2XS0A 4V01A 1R3CA 2A2AA 4RSSA 4AQCA 2HELA 1P14A 4FX3A 4W4YA 5KMJA 4FKSA 4R7IA 4AAAA 3LPBA 3TN8A 5BPYA 2PE0A 4UN0C 5EDPA 5DRBA 1IR3A 4DEHA 5JK3A 3LAUA 2W17A 2HW7A 4HYIA 4WA9A 4WUAA 4FVQA 4IFGA 4HVHA 3MA6A 3PWYA 4I5CA 2VUWA 4ID7A 2C5XA 3QWKA 3ZLSA 2XYUA 3WZDA 4D2SA 4WNOA 4BHZA 4DFXE 3B8QA 4FTUA 5AR8A 5ANDA 3W55A 2UW4A 3OY3A 4RFYA 5FTOA 2RSVA 3R28A 3EFLA 2VWVA 3NW5A 3Q4CA 3W10A 2FA2A 1BI8A 1Y57A 4ACCA 4OTPA 3OVVA 4EOMA 3D9VA 4RIYA 2GNFA 4QQ5A 4BCHA 4ACMA 4DYMA 4XG3A 2W1EA 2OSCA 3CPCA 4DCEA 2NP8A 4AA4A 3K5VA 1R0PA 3F69A 1ZAOA 1YDRE 3PYYA 4MH7A 2YN8A 4TYHB 5E90A 3JY9A 5CEKA 3EQFA 3VW8A 4FV8A 1SNUA 1BL6A 4IB0A 3ZZWA 5HNGA 1JPAA 2Z7LA 4A07A 3FV8A 4IJ9A 5LMKC 4HPUE 4DT9A 1OKVA 3UC4A 2UZOA 3HVCA 4F7NA 4KKHA 3A8XA 4FK6A 4NFNA 4Z16A 2XBJA 4JG6A 3E8CA 3CE3A 4QP6A 4FL1A 3KKVA 4LG4A 4FTJA 4YZNA 3Q96A 3OC1A 4M67A 4C3PA 4IX4A 4K18A 2V55A 1YDTE 3V3VA 2YISA 4O0VA 3LFNA 5JEBA 5M51A 5D41A 3K5UA 4NUSA 4O0TA 1TVOA 4RVLA 2A27A 1UU8A 3QTWA 2PMOX 4QQTA 1YXXA 4KSQA 3DDQA 3HRCA 4XV3A 2ITVA 4BF2A 1YOMA 3ZSIA 3EQRA 4G5PA 1YOJA 2OLCA 5BMMA 4RIWA 3NW7A 3QRUA 3DKFA 2JD5A 4L7FA 5J9ZA 4RWLA 4LI5A 3UZPA 2QD9A 4IAAA 4MWHA 2A0CX 3EKNA 3NUSA 4QD6A 5TT7A 2ZAZA 4YLKA 3H9OA 3V5LA 2XCHA 4XOZA 2VX1A 3F7WA 4L3LA 4XEYA 3NUUA 3GC7A 4K6ZA 3BE9A 4DLJA 4RQKA 5CX9A 4U43A 3MGYA 2IW9A 3PXFA 1JSVA 1MRVA 4MVFA 4GK2A 4WNPA 4D2TA 4IWQA 4F65A 1WVWA 3PIYA 4RA5A 1M7NA 2O65A 2CCIA 3B2WA 3EFKA 3BWFA 4DGMA 2CSNA 5A4LA 3TI1A 3QRKA 2XKFA 5E91A 4CFFA 3JUHA 4HNFA 1W8CA 2JDSA 4EWHA 3KRWA 3O0GA 4YJSA 4C7TA 2VU3A 1IAJA 4DFYA 1NT2A 3GB2A 4USDA 3CS9A 4A9RA 1WZYA 4ZTRA 3TIZA 1Q3WA 5HLWA 4KABA 4B8MA 2XEZA 1HCKA 1YW2A 4I4FA 4J97A 4ERWA 2QG7A 3NUXA 3OBJA 3NVMB 2W7XA 4JOAA 5TKDA 1Q3DA 3RAWA 5AA8A 3W1FA 1OUKA 2JIUA 2GNJA 3FDNA 3V5JA 3Q5IA 4I6QA 5IISA 2WQBA 5CSWA 2PWLA 2WMWA 5HTIA 3FMNA 2UUEA 4J53A 2WELA 2KTYA 3MBLA 4QP3A 3II5A 4BBEA 5DNRA 3TNQB 4MAOA 4G3DA 3LMIA 3MH3A 1BLXA 4JL9A 5L3AA 4QMXA 2C6IA 3PRIA 4E1ZA 3NRMA 3ZU7A 3NAYA 4I92A 4HCTA 5FEDA 4PDYA 2J90A 2O2UA 2YM6A 5HBEA 5IQEA 4DAWA 3VBVA 1L3RE 3VWAA 3WF7A 1AQ1A 3TV7A 4LV5A 4PQNA 4FEVA 3OT8A 4DH8A 3SG9A 3RPOA 2XK8A 3OROA 5HD4A 2HW6A 1OL6A 4EOOA 2XYNA 3QHRA 4D4VA 4P5QA 5EHYA 2UZUE 5HG5A 5HE2A 3V5TA 4ANSA 4B6LA 3Q4ZA 4XCUA 4X2GA 4CFWA 2GHMA 3FMLA 2R3LA 4L52A 2Y6OA 5BUIA 3TKUA 2QC6A 2WMSA 3LXKA 4BKZA 5JRSA 5EYCA 4EWQA 3F82A 2VTTA 3QRIA 3ZRLA 3EZRA 3GCVA 1UVRA 5HD7A 4GKHA 4FTRA 2GHLA 3C13A
chains in the Genus database with same CATH superfamily
2Q83A 4F0IA 3Q6WA 3QF9A 4QO9A 5AR7A 3TIYA 1QPCA 2W1ZA 4CNHA 4BDKA 3JPVA 3LXLA 2WTDA 4GG5A 3UP2A 3PUFC 4Z7HA 4IH8A 4L67A 3KRRA 4NW5A 2WHBA 4L7SA 3OCTA 2IJMA 3PA4A 3QKMA 4G6OA 4XMOA 4BCJA 3COIA 3H3CA 2I0HA 4KBAA 3LFSA 4JXFA 4M14A 4BY9E 3ZFMA 4YZCA 2PMLX 2BRMA 2YA9A 4O96A 5HCZA 4RA4A 2VWWA 5DWRA 3R7GA 3FI2A 4ZLYA 3HP2A 1I09A 3ALNA 3KULB 4O1PA 1OGYA 3ORIA 5JMSA 4FL2A 4CMTA 5FBNC 3MIAA 2IVUA 3OXIA 3AC4A 4YLLA 4KUJA 4O2ZA 2Y4PA 1TKIA 3QD2B 4AT4A 4W8EA 3RP9A 4BCMA 5CU0A 2QLUA 3NWWA 3MW1A 5AR5A 2OKRA 3LZBA 4Q9SA 3EQIA 3U4WA 4C2WA 2YACA 5LVMA 4GS6A 5KMLA 3AC1A 2XK6A 3L9NA 3NGAA 4I6BA 2XKCA 2HOGA 3NW6A 3FXWA 2CN5A 1QCFA 2UZTA 2JGZA 4D1ZA 3JS2A 4FYOA 4DG3E 3MV5A 3I81A 3VONA 3CGFA 3VBTA 2QO9A 3AT2A 4NFMA 4FIJA 3ZLYA 5IUGA 3CKWA 3EYHA 5EK7A 3BGPA 2J0MB 3LCOA 1OL2A 3NNXA 4KD1A 2EUFB 4RIXA 3WF9A 1NW1A 3D5VA 3FLNC 3BRBA 5EKOA 2W5HA 3FSKA 3MFTA 4ZK5A 3CSVA 3AOXA 5FG8A 4EKLA 1PMVA 1W2DA 3C4FA 3FKNA 5TF9A 4DTAA 4CG9A 3R30A 2EXEA 3UVRA 2JC6A 3R7EA 5HX8A 2OJJA 5GJGA 3SC1A 4FEWA 4G5JA 5HTCA 2VX0A 4IZ5A 4CFUA 5IH6A 2UW5A 3FZPA 4YZ9A 4BIDA 3NDMA 4O84A 3W2SA 4LDTA 1GZOA 2QO7A 1KWPA 4WBBB 3DLSA 5L6WL 5L8LA 4APPA 2JAMA 3ORMA 2G1TA 5J87A 1UWHA 3KA0A 4AZEA 3U54A 3BLRA 2Z2WA 3IKAA 4Q5EA 3CC6A 5CAOA 4WIHA 2CMWA 3E3PA 4FTLA 5BYLA 3BBWA 3ORLA 4FEXA 1GIIA 3PXKA 4RZVA 4BTFA 3HDMA 5IA1A 2OJ9A 4GFGA 5KHWA 3ATTA 4JJRA 4EOLA 1LP4A 1UWJA 5B2KA 5CEOA 4G6LA 3EQDA 3MH2A 4C4HA 3UDBA 1T46A 1LPUA 1Q8UA 5CAPA 2VWUA 3NPCA 5F20A 2CNUA 4GEOA 3VBYA 3TDVA 4RX7A 3W2OA 2B9IA 4E73A 4TYJA 3SW4A 3VS4A 4O4EA 4L6QA 4HYUA 2WTVA 4EK3A 4JT3A 4PWNA 4DFUA 3TNHA 4FSMA 4LGGA 4XP2A 4YTHA 5AP6A 4BWXA 5E7RA 4C3RA 3LOKA 4JR7A 2IWIA 4MBLA 4L43A 5DR6A 2PVJA 4BBMA 5B7VA 4JR3A 3ZZEA 1CKIA 3W0QA 3VUIA 4RJ7A 4IB5A 5DEYA 3UPZA 3KULA 3RPYA 1KE9A 5CT7A 2CCHA 3KL8A 5KUPA 5IDPA 5JFVA 4RQVA 4QRCA 5A54A 4MQ2A 4EBWA 4D5KA 4O86A 3C51A 3P7AA 4YC3A 1R39A 5IQIA 3UNKA 1GZKA 1V0BA 4BKJA 2H9VA 4F4PA 2OICA 3EFWA 4B7TA 1OBGA 4DA5A 3KRXA 5D7VA 2XIKA 4C0TA 1NXKA 2C30A 2JDRA 3PJ8A 4E6CA 3TYKA 4F1MA 3HV5A 4CQGA 4NKAA 3W16A 1FMKA 4DT8A 3VS3A 3E3BX 4G9CA 1ZXEA 2VTMA 4O38A 3UOKA 2JBOA 4U79A 2YHVA 5HE1A 5CXHA 2GMXA 4FV4A 3MS9A 1YWRA 1UKIA 2C5VA 1XQZA 2WMRA 3FZTA 1HOWA 4ALWA 4QQJA 3T3UA 1BYGA 4YBKA 5BX0A 4F1TA 4D4SA 4KA3A 3F5GA 4IVAA 4K11A 3Q04A 1Z9XA 4M66A 4KS8A 4XOYA 4RX8A 3L8SA 4YURA 5I5ZA 4LFIA 2PVNA 4TYIA 5CWZA 4A9TA 2W06A 2YM8A 4BCKA 2IZSA 3UOHA 1CTPE 3P4KA 2YIXA 4B9DA 5LQFA 3QQJA 3GVUA 3OUNB 4RLLA 4IZYA 5IUIA 4YZBA 5EDRA 3HAVA 3ACKA 3PZEA 4II5A 2ITQA 3WBLA 2VTOA 5FBOA 4DH1A 3BQCA 3GCSA 4JBOA 1J1CA 2X81A 4RWIA 3QLGA 5K0XA 3AD6A 4S33A 3UZTA 2PZ5A 2BTRA 4I4EA 3V5WA 5HE3A 2VO3A 3BYVA 4BWPA 1J91A 5EQYA 2BKZA 4YJNA 1LEWA 1XH4A 4C57A 3L9LA 3UYSA 4YC8A 4ITIA 5ACBC 3S2PA 4AT5A 4EHZA 1H08A 5CLPA 4F9AA 1FBNA 2CKOA 3NVKI 3SG8A 4F70A 3R7YA 2BZJA 4U45A 5BV3A 4B99A 3DB8A 1PJKA 2JLDA 4AGWA 3FE3A 3EQPA 3TACA 4F9CA 4MXAA 5LWNA 4OR5A 1U5RA 3I1AA 1XWSA 3UBDA 3WE4A 3ITZA 5DGZA 4FT5A 3QTQA 1URCA 5AV2A 4OBPA 5FWKK 4GG7A 5I9ZA 2V0DA 4BL1A 3LW0A 1ZARA 3H0ZA 3C50A 4BCPA 3W2CA 4ZY4A 2VGOA 3EIDA 3UG1A 2XKDA 4GUBA 2B4SB 4YNEA 4YHTA 4ZS0A 2XK9A 3RPSA 3TG1A 4CTBA 4JDJA 5FXSA 5DT3A 4QYYA 2UZLA 5HNBA 4O2PA 3GU7A 2E9UA 1JOWB 1YI4A 1IA8A 1Y8GA 2OW3A 3C0GA 3DAJA 3FMJA 3O51A 3LLAA 5HIBA 3TUBA 4G3CA 3BYUA 3KMMA 4QYFA 5A14A 3TUCA 3GC0A 3BGZA 4ACHA 1TQIA 4BCNA 4F99A 5IF1A 1JVPP 2BR1A 4L00A 4HVIA 5KNJA 2GNIA 2R9SA 3R01A 1QPJA 3FY2A 2SRCA 2J0KA 3BHHA 3CP9A 3F88A 4CCBA 2VTLA 2HZ0A 4TY1A 3Q2JA 2EVAA 4CMOA 3RAKA 3V6SA 4KRDA 4FV0A 4YP8A 1UNHA 4F6UA 1KOAA 2UW9A 1R1WA 4Q9ZA 4C38A 2BZIB 3W0RA 3NCZA 3TNPC 2VNYA 5CSHA 2GQSA 5C9CA 1ZY5A 2P0CA 2I7QA 4PP7A 3GOPA 4JVGA 4M84A 4FSTA 4NK9A 5EI6A 4EH4A 4DTKA 4UALA 5FQDC 3PSCA 4EUUA 2J0IA 4O7NA 2I0EA 2BVAA 3DCVA 4F7JA 4DH3A 1SVHA 3PXYA 4AWIA 2PUNA 3VC4A 1URWA 1GY3A 2R3RA 3FMEA 1H25A 4LGHA 1Y6AA 4QMOA 5BYZA 4BVUA 3DNDA 5KMOA 1HCLA 4FTMA 3DXQA 3MESA 2OI4X 4FKIA 4O27B 3KXZA 3O8TA 3ODYX 3I5ZA 3Q6UA 4WG4A 3RHKA 3QUDA 2Y7JA 4IM0A 4H3PA 3UG2A 4BN1A 4I5PA 3QD4A 5LWMA 4IBMA 4UXQA 3O50A 4C62A 3IW7A 2HXQA 3LLTA 4D1SA 3JVRA 3PUPA 4BC6A 4EYMA 4QTEA 3FLQA 4BKYA 3AC2A 4MNFA 3PY3A 4EK6A 5C8KA 1YXUA 5CANA 4W4WA 3IW8A 5CZHA 3NMUF 3PE1A 4QMMA 2AC5A 3FC2A 4L42A 3FC1X 2FSTX 3BELA 3BKBA 3SKCA 2BDJA 4KBCA 3UYTA 5M4CA 4I5HA 3ERKA 3O17A 4WKQA 3WILA 4F9WA 4KIKB 3NYVA 2ITUA 2VTSA 1QL6A 4FTAA 1H24A 5JQ8A 5DN3A 2QR8A 4MF0A 3VIDA 4J71A 2QI8A 4IZAA 3PPJA 3ZOSA 3I0OA 2VO6A 2A1AB 2R7IA 4X3JA 5D10A 3ZSHA 2NPQA 3ZUUA 2CKEA 3O2MA 3AKKA 2R3HA 3DQWA 2GS2A 4FKGA 2BFXA 5I9YA 2VWBA 3WZJA 3FY0A 5CENA 2X0QA 3FUPA 4Q5HA 4F7SA 4GT3A 4NCTA 5I3OA 4IEBA 4BDJA 1R0EA 4MF1A 4TRLA 4AOIA 4HNIA 1NA7A 4S34A 5CF4A 3OOMA 5LOHA 2X2MA 4JS8A 5KZ0A 4ASEA 4D2PA 4FKJA 4U42A 2WD1A 4XX9A 4NWMA 4OAUC 1GIJA 3W8QA 3A7GA 2HWOA 3S95A 5G6VA 1WBPA 4ZJVA 3IGGA 4PPBA 5A4CA 2DWBA 5LCJA 2OXDA 2IO6A 3NSZA 2P55A 5JZJA 3L9PA 3FEGA 4NZWB 4JI9A 4NH1A 4IAZA 4YTIA 2ETRA 3HUCA 3DJ5A 3DJ6A 2C6EA 3NUPA 4IZ7A 3R1QA 2DYLA 2PL0A 4BTJA 2YCQA 3MH1A 4HZRA 4I3ZA 3PXZA 4KIQA 2XNMA 3FXXA 4IHPA 4QP2A 3BI6A 5AFVA 5HIEA 3GU5A 4EORA 1H27A 2ZMCA 4UWCA 5LVNA 3C0IA 3KXHA 4X3FC 1PF8A 2OG8A 4R8QA 2YABA 3I6UA 3WARA 1VLRA 1V0PA 4IIRA 3MH0A 3PLSA 4R5YA 5HG8A 4BJJB 3P5KA 3CR0A 3PP0A 1VEBA 2QONA 1H1PA 1BX6A 4R3CA 3G33A 4TN6A 1XJDA 2R3MA 3U4UA 5HLNA 4GH2A 3KXNA 4ZSEA 3PP1A 5I9VA 2VO0A 2VTJA 5BVKA 2WEVA 3ZONA 2XIYA 3DOGA 3QTSA 4DBNA 5JQ5A 4GYGA 4E5AX 3A8WA 2HZNA 4NW6A 3DJ7A 4IWDA 4UX9A 3PXRA 4G1WA 3DBEA 2XANA 3FPMA 3BYSA 5FP6A 4D58A 3RMFA 3E7OA 1IA9A 3MSSA 4ZZNA 2WU7A 3OUKA 4FIIA 4I41A 4IM2A 5HCYA 2X2KA 4NKSA 5HIDA 3ZLWA 3IW5A 4FTKA 3MI9A 1YHSA 4W4XA 1Q8ZA 3E64A 5EM8A 4UYAA 3HGKA 3K54A 4JRVA 1OKYA 5KBQA 4Z55A 1YHVA 3LMHA 4LV8A 4GVJA 2YAAA 3OWJA 4KKGA 5J7HA 4DEBA 2CLQA 3E7VA 4FG7A 5J1VA 1O6YA 4YPSA 5ETIA 4N6YA 3PJ3A 4MXXA 2HAKA 2WMUA 3D94A 3WZUA 3R63A 3PVUA 4JBQA 4DGOA 4CLJA 3IPHA 1J7LA 2WMVA 3TZMA 3UGCA 4HPTE 2UZBA 5J9LA 3PE2A 3ZDIA 5CEQA 2C3KA 2WOTA 4H58A 2VWZA 4FNXA 4AFJA 5E9EA 4R7BA 4HJOA 5BVEA 1MQ4A 5H2UA 2C6TA 1KE5A 4H05A 2VX3A 4YJUA 4CRSA 4E5BA 5CZIA 5JT2A 4FK3A 5F9EA 4J99A 3SLSA 2FGIA 1VZOA 1M2QA 1F3MC 3KN5A 4N70A 1H26A 2HK5A 4OTRA 4KSPA 5BMSA 3MN3A 2YM4A 5DG5A 2XNEA 4E26A 2VN9A 2J5EA 3IOKA 3KXXA 3EL8A 5B2LA 4KWPA 3SOAA 3IONA 3Q2MA 2FO0A 4RGJA 4ZEGA 4G6NA 5T3QA 3Q52A 5IQBA 4FKVA 2QURA 3G0FA 5IDNA 2WTWA 2UW3A 1PXOA 4QTDA 3WZEA 2W96B 5AAGA 4W4VA 5E8SA 2BROA 2PUUA 3WYYA 5IMEA 3OTUA 4NL0A 2C6KA 4I0SA 5E1SA 2W4JA 3P5JC 4BJJA 2VV9A 3P78A 3H9FA 3EHAA 3F2AA 2GHGA 4LYNA 4R3PA 1F0QA 3MVJA 4FV6A 3G9LX 4M68A 2XAOA 4AXDA 2B55A 3OCGA 3B8RA 4U7ZA 4EOIA 5AP3A 3OTVA 5H3QA 4O7WA 1A06A 3A4PA 4FL3A 2C0OA 4QMZA 2XNNA 2WAJA 4QP8A 3R7VA 4KIPA 3GI3A 3CEKA 5BUEA 1IG1A 2BTSA 5EDQA 2RGPA 4K9YA 1H8FA 4K77A 5EOBA 4CXAA 3AT3A 3QRTA 3WIKA 5ETCA 3LM0A 4TWOA 3PPKA 5I9WA 4RBLA 3JYAA 4F6WA 3NNUA 4CFNA 3UDTA 1JAMA 5HG9A 1PYXA 4M7IA 3UP7A 4DHIB 2YIRA 3UZRA 2UZNA 4V04A 4GW8A 4UZDA 2BFYA 2HZIA 2ZV2A 5EW9A 3KMUA 3CTJA 2CGUA 3UE4A 3NYOA 5T68A 2Z8CA 3V5QA 4MEDA 5AUVA 4Y83A 4XG8A 4IAKA 2H96A 4AOTA 3I0QA 2X6DA 3LJ1A 4O6LA 5EFQA 4ZY5A 2F9GA 1WBOA 4LL0A 4WG5A 3PJ1A 4P4CA 1RDQE 4G17A 5CTPA 4HYHA 4DGLC 1GZ8A 5K3YA 1VYZA 4EYJA 3PY1A 5AV1A 3TEIA 5L2IA 3FLYA 2VZ6A 3FMKA 3QFVA 4ZTNA 2BDFA 4YO6A 3K2LA 3S1HA 4PY1A 3WI6A 5GZ9A 1PXJA 2PUIA 4I93A 3P86A 2NRYA 3ULIA 1OUYA 2UZWE 3FQEA 4CMUA 3BHVA 4D4RA 1M7QA 2PMNX 4IAYA 4UWYA 3REPA 4I5MA 3D15A 5DI1A 4ANOA 4ZAUA 5HCXA 4YO4A 3QQGA 2IN6A 3RPRA 4CCUA 4RPVA 4A4LA 3QA0A 3DV3A 2VGPA 3F9NA 5GHVA 4DH7A 5CAVA 2OXXA 4F08A 5DOSA 1TFFA 4AU8A 1XH6A 4FV2A 2IPXA 5AWMA 5IUHA 4D4YA 2OIBA 1NY3A 4A4XA 3U51A 3W2PA 3AGLA 2IG7A 3UODA 5E8VA 2XBAA 3EYGA 3OW4A 4EONA 5A4QA 1TZDA 2PMIA 2GNLA 2X8IA 3LCSA 4U3ZA 5KMIA 3DK7A 5DR2A 3P7BA 4AZWA 1FMOE 2OIQA 2RKUA 4MTAA 2GCDA 4ZTMA 4FI1A 4PP9A 4R3RA 4DEDA 1PMEA 3DS6A 3RJCA 5KKRB 2W99B 3ZO3A 3COMA 1Q8TA 3ORPA 4BI0A 1H1QA 5AUTA 3HUBA 3PLAE 4YNOA 4E93A 2I40A 2XM9A 4YJPA 5CI7A 3ZEPA 5CXZA 1JWHA 3D0EA 3G90X 3HMMA 3RCDA 4C33A 5E8WA 3F7ZA 4PV0A 2GPHA 2C0IA 4WSYA 4CGAA 2RIOA 4GJ2A 3ZYAA 4FZDB 4ENXA 4PL4A 2WIHA 3HMIA 4RG0A 4RJ3A 4USEA 3L1SA 2X8EA 4S30A 5HBHA 4XV9A 3P7CA 1CSNA 1K2PA 4U0IA 2ESMA 4ERKA 2X1NA 2YIQA 1REJA 5GJDA 3PRFA 3LFEA 3C4EA 4QDEA 2QR7A 1DS5A 4O21A 3R9HA 4TYHA 3KCKA 4GT5A 1PRYA 3PVWA 3R0TA 1OL7A 4O4BB 3BV3A 4ZZOA 3ZXZA 2Z02A 5CAQA 1OIYA 1XBBA 4XRJA 3MY1A 1JKKA 4H3BA 4BI2A 5I3RA 2X4ZA 3G51A 4FV3A 4EH9A 4L3PA 2ETKA 4BYIA 1O9UA 1IEPA 1SVGA 4BWKA 3HLLA 1OM1A 3OD6X 1AGWA 2UW8A 4BDHA 4I6LA 3IDCA 3AGMA 3G0EA 4FSRA 3CY2A 2JKOA 3VJOA 2Z60A 3V5PA 1GIHA 2WMQA 3EQGA 2QG5A 3RK5A 4APCA 2E9NA 2XP2A 4YSMA 3BCEA 4EOPA 4WT6A 4IB1A 4KBKA 1ZMWA 2GNHA 2JITA 4FTNA 4RRVA 2IW8A 1YI6A 4EI4A 3DAEA 5IEYA 3R8VA 4C35A 3PG1A 1PY5A 4FVRA 4IB3A 1XH9A 3SGCA 5IQDA 5CYIA 4I0TA 5DFPA 1BUHA 4DHFA 2O63A 2QOFA 5E8TA 3W2QA 4OTDA 4BDGA 2H34A 2GS7A 2YERA 3QCQA 3G2FA 3UIMA 3FKOA 4JIKA 2PUPA 3CD3A 2PZYA 3R1YA 4FGBA 5K0KA 3RI1A 3TKHA 4CRLA 3TKIA 5C1QB 5JFXA 5HOAA 4FBXA 4CYJA 5AV3A 2F57A 1FPUA 2QOBA 3LQ5A 4NM0A 5AADA 4FNZA 4AA5A 2WQNA 1GZNA 3MIYA 3NNVA 3OZ6A 4FTIA 2GU8A 1W84A 4CZTA 4WUNA 2EU9A 2XH5A 2Y4IC 2YJSA 3NIZA 1SYKA 3KY2A 4G2FA 3DQXA 2ZM3A 1Q8YA 4QMTA 3ML1A 5HVYA 3OT3A 2J0JA 5AM7A 2OK1A 3N4UA 2C1BA 3ZC6A 2X7GA 3F2RA 2R7BA 5H8GA 3FQSA 1YKRA 3QYZA 1UU7A 5AA9A 3FI8A 5AUXA 4D1XA 3GGFA 3R2YA 3PSDA 3PY0A 3RALA 4WOVA 1O6LA 1ZOGA 3QCXA 1STCE 4GCJA 4DC2A 3EJ1A 1JQHA 3KMWA 2HENA 4XNEA 2B52A 5DH3A 2UVZA 3F2NA 3R2BA 4EC8A 1SMHA 3BLQA 5CALA 2R3QA 4UMPA 2B9JA 4FIFA 5J8IA 3VS0A 3N51A 4PDOA 2WXVA 3OMVA 1ZOHA 4YZMA 1S9IA 1OKWA 1WVYA 4EH7A 2OF2A 4AG8A 4YU2A 4AFEA 3FAAA 3PVBA 2J0LA 4ITHA 2UVYA 2XNPA 3RK7A 2EB3A 2NYAA 4XLIA 2R3PA 3NUYA 3QQKA 4E6QA 2F7EE 2ZDTA 3QQUA 1DM2A 2HIWA 3NYXA 3RVGA 4Z7GA 2IZRA 3QUPA 4FYNA 2V62A 4MWIA 3O5AA 2WMBA 4U3YA 3UMXA 4D9TA 3HMNA 4E4LA 4GYIA 2QHMA 5L2SA 5AAFA 4ZY6A 3NX8A 3VRZA 3FI4A 4S32A 3CQUA 4Q2AA 2PTKA 2PVFA 2ZDUA 4YJTA 2XM8A 3ZBXA 4H36A 4FSYA 1XR1A 1U54B 3DAKA 1GNGA 4QMSA 1K9AA 3F5PA 4OTWA 3GT8A 2GTMA 4Z9LA 4X2KA 3SW7A 5IH4A 5JN2A 1APME 1ZOEA 4JQEA 5AIRA 5HICA 4EL9A 4PPCA 5DYJA 3C0HA 4DDGA 2WMAA 3DNEA 3QBNA 3QZFA 3TZ8A 4I1ZA 4NYEA 3A99A 5HHWA 3R1SA 4UZHA 4ENYA 4BZDA 4W9WA 3DKGA 4FZAB 1J7IA 2XIZA 4HVDA 1G3NA 2WQEA 3MVMA 1F5QA 4Y85A 3AKLA 4J98A 3GP0A 2ZM1A 1A48A 3QC9A 4YHFA 5LARA 4PX6A 3OEZA 4OLIA 3KU2A 5GIPE 2RFEA 3VUDA 3F6XA 5FUTA 3NFFB 3MY5A 1YRPA 1PXIA 1ZZ2A 2YAKA 2O3PA 3V8TA 4C4JA 4O22A 1I44A 3S00A 4JDHA 2C5YA 4FNWA 2W9FB 4FG9A 2CKQA 1CKJA 4LMUA 4YHJA 2CLXA 3E63A 4NU1A 4EK8A 1PXMA 3MJ2A 5E8YA 4HOKA 5HG7A 2WQOA 4EC9A 1XKKA 5AX3A 1KV2A 2R3OA 4GJ3A 4C4GA 1LEZA 1JKLA 4FV9A 5JGBA 2WGJA 3R02A 4L68A 2VTIA 4ACDA 3R9NA 2RF9A 3RPVA 1B39A 4IX5A 3GQIA 2WTKB 5FEEA 4EKKA 3G9NA 2CKPA 3EFJA 3QQLA 4OGRA 2AC3A 4U8ZA 4ZP5A 4F7LA 4MYGA 5KZIA 5HKMA 3UIXA 2ZYBA 2OH4A 1H28A 2C4GA 3QTXA 5JH6A 1XH5A 2GNGA 4TL0A 2Y0AA 4AXFA 3D5WA 1LR4A 3KVWA 4YBJA 5A3XA 1MRYA 3QL8A 4QNYA 3UVPA 4BBFA 4BDFA 5HLPA 4C58A 2R64A 4C37A 4YMJA 2WKMA 4JAJA 4AN2A 2PE1A 4FTCA 3ZRKA 3AC8A 4FTQA 2HWPA 3KN6A 2W1HA 3E5AA 3KCFA 4NTSA 3OG7A 5CU2A 5AUZA 4ACGA 5DVRA 3SV0A 3VO3A 3VUGA 4D2VA 2PULA 3FZOA 5IQHA 2WPAA 2XIRA 3ATSA 3SX9A 5CEMA 3EQCA 4F63A 2GTNA 3GCQA 4PPAA 4AP7A 4R7HA 4BCIA 2YZAA 2ZM4A 4IE9A 4YUQA 4YJOA 5A9UA 2ZV7A 5KMKA 3QTIA 4L01A 2A4LA 2B1PA 2Z7QA 4HGLA 3VHEA 1ZYLA 5AEPA 5EW8A 2OZAB 3LJ0A 2O8YA 2Q0BA 3NZ0A 4O0YA 3Q9XA 3RTPA 3VS2A 5HEZA 3UNJA 4A06A 4M69B 2CJMA 5J9YA 5B0XA 3HNGA 4FV7A 3DK6A 5LCKA 3DY7A 4XH6A 1GAGA 1YDSE 4YZDA 3BV2A 5AIKA 4RC3A 5M55A 4TWNA 3W32A 1XMLA 2ITZA 1OL1A 2R4BA 4JG8A 4XBRA 3HECA 3O7LD 4AX8A 2XNOA 5BVDA 4FKPA 2E9PA 5F95A 1WFCA 1L8TA 4CLIA 5JRQA 5CEIA 3FLWA 1H0WA 4ANLA 3HA6A 1Y6BA 4BTKA 4HGEA 4AUAA 4L9IA 3W8LA 5EG3A 3Q60A 5HZNA 3O96A 3VULA 3U6IA 4RJ5A 3QXOA 5J95A 4J8NA 4G31A 5ANIA 3GNIB 4D0WA 2OGVA 3FI3A 3GC8A 3KRJA 2XEYA 1WCCA 4QTAA 4N6ZA 1CMKE 3ELJA 1KSWA 4LRMA 5M53A 5CVFA 1PXLA 3UQFA 4DGGA 3CPBA 2QODA 3LHJA 4H39A 4DFZE 4F0GA 2CNQA 4GUEA 4EBVA 3Q9YA 4AXCA 4CYIA 4C8BA 4CT2A 1CDKA 3R6XA 4MXZA 2WIPA 4FZFB 4IC7A 5LVPA 5J1WA 3FLSA 4MBIA 4MXCA 4BIBA 4XUFA 3RAIA 3VQHA 5ICPA 3BIZA 5EM6A 3GCPA 3VW6A 2JKQA 2C6MA 3LVPA 4J7BA 3TZ9A 4KKEA 2CDZA 3V8SA 4FA2A 3IGOA 5LJJA 1JSTA 4PMPA 3O8PA 1U59A 4N57A 1M52A 2Y9QA 2ITXA 4ITJA 2YM3A 1OGUA 2P2HA 3AC5A 2EXCX 2XJ0A 4MQ1A 4QNAA 2C3JA 3S4QA 3T9TA 4EJ7A 2PYWA 2G01A 4DG0E 2W1IA 3CJGA 2WMXA 4GMYA 3FHRA 5J5TA 4OTGA 5GIOE 4X2FA 3LXNA 2QLQA 2QOIA 5FTQA 4KNBA 4GFOA 4FTOA 2QOLA 3PIXA 4DFBA 3R9RA 1WBWA 5FDXA 2IZUA 2CPKE 4C4EA 4D9UA 4QPAA 3DBDA 3RM7A 1YXVA 4YPDA 3TL8A 4K33A 3QALE 3I6WA 4FSQA 1WBTA 4FGRA 4CV9A 4IANA 3VNTA 4AACA 4DEIA 5IZFA 3MPAA 3T9IA 3I7CA 3SXFA 4LUDA 1P5EA 3TTIA 2OWBA 4R5SA 3R8PA 1UA2A 2BCJA 3M1SA 4J1RA 3PTGA 3D7ZA 3B2TA 4FRFA 3BEGA 4DTBA 4LRJA 4RZWA 5CU4A 5EM7A 3R7OA 3TWJA 5M4IA 4D2RA 5DA3A 4BYJA 3R7IA 3ORXA 4X3FB 4BCFA 1FOTA 2W0JA 4FKQA 2W9ZB 4UBAA 4ZSGA 4U81A 4AT3A 2W4KA 3DK3A 3KF7A 2A98A 5HI2A 3SDJA 1W83A 1ZMVA 3C4ZA 2UW0A 2XMYA 4FVPA 4RT7A 3QX2A 4A9SA 2V7AA 3QKKA 3R8LA 4D28A 5JZNA 3ZRMA 4M3QA 2BKKA 2O5KA 5BQ0A 5JKGA 4WO5A 2EB2A 3A7IA 3V8WA 5EHLA 3S0OA 3SA0A 3MYGA 2C6DA 4M15A 4I6HA 3IW4A 4MNEB 4GK3A 4NCTC 2XCKA 4I22A 4QMVA 2BZHB 1ZYSA 2RG5A 3NAXA 4BFMA 4IADA 4FV5A 2WOUA 2YM5A 4RVTA 5HGIA 4PL5A 2ONLC 4L45A 4MD8E 4OTFA 5H8BA 4YJVA 3MPTA 3QTRA 5K4JA 4IQ6A 2ONLA 2HXLA 3RK9A 3EN6A 4TWCA 4TXCA 1FVTA 3BU6A 4G3EA 4DEAA 4ZTQA 1WMKA 4PF4A 4MK0A 4ANNA 4UYNA 5KCVA 1ST0A 2ZB0A 3M11A 1VJYA 3LQ8A 4GSBA 3GEQA 3RKBA 4EH3A 5L2TA 3DPKA 1RJBA 5C4LA 1H0VA 3FWQA 4QQCA 1NVRA 4RVMA 5EYKA 3VS1A 2ZJWA 2VO7A 3CJFA 3H30A 3UIUA 2WO6A 4UMQA 3ZEWA 4QMQA 5CAUA 4A4OA 1KUTA 3R8ZA 4USFA 2ZFYA 3ID6C 3EMGA 3MA3A 3BPRA 4FTTA 4GV1A 4ZLOA 3TNWA