1W82A

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/inhibitor
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 110
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1w82A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1w82A01
1YI4A 3ZONA 4FF8A 5AIKA 3LMHA 1YWRA 2CPKE 4IEBA 1SNUA 4BDKA 2OJFE 1YXTA 1KV2A 4RJ7A 3RM7A 2QONA 1M7NA 1YXVA 2W5BA 3F3WA 3QQFA 1W83A 3FLSA 1IAJA 2CGWA 4FIHA 2XK9A 3N9XA 1G5SA 4TNDA 3SKCA 3TNPC 2F7ZE 3DPKA 3TTJA 1PMNA 2YDIA 3CKXA 3TM0A 3K54A 2C69A 4DLJA 5IKWA 3SG8A 4AZVA 5ETIA 4GEOA 3IPHA 4LV5A 4XUFA 4ASDA 4GJ3A 4FV5A 4AZTA 5JQ8A 1OM1A 3P1AA 3ZCLA 3RJCA 2BZKB 2GS2A 4X2NA 4DAWA 4DH7A 1QL6A 3FQSA 5AIRA 4HVSA 5HTIA 4NM7A 4BZNA 3NNUA 2I0EA 3VBVA 3TKIA 3OW3A 4GFGA 4EI4A 5HBJA 2QG5A 4WA9A 5HOAA 3MB6A 4CTBA 1VYZA 4EHGA 5AA9A 4I6BA 3OXTA 1JKKA 4C57A 3QTIA 4IM3A 4DYMA 3NYNA 4QMUA 3QUPA 4PNKA 2YM5A 3LXLA 2R3PA 2YIYA 2WOTA 2G15A 3ETAA 4IW0A 4N70A 4DEGA 4J99A 2I0YA 4EJ7A 4I93A 5I9XA 4PL5A 3TZ9A 2OIQA 5CU6A 4RVTA 2EVAA 5CEQA 3FYKX 4MK0A 1Z9XA 2YACA 2C3LA 2X6EA 4CFUA 5HQ0A 2OU7A 4DGGA 2Z2WA 4A07A 3E8CA 2VWYA 4BKZA 3OWPA 2PVRA 3RI1A 5HCXA 3ZZWA 2YFXA 4DT9A 4AE6A 4U43A 5IEYA 3R00A 1JKTA 3EWHA 4WNOA 4ZTSA 5L4QA 1H08A 2J4ZA 1IEPA 3R1QA 4AQCA 1R78A 3FMJA 3LXNA 3BHTA 5FWKK 1Q62A 3ZRLA 5C8KA 2QLQA 5ANOA 4DBXA 3EQBA 4L42A 5B2LA 5KHXA 4BCGA 4EK8A 5IUIA 4QMYA 4BY9E 1NY3A 5E8YA 2DYLA 4AGUA 2G9XA 2QHNA 2VTTA 2WELA 2YAKA 4HNFA 3SOAA 4FOCA 4O0YA 4RIYA 4X3FC 3HV4A 5EW8A 3Q52A 4TYEA 1K3AA 5IA3A 3SAYA 4QP7A 4YC6A 4TYJA 5AP1A 3TCPA 4D58A 2IZUA 2VX3A 3FKLA 2E2BA 2OK1A 1FVTA 2PZRA 4RIXA 3QBNA 5AUXA 4DEBA 5AP4A 1H0VA 3EHAA 4A4LA 2ITPA 4FSWA 4YJQA 2IPXA 5DT0A 3R9NA 4YZ9A 2HAKA 2XNEA 3BI6A 4NU1A 3W2RA 3GFWA 4R77A 2Z7RA 4EOQA 1JSVA 2VTRA 1VR2A 2A27A 2Z7SA 2QI8A 3UC3A 4O7VA 4O7WA 2ZJWA 2RSVA 4GVAA 4PQNA 2XYUA 3I5NA 2O8YA 3O23A 4K0YA 4FKRA 1URCA 4JDKA 3PP0A 4GT3A 4IWDA 4C62A 2I40A 3R71A 3MFTA 1H00A 4O7LA 2YCRA 5DH3A 5HORA 4DEHA 3QZHA 5IQDA 3BBTB 1BMKA 2JGZA 3CP9A 5T6KA 3EN9A 4EOOA 5I9UA 3MVJA 3O71A 4ITHA 3UDBA 4AT4A 4KWPA 4FIGA 4QP9A 4DGNA 4G3DA 4K6ZA 3UYSA 3MVHA 2C5NA 2PZ5A 3WARA 5DI1A 4AE9A 4FV7A 5EM6A 2W5AA 4MQ2A 4KS8A 2QHMA 3ORMA 2C0TA 2WTJA 2JFMA 2RFNA 3OZ6A 2WXVA 5M4FA 2R7IA 4PTEA 4M69A 2QD9A 5DR9A 3TV7A 5AP7A 1U54A 1IASA 5GZ9A 4RPVA 3KMWA 1ZY5A 3VRZA 4IAKA 2X7GA 3DKCA 4Y83A 4CSVA 2HIWA 3PJ2A 4FR4A 5JFSA 3DAJA 4ALUA 2PVKA 4EC8A 4KIKA 4IVBA 5CYIA 5FRIA 4G6NA 3BIZA 2RF9A 1GIHA 2JAVA 1XKKA 3DY7A 4USEA 3FI4A 5CVFA 4L6QA 5I0BA 4O7NA 4FSZA 4R78A 3DB8A 4F1OA 3HUCA 1XJDA 4KABA 5C8NA 2XBJA 3GCPA 3VW8A 4F7LA 5BUJA 3K3IA 4RVLA 2ITVA 4DCEA 3NUUA 5CSXA 3IKAA 4C4GA 2O65A 2QNJA 4O38A 2PE2A 5JFWA 4MBJA 4OAUC 5TOZA 3TXOA 4MF0A 2E9OA 3C4EA 3OG7A 5M51A 4AGWA 3H0ZA 4RFMA 4DN5A 1CSNA 5CWZA 2YERA 3ZEPA 4C8BA 5L6PA 2WAJA 2H6DA 3IONA 4MNEA 3HL7A 3CY2A 3EQFA 3HZTA 3MTLA 1P4FA 4TN6A 4CXAA 3LKMA 3CJGA 2IZRA 3KXHA 1WFCA 4EWHA 4L44A 4EQCA 4HGLA 5FXQA 3CTHA 4I41A 2PULA 1CMKE 4D1ZA 4FSRA 4MVFA 4P5QA 3UBDA 3VQUA 1TKIA 4LMUA 4QMTA 5C26A 5KKRB 4C58A 2GNIA 2R3NA 2PUIA 1MUOA 2GNJA 4IWPA 4CKIA 3MWUA 4YTFA 2ETMA 3ZLWA 3HECA 4DG0E 5ANDA 2Q0NA 1BI7A 3O7LD 2C6MA 4H3QA 3QRJA 4O2ZA 3JR1A 3RAKA 4JDIA 2VX0A 3C9WA 3I1AA 3ZO4A 4C61A 2C1AA 3DXQA 1OITA 3NMUF 4KS7A 5HLPA 1YHVA 3V5LA 4CZYB 4RWJA 3N51A 3SA0A 4EC9A 1KUTA 2OXYA 3DDQA 3KRJA 4G6OA 4I0SA 1QPDA 2Z60A 1LR4A 3EL7A 2QOHA 1PXLA 4X2FA 1OZ1A 3UVRA 4O83A 5EQPA 2JBOA 4C3RA 4ORKA 5FM3A 4RC3A 3O2MA 4E26A 1A06A 2I1MA 1DAWA 4FV8A 1I09A 4G3EA 4RFYA 4BIDA 3D7TB 1YWNA 4RVKA 3FLYA 4BCHA 3CR0A 5HICA 4XOZA 3RCJA 4PX6A 1GJOA 4XG3A 4FKIA 4YZCA 3TG1A 4BWKA 4MXZA 3ALOA 4AAAA 3EL8A 2UZEA 1PF8A 2YCQA 3QKLA 3FC1X 4L68A 2Y4PA 2JDTA 4IX4A 5HESA 2XMYA 4D2SA 4K8AA 1Y8GA 5AJQA 2OXDA 4D28A 3PLAE 5L2TA 5DLSA 4ZTLA 1OUKA 4QOXA 1WAKA 1OKZA 5G6VA 2ZVAA 5GJGA 5IA0A 5ETCA 1KV1A 4TPTA 3UQGA 5K5XA 4XV2A 4MXXA 3UMXA 4WG4A 4Y5QA 3DQWA 3RNIA 3U6HA 2JBPA 5ACKA 3DXPA 4O6LA 1ZOGA 3E62A 3BEGA 3DJ7A 3QQGA 3RGFA 4F9CA 4FZ6A 2QR7A 4W8EA 5HX6A 2CNQA 4EZ5A 3G33A 4FG9A 4X21A 4EYJA 3PG1A 4PP9A 5CI7A 4IWOA 5HNBA 3EKNA 4FL1A 2FSLX 3GC0A 1TQIA 3DNEA 1NVRA 1P14A 3ORIA 3VUDA 3TV6A 5HBHA 1PMVA 1XO2B 2X8EA 4ZEGA 1UKHA 4I92A 4XBUA 3A61A 5FLFA 3QKKA 2X9FA 3R73A 4TKSA 3JYAA 1Q61A 1YI3A 3A7GA 5HVJA 4LRMA 4PL4A 3QCXA 3MPTA 3NNVA 2P33A 4RWKA 4YLLA 4XOYA 5DT3A 1B39A 5K4JA 4R7BA 2BROA 1IA8A 3KMUA 3Q3BA 5JQ5A 4V01A 5FP6A 3I7BA 4IAZA 3ZH8A 1MRYA 5JK3A 1STCE 4RMZA 4NYEA 4JBOA 4A06A 4Q2AA 3ZM4A 5AAGA 5M08A 2IVVA 4Z9LA 3ZXTA 4RX9A 4DH8A 5EI8A 3MESA 3DNDA 3FC2A 3PDTA 4AU8A 5LCJA 1FPUA 3BWFA 4FNXA 3W32A 2UVYA 5DOSA 5HE3A 2QO2A 4CLIA 5GHVA 2ITZA 1SMHA 3BKBA 4IMYA 4LGGA 3OT3A 4BI2A 4D2VA 3FE3A 3FMHA 4Z7HA 2W17A 4I0TA 5H2UA 1E1XA 4ZTMA 3ORXA 1ZYDA 3O0GA 4ACGA 4ZZNA 2UZDA 4PWNA 5AP2A 3UO4A 4GUEA 1REKA 2BVAA 5AP3A 3ZFYA 3BYUA 2VGOA 5L2IA 4AGDA 4BHZA 5CY3A 2ONLC 4GFOA 3I79A 4D55A 2YCSA 2UZWE 1WBNA 4QNAA 1DI8A 5LVNA 2Z7QA 2JDSA 4UMRA 4O7ZA 5FQDC 4DEEA 4BR3A 4CRSA 5CSWA 3COKA 5IUHA 4QYFA 3TUBA 3CGFA 4XV3A 4AN2A 2VGPA 3PRFA 4NM5A 3V3VA 4XNEA 2PVLA 2YZLA 4NK9A 5BX0A 3MH3A 4CVAA 3U4WA 4PTCA 5EDQA 3KREA 4A9TA 5AUZA 3HV6A 3PSDA 4M84A 3TV4A 4E4LA 4ID7A 2QVSE 4BCFA 1U59A 3CLYA 4E1ZA 3D15A 2EXCX 2W99B 2B53A 2IWIA 2GMXA 4L43A 4JQ8A 5CT7A 4FV3A 5D7AA 5HTBA 3B8RA 3LW0A 3IS5A 2CGVA 2OFUA 3QHRA 1PKGA 2JIIA 2HZNA 1ZXEA 2YM8A 3H10A 1CKIA 1UA2A 1X8BA 2UW8A 4AG8A 4B6LA 4FT3A 1H25A 3D2KA 4ANOA 1GZ8A 2JD5A 2VTQA 3V5TA 3C13A 5HLWA 4O7SA 3H4JA 4M69B 5TR6A 3ORZA 4ACHA 5ACBC 4RIOA 3A4PA 3OUNB 2JKQA 2WIHA 5HTCA 5E92A 5C8MA 5IQEA 5AR7A 2X81A 4M0YA 4YGAA 4E8AA 4B99A 4ZSJA 3LLTA 4IQ6A 4JIKA 5AX9A 5KZIA 4IAAA 3IW5A 5DHJA 4F08A 1REJA 3LHJA 4P2KA 4O7TA 2BHEA 4QQCA 1IAHA 1WVYA 3V01A 1IRKA 4KRCA 3PVWA 5FTGA 4R3CA 2P0CA 3LJ0A 5AUVA 3Q32A 1Q8YA 4BDJA 5BUIA 4CLJA 3AOXA 3DXNA 4KBCA 4P5ZA 1RQQA 3EB0A 5KMKA 4QTAA 3N4VA 3R04A 5IA1A 1XHAA 2J51A 4TYGA 1NW1A 5A4QA 2C0IA 3JY9A 2G2FA 5F95A 1W98A 5EM8A 4FNYA 2DQ7X 2XF0A 4D4YA 3F66A 4BDAA 3D7ZA 4C0TA 4NL0A 3L8PA 2C6OA 2LGCA 4GU6A 3V6SA 4JVGA 2J0MB 4U42A 4AUAA 2HENA 2ZAZA 4IZAA 3ZUTA 3C7QA 3EFKA 3NUPA 3VBWA 2PUNA 3OTUA 4O1PA 4TWCA 3HA8A 2OSCA 1Y6BA 3QC4A 5AM6A 5M4CA 3P78A 3S0OA 1IA9A 5K0XA 4O91A 4L45A 5J7HA 1Q5KA 2NO3A 3TUDA 2Y0AA 2YCFA 4FODA 3I81A 4GK2A 2Y7JA 1PXIA 3NNXA 3PSBA 3KU2A 4FTTA 4CG9A 3O50A 3QQHA 2OLCA 5DBXA 3QAME 1HOWA 4XG9A 1ERKA 4DC2A 1KE6A 1Q41A 5DA3A 4FTNA 3PSCA 4QP1A 4ZLOA 3MPAA 4OAVB 1XQZA 4I0RA 5M56A 4JBPA 4CV9A 3W2QA 2QOQA 4R7IA 4B9DA 3QTXA 5LMKA 3PA4A 3QA8A 4G1WA 4I3ZA 2GHMA 2UZLA 3RZBA 5CAVA 4I94A 1UNHA 4JAIA 2ETKA 4JNWA 4BKJA 4BHNA 4YO4A 1M17A 5AP0A 5HE0A 5IF1A 4O7YA 3NWWA 4DGLC 5L3AA 4JIAA 2XBAA 5C4LA 4M3QA 4D4VA 2UVXA 4Y85A 2ZB1A 4AP7A 5CAUA 3NUAA 2R0UA 3EQHA 2WFYA 5AMNA 3QXOA 4EH3A 3OY3A 3ZFXA 3NW6A 4W9WA 3TI1A 3KN6A 4FNZA 3QC9A 1QMZA 2J7TA 2ZOQA 3GCSA 1OI9A 2CMWA 5F94A 1OIUA 2ITOA 1PYEA 5IQAA 1E9HA 1H27A 2F49A 3ZOSA 3GU7A 2ITUA 4FTKA 4M13A 5A4EA 4Z55A 3WZDA 2FA2A 4JG7A 3C1XA 4LQMA 3PJ3A 2IW8A 4YJUA 5E1SA 4IADA 1OBGA 1FQ1B 2R2PA 2VUWA 3D4QA 2YIWA 3NUXA 4I6FA 2C6LA 3Q2MA 5EYDA 3EQIA 2R3LA 3S00A 5K5NA 3WF8A 3D5WA 4F6UA 4IHPA 2PZYA 5C1QB 4UBAA 3NW5A 4Y8DA 4YNOA 5IG1A 2FB8A 4MCVA 4U8ZA 1YI6A 2I0HA 2UW7A 1NXKA 2VWUA 4R3RA 3FLQA 3JVSA 3QGWA 2XA4A 2QOIA 4G5PA 4WNKA 3TTIA 2G2HA 2RGPA 1OL1A 3WYXA 3M11A 3AGMA 4EEVA 5J1VA 3R21A 4EL9A 3R6XA 2OJGA 4PDSA 1UU3A 3LXPA 3Q4CA 4UWYA 2WTKB 3MH1A 4WRGA 4F0IA 4FEVA 4YLJA 1XH9A 3KQ7A 2A0CX 3IW6A 3OC1A 4R8QA 3OWJA 5CF6A 3ZM9A 4LRJA 5L2SA 4UZDA 4IVAA 3TACA 4JJRA 3U87A 3WF7A 4BZDA 4RT7A 4MX9A 2YIRA 3L8XA 2XRUA 4BDIA 3KL8A 3WZKA 4E4NA 4RLKA 3WILA 3QTRA 2BMCA 2ESMA 2XK4A 3KY2A 1WBTA 1H4LA 3DKGA 1FBNA 4DEIA 4JR7A 4Q5EA 3P79A 1UNGA 2BCJA 3OROA 2WZJA 3A2CA 3PTGA 4O7RA 3Q4UA 2QOFA 3PY1A 5GZAA 2PMNX 2Z8CA 2WMUA 4MQ1A 4AT3A 4EOJA 4DCAA 4LGDA 3D83A 3U8WA 4AOIA 3C50A 3DOGA 3ZO2A 2BZJA 1Q8WA 3DBFA 3HUBA 4FOBA 5AUWA 3SRVB 4AS0A 4F9YA 2GHGA 2VTLA 3F3UA 3QU0A 4PNIA 5HIDA 4A9RA 3D5VA 5HU9A 3HMPA 2VD5A 2VNWA 4MWIA 3NVMB 3F7WA 4QPMA 4GU9A 2C6IA 3VUMA 1O9UA 4FKUA 3HGKA 3PIYA 3UODA 1A9UA 4CNHA 5AADA 1LEWA 4RGJA 4U80A 2BAQA 2XP2A 1OPJA 4TT7A 4RA4A 1GZOA 2C5OA 2JFLA 1Q97A 4FVPA 5L8KA 4X2KA 3RPYA 3U9NA 3F61A 1ZAOA 3H3CA 5CLPA 3W2SA 3BWJA 1KE7A 3COHA 2PVNA 4ACCA 3A4OX 4O0WA 5ITAA 2OF2A 3HP2A 3EH9A 4O86A 4WNMA 1W82A 5DR6A 5HI2A 5EI6A 4RLLA 3OCBA 4F63A 3MA3A 3VULA 4QMOA 3DFCB 3BLHA 3VUKA 2VV9A 3FZRA 5G1XA 1WBWA 3LPBA 4F70A 5CF4A 5KNJA 5IQBA 3BBWA 3FI3A 5FP5A 3I0OA 2ZM1A 4E4XA 3ET7A 3UIMA 3PA3A 4ALVA 1SZMA 5HE2A 4IIRA 1DM2A 3GP0A 2XUUA 3HX4A 4XJ0A 4LL5A 4IX5A 1W7HA 4W4XA 4DH1A 2BFXA 2CCHA 4FTAA 3TZ8A 2JAMA 3L1SA 4F9BA 3FWQA 4EKLA 3MFUA 3R63A 1GZNA 4IC7A 2HW7A 3MA6A 3BGQA 4YC8A 4LUEA 5D10A 4YHJA 4CEGA 4D1XA 3EQDA 3PY3A 4FTMA 4ZJIA 3ZEWA 4DHFA 1U4DA 1W8CA 4RWIA 3POOA 5BVOA 3G9LX 4YJSA 2UW6A 5GJFA 5JKGA 4X2JA 1YXUA 3SW4A 2J6MA 4M68A 4D5KA 2IJMA 4O84A 1KWPA 3Q53A 1JKLA 3L9LA 3F2NA 2XNGA 4AW5A 3BX5A 2OW3A 4FV0A 3HDNA 4ZK5A 4E5WA 2CGUA 5HO6A 2IVUA 2WMBA 3R9HA 2B55A 4FSQA 4GKIA 3ZMMA 5HG5A 3ATTA 3RAHA 3KVXA 1CTPE 3C4ZA 3GUBA 4PDYA 4IX3A 3I0QA 4CFFA 4F9AA 3GB2A 2V55A 4UWBA 4U9AA 4XG4A 1M2PA 2VWVA 3IECA 5CENA 4YR8A 4QTEA 3EIDA 5DT4A 1UWJA 1AGWA 2GNHA 3KGAA 1Y6AA 2QKRA 2UW3A 3LFDA 4A7CA 4CMOA 4FTCA 3Q9XA 2XK8A 2CKQA 3FV8A 5HHWA 4KNBA 4J97A 3JVRA 3BLQA 3FSFA 2IW9A 2VO6A 5FM2A 4EOPA 4CD0A 5DWRA 5IH5A 1YOMA 2CHLA 2EUFB 3EYHA 3FUPA 3Q5ZA 5KMJA 3QRKA 5BNJA 4DE4A 1KOAA 3VS1A 3LQ8A 4NCTA 2B9FA 4Y5HA 3TZMA 1R39A 2JKMA 5IQGA 4YJTA 3VS3A 5BPYA 4MXYA 3T8OA 5JN2A 4HYUA 3UPXA 3MFSA 3QLFA 4BYJA 2VZ6A 3KRLA 4F99A 3U6IA 4OTDA 2V7AA 4YJPA 3NVKI 4DTBA 4OTQA 5A4CA 4BCMA 3R9RA 4IBMA 5LARA 2GTNA 3NCZA 2YDJA 3BEAA 4G34A 5CXZA 2F7EE 3FKNA 4USDA 5HD4A 3B8QA 4FYNA 1TQPA 4G31A 1OECA 2DUVA 2X1NA 4WG5A 4XP3A 1M52A 4JX3A 5EK7A 3AMBA 3R1YA 1PYXA 2C5XA 2C5VA 4G17A 5KMMA 4NSTA 5LWMA 4EZ3A 1CDKA 3F69A 4ANMA 4CFWA 4CRLA 4HGEA 1H26A 2JC6A 4QMSA 2EWAA 5F20A 1O6LA 3GQLA 3LJ1A 1IG1A 5LMKC 3LIJA 3PFQA 3ENHA 4BCQA 3LCKA 3EN6A 3R7UA 2F2CB 2HZIA 1R0EA 4CMUA 5IMEA 4I21A 2Z02A 4FKVA 3G51A 2W4JA 4PPCA 4ZAUA 1FGIA 4I5MA 3SDJA 2XM9A 3BHUA 3OFMA 4YTHA 3RVGA 4QP8A 4E73A 4OTRA 4C4FA 1J1CA 3I7CA 4GCJA 2W4KA 4HZRA 4QYHA 5IQIA 2C30A 4S32A 3BYOA 2GU8A 3WF6A 1Q8ZA 1ZRZA 4NT4A 4X2GA 1MRUA 3UVPA 5EYCA 3REPA 4RX7A 5KHWA 2GTMA 1JQHA 4CZUA 4YJNA 2FSTX 2QOBA 5LOHA 4OTIA 1OL6A 2UZOA 4DH5A 2HW6A 5HBEA 2G01A 2XNPA 3LFBA 5EH0A 4F7JA 4CT1A 2R3QA 4DG3E 3CY3A 4E93A 3TDWA 3H9OA 4C38A 2YM6A 3KA0A 4YJRA 2WQBA 3C4CA 4ZTHA 5L2QA 1V0OA 1L3RE 2X6DA 2VWIA 5D11A 3A7JA 4BDCA 4OW8A 2YHVA 2HWOA 3FY0A 2XIXA 2E9UA 2Z7LA 5CNNA 3MJ2A 4FKJA 5DRDA 3ACKA 3VUHA 4A4OA 2CCIA 2ZDUA 3GT8A 1GAGA 4JS8A 3ACJA 4KD1A 4NFNA 5A6NA 2R4BA 3OW4A 3JPVA 3QD3A 4ZOGA 4KKEA 4C59A 4E7WA 4WNPA 3KN5A 5CAPA 4EONA 5J9LA 2CKOA 4ANBA 4C7TA 4UXQA 3S95A 1BKXA 2G2IA 1MQBA 3F5PA 4I24A 3ZHPC 2FVDA 3FQEA 5FDXA 4XG6A 1CM8A 3QQLA 4O0SA 4G16A 4ZZOA 1J7LA 4C4JA 2PY3A 4MNEB 2ZMCA 2QOKA 4O22A 3ZDIA 4BDEA 2XM8A 3U51A 4ZZMA 4EK3A 5DYJA 3UZPA 1ZZ2A 3LFEA 3VJOA 2OF4A 5CXHA 2WEVA 4RIYB 5AP5A 1ZYLA 2GHLA 2I6LA 3AMYA 1W0XC 4ERKA 4BCJA 1G8AA 3MVMA 4N4SA 2YABA 3TWJA 3F6XA 4QMPA 2BRBA 4HPUE 4FZ7A 4QTBA 4BCIA 5IU2A 3P08A 5D12A 3JXWA 1H1SA 3GCUA 3NIEA 3QYZA 4YJVA 4MXCA 5IPJA 3V8SA 3FPMA 2DS1A 4S30A 5HG7A 3QD4A 5LMBA 2F4JA 5LVPA 3WIGA 3R8LA 3DK6A 4YZBA 1ZARA 3PZEA 4WKQA 3S2PA 2R7BA 2PL0A 2W7XA 4FNWA 1OKYA 3EQGA 4R5SA 3U4UA 3UIBA 3ELJA 5HNGA 2XK6A 4IDVA 2B9JA 4F6WA 2ZV7A 2YISA 4HVHA 2X7FA 5J7BA 4BVUA 5HX8A 4KIKB 4I5HA 4WO5A 2W0JA 4RSSA 1OIRA 3O17A 5M07A 3IDBA 3FZSA 2WTDA 1GIJA 3EMGA 4I5PA 5DMZA 5GNKA 4C2VA 2XJ2A 4OLIA 5ANIA 5M53A 4I6HA 1U54B 2J0JA 2PWLA 2VTHA 2X39A 5CZIA 5EW3A 3UIXA 3EZRA 2VN9A 3A60A 5AV3A 3FYJX 3R2BA 3AC8A 2C47A 4BL1A 2O0UA 5IQHA 4FV4A 4PY1A 3E63A 4AZWA 5IUGA 2JIVA 1R0PA 3QCYA 5C27A 1ATPE 4IJPA 3VBXA 3U54A 5AUYA 3R8UA 5BMMA 2BTRA 4HGSA 2W1IA 2QU6A 2Y6OA 3ZRMA 5L8LA 2ITXA 4YLKA 4BTFA 3LAUA 4BDHA 5HIBA 1NA7A 2WIPA 3GEQA 5IA4A 3ANQA 2BR1A 3ROCA 3NSZA 4BF2A 5BVEA 2J0LA 2QO7A 3MFRA 4FX3A 2H34A 4C34A 5B2MA 5LVOA 3TJDA 4BWPA 2JIUA 3O96A 3FY2A 4WBOA 1RE8A 2VTIA 4GK3A 2KTYA 1UVRA 5EYKA 3IOPA 2X4ZA 4L9IA 4BIBA 4KUJA 4CGAA 4M14A 4OT6A 5AAFA 3SXFA 3PVUA 2H96A 3UZRA 1HCKA 3UOHA 4XS2A 3AG9A 3MS9A 4ENXA 2X8DA 5CSHA 2X4FA 4EBVA 4O27B 4YO6A 2WTWA 1WVXA 4BN1A 4JDHA 3DK7A 2Y4IC 4ZP5A 1Z5MA 3ZS5A 2XCHA 4K18A 4NW6A 4YUQA 2J0KA 3OT8A 3LFFA 4FZFB 4KINA 3NYVA 5HIEA 3FXZA 3G0EA 3KRXA 4FG8A 4PDOA 4BIEA 3FMMA 3F2AA 2WMSA 2WMAA 3ZBFA 2PZPA 4K2RA 3QWJA 2A19B 1G8SA 3SW7A 5EDPA 3RTPA 2HWPA 4FV6A 4M12A 4B4LA 3EFLA 4QP2A 3GXLA 4O96A 4WD5A 3HMNA 4WHZA 4C3PA 4C4IA 3U9CA 3BRBA 3ODZX 1PRYA 3ANRA 3G90X 4YJOA 4B7TA 3CE3A 4QQJA 2F7XE 4GVJA 4CQGA 4ACDA 4L01A 4LOQA 3DTWA 3I6UA 5AWMA 4MEDA 4YC3A 4AFJA 4RC2A 4AGCA 4I4EA 5FTOA 2CNUA 5H8BA 3KB7A 3L9MA 4PUZA 2OWBA 4KRDA 5ETFA 1JSUA 4M15A 2PUPA 2XCKA 3G15A 5IQFA 3FI8A 5AUTA 4JLCA 4NTTA 1OIYA 2NRUA 4D2TA 3NUSA 2IW6A 4JG6A 3WE8A 3PRIA 3MY1A 3C4FA 5KBRA 1PJKA 3PXKA 4BDFA 1H1QA 4E6AA 4H3PA 4GK4A 4ANNA 5E90A 2CLQA 2WTVA 4CFXA 4JL9A 5EM5A 5KKRC 2CDZA 3LFNA 4OR5A 4IXPA 3R7OA 3UNKA 5BVWA 5JH6A 3HLLA 2XIKA 2WO6A 4CCBA 2ZB0A 4BGGA 4HPTE 1U46A 2X0GA 2HYYA 3C4WA 4RG0A 4F0GA 4KSPA 2PE0A 3OXZA 5EHOA 2WMWA 2FGIA 4Z16A 4HVDA 1R3CA 3M2WA 3PE2A 4HOKA 4C2WA 1BX6A 2C6TA 1JWHA 2ZV9A 2QKWB 5HCZA 3RP9A 3V5PA 4FKTA 4XX9A 2BRNA 3MH0A 2J2IB 2QODA 3P4KA 3QQJA 4X6QC 4D0WA 1LP4A 3C0GA 4QTCA 4ENYA 3W8LA 2IVSA 4D2RA 3UTOA 2HZ0A 4U40A 5CASA 4N6ZA 1YRPA 3QGYA 2FO0A 1G3NA 3CS9A 4JG8A 4QQ5A 4ITJA 3D94A 5LMAA 3VF9A 2C6DA 4GV1A 4EBWA 4LG4A 4UYAA 4U5JA 3ZUUA 4O2PA 3QD2B 4JT3A 3ROYA 4YMJA 2QURA 3DLZA 3KCKA 4UMTA 5KUPA 3UIUA 5I9YA 2O63A 3K2LA 3SQQA 2YWVA 3H9FA 4NZWB 4FKPA 4R3PA 3MW1A 4C3FA 5CF5A 3DK3A 4FL2A 4OTHA 1YW2A 5E91A 3BHYA 3R01A 4F09A 4IB0A 3S4QA 2PK9A 3PVBA 3ZU7A 4MXOA 5A46A 4W4WA 4X3FB 1LEZA 2XJ0A 3G6HA 4IVDA 1YWVA 5CZHA 4E20A 2PMOX 5FG8A 5DR2A 4UMQA 5I3RA 4K1BA 2BDFA 4RJ3A 3NLBA 2X2MA 4FT9A 1DI9A 1U5QA 1YKRA 2BRGA 4ZY6A 4FEUA 3BGPA 3QTUA 1FMKA 3ITZA 3HV5A 2X7OA 3QRTA 2BHHA 3F5UA 4IZ7A 4KIOA 4L8MA 5CVHA 4AW2A 3FPQA 1JLUE 4KBKA 3CTJA 4M8TA 1XBAA 1ZMWA 3NDMA 5HG9A 3DZQA 4DFYA 2V7OA 3BE2A 4QTDA 1AD5A 3AC5A 5GINE 1Q3DA 4ERWA 5HEZA 1UU7A 3PJCA 4DTKA 3R8MA 2PVJA 4XCUA 2ITQA 3ZDUA 2W06A 4JBQA 1URWA 4QMZA 3W2PA 2ZDTA 4BYIA 2I7QA 2J5EA 3AQVA 4XYFA 4IH8A 2YLEA 4JBVA 4FV1A 5HVYA 2UV2A 3A7FA 3VHKA 1ZLTA 4XG2A 3SLSA 3W55A 4ZSAA 4TWNA 4TYIA 1NVSA 3LCSA 5A4LA 3NEWA 3D5XA 4DLIA 2OIDA 1YXSA 2W5HA 4IM0A 2Y6MA 1BUHA 3NZ0A 5CTPA 1I44A 3Q5IA 3FMKA 3QRUA 3BE9A 2OG8A 3QZFA 2J0IA 4Z3VA 5ANGA 2B7AA 3KC3A 4O21A 3UOLA 5BVDA 3E7OA 4NCTC 4Y95A 4FTUA 3I60A 4P7EA 5I3OA 4AXAA 5AM7A 3SD0A 2JEDA 5M44A 3BLRA 3ZUVA 4OGRA 3WF5A 4AN9A 4GRBA 2NNWB 1VZOA 3W33A 5LVMA 3NNWA 1P4OA 5JT2A 3C0IA 3ZYAA 3R02A 5EI2A 3KK9A 3TT0A 4ASXA 2CLXA 4KKGA 3QZIA 4L3JA 4DITA 1VEBA 3KXXA 5CU3A 2VTPA 3KULB 3RPOA 1YDSE 3DA6A 2BAKA 2PVMA 4BBEA 3EZVA 4YNEA 4I20A 4AN3A 3FMDA 5GIPE 2J50A 2W1ZA 3G5DA 2VO0A 4IACA 4M7IA 5LQFA 4RZVA 4D4RA 3E87A 2YIXA 4GT4A 3DKFA 4F9WA 4QNYA 5E8TA 3R7GA 4U44A 3FHRA 1MQ4A 3CTQA 4H1MA 4LM5A 3SRVA 3UNJA 4PRJA 4AOJA 3LJ2A 4HNIA 2QQ7A 2C3KA 4OUCA 4DTAA 4O0XA 4I1ZA 4Y73A 3R7IA 4MYGA 4F6SA 4N0SA 4FSMA 1OL7A 2CJMA 5DVRA 4EQUA 2OO8X 1UU9A 2ZV8A 5GJDA 5B7VA 2PMLX 4G9RA 2GQGA 4TW9A 3HVCA 2UUEA 4QT1A 3UOJA 4RIWB 4H58A 3IDPA 4IZYA 3COMA 2RIOA 4ZLYA 4J52A 4UYNA 3VF8A 1O6YA 5K4IA 5AAEA 2GDOA 3LFCA 2YLFA 3SX9A 3QX2A 1VYWA 3DFAA 2GPHA 2AYPA 1FMOE 1Q99A 3D9VA 3W8QA 1XBCA 3QFVA 4NM3A 2OJ9A 4TTHB 2W1DA 3LM5A 3KFAA 3FLZA 3QTQA 4RQKA 4CFVA 2EB2A 5ANKA 3SC1A 4USFA 2XH5A 1K9AA 3KXZA 5K0KA 3F7ZA 3GU5A 4OBQA 4S31A 2B9IA 2GFCA 4CQEA 1ZZLA 5L6OA 1RJBA 3AT3A 1NT2A 5K9IA 3UO6A 4X6RA 4C35A 3KF7A 3BELA 1OPKA 3I6WA 4RJ4A 5DPVA 3C5IA 4JXFA 3BCEA 2BTSA 4V05A 3PXRA 1BLXA 4MTAA 5HVKA 4H36A 3UP2A 1SM2A 3Q9ZA 1AQ1A 4XHKB 4AA4A 1YOJA 3E92A 3GC9A 2XKFA 4PF4A 3C0HA 1J91A 3KVWA 3OVVA 2UZUE 5FEEA 2RFEA 3ENMA 3RPSA 4CFNA 3IK3A 4MWHA 4FIEA 4YBJA 4YZDA 3AD5A 4FZDB 4LI5A 3SGCA 4JAJA 2PVYA 4BGQA 3QXPA 4GW8A 3QHWA 2OFVA 3Q60A 4RVMA 2PTKA 3ORKA 3M1SA 4AX8A 2QCSA 2XK7A 5D9HA 3HKOA 3PIXA 3TNWA 3G0FA 3DB6A 5A3XA 4BDGA 3KXMA 1P2AA 4OTFA 3F3VA 5KBQA 5CQWA 5JFVA 4JDJA 4AOTA 1JVPP 3FMEA 5AR5A 3F5GA 3MY5A 4FGBA 2W1FA 4MF1A 3A8WA 3TKUA 3BV3A 4HW7A 5DEWA 3KF4A 4ZLZA 1PXNA 2LAVA 1Y8YA 4APCA 2OZOA 4EUUA 4L52A 3UC4A 5H8GA 3V8TA 3QYWA 1OB3A 2EXMA 5C4KA 4RJ5A 3MIAA 4FSYA 2CN8A 2HELA 2RG5A 3POZA 5JSMA 3PJ1A 1KE8A 3AXWA 3E7VA 3UPZA 4EH5A 1XWSA 4AA0A 3EN7A 1MRVA 4D2WA 4CKJA 2B52A 3LZBA 3PPKA 4GYGA 4XP0A 3WZEA 4HCUA 4D2PA 4FUXA 4AW1A 5A54A 4HCTA 3AC1A 5JZJA 1WCCA 1M14A 4FTIA 4WT6A 2PPQA 3PIZA 5FXSA 5L6WL 5KMOA 4DA5A 2GNGA 3W16A 1ND4A 3NW7A 1GIIA 2WTCA 3VWAA 4IB1A 4FGRA 4NH1A 4FICA 5CT0A 3GVUA 4EH2A 1LPUA 4EHVA 3EYGA 4L53A 4YZMA 3N4TA 2QR8A 5KZ0A 3VNTA 5KCVA 4C36A 3E8EA 2VWWA 2WPAA 3DQXA 3K5UA 4B8MA 3HRFA 3ULZA 3PWYA 4GIIA 5I4NA 4I6QA 4FV2A 4DINA 3COIA 2GQSA 1XH8A 4PDPA 4E3CA 4QP6A 3N4UA 3RK5A 2R3OA 4CV8A 4RJ6A 4UY9A 4CCUA 5EFQA 4DH3A 3VC4A 3FZOA 3WF9A 4PP7A 1R1WA 4N6YA 1ZMVA 4V0GA 3GU6A 4C4HA 2RFDA 2AC3A 4M97A 3LCTA 2X2KA 3VJNA 4EH9A 3R22A 1UWHA 1K2PA 4WUNA 3S1HA 4ZSLA 4FIIA 2VTSA 1O6KA 3BGZA 3L9PA 4JQEA 4MD8E 4W4VA 4XBRA 3VS0A 3FJQE 2XNMA 4QRCA 3QALE 4ALWA 4CTCA 5BUEA 5FXRA 4RIXB 2WGJA 3KXGA 3V5JA 2XKEA 4AT5A 2OIBA 2W4OA 5HKMA 5IEVA 4AACA 2PVFA 3HMOA 2P3GX 4EH4A 5BYYA 3FXWA 1TVOA 1PY5A 4L46A 3DDPA 3GQIA 4KBAA 2VO3A 1ZYSA 4D0XA 1H8FA 5A4TA 1Q8TA 3EQCA 4L7FA 4NFMA 3DU8A 4M0ZA 4M66A 1M7QA 4JI9A 2OJIA 3RCDA 3MN3A 4PMPA 4TYHA 3SOCA 3PXFA 4RX5A 2UW4A 4GSBA 3QL8A 4RX8A 1JAMA 4IANA 1JBPE 2IN6A 4LFIA 2NP8A 4O0UA 5JEBA 3LLAA 4UN0C 3FMNA 4IAYA 4YSMA 3UQFA 1JKSA 4BCOA 5JGDA 3CXWA 5EHYA 1JSTA 4EOSA 4NIFB 4FEXA 4U45A 2VAGA 3VBYA 5BVNA 4QPAA 4EQMA 4X0MA 3PE1A 3WYYA 2R9SA 3MY0A 3PA5A 1J7UA 1OKVA 2UVZA 5LJJA 4MBIA 1Q3WA 1WBPA 3ERKA 4EKKA 3TIYA 1PXOA 4GMYA 2YJSA 3F9NA 4QMXA 4FVRA 3QUDA 4RA5A 2BZHB 3MB7A 4UXLA 3P0MA 4ONAA 3AD6A 2IO6A 3ALNA 3CGOA 5LCKA 3GOPA 3FAAA 2B4SB 3UGCA 5CU0A 3NR9A 4DEAA 3U55A 3W18A 3QTZA 3WZJA 4XG7A 3AC4A 2BILB 3PYYA 5D1JA 2UZTA 4AA5A 5KO1A 2B54A 3V6RA 3CJFA 2KULA 2F9GA 4U6RA 3PXZA 4K77A 3UG2A 5CAQA 5F4NA 3FQHA 4W4YA 3VAPA 3CD8A 4S34A 2WQOA 2FYSA 3NPCA 3TEIA 4B0GA 4JRVA 4AZFA 1NVQA 1SYKA 3OWKA 5BVKA 4D5HA 5JFXA 3F82A 1JNKA 1CKPA 3UZTA 3HV7A 1F3MC 3EKKA 3C5UA 4ZSEA 4ZJVA 1WVWA 4HGTA 2YDKA 5E4HA 2W9ZB 4NKAA 1U5RA 3FMLA 1OGUA 3GCQA 2W1CA 4A9YA 4EOLA 5E8UA 2CKPA 2GSFA 3TNIA 5C01A 4E6CA 3R7YA 2CKEA 2QO9A 2GNLA 4DFXE 1OL5A 2WEIA 5CEMA 4FKWA 3MVLA 3BYMA 4GYIA 1A48A 3VW6A 5EOBA 4C37A 4UX9A 4Q5HA 3IQ7A 3RPRA 2BDWA 3PXYA 2OBJA 4FTOA 4GG5A 4HVIA 1J3HA 3SHEA 5CAOA 1PHKA 4P90A 5DN3A 4LV8A 4H3BA 4ZY5A 2R3KA 2XVDA 1OMWA 4NUSA 3VS6A 2VTAA 3HMIA 2PYWA 2BAJA 2XNBA 4UV0A 3GGFA 1ZMUA 1UV5A 4FEQA 3RBWA 3BYSA 4Z7GA 3TDVA 3PVGA 4FK3A 2XNOA 4DFZE 3E5AA 5AV0A 4LGHA 2IG7A 5CI6A 1XBBA 3HEGA 3Q4TA 4MHAA 4AZSA 3BU3A 3TNQB 4LL0A 1H1RA 4F7NA 3A8XA 2HY81 3R1NA 1HCLA 1P5EA 1GNGA 3CEKA 1W84A 3V5QA 1V1KA 3VQHA 3WOWA 4APPA 1H24A 4EK5A 5E8WA 3GU8A 3H0YA 3CSVA 4LRKA 3BZ3A 4WSQA 4BI0A 1BYGA 3F88A 3KRRA 5DRBA 4IFCA 4ZTQA 2UW0A 3IOKA 3DBDA 4O0RA 4ZTNA 4EHEA 5JMSA 2X8IA 4RWLA 5IA2A 4ZY4A 4KB8A 1B6CB 1PXKA 4JRNA 2B1PA 3EFJA 3W10A 1PMUA 3QA0A 3K5VA 2XZSA 3R8PA 3TNHA 5JRQA 3BU6A 3NRMA 4I22A 4MBLA 5AUUA 5HGIA 3VS2A 4I23A 4UALA 5T3QA 1GZKA 2HOGA 2GS7A 3DKOA 3P86A 4FC0A 3AT2A 1WMKA 2BIKB 3BV2A 1V0BA 2ZM4A 4FIJA 2FSMX 4YPSA 4R6VA 2VU3A 1SVGA 3CD3A 4YTIA 5F1ZA 3D7TA 4JR3A 4HVGA 4ASEA 2Y8OA 3FZTA 4BBMA 3OBJA 3NAXA 4TZRA 3Q9WA 1PXMA 2HZ4A 3ZC5A 1DS5A 4F1MA 2BDJA 1SNXA 3DGKA 3HMMA 4UB7A 4J71A 2CNVA 2C3JA 2V62A 3MDYA 3VN9A 3ZRKA 2G1TA 2BRHA 3RWQA 3R8ZA 3FDNA 5TKDA 2J5FA 5IISA 4BICA 4U81A 4FT0A 3Q9YA 4O1OA 1YHSA 3R0TA 3HV3A 3O8UA 3UQCA 2JDOA 2QLUA 4AFEA 4FI1A 4JOAA 3DZOA 4RIWA 3TL8A 2WTIA 4YHFA 3ZBXA 5L8JA 4IVCA 3RAIA 4GG7A 3FXXA 3IW8A 3LMIA 4FL3A 4YU2A 5KX8A 5IQCA 5DEYA 3OP5A 4ZMFA 4FV9A 3WBLA 4GH2A 4CZTA 4ACMA 2WOUA 2C6KA 3FZ1A 5CF8A 5GZ8A 4FEWA 3F3ZA 2QOCA 4J95A 3D0EA 2XEYA 4XH6A 5D7VA 5ANJA 5EG3A 2WMXA 2XIYA 4H39A 4E4MA 3CQWA 4GT5A 4DFNA 4LUDA 5CU2A 2Q83A 5FUTA 3E93A 5CSPA 2E9PA 3OCSA 4FT7A 2W1GA 4CMTA 5BYLA 3AMAA 5IMXA 4G2FA 2XRWA 4IJ9A 3FL4A 1QPEA 1YVJA 2VWZA 3MGYA 1M2QA 3DBEA 3MIYA 3NGAA 3PXQA 3QX4A 4IB3A 4KAOA 5E8SA 2XYNA 2OZAB 4HYSA 5HNIX 3AC3A 2A2AA 4DGMA 2RG6A 1UKIA 5C03A 4E5AX 5K3YA 3ORPA 4F65A 2DWBA 3HRBA 3SG9A 2V0DA 4D9TA 4WBBB 4G3CA 2YM7A 5B0XA 4IWQA 3SV0A 4OBPA 3QQKA 5AR3A 5FD2A 3G2FA 3BHVA 1XH4A 2QG7A 4HZSA 4R1YA 1ZYCA 4QD6A 2C1BA 3ORNA 4MH7A 1WBSA 4TY1A 4U3ZA 4PTGA 4AW0A 1DAYA 2X2LA 5E8XA 5HO8A 2A1AB 5DE2A 3KXNA 4EUTA 1L8TA 3DS6A 3T3VA 1T45A 3IGGA 4YTCA 4EHZA 3RK7A 4NM0A 4IZ5A 3PPZA 3QCSA 5DNRA 4G3FA 3UOKA 5E1EA 4WSYA 5IDNA 5FTQA 4DFLA 2VTOA 5AA8A 4O81A 3CBLA 4NW5A 3QRIA 4EH7A 4BDBA 3DJ6A 3UE4A 2YIQA 3KMMA 3M42A 4K11A 1LUFA 4EOIA 4Y72A 4Y46A 3ID6C 4FKQA 2IZTA 3V8WA 4B8LA 5EHLA 2BUJA 4IDTA 5AV2A 4A9UA 2P55A 2C6EA 5IEXA 4BBFA 4ZMEA 3V51A 2HCKA 2XNNA 3R2YA 4ZSGA 2VWBA 2WQNA 3P7BA 3OBGA 4FZAB 3ZO3A 3EQPA 5BQ0A 2P4IA 4XLIA 3K3JA 5A9UA 1OKWA 2GQRA 5ETAA 3OD6X 4ZJJA 2FUMA 3PLSA 1OPLA 2R3JA 4RQVA 3PY0A 5J5SA 1S9IA 5KE0A 1IR3A 5E9EA 3A7IA 3W2OA 3KRWA 4FYOA 4O0VA 3ZXZA 3BQRA 4U0IA 2XKCA 5EKOA 5F9EA 4O0TA 5IH6A 3OXIA 5IH4A 1KE5A 1J1BA 1H01A 2GS6A 2WB8A 4LMNA 3DAEA 3OY1A 2C5YA 4LOOA 3ZO1A 2ERKA 3E88A 5E7RA 3PPJA 4QP4A 3Q96A 4XG8A 4CKRA 5M57A 3DAKA 2V22A 4MNFA 3P7CA 1E1VA 3R8VA 3ZTXA 5JRSA 4MXAA 5DFPA 3TKHA 3DT1A 2Q0BA 4FK6A 2WTKC 3KK8A 3R28A 4NJDA 3QKMA 4FIFA 4QMVA 4CT2A 2NRYA 5J1WA 2JDRA 2PHKA 3O7LB 4II5A 3F2RA 2UZVA 3MI9A 2PE1A 2GFSA 5J95A 1WBOA 2HY0A 4J96A 5BYZA 4LOPA 4HYIA 1H0WA 5CVGA 2YWPA 3QTSA 4U79A 3FLWA 1YQJA 5KMIA 3Q2JA 3H9RA 5CX9A 4MAOA 3FLNC 3SVVA 1XH7A 3HNGA 3KKVA 4NTSA 3IG7A 4ZXTA 2WMQA 5A6OA 1UU8A 2JDVA 4BTMA 2EU9A 2XIRA 1J7IA 1H1WA 1TQMA 2OH4A 2OICA 3OF0A 2B9HA 3ZFMA 4BRXA 4BCPA 2J90A 3CQEA 4R7HA 5E8VA 5ICPA 3LFAA 4DG2E 4FSNA 4IAFA 2UW5A 4TYHB 3ZC6A 4TXCA 3UO5A 3FEGA 2H9VA 1BI8A 2IZSA 3MH2A 4HJOA 4AWIA 2V5QA 4ITIA 4QMLA 1BL7A 4PMMA 3D14A 3DTCA 4EWQA 3UMWA 3PWDA 4LYNA 4G3GA 4S2ZA 4C02A 4EJNA 2BZIB 3B2TA 3U6JA 2REIA 3MTFA 5CQUA 5M4IA 4J1RA 3W2CA 2WQEA 4RRVA 4UMUA 5TO8A 2R5TA 3CIKA 3CQUA 3CKWA 3GOKA 3LXKA 1APME 3NS9A 3OEZA 4UZHA 5CEKA 4RJ8A 3G6GA 3EN5A 4EH8A 3VBTA 4I4FA 3HA6A 2YAAA 1EH4A 2WMRA 3SXRA 4EH6A 2PU8A 1YDTE 3BU5A 5DG5A 2EXEA 4EK6A 1UNLA 4W8DA 4JX7A 5CALA 2XK3A 1FOTA 3O51A 2GCDA 3QUEA 3KCFA 2ZM3A 2VWXA 3OCGA 4XP2A 2F57A 4Q9ZA 4FE2A 3C4XA 4F64A 1YXXA 2UZBA 5M55A 4XLVA 4YHTA 4BTJA 4F7SA 2OH0E 3EN4A 3VO3A 2PUUA 3LFSA 2W1HA 2AUHA 4IFGA 1QCFA 4UMPA 1PKDA 3D5UA 3VUGA 2WKMA 3VVHA 3R30A 5HD7A 5LXMA 3GC8A 2O5KA 4X7QA 5HCYA 4KA3A 5A14A 2YN8A 4XRLA 3AT4A 4CYJA 3IDCA 3R7VA 5J5TA 4E5BA 2BFYA 2CGXA 3RAWA 1FINA 4DGOA 2O2UA 3EQRA 5EQYA 1ZYJA 5DIAA 4FTQA 2R3FA 4QYEA 3L8SA 2HXQA 4OTGA 3T9IA 3EJ1A 3NCGA 2FSOX 2OXXA 3LFQA 3QTWA 4OTPA 1GY3A 4L3LA 4IAIA 4U41A 4U7ZA 3VS5A 5CEIA 2ERZE 4XRJA 3TIZA 4BZOA 5I5ZA 4CG8A 3DCVA 5D41A 1Z57A 2JKKA 3WIKA 5FDPA 5EYMA 1YHWA 1Q8UA 2F2UA 5LWNA 3V5WA 3T3UA 3DJ5A 3IO7A 3FL5A 3ZLSA 2R3GA 4WIHA 5FEQA 3TJCA 4BGHA 4QMMA 3RM6A 4ARKA 3JY0A 4FSTA 3FZPA 3O8PA 2P2IA 4BWXA 3PP1A 4YZNA 5AP6A 1PW2A 2ACXA 5I9WA 5I9VA 2E9VA 4YPDA 4BCNA 3GENA 5JGBA 4TL0A 2P2HA 5EKNA 2JKOA 4BCKA 4V0GB 3THBA 5AR2A 3WI6A 2QOLA 2ITNA 2WD1A 4PPBA 3RKBA 4BI1A 3SXSA 3OHTA 2VO7A 3AD4A 3DLSA 2QU5A 3LMGA 4E6DA 1YOLA 3RWPA 4PL3A 1BL6A 5HZNA 2UZNA 2YEXA 2QOOA 5CU4A 2JLDA 1WBVA 3ORLA 2BKKA 4C33A 5CANA 3DBQA 5FBNC 3BQCA 1KSWA 4D9UA 3DV3A 1H07A 1OL2A 5LVLA 2VNYA 4H05A 2H8HA 2XJ1A 4IX6A 4R1VA 4WG3A 1WZYA 3RINA 3HAVA 2R3HA 3RNYA 4N57A 4QPSA 3HDMA 3JS2A 1JOWB 4DEDA 4Q9SA 4V04A 1ZY4A 4A9SA 5DGZA 5HU3A 3WE4A 3NUNA 4FT5A 3GCVA 1XH5A 3R9DA 3CC6A 5CSVA 5EOLA 2YZAA 3A7HA 3EOCA 3NX8A 4W9XA 4FKGA 4GUBA 2BPMA 3QQUA 4UWCA 3E3PA 5H3QA 2R0IA 4EOMA 3P9JA 3RPVA 1ZWSA 2YM3A 1OVEA 3R1SA 5CEPA 2HXLA 5EQEA 2YA9A 3FSKA 4IB5A 3TN8A 5CEOA 3ATSA 2BIYA 5FEDA 2ZV2A 3TZ7A 2I0VA 3UYTA 3LCDA 5T68A 3VHEA 4FKLA 2YM4A 3MYGA 4TRLA 4EOKA 2J9MA 2XS0A 1ZOEA 1V0PA 3H30A 3AGLA 3NYXA 4P4CA 5FGKA 4A4XA 3TUCA 3AC2A 1OBDA 1PMEA 4TWPA 2VTMA 3ZSIA 5I9ZA 2PMIA 3PUPA 5J9ZA 5EM7A 4L67A 4MD7E 3QLGA 3RALA 2OJJA 4NJ3A 3KULA 3F5XA 2XB7A 5JGAA 4OBOA 3EFWA 2W1EA 3OS3A 2W9FB 1PXJA 1Y91A 3CPCA 3R9OA 4ZS0A 2O64A 5AEPA 5FBOA 3IGOA 5H9BA 4FVQA 4C4EA 3OOGA 2ITYA 1OIQA 3BPRA 3MSSA 3ULIA 4BKYA 4K9YA 4XV9A 2ITTA 2CN5A 3NYOA 2C3IB 5JZNA 2IVTA 3MV5A 3OUKA 4RBLA 4GFMA 3QWKA 4GS6A 2NPQA 4F4PA 3UP7A 2FH9A 3R83A 4BDDA 3VIDA 5H8EA 4FMQA 1KOBA 4DFBA 2OKRA 4CYIA 4D4SA 3LE6A 3ZLYA 3GFEA 3LM0A 5TT7A 2RFSA 4FG7A 3V04A 3WZUA 4ANQA 4BB4A 4ZIMA 5BVFA 1GOLA 3UG1A 3E8NA 3LCOA 4TNBA 4L3PA 4QMWA 5HE1A 2W05A 2VTJA 3LOKA 4QP3A 1XH6A 2QC6A 3L8VA 4O6EA 3ODYX 2UW9A 1F0QA 4J8MA 4M67A 3CCNA 4L7SA 4QMQA 4NKSA 2W96B 4IC8A 4RFZA 5C9CA 4NWMA 4RC4A 3L9NA 3ZLXA 4KSQA 1CKJA 4WUAA 3RK9A 4E6QA 4WRSA 1B38A 1FGKA 2OZAA 3F3TA 3DBCA 2WMVA 3P23A 3VS4A 3A62A 4FKSA 5HG8A 4YP8A 2RL5A 1Q24A 4QYGA 3ZZEA 4KIPA 4MD9E 3G9NA 3GNIB 3MPMA 1H1PA 1KE9A 4JQ7A 4DT8A 5E8ZA 3NUYA 5TF9A 1MP8A 5IDPA 4AZEA 4ZS4A 1H28A 2WMTA 2GNFA 3C51A 2WNTA 4GIHA 4H1JA 4YBKA 4TWOA 1OUYA 1T46A 3GU4A 2PZIA 4FBXA 3GC7A 1XR1A 2ZYBA 5L2WA 4YURA 1QPJA 3LVPA 3RHXA 3ZSHA 2WHBA 2PVHA 4BTKA 4ANSA 3GBZA 2BRMA 4YSJA 3HRCA 4FTRA 3PZHA 2PSQA 4UEUA 5B2KA 5IA5A 3GI3A 3VS7A 3FI2A 4XEYA 2R64A 1SVHA 2AC5A 4G5JA 4S33A 5TE0A 2YJRA 2CSNA 2WU6A 4G6LA 3FBVA 4PPAA 3A99A 3T9TA 3NIZA 1QPCA 4QO9A 1Y57A 1RDQE 5J79A 3E3BX 3RMFA 5AR4A 5AV1A 3D2IA 4J8NA 2XIZA 4FSUA 2C0OA 2OGVA 1JPAA 1Q4LA 3OCTA 4QYYA 5CNOA 2R3MA 3I4BA 4L00A 4R5YA 4PMTA 3HYHA 4DBNA 4DFUA 3O8TA 4K33A 5ANEA 4OT5A 4FTJA 5M09A 5AX3A 5AFVA 3ORTA 4X3JA 2B0QA 3BYVA 3OTVA 4J53A 3UVQA 4KIQA 4HCVA 3Q6WA 4BC6A 4CFMA 4NEUA 3P7AA 1FVVA 2RKUA 4WOVA 3VUTA 4XMOA 5IZFA 3JUHA 2JITA 4DF3A 5EW9A 4FTLA 4RZWA 4EORA 3FKOA 3KEXA 3RZFA 3UJGA 3VBQA 3ZSGA 2OI4X 3BHHA 4KKHA 5HLNA 3R7EA 2YITA 4GJ2A 4EK4A 2C4GA 1F5QA 3P5KA 2EB3A 1M2RA 5CS6A 5M4UA 2BALA 3VRYA 4XV1A 4G9CA 3CPBA 4J7BA 1FVRA 1RW8A 2X9EA 4FKOA 2O3PA 3OOMA 3NAYA 3FHIA 4AF3A 3E64A 3RHKA 4FUYA 4ASZA 3Q6UA 2XEZA 1YDRE 3OWLA 3QD0A 3QF9A 3QZGA 2HK5A 3PG3A 3S3IA 4GL9A 2R3RA 3B2WA 2WQMA 4U3YA 4O82A 1ZOHA 1S9JA 4OTWA 5GIOE 5KMLA 2Y4IB 4HYHA 4PMSA 2SRCA 5BMSA 1VJYA 2VTNA 2R3IA 3OMVA 4U97A 5J87A 4EYMA 4QMNA 5HO7A 4F0FA 4X3FA 2ZMDA 4ZTRA 4IM2A 4GKHA 3I5ZA 2A4LA 3MJ1A 4D1SA 3HAMA 3UNZA 1SVEA 4F1TA 3W1FA 2VRXA 3IW4A 2BKZA 4EZ7A 5KMNA 2VX1A 4I5CA 5EDRA 3LQ3A 3IW7A 2Y9QA 3QCQA 3MBLA 3II5A 4MKCA 3LQ5A 4PV0A 5M06A 2E9NA 5J8IA 4ANLA 4J98A 3VUIA 2ETRA 3PJ8A 3Q04A 3OEFX 1PXPA 5AV4A 4IE9A 3HP5A 2ITWA 2ONLA 2WU7A 2XKDA 4FA2A 3E8DA 5J9YA 5AR8A 3Q4ZA 4QQTA 4NIFA 2C68A 4BFMA
chains in the Genus database with same CATH superfamily
1YI4A 3ZONA 4FF8A 5AIKA 3LMHA 1YWRA 2CPKE 4IEBA 1SNUA 4BDKA 2OJFE 1YXTA 1KV2A 4RJ7A 3RM7A 2QONA 1M7NA 1YXVA 2W5BA 3F3WA 3QQFA 1W83A 3FLSA 1IAJA 2CGWA 4FIHA 2XK9A 3N9XA 1G5SA 4TNDA 3SKCA 3TNPC 2F7ZE 3DPKA 3TTJA 1PMNA 2YDIA 3CKXA 3TM0A 3K54A 2C69A 4DLJA 5IKWA 3SG8A 4AZVA 5ETIA 4GEOA 3IPHA 4LV5A 4XUFA 2ZFYA 4ASDA 4GJ3A 4FV5A 4AZTA 5JQ8A 1OM1A 3P1AA 3ZCLA 3RJCA 2BZKB 2GS2A 4X2NA 4DAWA 4DH7A 1QL6A 3FQSA 5AIRA 4HVSA 5HTIA 4NM7A 4BZNA 3NNUA 2I0EA 3VBVA 3TKIA 3OW3A 4GFGA 4EI4A 1W2FA 5HBJA 2QG5A 4WA9A 5HOAA 3MB6A 4CTBA 1VYZA 4EHGA 5AA9A 4I6BA 3OXTA 1JKKA 4C57A 3QTIA 4IM3A 4DYMA 3NYNA 4QMUA 3QUPA 4PNKA 2YM5A 3LXLA 2R3PA 2YIYA 2WOTA 2G15A 3ETAA 4IW0A 4N70A 4DEGA 4J99A 2I0YA 4EJ7A 4I93A 5I9XA 4PL5A 3TZ9A 2OIQA 5CU6A 4RVTA 2EVAA 5CEQA 3FYKX 4MK0A 1Z9XA 2YACA 2C3LA 2X6EA 4CFUA 5HQ0A 2OU7A 4DGGA 2Z2WA 4A07A 3E8CA 2VWYA 4BKZA 3OWPA 2PVRA 3RI1A 5HCXA 3ZZWA 2YFXA 4DT9A 4AE6A 4U43A 5IEYA 3R00A 1JKTA 3EWHA 4WNOA 4ZTSA 5L4QA 1H08A 2J4ZA 1IEPA 4BJJA 3R1QA 4AQCA 1R78A 3FMJA 3LXNA 3BHTA 5FWKK 1Q62A 3ZRLA 5C8KA 2QLQA 5ANOA 4DBXA 3EQBA 4L42A 5B2LA 5KHXA 4BCGA 4EK8A 5IUIA 4QMYA 4BY9E 1NY3A 5E8YA 2DYLA 4AGUA 2G9XA 2QHNA 2VTTA 2WELA 2YAKA 4HNFA 3SOAA 4FOCA 4O0YA 4RIYA 4X3FC 3HV4A 5EW8A 3Q52A 4TYEA 1K3AA 5IA3A 1G8KA 3SAYA 4QP7A 4YC6A 4TYJA 5AP1A 3TCPA 4D58A 2IZUA 2VX3A 3FKLA 2E2BA 2OK1A 1FVTA 2PZRA 4RIXA 3QBNA 5AUXA 4DEBA 5AP4A 1H0VA 3EHAA 4A4LA 2ITPA 4FSWA 4YJQA 2IPXA 5DT0A 3R9NA 4YZ9A 2HAKA 2XNEA 3BI6A 4NU1A 3W2RA 3GFWA 4R77A 2Z7RA 4EOQA 1JSVA 2VTRA 1VR2A 2A27A 2Z7SA 2QI8A 3UC3A 4O7VA 4O7WA 2ZJWA 2RSVA 4GVAA 4PQNA 2XYUA 3I5NA 2O8YA 3O23A 4K0YA 4FKRA 1URCA 4JDKA 3PP0A 4GT3A 4IWDA 4C62A 2I40A 3R71A 3MFTA 3NFGB 1H00A 4O7LA 2YCRA 5DH3A 5HORA 4DEHA 3QZHA 5IQDA 3BBTB 1BMKA 2JGZA 3CP9A 5T6KA 3EN9A 4EOOA 5I9UA 3MVJA 3O71A 4ITHA 3UDBA 4AT4A 4KWPA 4FIGA 4QP9A 4DGNA 4G3DA 4K6ZA 3UYSA 3MVHA 2C5NA 2PZ5A 3WARA 5DI1A 4AE9A 4FV7A 5EM6A 2W5AA 4MQ2A 4KS8A 2QHMA 3ORMA 2C0TA 4O4CA 2WTJA 2JFMA 2RFNA 3OZ6A 2WXVA 5M4FA 2R7IA 4PTEA 4M69A 2QD9A 5DR9A 3TV7A 5AP7A 1U54A 1IASA 5GZ9A 4RPVA 3KMWA 1ZY5A 3VRZA 4IAKA 2X7GA 3DKCA 4Y83A 4CSVA 2HIWA 3PJ2A 4FR4A 5JFSA 3DAJA 4ALUA 2PVKA 4EC8A 4KIKA 4IVBA 5CYIA 5FRIA 4G6NA 3BIZA 2RF9A 1GIHA 2JAVA 1XKKA 3DY7A 4USEA 3FI4A 5CVFA 4L6QA 5I0BA 4O7NA 4FSZA 4R78A 3DB8A 4F1OA 3HUCA 1XJDA 4KABA 5C8NA 2XBJA 3GCPA 3VW8A 4F7LA 5BUJA 3K3IA 4RVLA 2ITVA 4DCEA 3NUUA 4DHIB 5CSXA 3IKAA 4C4GA 2O65A 2QNJA 4O38A 2PE2A 5JFWA 4MBJA 4OAUC 5TOZA 3TXOA 4MF0A 2E9OA 3C4EA 3OG7A 5M51A 4AGWA 3H0ZA 4RFMA 4DN5A 1CSNA 5CWZA 2YERA 3ZEPA 4C8BA 5L6PA 2WAJA 2H6DA 3IONA 4MNEA 3HL7A 3CY2A 3EQFA 3HZTA 3MTLA 1P4FA 4TN6A 4CXAA 3LKMA 3CJGA 2IZRA 3KXHA 1WFCA 4EWHA 4L44A 4EQCA 4HGLA 5FXQA 3CTHA 4I41A 2PULA 1CMKE 3VONA 4D1ZA 4FSRA 4MVFA 4P5QA 3UBDA 3VQUA 1TKIA 4LMUA 4QMTA 5C26A 5KKRB 4C58A 2GNIA 2R3NA 2PUIA 1MUOA 2GNJA 4IWPA 4CKIA 3MWUA 4YTFA 2ETMA 3ZLWA 3BL9A 3HECA 4DG0E 5ANDA 2Q0NA 1BI7A 3O7LD 2C6MA 4H3QA 3QRJA 4O2ZA 3JR1A 3RAKA 4JDIA 2VX0A 3C9WA 3I1AA 3ZO4A 4C61A 2C1AA 3DXQA 1OITA 3NMUF 4KS7A 5HLPA 1YHVA 3V5LA 4CZYB 4RWJA 3N51A 3SA0A 4EC9A 1KUTA 2OXYA 3DDQA 3KRJA 4G6OA 4I0SA 1QPDA 2Z60A 1LR4A 3EL7A 2QOHA 1PXLA 4X2FA 1OZ1A 3UVRA 4O83A 5EQPA 2JBOA 4C3RA 4ORKA 5FM3A 4RC3A 3O2MA 4E26A 1A06A 2I1MA 1DAWA 4FV8A 1I09A 4G3EA 4RFYA 4BIDA 3D7TB 1YWNA 4RVKA 3FLYA 4BCHA 3CR0A 5HICA 4XOZA 3RCJA 4PX6A 1GJOA 4XG3A 4FKIA 4YZCA 3TG1A 4BWKA 4MXZA 3ALOA 4AAAA 3EL8A 2UZEA 1PF8A 2YCQA 3QKLA 3FC1X 4L68A 2Y4PA 2JDTA 4IX4A 5HESA 2XMYA 4D2SA 4K8AA 1Y8GA 5AJQA 2OXDA 4D28A 3PLAE 5L2TA 5DLSA 4ZTLA 1OUKA 4QOXA 1WAKA 1OKZA 5G6VA 2ZVAA 5GJGA 5IA0A 5ETCA 1KV1A 4TPTA 3UQGA 5K5XA 4XV2A 4MXXA 3UMXA 4WG4A 4Y5QA 3DQWA 3RNIA 3U6HA 2JBPA 5ACKA 3DXPA 4O6LA 1ZOGA 3E62A 3BEGA 3DJ7A 3QQGA 3RGFA 4F9CA 4FZ6A 2QR7A 4W8EA 5HX6A 2CNQA 4EZ5A 3G33A 4FG9A 4X21A 4EYJA 3PG1A 4PP9A 5CI7A 4IWOA 5HNBA 3EKNA 4FL1A 2FSLX 3GC0A 1TQIA 3DNEA 1NVRA 1P14A 3ORIA 3VUDA 3TV6A 5HBHA 1PMVA 1XO2B 2X8EA 4ZEGA 1UKHA 4I92A 4XBUA 3A61A 5FLFA 3QKKA 2X9FA 3R73A 4TKSA 3JYAA 1Q61A 1YI3A 3A7GA 5HVJA 4LRMA 4PL4A 3QCXA 3MPTA 3NNVA 2P33A 4RWKA 4YLLA 3AKJA 4XOYA 5DT3A 1B39A 5K4JA 4R7BA 2BROA 1IA8A 3KMUA 3Q3BA 5JQ5A 4V01A 5FP6A 3I7BA 4IAZA 3ZH8A 1MRYA 5JK3A 1STCE 4RMZA 4NYEA 4JBOA 4A06A 4Q2AA 3ZM4A 5AAGA 5M08A 2IVVA 4Z9LA 3ZXTA 4RX9A 4DH8A 5EI8A 3MESA 3DNDA 3FC2A 3PDTA 4AU8A 5LCJA 1FPUA 3BWFA 4FNXA 3W32A 2UVYA 5DOSA 3UDZA 5HE3A 2QO2A 4CLIA 5GHVA 2ITZA 1SMHA 3BKBA 4IMYA 4LGGA 3OT3A 4BI2A 4D2VA 3FE3A 3FMHA 4Z7HA 2W17A 4I0TA 5H2UA 1E1XA 4ZTMA 3ORXA 1ZYDA 3O0GA 4ACGA 4ZZNA 2UZDA 4PWNA 5AP2A 3UO4A 4JMQA 4GUEA 1REKA 2BVAA 5AP3A 3ZFYA 3BYUA 2VGOA 5L2IA 4AGDA 4BHZA 5CY3A 2ONLC 4GFOA 3I79A 4D55A 2YCSA 2UZWE 1WBNA 4QNAA 1DI8A 5LVNA 2Z7QA 2JDSA 4UMRA 4O7ZA 5FQDC 4DEEA 4BR3A 4CRSA 5CSWA 3COKA 5IUHA 4QYFA 3TUBA 3CGFA 4XV3A 4AN2A 2VGPA 3PRFA 4NM5A 2AQXA 4XNEA 3V3VA 2PVLA 2YZLA 4NK9A 5BX0A 3MH3A 4CVAA 3U4WA 4PTCA 5EDQA 3KREA 4A9TA 5AUZA 3HV6A 3PSDA 4M84A 3TV4A 4E4LA 4ID7A 2QVSE 4BCFA 1U59A 3CLYA 4E1ZA 3P5JC 3D15A 2EXCX 2W99B 2B53A 2IWIA 2GMXA 4L43A 4JQ8A 5CT7A 4FV3A 5D7AA 5HTBA 3B8RA 3LW0A 3IS5A 2CGVA 2OFUA 3QHRA 1PKGA 2JIIA 3TMOA 2HZNA 1ZXEA 2YM8A 3H10A 1CKIA 1UA2A 1X8BA 2UW8A 4AG8A 4B6LA 4FT3A 1H25A 3D2KA 4ANOA 1GZ8A 2JD5A 2VTQA 3V5TA 3C13A 5HLWA 4O7SA 3H4JA 4M69B 5TR6A 3ORZA 4ACHA 5ACBC 4AAYA 4RIOA 3A4PA 3OUNB 2JKQA 2WIHA 5HTCA 5E92A 5C8MA 5IQEA 5AR7A 2X81A 4M0YA 4YGAA 4E8AA 4B99A 4ZSJA 3LLTA 4IQ6A 4JIKA 5AX9A 5KZIA 4IAAA 3IW5A 5DHJA 4F08A 1REJA 3LHJA 4P2KA 4O7TA 2BHEA 4QQCA 1IAHA 1WVYA 3ML1A 3V01A 1IRKA 4KRCA 3PVWA 5FTGA 4R3CA 2P0CA 3LJ0A 5AUVA 3Q32A 1Q8YA 4BDJA 5BUIA 4CLJA 3AOXA 3DXNA 4FRFA 4KBCA 1RQQA 3EB0A 4P5ZA 5KMKA 4QTAA 3N4VA 3R04A 5IA1A 1XHAA 2J51A 4TYGA 1NW1A 5A4QA 2XAMA 2C0IA 3JY9A 2G2FA 5F95A 1W98A 5EM8A 4FNYA 2DQ7X 2XF0A 4D4YA 3F66A 4BDAA 3D7ZA 4C0TA 4NL0A 3L8PA 2C6OA 2LGCA 4GU6A 3V6SA 4JVGA 2J0MB 4U42A 4AUAA 2HENA 2ZAZA 4IZAA 3ZUTA 3C7QA 3EFKA 3NUPA 3VBWA 2PUNA 3OTUA 4O1PA 4TWCA 3HA8A 2OSCA 1Y6BA 3QC4A 5AM6A 5M4CA 3P78A 3S0OA 1IA9A 5K0XA 4O91A 4L45A 5J7HA 1Q5KA 2NO3A 3TUDA 2Y0AA 2YCFA 4FODA 3I81A 4GK2A 2Y7JA 1PXIA 3NNXA 3PSBA 3KU2A 4FTTA 4CG9A 3O50A 3QQHA 2OLCA 5DBXA 3QAME 1HOWA 4XG9A 1ERKA 4DC2A 1KE6A 2AEGA 1Q41A 5DA3A 4FTNA 3PSCA 4QP1A 4ZLOA 3MPAA 4OAVB 1XQZA 4I0RA 5M56A 4JBPA 4CV9A 3W2QA 2QOQA 4R7IA 4B9DA 3QTXA 5LMKA 3PA4A 3QA8A 4G1WA 4I3ZA 2GHMA 2UZLA 3RZBA 5CAVA 4I94A 1UNHA 4JAIA 2ETKA 4JNWA 4BKJA 4BHNA 4YO4A 1M17A 5AP0A 5HE0A 5IF1A 4O7YA 3NWWA 4DGLC 5L3AA 4JIAA 2XBAA 5C4LA 4M3QA 4D4VA 2UVXA 4Y85A 2ZB1A 4AP7A 5CAUA 3NUAA 2R0UA 3EQHA 2WFYA 4O4EA 5AMNA 3QXOA 4EH3A 3OY3A 3ZFXA 3NW6A 4W9WA 3TI1A 3KN6A 4FNZA 3QC9A 1QMZA 2J7TA 2ZOQA 3GCSA 1OI9A 2CMWA 5F94A 1OIUA 2ITOA 1PYEA 5IQAA 1E9HA 1H27A 2F49A 3ZOSA 3GU7A 2ITUA 4FTKA 4M13A 5A4EA 4Z55A 3WZDA 2FA2A 4JG7A 3C1XA 4LQMA 3PJ3A 2IW8A 4YJUA 5E1SA 4IADA 1OBGA 1FQ1B 2R2PA 2VUWA 3D4QA 2YIWA 3NUXA 4I6FA 2C6LA 3Q2MA 5EYDA 3EQIA 2R3LA 3S00A 5K5NA 3WF8A 3D5WA 4F6UA 4IHPA 2PZYA 5C1QB 4UBAA 3NW5A 4Y8DA 4YNOA 5IG1A 2FB8A 3W0NA 4MCVA 4U8ZA 1YI6A 2I0HA 2UW7A 1NXKA 2VWUA 4R3RA 3FLQA 3JVSA 3QGWA 2XA4A 2QOIA 4G5PA 4WNKA 3TTIA 2G2HA 2RGPA 1OL1A 3WYXA 3M11A 3AGMA 4EEVA 5J1VA 3R21A 4EL9A 3R6XA 2OJGA 4PDSA 1UU3A 3LXPA 3Q4CA 4UWYA 2WTKB 3MH1A 4WRGA 4F0IA 4FEVA 4YLJA 1XH9A 3KQ7A 2A0CX 3IW6A 3OC1A 4R8QA 3OWJA 5CF6A 3ZM9A 4LRJA 5L2SA 4UZDA 4IVAA 3TACA 4JJRA 3U87A 3WF7A 4BZDA 4RT7A 4DDIA 4MX9A 2YIRA 3L8XA 2XRUA 4BDIA 3KL8A 3WZKA 4E4NA 4RLKA 3WILA 3QTRA 2BMCA 2ESMA 2XK4A 3KY2A 1WBTA 1H4LA 3DKGA 1FBNA 4DEIA 4JR7A 4Q5EA 3P79A 1UNGA 2BCJA 3OROA 2WZJA 3A2CA 3PTGA 4O7RA 3Q4UA 2QOFA 3PY1A 5GZAA 2PMNX 2Z8CA 2WMUA 4MQ1A 4AT3A 4EOJA 4DCAA 4LGDA 3D83A 3U8WA 4AOIA 3C50A 3DOGA 3ZO2A 2BZJA 1Q8WA 3DBFA 3HUBA 4FOBA 5AUWA 3SRVB 4AS0A 4F9YA 2GHGA 2VTLA 3F3UA 3QU0A 4PNIA 5HIDA 4A9RA 3D5VA 5HU9A 3HMPA 2VD5A 2VNWA 4MWIA 3NVMB 3F7WA 4QPMA 4GU9A 2C6IA 3VUMA 1O9UA 4FKUA 3HGKA 3PIYA 3UODA 1A9UA 4CNHA 5AADA 1LEWA 4RGJA 4U80A 2BAQA 2XP2A 1OPJA 4TT7A 4RA4A 1GZOA 2C5OA 2JFLA 1Q97A 4FVPA 5L8KA 4X2KA 3BL7A 3RPYA 3U9NA 3F61A 1ZAOA 3H3CA 5CLPA 3W2SA 3BWJA 1KE7A 3COHA 2PVNA 4ACCA 3A4OX 4O0WA 5ITAA 2OF2A 3HP2A 3EH9A 4O86A 4WNMA 1W82A 5DR6A 5HI2A 5EI6A 4RLLA 3OCBA 4F63A 3MA3A 3VULA 4QMOA 3DFCB 3BLHA 3VUKA 2VV9A 3FZRA 5G1XA 1WBWA 3LPBA 4F70A 5CF4A 5KNJA 5IQBA 3BBWA 3FI3A 5FP5A 3I0OA 2ZM1A 4E4XA 3ET7A 3UIMA 3PA3A 4ALVA 1SZMA 5HE2A 4IIRA 1DM2A 3GP0A 2XUUA 3HX4A 4XJ0A 4LL5A 4IX5A 1W7HA 4W4XA 4DH1A 2BFXA 2CCHA 4FTAA 3TZ8A 2JAMA 3L1SA 4F9BA 3FWQA 4EKLA 3MFUA 3R63A 1GZNA 4IC7A 2HW7A 3MA6A 3BGQA 4YC8A 4LUEA 5D10A 4YHJA 4CEGA 4D1XA 3EQDA 3PY3A 4FTMA 4ZJIA 3ZEWA 4DHFA 1U4DA 1W8CA 4RWIA 3POOA 5BVOA 3G9LX 4YJSA 2UW6A 5GJFA 5JKGA 4X2JA 1YXUA 3SW4A 2J6MA 4M68A 4D5KA 2IJMA 4O84A 1KWPA 3Q53A 1JKLA 3L9LA 3F2NA 2XNGA 4AW5A 3BX5A 2OW3A 4FV0A 3HDNA 4ZK5A 4E5WA 2CGUA 5HO6A 2IVUA 2WMBA 3R9HA 2B55A 4MUQA 4FSQA 1OGYA 4GKIA 3ZMMA 5HG5A 3ATTA 3RAHA 3W0MA 3KVXA 1CTPE 3C4ZA 3GUBA 4PDYA 4IX3A 3I0QA 4CFFA 4F9AA 3GB2A 2V55A 4UWBA 4U9AA 4XG4A 1M2PA 2VWVA 3IECA 5CENA 4YR8A 4QTEA 3EIDA 5DT4A 1UWJA 1AGWA 2GNHA 3KGAA 1Y6AA 2QKRA 2UW3A 3LFDA 4A7CA 4CMOA 4FTCA 3Q9XA 2XK8A 2CKQA 3FV8A 5HHWA 4KNBA 4J97A 3JVRA 3BLQA 3FSFA 2IW9A 2VO6A 5FM2A 4EOPA 4CD0A 5DWRA 5IH5A 1YOMA 2CHLA 2EUFB 3EYHA 3FUPA 3Q5ZA 5KMJA 3QRKA 5BNJA 4DE4A 1KOAA 3VS1A 3LQ8A 4NCTA 2B9FA 4Y5HA 3TZMA 1R39A 2JKMA 5IQGA 4YJTA 3VS3A 5BPYA 4MXYA 3T8OA 5JN2A 4HYUA 3UPXA 3MFSA 3QLFA 4BYJA 2VZ6A 3KRLA 4F99A 3U6IA 4OTDA 2V7AA 4YJPA 3NVKI 4DTBA 4OTQA 5A4CA 4BCMA 3R9RA 4IBMA 5LARA 2GTNA 3NCZA 4LDTA 2YDJA 3BEAA 4G34A 5CXZA 2F7EE 3FKNA 4USDA 5HD4A 3B8QA 4FYNA 1TQPA 4G31A 1OECA 2DUVA 2X1NA 4WG5A 4XP3A 1M52A 4JX3A 5EK7A 3AMBA 3R1YA 1PYXA 2C5XA 2C5VA 4G17A 5KMMA 4NSTA 5LWMA 4EZ3A 1CDKA 3F69A 4ANMA 4CFWA 4CRLA 4HGEA 1H26A 2JC6A 4QMSA 2EWAA 5F20A 1O6LA 3GQLA 4AQKA 3LJ1A 1IG1A 5LMKC 3LIJA 3PFQA 3ENHA 4BCQA 3LCKA 3EN6A 3R7UA 2F2CB 2HZIA 1R0EA 4CMUA 5IMEA 4I21A 2Z02A 4FKVA 3G51A 2W4JA 4PPCA 4ZAUA 1FGIA 4I5MA 3SDJA 2XM9A 3BHUA 3OFMA 4YTHA 3RVGA 4QP8A 4E73A 4OTRA 4C4FA 1J1CA 3I7CA 4GCJA 2W4KA 4HZRA 4QYHA 5IQIA 2C30A 4S32A 3BYOA 2GU8A 3WF6A 1Q8ZA 1ZRZA 4NT4A 4X2GA 1MRUA 3UVPA 5EYCA 3REPA 4RX7A 5KHWA 2GTMA 1JQHA 4CZUA 4YJNA 2FSTX 2QOBA 5LOHA 3W0OA 4OTIA 1OL6A 2UZOA 4DH5A 2HW6A 5HBEA 2G01A 2XNPA 3LFBA 5EH0A 4F7JA 4CT1A 2R3QA 4DG3E 3CY3A 4E93A 3TDWA 3H9OA 4C38A 2YM6A 3KA0A 4YJRA 2WQBA 3C4CA 4ZTHA 5L2QA 1V0OA 1L3RE 2X6DA 2VWIA 5D11A 3A7JA 4BDCA 4OW8A 2YHVA 2HWOA 3FY0A 2XIXA 2E9UA 2Z7LA 5CNNA 3MJ2A 4FKJA 5DRDA 3ACKA 3VUHA 4A4OA 2CCIA 2ZDUA 3GT8A 1GAGA 4JS8A 3ACJA 4KD1A 4NFNA 5A6NA 3UDTA 2R4BA 3OW4A 3JPVA 3QD3A 4ZOGA 4KKEA 4C59A 4E7WA 4WNPA 3KN5A 5CAPA 4EONA 5J9LA 2CKOA 4ANBA 4C7TA 4UXQA 3S95A 1BKXA 2G2IA 1MQBA 3F5PA 4I24A 3ZHPC 2FVDA 3FQEA 5FDXA 4XG6A 1CM8A 3QQLA 4O0SA 4G16A 4ZZOA 1J7LA 4C4JA 2PY3A 4MNEB 2ZMCA 2QOKA 4O22A 3ZDIA 4BDEA 2XM8A 3U51A 4ZZMA 4EK3A 5DYJA 3UZPA 1ZZ2A 3LFEA 3VJOA 2OF4A 5CXHA 2WEVA 4RIYB 5AP5A 1ZYLA 2GHLA 2I6LA 3AMYA 1W0XC 4ERKA 4BCJA 1G8AA 3MVMA 4N4SA 2YABA 3TWJA 3F6XA 4QMPA 2BRBA 4HPUE 4FZ7A 4QTBA 4BCIA 5IU2A 3P08A 5D12A 3JXWA 1H1SA 3GCUA 3NIEA 3QYZA 4YJVA 4MXCA 5IPJA 3V8SA 3FPMA 2DS1A 4S30A 5HG7A 3QD4A 5LMBA 2F4JA 5LVPA 3WIGA 3R8LA 3DK6A 4YZBA 1ZARA 3PZEA 4WKQA 3S2PA 2R7BA 2PL0A 2W7XA 4FNWA 1OKYA 3EQGA 4R5SA 3U4UA 3UIBA 3ELJA 5HNGA 2XK6A 4IDVA 2B9JA 4F6WA 2ZV7A 2YISA 4HVHA 2X7FA 5J7BA 2X0QA 4BVUA 4KIKB 5HX8A 4I5HA 4WO5A 2W0JA 4RSSA 1OIRA 3O17A 5M07A 3IDBA 3FZSA 2WTDA 1GIJA 3EMGA 4I5PA 5DMZA 5GNKA 4C2VA 2XJ2A 4OLIA 5ANIA 5M53A 4I6HA 1U54B 2J0JA 2PWLA 2VTHA 2X39A 5CZIA 5EW3A 3UIXA 3EZRA 2VN9A 3A60A 5AV3A 3FYJX 3R2BA 3AC8A 2C47A 4BL1A 2O0UA 5IQHA 4FV4A 4PY1A 3E63A 4AZWA 5IUGA 2JIVA 1R0PA 3QCYA 5C27A 1ATPE 4IJPA 3VBXA 3U54A 5AUYA 3R8UA 5BMMA 2BTRA 4HGSA 3W0RA 2W1IA 2QU6A 2Y6OA 3ZRMA 5L8LA 2ITXA 4YLKA 4BTFA 3LAUA 4BDHA 5HIBA 1NA7A 2WIPA 3GEQA 5IA4A 3ANQA 2BR1A 3ROCA 3NSZA 4BF2A 5BVEA 2J0LA 2QO7A 3MFRA 4FX3A 2H34A 4C34A 5B2MA 5LVOA 3TJDA 4BWPA 2JIUA 3O96A 3FY2A 4WBOA 1RE8A 2VTIA 4GK3A 2KTYA 1UVRA 5EYKA 3IOPA 2X4ZA 4L9IA 4BIBA 4KUJA 4CGAA 4M14A 4OT6A 5AAFA 3SXFA 3PVUA 2H96A 3UZRA 1HCKA 3UOHA 4XS2A 3AG9A 3MS9A 4ENXA 2X8DA 5CSHA 2X4FA 4EBVA 4O27B 4YO6A 2WTWA 1WVXA 4BN1A 4JDHA 3DK7A 2Y4IC 4ZP5A 1Z5MA 3ZS5A 2XCHA 4K18A 4NW6A 4YUQA 2J0KA 3OT8A 3LFFA 4FZFB 4KINA 3NYVA 5HIEA 3FXZA 3G0EA 3KRXA 4FG8A 4PDOA 4BIEA 3FMMA 3F2AA 2WMSA 2WMAA 3ZBFA 2PZPA 4K2RA 3QWJA 2A19B 1G8SA 3SW7A 5EDPA 3RTPA 2HWPA 4FV6A 4M12A 4B4LA 3EFLA 4QP2A 3GXLA 4O96A 4WD5A 3HMNA 4WHZA 4C3PA 4C4IA 3U9CA 3BRBA 3ODZX 1PRYA 3ANRA 3G90X 4YJOA 4B7TA 3CE3A 4QQJA 2F7XE 4GVJA 4CQGA 4ACDA 4L01A 4LOQA 3DTWA 3I6UA 5AWMA 4MEDA 4YC3A 4AFJA 4RC2A 4AGCA 4I4EA 5FTOA 2CNUA 5H8BA 3KB7A 3L9MA 1G8JA 4PUZA 2OWBA 4KRDA 5ETFA 1JSUA 4M15A 2PUPA 2XCKA 3G15A 5IQFA 3FI8A 5AUTA 4JLCA 4NTTA 1OIYA 2NRUA 4D2TA 3NUSA 2IW6A 4JG6A 3WE8A 3PRIA 3MY1A 3C4FA 5KBRA 1PJKA 3PXKA 4BDFA 1H1QA 4E6AA 4H3PA 4GK4A 4ANNA 5E90A 2CLQA 2WTVA 4CFXA 4JL9A 5EM5A 5KKRC 2CDZA 3LFNA 4OR5A 4IXPA 3R7OA 3UNKA 5BVWA 5JH6A 3HLLA 2XIKA 2WO6A 4CCBA 2ZB0A 4BGGA 4HPTE 4AXEA 1U46A 2X0GA 2HYYA 5BV3A 3C4WA 4RG0A 4F0GA 4KSPA 2PE0A 3OXZA 5EHOA 2WMWA 2FGIA 4Z16A 4HVDA 1R3CA 3M2WA 3PE2A 4HOKA 4C2WA 1BX6A 2C6TA 1JWHA 2ZV9A 2QKWB 5HCZA 3RP9A 3V5PA 4FKTA 4XX9A 2BRNA 3MH0A 2J2IB 2QODA 3P4KA 3QQJA 4X6QC 4D0WA 4AXCA 1LP4A 3C0GA 4QTCA 4ENYA 3W8LA 2IVSA 4D2RA 3UTOA 2HZ0A 4U40A 5CASA 4N6ZA 1YRPA 3UDSA 3QGYA 2FO0A 1G3NA 3CS9A 4JG8A 4QQ5A 4ITJA 3D94A 5LMAA 3VF9A 2C6DA 4GV1A 4EBWA 4LG4A 4UYAA 4U5JA 3ZUUA 4O2PA 3QD2B 4JT3A 3ROYA 4YMJA 2QURA 3DLZA 3KCKA 4UMTA 5KUPA 3UIUA 5I9YA 2O63A 3K2LA 3SQQA 2YWVA 3H9FA 4NZWB 4FKPA 4R3PA 3MW1A 4C3FA 5CF5A 3DK3A 4FL2A 4OTHA 1YW2A 5E91A