1W83A

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of novel p38alpha MAP kinase inhibitors using fragment-based lead generation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/inhibitor
total genus 109
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1w83A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1w83A01
4DG0E 4D55A 3P0MA 5FXSA 4I6BA 3LQ3A 4C58A 2VWXA 5M57A 1W98A 3DLZA 3R6XA 3GT8A 3C4EA 2WMBA 4OTHA 4FL1A 4BIBA 2QLUA 3ZONA 3IECA 4C35A 5IEXA 4O7SA 3EQPA 3R00A 1TVOA 4YU2A 4QRCA 3S3IA 3N51A 2OXYA 3O7LB 4QP4A 4BF2A 4FG8A 4HOKA 2WTDA 3PJ8A 2QNJA 4CV8A 2ZMDA 1WBVA 4F9BA 3SA0A 3GFEA 1FVTA 1XH4A 3RZBA 4Y73A 5F94A 5CU0A 3FYKX 2YACA 4AGDA 4Y46A 3PJ1A 5E8SA 3UZRA 3SW4A 3UZTA 4AG8A 5AX9A 1GY3A 4USDA 3F2NA 3MVHA 2OIQA 3CY3A 2O65A 3R63A 4FTQA 1V0PA 3FC1X 3EQCA 3IOKA 3A7IA 5IKWA 5DYJA 3HZTA 3H30A 2UW9A 3W8LA 2WMWA 4BDGA 3PWDA 3DTWA 4HYIA 2RFDA 4QQJA 5HD7A 2PZYA 4TNDA 3ROCA 3UDBA 3QBNA 4DT9A 3JS2A 4A9SA 2HY81 3DBEA 4BHNA 4CGAA 4X2JA 3KXHA 4AE6A 2WQMA 1TQIA 1XH8A 3PPZA 4UZDA 4CLJA 3R7GA 2RKUA 2UZVA 4E5AX 4NM3A 2DS1A 5AUYA 1UWJA 4XBUA 4U40A 5DR2A 3TI1A 2QU6A 4FF8A 2IZUA 4ZZMA 2W1HA 1YI6A 2WGJA 2V7OA 3RNIA 3KCKA 3ODZX 4FGBA 3ODYX 3KQ7A 2PVHA 3OS3A 3V8SA 4EWQA 3ZXTA 4EYJA 3F88A 4FX3A 5AR5A 4O7VA 2XH5A 1CSNA 3B8QA 3R1NA 4ANQA 3FMMA 1O6LA 4CTBA 3D9VA 3QTSA 3TG1A 2XK8A 3EFLA 3FUPA 3IS5A 2O64A 4IJ9A 1S9IA 1BKXA 5AP6A 4EOIA 2LAVA 4CKRA 3JY9A 3Q9WA 2CNVA 3DTCA 5CU2A 3VIDA 3MBLA 4DF3A 1OMWA 4WG5A 3LPBA 2QR8A 4GIIA 4YUQA 3NMUF 2OWBA 2CSNA 4WSYA 1YHWA 5IPJA 5D9HA 4RIXA 3P9JA 3MW1A 2PWLA 5HIBA 4AF3A 2W5BA 4QTDA 5GIPE 2PZIA 4XMOA 5D7VA 5AV2A 3FKNA 4H05A 1O6YA 3HP5A 5EDQA 3P79A 3BX5A 1OBDA 4YSMA 4FKWA 5C8NA 3OT3A 4FT0A 4Y72A 4HGLA 4Q9ZA 5I0BA 2PVLA 2B54A 2ZM3A 3COHA 3PSBA 4EOJA 2RFNA 3NYXA 1Y57A 4GYGA 2X39A 3DFAA 3JVSA 3ZM4A 3POZA 5HE3A 3HV7A 5CNNA 2XNNA 2WTWA 3MJ2A 1PXJA 4K9YA 3GB2A 2YWPA 4RFMA 4NW6A 4YJOA 2WO6A 3OW4A 3QD4A 1APME 3WYXA 3BIZA 2RFSA 2XJ0A 3JYAA 3MN3A 4O0WA 2IN6A 1KSWA 2P3GX 3EL7A 4QP9A 3KXNA 3R01A 2NPQA 3O8TA 1TQMA 3TIYA 4ACMA 4EBWA 3PZHA 1Q4LA 2UW7A 4G3CA 2BR1A 2QURA 4ALWA 1SM2A 3OW3A 4ZLOA 2PULA 3L8VA 5IQGA 4YNEA 3VUKA 4GYIA 4FTIA 3HRFA 2X8IA 2XYUA 3MS9A 4JJRA 4BGQA 2GSFA 3NS9A 5CQWA 5HX8A 1MQ4A 3EWHA 4RFYA 4YTCA 2J50A 3ZM9A 4L45A 5AA9A 4FV0A 3DGKA 4HVSA 1IASA 4KIKA 4QTBA 3FZPA 4RBLA 4XHKB 2R3KA 3TUDA 3TV6A 3H9OA 2R5TA 4JOAA 5CLPA 3CR0A 1VZOA 3SXSA 2OJGA 2HK5A 4FKVA 5C9CA 4ZAUA 4FE2A 2ESMA 2XIXA 3R1QA 5AR3A 2IZSA 2CN5A 1ZYCA 3DBQA 5FDXA 1CDKA 1REJA 1KOAA 2J0JA 4BKZA 3SAYA 4P2KA 1TQPA 4MNEB 4RVTA 4N6ZA 3KXXA 2C3IB 1JLUE 3MGYA 3PWYA 3G9NA 5A46A 2ONLA 3AC8A 4ZZOA 2VWZA 3TNWA 1NY3A 3LMGA 3HP2A 4TYJA 3V6RA 2PYWA 2GCDA 3CD8A 1OVEA 5FTOA 2OZAA 2OFVA 4F9YA 2J4ZA 5FLFA 3FKLA 5JH6A 5KMJA 4CZUA 1TKIA 1P4FA 2C3LA 2P2IA 4QPMA 5I5ZA 1YW2A 5TF9A 5E9EA 3IGOA 3ULZA 2BFXA 4JI9A 3E7VA 4JX7A 4MXAA 4YBKA 5M44A 4DLJA 3QXOA 3KRXA 1B39A 4TRLA 1Q3DA 5AV3A 2QLQA 3T9TA 3CBLA 3HMMA 1H0WA 1BMKA 1PXIA 3QQUA 4MCVA 3TL8A 3ZZWA 4F0FA 3QZHA 4NSTA 4PDPA 5DT0A 4N70A 4X2NA 3TV7A 2J7TA 1UNHA 2WZJA 2C5OA 3A7JA 4IJPA 3TKHA 1ZYJA 1U54A 4E7WA 5J87A 1L3RE 2JIIA 1Q3WA 2VTRA 4GFOA 4TN6A 5EM6A 5M09A 1U54B 4CQEA 4DTKA 2HZNA 3DV3A 3KMUA 5TO8A 1H0VA 4IW0A 4JXFA 3O96A 4JQ8A 4MXYA 1OBGA 2BTSA 2OJJA 4FR4A 4M12A 4AW1A 3LE6A 1V0BA 3RKBA 3SLSA 3LZBA 1WCCA 3O17A 5HE0A 5IA2A 2OO8X 3LQ5A 4ALUA 2QHNA 5B2MA 5HG5A 4TZRA 1PMUA 3Q9ZA 3KN6A 4NTTA 3UIUA 3CJGA 3TTIA 3UVRA 1NVRA 4HYUA 4G6LA 4D0WA 5B7VA 5C1QB 4M0YA 5DVRA 4E6AA 4UX9A 2ZDUA 3FJQE 3FPQA 2VTAA 3C9WA 4I24A 2C1AA 3OG7A 4NW5A 2QOIA 4RWIA 3D7ZA 5FD2A 4EOSA 5EKNA 4EK3A 1T45A 1PKGA 3QA0A 3ZH8A 3U55A 2ZJWA 4O7TA 3PRIA 4K11A 2NNWB 3PIZA 4XH6A 3U54A 4YTIA 1BL6A 2EVAA 3AMAA 3FZTA 3GVUA 1SVEA 5DEYA 1OKWA 4IZYA 5HTCA 4HVIA 4HPUE 5CVHA 3L8XA 2VTTA 3FKOA 2A2AA 3MV5A 4YO4A 3RK5A 4M0ZA 2QD9A 2R3MA 4ZSLA 3BHHA 2YIWA 2YM5A 4MBJA 3FLYA 4D2PA 3FAAA 5IA1A 4IAZA 4C3FA 3TM0A 4EI4A 3DQWA 5HO7A 1OL6A 2WOUA 4GU9A 3QX2A 5CSHA 4I23A 3ZSIA 1H1WA 5ITAA 2FSTX 5AAGA 4W8DA 5EYDA 5G6VA 3FE3A 4Q2AA 4CSVA 1PXKA 5TR6A 4PMSA 2ITXA 3A7GA 3MH3A 1JKKA 4I94A 1ZYDA 3FLQA 5CSXA 4QTEA 5I4NA 1OECA 3FI2A 3BYMA 5HOAA 3W16A 3LKMA 1PW2A 3ORXA 5HE1A 3N4TA 1Q97A 5CENA 4YJPA 3HGKA 3LXKA 4D4YA 4IWDA 1VYWA 4LUEA 3TNIA 4D2SA 3DDQA 3QC9A 4BVUA 2WMAA 4EH7A 3HEGA 3HRCA 4WRSA 4ZSJA 1H1QA 4FKRA 3W1FA 2GNGA 4YZDA 3BEAA 4I6FA 3N9XA 4D58A 3NUSA 4YJNA 3C4WA 4PWNA 3UC3A 4GT3A 3ENMA 3DQXA 4C8BA 2ITZA 4QQTA 5KBRA 1P14A 2W4KA 4U6RA 2EXMA 3CTHA 2X7FA 3GFWA 5DN3A 5A4CA 2GFCA 1OUKA 5CNOA 5C4LA 3E63A 3JPVA 1DI9A 3I7CA 4P5QA 5J5TA 3COKA 2BILB 4II5A 3QHWA 3GC0A 4Q5HA 3UYSA 4JRVA 3CTQA 4GS6A 1PMEA 4LOOA 3Q4TA 3LLAA 2WMVA 5CEIA 5M4FA 4O0XA 3QYWA 4K77A 2Z7QA 4YHJA 3TJDA 2A0CX 2FO0A 1NT2A 4Y95A 4DGMA 3D94A 4R1VA 3PRFA 5E8XA 2EB2A 2VTQA 1QPDA 2VD5A 3OUKA 2IW8A 4ACDA 4TYHA 1W7HA 3RCDA 4LRKA 3R7VA 4BBEA 3WZJA 4AGCA 5BUIA 2P2HA 5KHWA 1FBNA 4M97A 4HGSA 3QZIA 3R9DA 2PK9A 4RVKA 5DT4A 3I4BA 3S00A 4AACA 3RPSA 5IUHA 2PU8A 3EN4A 4O2ZA 3UC4A 4K6ZA 4FK3A 3KMWA 5AMNA 4AZTA 4QNYA 4X6RA 4D5KA 2X6EA 4IE9A 1QCFA 2IVVA 3UE4A 3VBQA 3O8PA 3R8MA 4JIKA 4AZVA 4CMOA 2OXDA 4FSZA 4JDKA 4BFMA 2J51A 3CKXA 4S2ZA 5L2WA 3HV3A 2HW7A 4ACCA 1PXPA 3Q9YA 4O81A 5A4TA 2B52A 2YJSA 4ITHA 5C27A 3BEGA 2VO3A 4FNYA 4AE9A 4MWHA 4ERWA 2XK4A 5L4QA 1E1XA 5CSWA 1CMKE 4MXZA 5FEEA 1IRKA 3UOKA 1UU8A 1O6KA 1XH5A 4F0GA 3VJNA 4G3EA 2CHLA 4RLKA 2KTYA 2WB8A 3ZUUA 4BTKA 3P4KA 3VN9A 4LRMA 2OJIA 3OEFX 4H3QA 2BDWA 3K2LA 1KE9A 5J8IA 4EC8A 4EK4A 4XLIA 3VS2A 4O6LA 2ZDTA 3F61A 4NKAA 5FP5A 2XKDA 3U9NA 3ZO4A 3LMIA 4TWCA 1OL5A 5K0XA 5DGZA 3ALOA 1FINA 4GCJA 2O0UA 2WQOA 4D2WA 5FM2A 2XNMA 4BCIA 4FV2A 5HIEA 3EH9A 3ZU7A 2GS2A 4EYMA 4O82A 4B8MA 4DC2A 1PF8A 3R28A 5CI7A 4RA4A 4BZNA 3ORMA 3OCGA 2BPMA 3UMWA 2WTJA 3PYYA 4E20A 5F9EA 3K3JA 2B9FA 3RAWA 1JWHA 2C6EA 1KV2A 2PUUA 4M66A 1DM2A 1H25A 1PXOA 4YSJA 1PXNA 2ETRA 3MWUA 4HCVA 3B2TA 5GINE 1XBBA 3CQEA 4LI5A 4QOXA 2VGPA 4O7YA 5HBJA 2G2HA 3RM7A 4LV5A 2RSVA 4IQ6A 3BBWA 4UXLA 4BIDA 3ZC5A 4R7HA 4ARKA 5DE2A 4KIQA 4DAWA 4IEBA 4FZ6A 5IH5A 1FGIA 5E8WA 2PVJA 2VAGA 2Z7RA 4UWYA 4EQCA 2X9FA 4C38A 4Y83A 3RVGA 3NNWA 3AQVA 3OD6X 3DK3A 4MKCA 3ZTXA 1PMNA 4IANA 3TCPA 3NUAA 2FUMA 3E8NA 4FIIA 3ORKA 3PUPA 4V04A 5EW9A 4R7BA 3C4ZA 3CTJA 4C0TA 1E9HA 1Q8TA 2BHEA 4B8LA 5HX6A 4H3BA 4NFNA 5BYZA 5AEPA 4EH3A 5BVFA 4BBMA 2BHHA 3GCSA 1IG1A 2IJMA 4G34A 4FGRA 3TZ7A 1VYZA 4F7LA 4LRJA 3EHAA 3IQ7A 3LHJA 3O8UA 4IACA 4MWIA 4DEDA 1JQHA 2BRGA 1QL6A 1J7IA 4ZZNA 2H8HA 4KKHA 5EQPA 3E8EA 3HUBA 4MXXA 5H8GA 4JBPA 4AOTA 4O0UA 4RWKA 3M2WA 3QD2B 2X9EA 3ORZA 1W83A 3E8DA 3UPZA 3MA6A 1CM8A 3DAJA 3KN5A 4NJDA 3CIKA 4FT3A 4KRDA 5KO1A 2YDIA 3I1AA 4EEVA 5E8UA 3SRVA 3CKWA 5IH4A 5K5XA 3KMMA 3QFVA 3IDCA 4O83A 3SRVB 1Z9XA 1W82A 3N4UA 1V1KA 4G5JA 4UALA 3GOKA 4L7FA 4DN5A 5CT0A 1ZZLA 2HOGA 2UZUE 3L8SA 2JD5A 3KK9A 4WRGA 5IQCA 4BCMA 4QYYA 5LMKC 3FI3A 3EJ1A 3F3TA 1OKVA 3A60A 4I22A 3RBWA 3DNEA 3BHVA 5HBEA 3GEQA 3IK3A 2JFLA 2V55A 3K54A 4MAOA 5KE0A 3DDPA 3R7IA 5BVNA 1MQBA 1FVRA 5AAFA 4EK8A 1YI3A 2PHKA 1UVRA 3VO3A 4K8AA 2OICA 4XP0A 4O7RA 3NVKI 5IMEA 3QYZA 2HXQA 3QKKA 4GK2A 3PE2A 4N57A 4RQKA 1OL7A 3HV6A 4QP2A 4AN3A 3SW7A 4AA5A 4FIJA 1IA8A 1LR4A 3N4VA 4IAAA 5J95A 2G1TA 3HMOA 4AXAA 3FMDA 3WZUA 5EQEA 2XA4A 2JDOA 3BHUA 3DLSA 2Z7SA 3UQGA 4JL9A 4QO9A 3ETAA 2JGZA 3SDJA 5FDPA 1XJDA 3JY0A 2CPKE 5TKDA 5JKGA 4GUBA 5AV0A 1P5EA 2R0IA 2UW0A 1ZY4A 4PUZA 5EM7A 4F09A 3DXPA 3OWPA 1K9AA 3Q2JA 4ZS0A 1FOTA 3E62A 1R78A 3ROYA 4JX3A 1S9JA 4QMMA 1BI8A 1YXUA 3VUGA 4JNWA 3CPBA 4D9TA 4Q5EA 3ZLSA 4OTIA 3FZRA 3IOPA 4NM5A 3MPMA 5HO8A 3PA4A 1ZY5A 4LL0A 4C7TA 3D0EA 3PJ2A 4MQ2A 3P1AA 2B7AA 5KMNA 5EYMA 2EB3A 2CCIA 5LMKA 4YJQA 3F5GA 3LVPA 4FSNA 5K5NA 3S1HA 2UW8A 2X8EA 1ZRZA 3PXQA 1M7NA 4CFVA 4XEYA 4ZLYA 2Z7LA 3NR9A 1H24A 4OT5A 2CKEA 4D2RA 2ITQA 4P7EA 4ZJIA 1X8BA 5CEQA 4EK5A 1Q61A 3QLGA 3R30A 3W55A 4BB4A 2AC5A 2CLXA 2YIYA 4ENYA 4ASZA 5D7AA 4AW2A 5LXMA 2R3OA 1M14A 5DPVA 2ZB1A 5TE0A 2BMCA 3FDNA 2BRBA 4JLCA 4QTAA 3PJ3A 4FBXA 5IEVA 3MYGA 4J8MA 2VTOA 2HXLA 4BZDA 5KMMA 4G2FA 2QOLA 4O7NA 2WIHA 3QLFA 3NYNA 4FTTA 4QYHA 2PVNA 4I5CA 3UGCA 4U81A 3AG9A 4S30A 1Q24A 2RF9A 4HCTA 1M17A 2XIZA 3FXWA 3WF9A 2YCFA 3O0GA 4FV3A 4APCA 2ZV9A 4EHZA 4ENXA 4MD7E 3L9LA 4HZRA 4U9AA 5LARA 4W4WA 2QO2A 2Y9QA 3R21A 4Y85A 5FEQA 4M13A 4D4RA 1CKPA 1REKA 4E5BA 3TWJA 3RINA 2UW6A 5CF4A 5GZAA 4FKOA 3I0QA 3S2PA 1Y6AA 5EHYA 5HE2A 4XLVA 2J2IB 3NNVA 3POOA 4HPTE 5KHXA 4KIPA 3UOHA 3CSVA 2YHVA 3QF9A 3QD3A 3W2RA 4RJ6A 5LQFA 3FEGA 2VUWA 2WMQA 1J7LA 5DRBA 5CSPA 4E73A 4O84A 3VS5A 1Y6BA 4EZ7A 4D9UA 3LCSA 4NH1A 4OUCA 4PTEA 2VTIA 3MH0A 5L8JA 4BI2A 3A7FA 3RJCA 2QCSA 3EFWA 2VX0A 3D2KA 3MFTA 4AW0A 5CASA 4X2GA 5CEOA 3MFSA 3KVXA 5AP1A 1HCKA 3R22A 4I5PA 3I7BA 5CQUA 5HLWA 4M69B 5HI2A 4EKKA 1ERKA 4D4VA 3W32A 1UU9A 4PMMA 3FMEA 5BYYA 3OEZA 5ANEA 5AV4A 3QRTA 5JZJA 4OW8A 1OL1A 3KRRA 3NAXA 3T3UA 3V5QA 3NUPA 3GCUA 4RIYA 2OGVA 2PZRA 3EQBA 4QMNA 4FV1A 4R5YA 4BRXA 4BYJA 4AX8A 3U6JA 4EWHA 3G6GA 4FZDB 1SNUA 5LMBA 4OAUC 1RW8A 3DAKA 1H00A 2NRUA 3BYUA 3VW6A 3VUIA 4R78A 3BELA 3PLAE 1K3AA 4OTGA 2OF4A 3OOGA 3DBCA 3DAEA 3HA6A 4LL5A 5FQDC 3R9OA 4QMWA 3TKUA 3BV2A 3EKNA 4GJ2A 4AQCA 4CYJA 3MY0A 4WNMA 3DOGA 3HV4A 4ZLZA 4I20A 5B0XA 4FEQA 2QOKA 1PXLA 1FPUA 4RX8A 2C6MA 3NUUA 4WT6A 4L53A 5L8LA 2ITWA 5GJGA 2HCKA 2GNJA 2F49A 3NUYA 4U97A 4FYOA 4EH2A 1BI7A 2O5KA 2UVZA 3A99A 5EYKA 3GC7A 5J9YA 3OFMA 4PL3A 5GZ9A 1YVJA 3F6XA 2R3GA 3BV3A 4PDSA 4WOVA 2C0TA 5JQ5A 3G0FA 2CNUA 2B1PA 4NZWB 2EUFB 2JIVA 2QHMA 3G9LX 5BVWA 4WKQA 3V5PA 2YLFA 5LMAA 4YJUA 3PSDA 2IZTA 2ITYA 5AV1A 5ETFA 5CU6A 4YNOA 5ACBC 4C33A 2WXVA 4YMJA 4JG6A 3NDMA 1OIQA 4X2FA 5AIKA 2PVMA 3RHKA 1SYKA 5CXZA 3C0HA 2QO9A 4RJ5A 3QTUA 3VW8A 3EQIA 2F9GA 2H9VA 4AZWA 3RAIA 5L3AA 5IQBA 2GTMA 3D5XA 3OF0A 4IAFA 3TJCA 4YLKA 5HIDA 3CQUA 3VBVA 4KBCA 4LGGA 4FODA 3NLBA 5DT3A 2VZ6A 3LFFA 2C68A 4C59A 3IDPA 3Q2MA 1MRVA 4E6CA 4EKLA 3H0YA 4JIAA 3WZKA 4O7ZA 3RK9A 3MB6A 2J5FA 4H1JA 3DB6A 3DKOA 4AFJA 3CGFA 3FQHA 4TWOA 4NU1A 4CXAA 4F70A 4I0TA 3FXZA 5L6OA 5L2IA 5E8TA 3MA3A 1RE8A 3GBZA 3QCQA 4J8NA 3UBDA 3UP2A 3ZOSA 4ANNA 5CXHA 4MBLA 4LM5A 5FWKK 2I40A 2XJ2A 4NL0A 4FTAA 4BWKA 1J1BA 4WHZA 2E2BA 2EU9A 3EN5A 5ANGA 2OIDA 2CLQA 2YM8A 3GC8A 4DH5A 3R9NA 3NRMA 5J9ZA 1EH4A 2VU3A 3OXIA 1IAHA 3DT1A 4AFEA 4IXPA 4XS2A 4CMTA 1YQJA 4I6HA 4X0MA 2HELA 5AP0A 2JDRA 1CKJA 1U5QA 4RIXB 4GV1A 5FGKA 4FKIA 5EW3A 4A9YA 2Y6MA 1B38A 2VWUA 4AT4A 5BVOA 3PIYA 2J0LA 4KNBA 5CWZA 5HNBA 3WIGA 5JEBA 4PMTA 4MXOA 4I0RA 3SG8A 3TT0A 5KZ0A 2ITPA 4RQVA 3RZFA 3VVHA 4EH6A 2A1AB 2FYSA 3QZFA 2BIKB 2HZ4A 3KGAA 5HVYA 4OTWA 2VNWA 3S4QA 4V0GA 5ANKA 5A9UA 3AGLA 3AT3A 4CCUA 1B6CB 4DINA 2ONLC 4L3LA 2JAVA 4IFCA 4BKYA 4V0GB 3Q5IA 1SZMA 4FTLA 4ZMFA 3ZO3A 3EN7A 1Q99A 1U5RA 3L9PA 5EI8A 3JUHA 4KINA 1YWRA 2GMXA 3IW8A 4YJRA 4E93A 5AFVA 3NWWA 3DK6A 1FVVA 1GJOA 3TDWA 3IKAA 3C5UA 4OBPA 1ZMUA 4V01A 3NEWA 5DFPA 5LVLA 4BI1A 5FM3A 2C69A 3A4PA 2X8DA 4DFZE 4PNKA 4GL9A 5EM5A 3AC5A 3WF5A 3UQCA 2EXCX 1LEWA 4J1RA 5BMSA 3F7WA 4BDKA 5M53A 4FVQA 1NW1A 3B8RA 1XWSA 3UIBA 3WARA 1ZXEA 5JFWA 1QPCA 4CD0A 3H10A 3M1SA 3FLNC 4IC8A 5HVKA 3LCKA 3OROA 1WFCA 3EYGA 4FIGA 1JSVA 4L52A 3OBJA 4DBNA 2W17A 3QAME 2CMWA 3GCVA 4GFMA 4ZTLA 4U0IA 4FL2A 4CTCA 4EH9A 1XQZA 2JDVA 1YXVA 2C3KA 1YXSA 2GS7A 3I81A 3U9CA 4G9CA 4D1SA 5IZFA 4I93A 3CY2A 4ANOA 3PY0A 1H4LA 3UJGA 3UVPA 2RG5A 3HX4A 5HESA 3PVBA 4KIKB 2UZWE 5TOZA 3R9RA 2XJ1A 4YZ9A 5E92A 3LJ2A 5HGIA 4USFA 4D28A 3VUMA 3F2RA 3BYOA 2YABA 3ET7A 2GQGA 4PL4A 3G0EA 4IBMA 2RL5A 2W1CA 4PTGA 4PPCA 3I60A 5JGAA 4IFGA 4WNPA 4IVDA 2CCHA 4DCAA 3H9FA 5KMKA 4JS8A 1GZNA 2H96A 3EN6A 4J97A 4QNAA 4RRVA 3SV0A 4BN1A 1BYGA 4QYEA 5DBXA 4L8MA 2R3JA 3ELJA 2NP8A 5B2KA 3LJ1A 3ZFXA 3LM5A 5CVFA 1W8CA 5A14A 2OZAB 4BTFA 4F08A 3DJ7A 1NVSA 3OC1A 3P7BA 2ITNA 3BGZA 3NNUA 2IZRA 3BHYA 3PXFA 3S0OA 1Q8WA 2XZSA 4BDFA 4C4IA 3DXQA 4NKSA 2P33A 4FSYA 4O7WA 1OIYA 4MD8E 4MNFA 3QL8A 1KE8A 3OCTA 4X2KA 1P4OA 4O6EA 2WIPA 3R9HA 5HU9A 2P4IA 2VWBA 3HRBA 3NSZA 4F6SA 4DBXA 5I3RA 3QALE 1ZAOA 5IQIA 3NW5A 4CT2A 2BAQA 2B9JA 3C13A 1FMOE 3UQFA 4Y5QA 1R0EA 2DWBA 3R8UA 2XEYA 3DXNA 3OWLA 3RI1A 3THBA 2I7QA 4A4OA 2UZNA 4LGDA 4JBVA 4U41A 4PL5A 3V01A 2FB8A 2PMOX 2Y8OA 2WMRA 3FMHA 2VN9A 3HECA 4U42A 2X4FA 3DU8A 4WG3A 4HW7A 4P5ZA 4PTCA 2ITTA 3OWKA 1VJYA 4O1OA 4E3CA 1YXTA 4NIFA 5B2LA 3F5PA 4AWIA 4DH1A 4EZ5A 3ZLXA 2VTHA 4UMUA 2ERZE 2XS0A 4NIFB 4YTHA 4KA3A 3UG2A 3NIZA 3KA0A 5JSMA 2XK9A 4MHAA 1QPEA 4FK6A 4XOYA 2ZB0A 5IF1A 4I4EA 4V05A 4L3PA 4MQ1A 4A9TA 2Y4IC 3NYVA 4APPA 4DITA 3MFUA 5D41A 4E8AA 4QMXA 1JPAA 2E9OA 2QO7A 4JAIA 3RHXA 4U8ZA 3R8PA 5BVKA 5HQ0A 3DY7A 4O96A 4CZTA 1A9UA 1ZARA 3O2MA 4FV7A 2C4GA 4IB3A 1U46A 5E4HA 1J91A 3F82A 2W9ZB 1Y91A 4MXCA 3TUBA 1G8SA 4AA0A 2OZOA 4C34A 3QX4A 3ACKA 2PTKA 4WNOA 4M68A 2YZLA 4R8QA 4CQGA 5LVNA 4CFWA 5D12A 4ZTNA 3RP9A 4FEUA 2BDJA 3NGAA 5KZIA 5CZHA 4GUEA 3VS0A 2PPQA 4IAIA 4W4XA 2QOQA 3KXZA 4FSQA 4TKSA 3VULA 1JKTA 3Q52A 3BU3A 2EWAA 3UMXA 1J7UA 4F9AA 3KCFA 3BYVA 3W2SA 1OM1A 2UZLA 3O51A 1I09A 5EHOA 3LFNA 4NFMA 2C5VA 3P23A 3H0ZA 3ZLYA 3OTVA 1AD5A 3OUNB 5CZIA 1Q8YA 3DZOA 3F3ZA 2GHMA 5CEKA 3HAVA 1H1SA 3DJ6A 2CDZA 3P86A 3W10A 4E6QA 5ETIA 4RVLA 2O8YA 5EH0A 4DEHA 5ETAA 3ZUTA 4L68A 1H28A 4YTFA 5EYCA 4U3ZA 4ZK5A 3QQHA 2Y4IB 4K1BA 4BCFA 1LEZA 1WBWA 3QTWA 4BBFA 4BCNA 4CRLA 3A2CA 3F3WA 1YKRA 3BQRA 3E5AA 4IX5A 4GK3A 3TKIA 1ZOGA 5J9LA 3BE2A 4B99A 2YM7A 2F7XE 5JGDA 5J1VA 1A06A 3BQCA 3DNDA 2R64A 4GVJA 2XNPA 4TYIA 5AUWA 3QC4A 2W1ZA 3M11A 5IISA 2PMIA 4FOBA 2BIYA 4IDTA 4IZ5A 4XG4A 3PG1A 5JFXA 3O7LD 4BC6A 5KX8A 4WUAA 3UNKA 3MSSA 2QOHA 4NT4A 4FVRA 5IU2A 4G6NA 2V7AA 2OSCA 3PIXA 4MF1A 3GU6A 1HCLA 3TZMA 4QP8A 5L2TA 4TYHB 5DRDA 2E9UA 4C4FA 1A48A 2I6LA 2HAKA 4GIHA 3C4CA 4U5JA 2UZTA 4C2WA 4R6VA 2IW6A 4J52A 2F4JA 1F5QA 3MI9A 1GIHA 1SNXA 2VWIA 4EL9A 3QTRA 3MJ1A 3KFAA 3ANQA 4XYFA 4I0SA 3KXGA 2BFYA 3FLZA 3C0IA 3KY2A 5DLSA 3ZLWA 3DFCB 3IW4A 4JAJA 5E91A 4FA2A 4WNKA 2JDSA 4L44A 4QMYA 2PUIA 4CKJA 5CU3A 2B9HA 5M4IA 4EONA 3GUBA 3ZXZA 5JRQA 4F1MA 1W84A 2JKQA 2WMSA 1UKHA 2B55A 1M2RA 4QYFA 5AM7A 1Y8GA 3F3UA 5H3QA 4FIEA 3WYYA 3I6UA 3K5UA 5JGBA 2RGPA 1MRYA 4G3DA 5FXRA 4LV8A 2YFXA 5CAPA 4M3QA 3MTFA 4TPTA 5GNKA 4ZJJA 3V8WA 5EG3A 2RG6A 1DAWA 3Q6UA 4RC3A 4RG0A 3VS3A 1ZWSA 4Z7GA 3D7TA 4B6LA 5AP4A 4E4NA 5M4UA 5HBHA 2WEVA 2QOBA 4QMPA 3VRZA 4U80A 4IAKA 1STCE 5T68A 4FMQA 3PG3A 4EH5A 4DCEA 4MTAA 3QTZA 5DR9A 3C1XA 3LLTA 3EZRA 3ORLA 3FZSA 5FRIA 5DI1A 3RCJA 1DS5A 3IPHA 5BUJA 2BVAA 3RTPA 2YM6A 3LXPA 5BMMA 4C37A 4DH3A 2UV2A 3IO7A 4F63A 3WZEA 3NW6A 4RIWA 2P0CA 3BE9A 5CYIA 2VRXA 2OLCA 2W5HA 4RIWB 4JR7A 4ASEA 4D1ZA 1YWNA 4UEUA 3E8CA 3II5A 3NUXA 4XOZA 3V6SA 3D5UA 1K2PA 2WU7A 4IVCA 5D11A 4F4PA 3ZEWA 4DYMA 5L2SA 3UO4A 3UG1A 2UZBA 3CQWA 3RPOA 3VBWA 3ZMMA 4ANMA 4EC9A 2YDJA 5EI2A 4ZSAA 4WD5A 3VRYA 5EQYA 5M55A 4XG8A 4FTUA 4NCTC 4ITJA 5T6KA 5DNRA 4XV1A 3QGWA 5HICA 5DMZA 1JOWB 4KKGA 4U44A 4YZBA 4CFUA 1RJBA 2WD1A 4DEIA 5CEPA 4LOPA 2OU7A 1OKZA 2YA9A 4BGHA 5I3OA 3FC2A 5KKRC 4QTCA 4ZP5A 2CGXA 4XNEA 4IM3A 4IWPA 4MK0A 3BYSA 3REPA 3WF8A 2UW5A 3FQEA 3VQHA 2OH4A 3QRKA 1JKSA 2F57A 1LUFA 2WNTA 2PVYA 4RA5A 4ZY6A 4MYGA 5DWRA 1URCA 5F4NA 5IDPA 3FL4A 1YRPA 1PMVA 5DEWA 2SRCA 2XM9A 5AUUA 4WIHA 4EOMA 5E1EA 1YOLA 2PMLX 4IVAA 1JSUA 4XV3A 4XG7A 3QWKA 5E8VA 4A9UA 4FZ7A 2BROA 2IVSA 2C5YA 4GT5A 4PPBA 3GC9A 4BDBA 2YAKA 4BTJA 5BVDA 5J1WA 5AP3A 1WVXA 3H9RA 4W9XA 5CS6A 3GI3A 3W8QA 2ITUA 5DR6A 3W33A 2YEXA 3ZBFA 5L8KA 3E7OA 2A19B 2QC6A 5AUZA 2ZAZA 4LFIA 5CY3A 3GU7A 4GH2A 2WELA 4PY1A 1ZOEA 4XRJA 1H1PA 4DGNA 3JVRA 2X2MA 2VTJA 4FI1A 3VS1A 4OBOA 4HVHA 5CAQA 4JG7A 5GZ8A 5I9ZA 4W4VA 3PXYA 4NCTA 2C47A 3VJOA 3P5KA 4C57A 5C8KA 4EZ3A 5T3QA 5AWMA 4Y5HA 4EHGA 2X81A 5AP2A 3C4FA 3HLLA 2UZOA 4AZEA 3D5VA 4FTKA 3MH1A 4DG3E 5LVOA 2H6DA 1F0QA 4J96A 4FT5A 4OTFA 1ZYSA 3VBXA 3CPCA 3D15A 3VBYA 3GU5A 3QKMA 2VO0A 4C62A 2UVYA 3D5WA 3P78A 4IB1A 4JRNA 2OF2A 1YOMA 3R02A 2XMYA 4RX9A 2W99B 2C1BA 3Q53A 3RPVA 2OG8A 2OJFE 3FXXA 4O21A 1LPUA 5M51A 4Q9SA 3QQJA 3Q4UA 4O0VA 3DBFA 5F20A 4FSRA 4FEXA 3A62A 4FT7A 3MESA 4UBAA 4TW9A 3AOXA 2J9MA 3BGPA 3LM0A 4O91A 2Y4PA 3ORNA 3S95A 4G31A 4TWNA 2PE1A 5HO6A 3AT4A 4NUSA 5K3YA 3WF7A 3LFCA 3E3BX 3LOKA 3PPJA 1IEPA 3AD6A 4PF4A 2W4OA 4GSBA 4QP1A 2WEIA 3E88A 5A54A 5JZNA 3U6HA 3QA8A 3AMYA 3PZEA 4UMQA 2W06A 3RPRA 4ZXTA 2REIA 4GJ3A 2G01A 3TIZA 3AC2A 4HYHA 1CKIA 3QGYA 2UW3A 3UNJA 3GCQA 4AN9A 3D14A 4C2VA 4CCBA 2W0JA 3Q5ZA 2VTPA 2ACXA 4W4YA 3SXFA 2WAJA 5EHLA 3G15A 2BCJA 3L9MA 4XG9A 1XKKA 2YITA 3AC1A 4D1XA 1AQ1A 3C50A 4HCUA 4F9CA 1UU3A 4AZSA 3QRUA 2R2PA 1WBOA 2F7ZE 2B53A 4C61A 1WBTA 3DKCA 2C6KA 4FV4A 4PMPA 5KUPA 1Q5KA 4RJ8A 2GNLA 4ZIMA 3KL8A 5ICPA 4E4MA 4FL3A 4QMSA 3LFSA 4RT7A 3AC4A 3MPAA 4HYSA 4XG3A 5AP5A 1ATPE 2R3IA 3E87A 4IDVA 4IIRA 1NVQA 4YPDA 1GZ8A 4YGAA 3U4WA 3W2QA 2F2CB 5CALA 4JDHA 3EL8A 5HNIX 2WTIA 4DGLC 4JDJA 1H26A 1UA2A 1E1VA 3MTLA 3LFAA 1OI9A 4XUFA 4KSQA 4PP7A 4OTQA 4HVGA 2HWPA 3ITZA 4RPVA 4G5PA 3SOCA 4C3RA 1BUHA 1OKYA 5CF6A 2WQNA 3D4QA 4LYNA 2DYLA 4FV5A 4RC4A 3E3PA 2JBOA 4U79A 4C4EA 1JVPP 2YISA 5HNGA 4WO5A 4BGGA 4BWPA 4JBQA 3F7ZA 2R9SA 2OKRA 2HWOA 2VNYA 4HGEA 4EOOA 1M52A 2BZHB 2CKPA 4KABA 2WKMA 2CGVA 4Z9LA 3AMBA 5IG1A 3R71A 5KMLA 4FNXA 5EK7A 1RDQE 5FP6A 2XK3A 4AP7A 3ATTA 1R0PA 4CFNA 2JFMA 3PXZA 5IQAA 4KRCA 2OW3A 2QODA 2XBJA 5DH3A 2X1NA 5HU3A 1JNKA 4KUJA 3P7CA 2BUJA 1OGUA 1XHAA 4FSMA 4TYEA 5EDRA 5AUXA 3QD0A 4CFXA 2XKCA 3ALNA 3GNIB 3OHTA 4DH8A 5AP7A 3BWFA 4RIYB 4JDIA 2LGCA 4DGGA 5M56A 1GZKA 3QCSA 2ETKA 4O0YA 1XBAA 4QQ5A 4C36A 5EOBA 5GHVA 1M2PA 3V04A 2B9IA 4AT5A 1UU7A 5BNJA 5ETCA 3FBVA 3FHRA 3KB7A 4BDAA 5ACKA 2R0UA 5JK3A 2W9FB 1IR3A 3U51A 5JQ8A 5KBQA 4UY9A 2Q0BA 2QVSE 3QKLA 3ULIA 2WHBA 2XCHA 1JAMA 3FV8A 3OWJA 3LFEA 4FVPA 2F2UA 2I0VA 4ID7A 3KXMA 2C6IA 4K33A 2BRNA 4C4JA 4ZY4A 4LUDA 1PKDA 3UIMA 4PX6A 3PXKA 4D2TA 3Q32A 4O2PA 3EQDA 4I4FA 4EJNA 1F3MC 1MUOA 3EQGA 5CVGA 4MVFA 1KOBA 3DPKA 5CAVA 5K9IA 1PXMA 2R4BA 3OT8A 2O63A 5FXQA 3TNQB 3VBTA 4AS0A 5K0KA 3R7UA 3OBGA 3CGOA 1J1CA 1NXKA 3WE8A 2HIWA 2J0MB 2C6TA 4FSWA 2AYPA 4BCGA 1GOLA 3GU8A 4YHTA 4O7LA 3I0OA 4AGWA 4FUXA 3CC6A 5JFSA 4E5WA 5IUGA 4OGRA 1H08A 4LG4A 5GJDA 3FI8A 2NRYA 3FYJX 5LVPA 3MVMA 4EOLA 3GU4A 4I92A 4FTCA 4ZEGA 4QMLA 1XO2B 3W2PA 4EOQA 4DH7A 4I41A 1KV1A 4U3YA 3EOCA 3OCSA 4L00A 5AUTA 3U6IA 5A4LA 4BDDA 2HY0A 4R1YA 4NK9A 3SGCA 3F5XA 4GK4A 1UWHA 3UO6A 3VUTA 4FTMA 4RX7A 5CT7A 5GIOE 4RZWA 2R3RA 3AD4A 4DEBA 1BLXA 2BALA 3FI4A 1WBPA 1GIIA 4H58A 3BLHA 2I0EA 4OR5A 4QMUA 1OUYA 4EQMA 4YZMA 2WTVA 4GG7A 3QXPA 4PP9A 5ANJA 5AX3A 2VX1A 5DIAA 4F7SA 1W0XC 4WSQA 3MB7A 3QQKA 4BZOA 2VWVA 3ENHA 4NYEA 1H1RA 5CX9A 4O38A 4KB8A 3T9IA 2OK1A 1PYEA 2QKRA 3IONA 3KULA 3JR1A 2XIKA 3C4XA 3Q4ZA 1PHKA 2WMTA 4I3ZA 4O1PA 2ZM4A 1OPLA 3KULB 3KEXA 4X3JA 4O0SA 5D10A 3TN8A 4PV0A 2I1MA 3LCTA 2UZDA 1YOJA 2FA2A 2BAJA 1NA7A 2W7XA 4YLLA 3OTUA 1I44A 5H8BA 4A06A 4XX9A 3ORTA 3EYHA 3G51A 4QD6A 1WZYA 4QQCA 2IW9A 3H4JA 3OOMA 2BZKB 4ZJVA 2ZOQA 4FKUA 3RM6A 3VS7A 3TEIA 4BDIA 5CANA 3A8XA 3LXNA 4YR8A 4IX3A 2PMNX 2JDTA 1ZZ2A 4AZFA 3KREA 4G6OA 1XR1A 2JKKA 3FHIA 3DJ5A 4NM7A 5AJQA 3W18A 1T46A 3VHKA 2DUVA 3R1YA 4Y8DA 4A7CA 3HMPA 1XH7A 3COIA 4GT4A 4JVGA 2CNQA 2X7OA 3G90X 4EH4A 3KVWA 4FTRA 4FKTA 3SVVA 1JSTA 1LP4A 2W1DA 4FT9A 4F0IA 4FTOA 3DBDA 2GDOA 3HV5A 5IUIA 2IWIA 3TZ9A 2PE0A 2XB7A 4IB5A 3MY5A 3EIDA 2A4LA 3PJCA 5IA0A 4RGJA 4IHPA 3FPMA 3HKOA 4I1ZA 3UOLA 3ZDIA 1YHSA 5BUEA 3OMVA 2GTNA 4JT3A 4W9WA 3LFDA 3B2WA 4WG4A 4FV8A 4XG2A 5EFQA 4BDJA 1OIRA 1Q62A 5K4JA 2O3PA 4QT1A 1KUTA 4CG8A 1PRYA 3SD0A 3PY1A 3G6HA 4BL1A 2XIRA 4RZVA 2VX3A 4TY1A 4LQMA 5KNJA 4DE4A 2W5AA 4FKJA 4X7QA 4CYIA 1U4DA 3Q9XA 2VWYA 4ERKA 4F65A 4FKSA 4MH7A 4ZY5A 3EFJA 5C8MA 5HD4A 4O86A 5IQHA 5FBNC 4S31A 3QRIA 3QZGA 4KAOA 3F66A 3U8WA 1YHVA 2W96B 3QTIA 2JITA 2BDFA 4J95A 3VUHA 4F7NA 4MEDA 2QU5A 4RIOA 3FLSA 5BVEA 5IQEA 5HTBA 3V51A 4FTNA 4H36A 5AAEA 2EXEA 1PY5A 3KK8A 2YLEA 4FTJA 4AUAA 4CVAA 3VHEA 3EFKA 2OBJA 3HMIA 4PRJA 1R3CA 3D83A 3O23A 3UP7A 4C3PA 4CFFA 4OT6A 4F7JA 2B0QA 4DLIA 2WU6A 4L43A 3FQSA 4TWPA 2C6LA 5HG8A 5L2QA 2JKMA 3ZO2A 3CXWA 4UMTA 4BI0A 2WQEA 3R7EA 2E9VA 5IMXA 3R2BA 4XRLA 4FEWA 4K0YA 2FGIA 2YIRA 5C26A 2R3HA 4ANSA 3AXWA 4OBQA 4LMNA 4X3FC 4IZAA 2X2LA 3I79A 3LFBA 3UIXA 3QUDA 4FV6A 3WZDA 3NZ0A 4IAYA 3CEKA 3ANRA 4MNEA 2GNHA 4FIFA 3VS4A 5JFVA 4OTPA 4M8TA 3CLYA 4ZTQA 3V8TA 2PL0A 4CFMA 3MFRA 3KKVA 2QOCA 4BCJA 2PZPA 2ZMCA 3DS6A 3PSCA 2FSLX 3WIKA 3LMHA 2Y0AA 2R7BA 4RJ4A 4UYAA 4IADA 3KC3A 2WTKC 2ETMA 5FTQA 4FSUA 3UYTA 3GOPA 4QPAA 4YURA 3E64A 2WMUA 4J99A 4RC2A 3HAMA 5IQFA 1H01A 1KE7A 3HNGA 5EDPA 4E26A 1H8FA 1VR2A 4ZMEA 2Q83A 3VWAA 3ID6C 1YWVA 3PPKA 4ALVA 3K5VA 2JLDA 1WAKA 2V62A 4FKQA 3TV4A 5ANIA 1OB3A 2PUNA 3FZ1A 2YERA 4R3RA 4EQUA 4RX5A 5CF5A 3KF4A 4DEGA 3MDYA 4L6QA 3ZUVA 2X0GA 2HENA 2GHGA 3Q4CA 3QUEA 3W2OA 5I9YA 3PDTA 3BGQA 3NX8A 1AGWA 3BPRA 3SC1A 4GRBA 3ZDUA 1Q41A 3MPTA 1G3NA 4KKEA 4YC3A 4FSTA 3GCPA 2XIYA 4UYNA 5JN2A 3W2CA 4YPSA 1GZOA 1YXXA 3A4OX 2YIXA 3TTJA 3QQLA 4GG5A 3F3VA 4OLIA 5HEZA 2IVUA 3Q3BA 3RNYA 2VTMA 4X3FA 3C0GA 3LJ0A 2E9PA 2J90A 3NW7A 4YP8A 2PVKA 5F95A 4EUUA 5FG8A 4X3FB 3ZYAA 2GHLA 3ORIA 4KBKA 3I6WA 3LXLA 4XCUA 3F9NA 5HG9A 4AAAA 4GVAA 4YC6A 4BWXA 1P2AA 4I21A 2XNGA 3DB8A 5H8EA 2V0DA 5E7RA 2HYYA 3MVLA 3GENA 2W1IA 5KCVA 5CAOA 4DFNA 4FUYA 4FNZA 4FEVA 2OJ9A 3ZHPC 4J71A 4YZCA 3QCYA 4E1ZA 1VEBA 2WTKB 2XVDA 4DFXE 4OTDA 1XBCA 2GQRA 4EOKA 1UNLA 3BU5A 3NYOA 3ZFMA 5BYLA 4YJSA 1PJKA 4M14A 5TT7A 2JIUA 5H2UA 3FLWA 4H39A 2YM4A 2C6OA 4Z7HA 5HCXA 3EMGA 3SX9A 2C30A 4AN2A 2ZV2A 4CRSA 4JBOA 3AD5A 2ERKA 4F1TA 3VF8A 5BPYA 3PTGA 5DOSA 2ITVA 5I9UA 2YZAA 4FKPA 4GW8A 4KIOA 2R3QA 4ASXA 4CKIA 4D4SA 3LCOA 2BTRA 1QMZA 3BU6A 4HJOA 4X21A 3CD3A 5A6NA 5HORA 4BR3A 4DFYA 4F6UA 4JG8A 4FG7A 4MBIA 4F9WA 3DKGA 2WOTA 4BICA 3E92A 2XNBA 2DQ7X 4RMZA 4AGUA 4M15A 3V5JA 4FZFB 3HMNA 3P08A 1V0OA 4TNBA 4JQEA 4JR3A 2R3LA 4UMPA 4RWLA 4DA5A 5CF8A 2ZM1A 2RIOA 4QP6A 3COMA 3QCXA 5AM6A 5IA5A 5IH6A 4IWOA 3ZS5A 3IGGA 3R7YA 3MIYA 3NPCA 4FYNA 4UMRA 2BRHA 2JBPA 3TNHA 3WE4A 4A4XA 5HZNA 3R8VA 3DK7A 5CTPA 5AADA 1OL2A 4DT8A 3FSKA 4FV9A 2QOFA 4RFZA 3SOAA 4TT7A 4BKJA 4IX4A 4NEUA 4N4SA 3MVJA 2GNFA 4WBBB 2XUUA 3RMFA 3ZO1A 2C6DA 4BCHA 4G17A 4F6WA 5HTIA 4L7SA 1MP8A 5C4KA 3OY3A 3VUDA 1ZYLA 3BI6A 4L46A 1OITA 4RLLA 1MRUA 3ZC6A 2BAKA 3GQIA 2CN8A 3PP0A 1OZ1A 4G16A 4FG9A 4D5HA 4EHEA 5K4IA 2WFYA 2WPAA 1XH9A 3ZRKA 1CTPE 3ZRLA 3R8ZA 4ACGA 4AOJA 4D0XA 2OIBA 4MF0A 3ATSA 4IH8A 5FBOA 3V5WA 5EM8A 3TXOA 4IM2A 4O0TA 3FL5A 1XH6A 4NJ3A 5HLNA 3ZSGA 4ACHA 3SG9A 5AR8A 2J6MA 4C02A 4NM0A 4PDOA 3R2YA 4QYGA 4K2RA 3LCDA 3BRBA 2G2FA 3PE1A 3D2IA 4ZTHA 4CMUA 4A4LA 3C51A 3KRJA 3ZZEA 3KRLA 3Q96A 3CJFA 3G5DA 3Q6WA 4DHFA 3V5LA 4XJ0A 4BCOA 4DEAA 4ANLA 4YBJA 3LW0A 4NWMA 2YM3A 3R1SA 4YLJA 1G5SA 3PVUA 2Z60A 2AUHA 2IG7A 3K3IA 4Z3VA 2I0YA 4CEGA 4GEOA 3GGFA 1KE5A 4TYGA 3U4UA 4AW5A 4M67A 4FKGA 1UKIA 2V5QA 3QUPA 3RAHA 4LOQA 4EUTA 2YIQA 3D7TB 4FZAB 2GQSA 1ZOHA 4DFUA 2UUEA 3M42A 1ND4A 1R1WA 1RQQA 2IO6A 2QR7A 4LGHA 5HCZA 3EN9A 5AIRA 2ZVAA 4ZTSA 4TTHB 2CGWA 3DKFA 5FTGA 2JC6A 3AT2A 3GQLA 4LMUA 1IAJA 4UZHA 5IEYA 5J5SA 4R3PA 1ZMVA 4MX9A 3TNPC 3R8LA 4XBRA 2W1FA 5IA4A 1R39A 5E8ZA 3ZFYA 5HCYA 3WF6A 2IPXA 2GS6A 2XM8A 4B4LA 2XNEA 4KBAA 2Z8CA 2CGUA 3GXLA 4QMZA 5LJJA 3CCNA 2VWWA 2BKKA 2UZEA 4P90A 2PZ5A 2P55A 3T8OA 3GP0A 1U59A 4CV9A 5C03A 1Q8UA 1G8AA 2G15A 4P4CA 4IZ7A 3Q04A 2JKOA 3O50A 2C3JA 3A8WA 3NCGA 4TXCA 1WVYA 3EB0A 4DG2E 2Q0NA 4C4GA 3BKBA 4GU6A 2XK7A 3FMLA 3ZCLA 3U87A 2R3NA 1ZMWA 4L3JA 5KMIA 3BCEA 4WA9A 2ITOA 2UVXA 3BLQA 5DHJA 2XNOA 2C0OA 3PA3A 2QOOA 2J5EA 2A27A 4EJ7A 4S34A 4KD1A 1YDRE 4KSPA 4O27B 2XCKA 3C7QA 2OFUA 3QRJA 4GKHA 4FC0A 3VS6A 5ANDA 5J7BA 1WBNA 1KE6A 2YAAA 3FMNA 2WMXA 3LAUA 4U45A 4KWPA 4RVMA 4AU8A 4O0RA 4ZS4A 1YI4A 2Z2WA 2CKQA 4BIEA 2PE2A 4CNHA 4BHZA 2JAMA 3V3VA 3PXRA 3QTQA 2HZIA 1Y8YA 1DAYA 3EQFA 3LFQA 2YCQA 3F2AA 1DI8A 3T3VA 3I5NA 1KWPA 2GNIA 4CG9A 4A9RA 1PYXA 4ANBA 4D2VA 5IDNA 5IQDA 2OXXA 5E8YA 2O2UA 5JMSA 3FY0A 2W05A 2FH9A 3WI6A 4QMQA 1UV5A 4L9IA 5LOHA 4BDCA 2PUPA 2FSOX 2OH0E 4QP3A 5LCJA 5LCKA 1HOWA 4J53A 3SQQA 4MD9E 3HDNA 4HNFA 3HDMA 3ACJA 4BCQA 4H1MA 5CSVA 5C01A 2XYNA 1SMHA 1ZLTA 4E4LA 4IMYA 4EH8A 1OIUA 2BZJA 5EW8A 3PY3A 2YCSA 3PP1A 3PVWA 4K18A 4C4HA 1BX6A 5EKOA 2F7EE 5BX0A 4YHFA 3UOJA 5AUVA 2QQ7A 3R0TA 3OP5A 3OXZA 4UWBA 4A07A 4R77A 1GIJA 4HVDA 4HZSA 3WOWA 2YWVA 4BCKA 2IVTA 2QG7A 1JKLA 4R5SA 3RK7A 3SXRA 2W4JA 4QP7A 4RSSA 2QKWB 4EBVA 4FKLA 3ZSHA 1M7QA 5M08A 2YCRA 4I5HA 2QI8A 4YJTA 3NCZA 2HZ0A 5J7HA 2GFSA 3MY1A 1FGKA 2VO7A 3PA5A 3PLSA 3HA8A 2UW4A 3EQRA 5KKRB 5HG7A 3NVMB 2C5XA 2RFEA 4FICA 4BY9E 4YO6A 1GAGA 3PFQA 3OZ6A 3Q60A 2WTCA 3UZPA 4H3PA 4DTAA 3OCBA 4R3CA 2C5NA 3I5ZA 3L9NA 4ZTMA 5A4EA 4ZSEA 2H34A 3F69A 4ITIA 1Q8ZA 2Y6OA 1OPJA 2G2IA 5KMOA 1M2QA 5FUTA 4GKIA 3BHTA 3IW6A 1IA9A 2W1EA 4EOPA 3NUNA 3CS9A 3G2FA 4B9DA 4R7IA 3ORPA 4N0SA 4QMVA 4UB7A 1URWA 5CU4A 3RAKA 3AC3A 4G3FA 4U7ZA 5AR2A 1H27A 1WMKA 3QQGA 4IC7A 5JRSA 3QWJA 1FQ1B 5A4QA 2BRMA 2XEZA 2J0KA 4B0GA 2W1GA 4G3GA 3ERKA 4BYIA 3OXTA 5I9VA 5JT2A 2OI4X 1BL7A 3IW7A 1UNGA 3JXWA 4PPAA 2VTLA 4CT1A 4DTBA 4QPSA 3A7HA 3NAYA 2KULA 2CKOA 4RJ7A 3RGFA 5GJFA 4E6DA 5BQ0A 2J0IA 3H3CA 3HL7A 2BZIB 3BZ3A 2B4SB 5E90A 4L01A 4W8EA 4GFGA 3LIJA 2AC3A 4WUNA 1Z5MA 5I9XA 3KRWA 5E1SA 4PNIA 5M4CA 1OPKA 3FMJA 3L1SA 3L8PA 3O71A 4IX6A 4QMOA 1FMKA 3C5IA 3HVCA 4L42A 4XV2A 3QQFA 4OTRA 3OY1A 3BBTB 4PQNA 4ZSGA 4J7BA 5G1XA 5HLPA 4IB0A 3TZ8A 4N6YA 2FSMX 2R3PA 4PDYA 4IWQA 2VTNA 4FNWA 5IA3A 3UODA 3WBLA 4G1WA 3R83A 5J79A 4AT3A 4HNIA 3NNXA 3P7AA 3R04A 4ORKA 5ANOA 1WBSA 4J98A 4L67A 4HGTA 4Z16A 3CE3A 2XKEA 4OAVB 2PVFA 2ZYBA 2YN8A 5HKMA 5M07A 3F5UA 4ZOGA 3IW5A 1YDTE 2X6DA 4YZNA 3R73A 5DG5A 3HUCA 4KS8A 4YJVA 3UPXA 1H07A 4GMYA 2ZV7A 2XF0A 3DCVA 2GPHA 1JBPE 2XRWA 5HVJA 2PSQA 3FMKA 4DEEA 4F1OA 2X2KA 4EHVA 2V22A 3ZRMA 1L8TA 4E4XA 3EKKA 4YC8A 4ASDA 3DZQA 3RWPA 4UXQA 4UN0C 3MH2A 4JQ7A 5AR4A 2VO6A 4DGOA 5LWNA 4QMTA 3IG7A 3LQ8A 2QONA 5AR7A 5AA8A 1YDSE 2GU8A 2G9XA 3A61A 2JEDA 2VTSA 5EOLA 3DA6A 2FVDA 3QTXA 4S33A 4G9RA 4XV9A 5DA3A 5F1ZA 3R7OA 4CZYB 5D1JA 3RWQA 5L6PA 4XP3A 5H9BA 1Z57A 4S32A 4U43A 4USEA 5LWMA 3TUCA 2CJMA 2WQBA 5A3XA 4BTMA 4EORA 5HHWA 4B7TA 5M06A 3WILA 3VF9A 4KS7A 2PY3A 5CI6A 5LVMA 3ZEPA 2E9NA 4ZTRA 4EK6A 4F64A 3CP9A 3BWJA 3KU2A 3V5TA 4F99A 3BLRA 2YJRA 5EI6A 2NO3A 4IM0A 2HW6A 1O9UA 3EZVA 3PVGA 3UVQA 3QU0A 3FZOA 3UTOA 4RWJA 4XG6A 3IDBA 2PVRA 3TACA 4TL0A 4M69A 2R3FA 3SHEA 4I6QA 3VQUA 2R7IA 3NIEA 2XRUA 4IVBA 5FEDA 4DFBA 3OVVA 2ZV8A 4UWCA 2X7GA 4O22A 4DFLA 2XP2A 4BCPA 3G33A 3AGMA 4AOIA 1SVHA 4BDEA 2QG5A 4WBOA 3MIAA 2XK6A 5CAUA 2Z02A 2X4ZA 3QHRA 1GNGA 4RJ3A 2VV9A 3HYHA 2XKFA 1SVGA 4CLIA 4NTSA 2I0HA 3KF7A 2XBAA 2BKZA 3EQHA 4XP2A 4AA4A 5I9WA 1QPJA 3FY2A 4M84A 3TDVA 5L6WL 2YDKA 4ONAA 3VC4A 1J3HA 3RPYA 4BDHA 4FIHA 3UO5A 3ZBXA 3FWQA 3RALA 1WVWA 4M7IA 3E93A 3VAPA 3VNTA 4I5MA 2VGOA 3UNZA 2C0IA 4X6QC 4FOCA 3SKCA 5CEMA 5A6OA 3FSFA 4Z55A 4UV0A 2Y7JA
chains in the Genus database with same CATH superfamily
4DG0E 4D55A 3P0MA 5FXSA 4I6BA 3LQ3A 4C58A 2VWXA 5M57A 1W98A 3DLZA 3R6XA 3GT8A 3C4EA 2WMBA 4OTHA 4FL1A 4BIBA 2QLUA 3ZONA 3IECA 4C35A 5IEXA 4O7SA 3EQPA 3R00A 1TVOA 4YU2A 4QRCA 3S3IA 3PUFC 3N51A 2OXYA 3O7LB 4QP4A 4BF2A 4FG8A 4HOKA 2WTDA 3PJ8A 2XAMA 2QNJA 4CV8A 2ZMDA 1WBVA 4F9BA 3SA0A 3GFEA 1FVTA 1XH4A 3RZBA 4Y73A 5F94A 5CU0A 3FYKX 2YACA 4AGDA 4Y46A 3PJ1A 5E8SA 3UZRA 3SW4A 3UZTA 4AG8A 5AX9A 1GY3A 4USDA 3F2NA 3MVHA 2OIQA 3CY3A 2O65A 3R63A 4FTQA 1V0PA 3FC1X 3EQCA 3IOKA 3A7IA 5IKWA 5DYJA 3HZTA 3H30A 2UW9A 3W8LA 2WMWA 4BDGA 3PWDA 3DTWA 4HYIA 2RFDA 4QQJA 5HD7A 2PZYA 4TNDA 3ROCA 3UDBA 3QBNA 4DT9A 3JS2A 4A9SA 2HY81 3DBEA 4BHNA 4CGAA 4X2JA 3KXHA 4AE6A 2WQMA 1TQIA 1XH8A 3PPZA 4UZDA 4CLJA 3R7GA 2RKUA 2UZVA 4E5AX 4NM3A 2DS1A 5AUYA 1UWJA 4XBUA 4U40A 5DR2A 3TI1A 2QU6A 4FF8A 2IZUA 4ZZMA 2W1HA 1YI6A 2WGJA 2V7OA 3RNIA 3KCKA 3ODZX 4FGBA 3ODYX 3KQ7A 2PVHA 3OS3A 3V8SA 4EWQA 3ZXTA 4EYJA 3F88A 4FX3A 5AR5A 4O7VA 2XH5A 1CSNA 3B8QA 3R1NA 4ANQA 3FMMA 1O6LA 4CTBA 3D9VA 3QTSA 3TG1A 2XK8A 3EFLA 3FUPA 3IS5A 2O64A 4IJ9A 1S9IA 1BKXA 5AP6A 4EOIA 2LAVA 4CKRA 3JY9A 3Q9WA 2CNVA 3DTCA 5CU2A 3VIDA 3MBLA 4DF3A 1OMWA 4WG5A 3LPBA 2QR8A 4GIIA 4YUQA 3NMUF 2OWBA 2CSNA 4WSYA 1YHWA 5IPJA 5D9HA 4RIXA 3P9JA 3MW1A 2PWLA 5HIBA 4AF3A 3W0NA 2W5BA 4QTDA 5GIPE 2PZIA 4XMOA 5D7VA 5AV2A 3FKNA 4H05A 1O6YA 3HP5A 5EDQA 3P79A 3BX5A 1OBDA 4YSMA 4FKWA 5C8NA 3OT3A 4FT0A 4Y72A 4HGLA 4Q9ZA 5I0BA 2PVLA 1G8KA 2B54A 2ZM3A 3COHA 3PSBA 4EOJA 2RFNA 3NYXA 1Y57A 4GYGA 2X39A 3DFAA 3JVSA 3ZM4A 3POZA 5HE3A 3HV7A 5CNNA 2XNNA 2WTWA 3MJ2A 1PXJA 4K9YA 2XANA 3GB2A 2YWPA 4RFMA 3PFYA 4NW6A 4YJOA 2WO6A 3OW4A 3QD4A 1APME 3WYXA 3BIZA 2RFSA 2XJ0A 3JYAA 3MN3A 4O0WA 2IN6A 1KSWA 2P3GX 3EL7A 4QP9A 3KXNA 3R01A 2NPQA 3O8TA 1TQMA 3TIYA 4ACMA 4EBWA 3PZHA 1Q4LA 2UW7A 4G3CA 2BR1A 2QURA 4ALWA 1SM2A 3OW3A 4ZLOA 2PULA 3L8VA 5IQGA 4YNEA 3VUKA 4GYIA 4FTIA 1ST4A 3HRFA 2X8IA 2XYUA 3MS9A 4JJRA 4BGQA 2GSFA 3NS9A 5CQWA 5HX8A 1MQ4A 3EWHA 4RFYA 4YTCA 2J50A 3ZM9A 4L45A 5AA9A 4FV0A 3DGKA 4HVSA 1IASA 4KIKA 4QTBA 3FZPA 4RBLA 4XHKB 2R3KA 3TUDA 3TV6A 3H9OA 2R5TA 4JOAA 5CLPA 3CR0A 1VZOA 3SXSA 2OJGA 2HK5A 4FKVA 5C9CA 4ZAUA 4FE2A 2ESMA 2XIXA 3R1QA 5AR3A 2IZSA 2CN5A 1ZYCA 3DBQA 5FDXA 1CDKA 1REJA 1KOAA 2J0JA 4AXFA 4BKZA 3SAYA 4P2KA 1TQPA 4MNEB 4RVTA 4N6ZA 3KXXA 2C3IB 1JLUE 3MGYA 3PWYA 3G9NA 5A46A 2ONLA 3AC8A 4ZZOA 2VWZA 3TNWA 1NY3A 3LMGA 3HP2A 4TYJA 3V6RA 2PYWA 2GCDA 3CD8A 1OVEA 5FTOA 2OZAA 2OFVA 4F9YA 2J4ZA 5FLFA 3FKLA 5JH6A 5KMJA 4CZUA 1TKIA 1P4FA 2C3LA 2P2IA 4QPMA 5I5ZA 1YW2A 5TF9A 5E9EA 3IGOA 3ULZA 2BFXA 4JI9A 3E7VA 4JX7A 4MXAA 4YBKA 5M44A 4DLJA 3QXOA 3KRXA 1B39A 4TRLA 1Q3DA 5AV3A 2QLQA 3T9TA 3CBLA 3HMMA 1H0WA 1BMKA 1PXIA 3QQUA 4MCVA 3TL8A 3ZZWA 4F0FA 3QZHA 4NSTA 4PDPA 5DT0A 4FRFA 4N70A 4X2NA 3TV7A 2J7TA 1UNHA 2WZJA 2C5OA 3A7JA 4IJPA 3TKHA 1ZYJA 1U54A 4E7WA 5J87A 1L3RE 2JIIA 1Q3WA 2VTRA 4GFOA 4TN6A 5EM6A 5M09A 1U54B 4CQEA 4DTKA 2HZNA 3DV3A 3KMUA 5TO8A 1H0VA 4IW0A 4JXFA 3O96A 4JQ8A 4MXYA 1OBGA 2BTSA 2OJJA 4FR4A 4M12A 4AW1A 3LE6A 1V0BA 3RKBA 3SLSA 3LZBA 1WCCA 3O17A 5HE0A 5IA2A 2OO8X 3LQ5A 4ALUA 2QHNA 5B2MA 5HG5A 4TZRA 1PMUA 3Q9ZA 3KN6A 4NTTA 3UIUA 3CJGA 3TTIA 3UVRA 1NVRA 4HYUA 4G6LA 4D0WA 5B7VA 5C1QB 4M0YA 5DVRA 4E6AA 4UX9A 2ZDUA 3FJQE 3FPQA 2VTAA 3C9WA 4I24A 2C1AA 3OG7A 4NW5A 2QOIA 4RWIA 3D7ZA 5FD2A 4EOSA 5EKNA 4EK3A 1T45A 1PKGA 3QA0A 3ZH8A 3U55A 2ZJWA 4O7TA 3PRIA 4K11A 2NNWB 3PIZA 4XH6A 3U54A 4YTIA 1BL6A 2EVAA 3AMAA 3FZTA 3GVUA 1SVEA 5DEYA 1VLRA 1OKWA 4IZYA 5HTCA 4HVIA 4HPUE 5CVHA 3L8XA 2VTTA 3FKOA 2A2AA 3MV5A 4YO4A 3RK5A 4M0ZA 2QD9A 2R3MA 4ZSLA 3O5AA 3BHHA 2YIWA 2YM5A 4MBJA 3FLYA 4D2PA 3FAAA 5IA1A 4IAZA 4C3FA 3TM0A 3TMOA 4O4CA 4EI4A 3DQWA 5HO7A 2AEGA 1OL6A 2WOUA 4GU9A 3QX2A 5CSHA 4I23A 3ZSIA 1H1WA 5ITAA 2FSTX 5AAGA 4W8DA 5EYDA 5G6VA 3FE3A 4Q2AA 4CSVA 1PXKA 5TR6A 4PMSA 2A98A 2ITXA 3A7GA 3MH3A 1JKKA 4I94A 1ZYDA 3FLQA 5CSXA 4QTEA 5I4NA 1OECA 3FI2A 3BYMA 5HOAA 3W16A 3LKMA 1PW2A 3AKLA 3ORXA 5HE1A 3N4TA 1Q97A 5CENA 4YJPA 3HGKA 3LXKA 4D4YA 4IWDA 1VYWA 4LUEA 3TNIA 4D2SA 3DDQA 3QC9A 4BVUA 2WMAA 4EH7A 3HEGA 3HRCA 4WRSA 4ZSJA 1H1QA 4FKRA 3W1FA 2GNGA 4YZDA 3BEAA 4I6FA 3N9XA 4D58A 3NUSA 4YJNA 3C4WA 4PWNA 3UC3A 4GT3A 3ENMA 3DQXA 4C8BA 2ITZA 4QQTA 5KBRA 1P14A 2W4KA 4U6RA 2EXMA 3CTHA 2X7FA 3GFWA 5DN3A 5A4CA 2GFCA 1OUKA 5CNOA 5C4LA 3E63A 3JPVA 1DI9A 3I7CA 4P5QA 5J5TA 3COKA 2BILB 4II5A 3QHWA 3GC0A 4Q5HA 3UYSA 4JRVA 3CTQA 4GS6A 1PMEA 4LOOA 3Q4TA 3LLAA 2WMVA 5CEIA 5M4FA 4O0XA 3QYWA 4K77A 2Z7QA 4YHJA 3TJDA 2A0CX 2FO0A 1NT2A 4Y95A 4DGMA 3D94A 4R1VA 3PRFA 5E8XA 2EB2A 2VTQA 1QPDA 2VD5A 3OUKA 2IW8A 4ACDA 4TYHA 1W7HA 3RCDA 4LRKA 3R7VA 4BBEA 3WZJA 4AGCA 5BUIA 2P2HA 5KHWA 1FBNA 4M97A 4HGSA 3QZIA 3R9DA 2PK9A 4RVKA 5DT4A 3I4BA 3S00A 4AACA 3RPSA 5IUHA 2PU8A 3EN4A 4O2ZA 3UC4A 4K6ZA 4FK3A 3KMWA 5AMNA 4AZTA 4QNYA 4X6RA 4D5KA 2X6EA 4IE9A 1QCFA 2IVVA 3UE4A 3VBQA 3O8PA 3R8MA 4JIKA 4AZVA 4CMOA 3UDTA 2OXDA 4FSZA 4JDKA 4BFMA 2J51A 3CKXA 4S2ZA 5L2WA 3HV3A 2HW7A 4ACCA 1PXPA 3Q9YA 4O81A 5A4TA 2B52A 2YJSA 4ITHA 5C27A 3BEGA 2VO3A 4FNYA 4AE9A 4MWHA 4ERWA 2XK4A 5L4QA 1E1XA 5CSWA 1CMKE 4MXZA 5FEEA 1IRKA 3UOKA 1UU8A 1O6KA 1XH5A 4F0GA 3VJNA 4G3EA 2CHLA 4RLKA 2KTYA 2WB8A 3ZUUA 4BTKA 3P4KA 3VN9A 4LRMA 2OJIA 3OEFX 4DDIA 4H3QA 2BDWA 3K2LA 1KE9A 5J8IA 4EC8A 4EK4A 4XLIA 3VS2A 4O6LA 2ZDTA 3ML1A 3F61A 4NKAA 5FP5A 2XKDA 3U9NA 3ZO4A 3LMIA 4TWCA 1OL5A 5K0XA 3AKJA 5DGZA 3ALOA 1FINA 4GCJA 2O0UA 2WQOA 4D2WA 5FM2A 2XNMA 4BCIA 4FV2A 5HIEA 3EH9A 3ZU7A 2GS2A 4EYMA 4O82A 3W0MA 4B8MA 4DC2A 1PF8A 3R28A 5CI7A 4RA4A 4BZNA 3ORMA 3OCGA 2BPMA 3UMWA 2WTJA 3PYYA 4E20A 5F9EA 3K3JA 2B9FA 3RAWA 2NYAA 1JWHA 2C6EA 1KV2A 2PUUA 4M66A 1DM2A 1H25A 1PXOA 4YSJA 1PXNA 2ETRA 3MWUA 4HCVA 3B2TA 5GINE 1XBBA 3CQEA 4LI5A 4QOXA 2VGPA 4O7YA 5HBJA 2G2HA 3RM7A 4LV5A 2RSVA 4IQ6A 3BBWA 4UXLA 4BIDA 3ZC5A 4R7HA 4ARKA 5DE2A 4KIQA 4DAWA 4IEBA 4FZ6A 5IH5A 1FGIA 5E8WA 2PVJA 2VAGA 2Z7RA 4UWYA 4EQCA 2X9FA 4C38A 4Y83A 3RVGA 3NNWA 3AQVA 3OD6X 3DK3A 4MKCA 3ZTXA 1PMNA 4IANA 3TCPA 3NUAA 2FUMA 3E8NA 4FIIA 3ORKA 3PUPA 4V04A 5EW9A 4R7BA 3C4ZA 3CTJA 4C0TA 1E9HA 1Q8TA 2BHEA 4B8LA 5HX6A 4H3BA 4NFNA 5BYZA 5AEPA 4EH3A 5BVFA 4BBMA 2BHHA 3GCSA 1IG1A 2IJMA 4G34A 4FGRA 3TZ7A 1VYZA 4F7LA 4LRJA 3EHAA 3IQ7A 3LHJA 3O8UA 4IACA 4MWIA 4DEDA 1JQHA 2BRGA 1QL6A 1J7IA 4ZZNA 2H8HA 4KKHA 5EQPA 3E8EA 3HUBA 4MXXA 5H8GA 4JBPA 4AOTA 4O0UA 4RWKA 3M2WA 3QD2B 2X9EA 3ORZA 1W83A 3E8DA 3UPZA 3MA6A 1CM8A 3DAJA 3KN5A 4NJDA 3CIKA 4FT3A 4KRDA 5KO1A 2YDIA 3I1AA 4EEVA 5E8UA 3SRVA 3CKWA 5IH4A 5K5XA 3KMMA 3QFVA 3IDCA 4O83A 3SRVB 1Z9XA 1W82A 3N4UA 1V1KA 4G5JA 4UALA 3GOKA 4L7FA 4DN5A 5CT0A 1ZZLA 2HOGA 2UZUE 3L8SA 2JD5A 3KK9A 4WRGA 5IQCA 2X0PA 4BCMA 4QYYA 5LMKC 3FI3A 3EJ1A 3F3TA 1OKVA 3A60A 4I22A 3RBWA 3DNEA 3BHVA 5HBEA 3GEQA 3IK3A 2JFLA 2V55A 3K54A 4MAOA 5KE0A 3DDPA 3R7IA 5BVNA 1MQBA 1FVRA 5AAFA 4EK8A 1YI3A 2PHKA 1UVRA 3VO3A 4K8AA 2OICA 4XP0A 4O7RA 3NVKI 5IMEA 3QYZA 2HXQA 3QKKA 4GK2A 3PE2A 4N57A 4RQKA 4O4EA 1OL7A 3HV6A 4QP2A 4AN3A 3SW7A 4AA5A 4FIJA 1IA8A 1LR4A 3N4VA 4IAAA 5J95A 2G1TA 3HMOA 4AXAA 3FMDA 3WZUA 5EQEA 2XA4A 2JDOA 3BHUA 3DLSA 2Z7SA 3UQGA 4JL9A 4QO9A 3ETAA 2JGZA 3SDJA 5FDPA 1XJDA 3JY0A 2CPKE 5TKDA 5JKGA 4GUBA 5AV0A 1P5EA 2R0IA 2UW0A 1ZY4A 4PUZA 5EM7A 4F09A 3DXPA 3OWPA 1K9AA 3Q2JA 4ZS0A 1FOTA 3E62A 1R78A 3ROYA 4JX3A 1S9JA 3UDSA 4QMMA 1BI8A 1YXUA 3VUGA 4JNWA 3CPBA 4D9TA 4Q5EA 3ZLSA 4OTIA 3FZRA 3IOPA 4NM5A 3MPMA 5HO8A 3PA4A 1ZY5A 4LL0A 4C7TA 3D0EA 3PJ2A 4MQ2A 3P1AA 2B7AA 5KMNA 5EYMA 2EB3A 2CCIA 5LMKA 4YJQA 3F5GA 3LVPA 4FSNA 5K5NA 3S1HA 2UW8A 2X8EA 1ZRZA 3PXQA 1M7NA 4CFVA 4XEYA 4ZLYA 2Z7LA 3NR9A 1H24A 4OT5A 2CKEA 4D2RA 2ITQA 4P7EA 4ZJIA 1X8BA 5CEQA 4EK5A 1Q61A 3QLGA 3R30A 3W55A 4BB4A 2AC5A 2CLXA 2YIYA 4ENYA 4JMQA 4ASZA 5D7AA 4AW2A 5LXMA 2R3OA 1M14A 5DPVA 2ZB1A 5TE0A 2BMCA 3FDNA 2BRBA 4JLCA 4QTAA 3PJ3A 4FBXA 5IEVA 3MYGA 4J8MA 2VTOA 2HXLA 4BZDA 5KMMA 4G2FA 2QOLA 4O7NA 2WIHA 3QLFA 3NYNA 4FTTA 4QYHA 2PVNA 4I5CA 3UGCA 3NFFB 4U81A 3AG9A 4S30A 1Q24A 2RF9A 4HCTA 1M17A 2XIZA 3FXWA 3WF9A 2YCFA 3O0GA 4FV3A 4APCA 2ZV9A 4EHZA 4ENXA 4MD7E 3L9LA 4HZRA 4U9AA 5LARA 4W4WA 2QO2A 2Y9QA 3R21A 4Y85A 5FEQA 4M13A 4D4RA 1CKPA 1REKA 4E5BA 3TWJA 3RINA 2UW6A 5CF4A 5GZAA 4FKOA 3I0QA 3S2PA 1Y6AA 5EHYA 5HE2A 4XLVA 2J2IB 3NNVA 3POOA 4HPTE 5KHXA 4KIPA 3UOHA 3CSVA 2YHVA 3QF9A 3QD3A 3W2RA 4AXEA 4RJ6A 5LQFA 3FEGA 2VUWA 2WMQA 1J7LA 5DRBA 5CSPA 4E73A 4O84A 3VS5A 1Y6BA 4EZ7A 4D9UA 3LCSA 4NH1A 4OUCA 4PTEA 2VTIA 3MH0A 5L8JA 4BI2A 3A7FA 3RJCA 2QCSA 3EFWA 2VX0A 3D2KA 3MFTA 4AW0A 5CASA 4X2GA 5CEOA 3MFSA 3KVXA 5AP1A 1HCKA 3R22A 4I5PA 3I7BA 5CQUA 5HLWA 4M69B 5HI2A 4EKKA 1ERKA 4D4VA 3W32A 1UU9A 4PMMA 3FMEA 5BYYA 3OEZA 5ANEA 5AV4A 3QRTA 5JZJA 4OW8A 1OL1A 1TZDA 3KRRA 3NAXA 3T3UA 3V5QA 3NUPA 3GCUA 4RIYA 2OGVA 2PZRA 3EQBA 4QMNA 4FV1A 4R5YA 4BRXA 4BYJA 4AX8A 3U6JA 4EWHA 3G6GA 4FZDB 1SNUA 5LMBA 4OAUC 1RW8A 3DAKA 1H00A 2NRUA 3BYUA 3VW6A 3VUIA 4R78A 3BELA 3PLAE 1K3AA 4OTGA 2OF4A 3OOGA 3DBCA 3DAEA 3HA6A 4LL5A 5FQDC 3R9OA 4QMWA 3TKUA 3BV2A 3EKNA 4GJ2A 4AQCA 4CYJA 3MY0A 4WNMA 3DOGA 3HV4A 4ZLZA 4I20A 5B0XA 4FEQA 2QOKA 1PXLA 1FPUA 4RX8A 2C6MA 3NUUA 4WT6A 4L53A 5L8LA 2ITWA 5GJGA 2HCKA 2GNJA 2F49A 3NUYA 4U97A 4FYOA 4EH2A 1BI7A 2O5KA 3W0RA 2UVZA 3A99A 5EYKA 3GC7A 5J9YA 3OFMA 4PL3A 5GZ9A 1YVJA 3F6XA 2R3GA 3BV3A 4PDSA 4WOVA 2C0TA 5JQ5A 3G0FA 2CNUA 2B1PA 4NZWB 2EUFB 2JIVA 2QHMA 3G9LX 5BVWA 4WKQA 3V5PA 2YLFA 5LMAA 4YJUA 3PSDA 2IEWA 2IZTA 2ITYA 5AV1A 5ETFA 5CU6A 4YNOA 5ACBC 4C33A 2WXVA 4YMJA 4JG6A 3NDMA 1OIQA 4X2FA 5AIKA 2PVMA 3RHKA 1SYKA 5CXZA 4DHJA 3C0HA 2QO9A 4RJ5A 3QTUA 3VW8A 3EQIA 2F9GA 2H9VA 4AZWA 3RAIA 5L3AA 5IQBA 2GTMA 3D5XA 3OF0A 4IAFA 3TJCA 4YLKA 5HIDA 3CQUA 3VBVA 4KBCA 4LGGA 4FODA 3NLBA 5DT3A 2VZ6A 3LFFA 2C68A 4C59A 3IDPA 3Q2MA 1MRVA 4E6CA 4EKLA 3H0YA 4JIAA 3WZKA 4O7ZA 3RK9A 3MB6A 2J5FA 4H1JA 3DB6A 3DKOA 4AFJA 3CGFA 3FQHA 4TWOA 4NU1A 4CXAA 4F70A 4I0TA 3FXZA 5L6OA 5L2IA 5E8TA 3MA3A 1RE8A 3GBZA 3QCQA 4J8NA 3UBDA 3UP2A 3ZOSA 4ANNA 5CXHA 4MBLA 4LM5A 5FWKK 2I40A 2XJ2A 4NL0A 4FTAA 4BWKA 1J1BA 4WHZA 2E2BA 2EU9A 3EN5A 5ANGA 2XARA 2OIDA 2CLQA 2YM8A 3GC8A 4DH5A 3R9NA 3NRMA 5J9ZA 1EH4A 2VU3A 3OXIA 1IAHA 3DT1A 4AFEA 4IXPA 4XS2A 4CMTA 3P5JC 1YQJA 4I6HA 4X0MA 2HELA 5AP0A 2JDRA 1CKJA 1U5QA 4RIXB 4GV1A 5FGKA 4FKIA 5EW3A 4A9YA 2Y6MA 1B38A 2VWUA 4AT4A 5BVOA 3PIYA 2J0LA 4KNBA 5CWZA 5HNBA 3WIGA 5JEBA 4PMTA 4MXOA 4I0RA 3SG8A 3TT0A 5KZ0A 2ITPA 4RQVA 3RZFA 3VVHA 4EH6A 2A1AB 2FYSA 3QZFA 2BIKB 2HZ4A 3KGAA 5HVYA 4OTWA 2VNWA 3S4QA 4O4BB 4V0GA 5ANKA 3AGLA 3AT3A 4CCUA 1B6CB 4DINA 2ONLC 4L3LA 2JAVA 4IFCA 4BKYA 4V0GB 3Q5IA 1SZMA 4FTLA 4ZMFA 3ZO3A 3EN7A 1Q99A 1U5RA 3L9PA 5EI8A 3JUHA 4KINA 1YWRA 2GMXA 3IW8A 4YJRA 4E93A 5AFVA 3NWWA 3DK6A 1FVVA 1GJOA 3AKKA 3IKAA 3TDWA 3C5UA 4OBPA 1ZMUA 4V01A 3NEWA 5DFPA 5LVLA 4BI1A 5FM3A 2C69A 3A4PA 2X8DA 4DFZE 4PNKA 4GL9A 5EM5A 3AC5A 3WF5A 3UQCA 2EXCX 1LEWA 4J1RA 5BMSA 3F7WA 4BDKA 5M53A 4LV7A 4FVQA 1NW1A 3B8RA 1XWSA 3UIBA 3WARA 1ZXEA 5JFWA 1QPCA 4CD0A 3H10A 3M1SA 3FLNC 4IC8A 5HVKA 3LCKA 3OROA 1WFCA 3EYGA 4FIGA 1JSVA 4L52A 3OBJA 4DBNA 2W17A 3QAME 2CMWA 3GCVA 4GFMA 4ZTLA 4U0IA 4FL2A 4CTCA 4EH9A 1XQZA 2JDVA 1YXVA 2C3KA 1YXSA 2GS7A 3I81A 3U9CA 4G9CA 4D1SA 5IZFA 4I93A 3CY2A 3NFGB 4ANOA 3PY0A 1H4LA 3UJGA 3UVPA 2RG5A 3HX4A 5HESA 3PVBA 4KIKB 2UZWE 5TOZA 3R9RA 2X0QA 2XJ1A 4YZ9A 5E92A 3LJ2A 5HGIA 4USFA 4D28A 3VUMA 3F2RA 3BYOA 2YABA 3ET7A 2GQGA 4PL4A 3G0EA 4IBMA 2RL5A 2W1CA 4PTGA 4PPCA 3I60A 5JGAA 4IFGA 4WNPA 4IVDA 2CCHA 3W0PA 4DCAA 3H9FA 5KMKA 4JS8A 1GZNA 2H96A 3EN6A 4J97A 4QNAA 4RRVA 3SV0A 4BN1A 1BYGA 4QYEA 5DBXA 4L8MA 2R3JA 3ELJA 2NP8A 5B2KA 3LJ1A 3ZFXA 3LM5A 5CVFA 1W8CA 5A14A 2OZAB 4BTFA 4F08A 3DJ7A 1NVSA 3OC1A 3P7BA 2ITNA 3BGZA 3NNUA 2IZRA 3BHYA 3PXFA 3S0OA 1Q8WA 2XZSA 4BDFA 4C4IA 3DXQA 4NKSA 2P33A 4FSYA 4O7WA 1OIYA 4MD8E 4MNFA 3QL8A 1KE8A 3OCTA 4X2KA 1P4OA 4O6EA 2WIPA 3R9HA 5HU9A 2P4IA 2VWBA 3HRBA 3NSZA 4F6SA 4DBXA 5I3RA 3QALE 1ZAOA 5IQIA 3NW5A 4CT2A 3KIOC 2BAQA 2B9JA 3C13A 1FMOE 3UQFA 4Y5QA 1R0EA 1W2DA 2DWBA 3R8UA 2XEYA 3DXNA 3OWLA 3RI1A 3THBA 2I7QA 4A4OA 2UZNA 4LGDA 4JBVA 4U41A 4PL5A 3V01A 2FB8A 2PMOX 2Y8OA 2WMRA 3FMHA 2VN9A 3HECA 4U42A 2X4FA 3DU8A 4WG3A 4HW7A 4P5ZA 4PTCA 2ITTA 3OWKA 1VJYA 4O1OA 4E3CA 1YXTA 4NIFA 5B2LA 3F5PA 4AWIA 4DH1A 4EZ5A 3ZLXA 2VTHA 4UMUA 2ERZE 2XS0A 4NIFB 4YTHA 4KA3A 3UG2A 3NIZA 3KA0A 5JSMA 2XK9A 4MHAA 1QPEA 4FK6A 4XOYA 2ZB0A 5IF1A 4I4EA 4V05A 4L3PA 4MQ1A 4A9TA 2Y4IC 3NYVA 4APPA 4DITA 3MFUA 5D41A 4E8AA 4QMXA 3W0SA 1JPAA 2E9OA 2QO7A 4JAIA 3RHXA 4U8ZA 3R8PA 5BVKA 5HQ0A 3DY7A 4O96A 4CZTA 1A9UA 1ZARA 3O2MA 4FV7A 2C4GA 4IB3A 1U46A 4QDEA 5E4HA 1J91A 3F82A 2W9ZB 1Y91A 4MXCA 3TUBA 1G8SA 2XALA 4AA0A 2OZOA 4C34A 3QX4A 3ACKA 2PTKA 4WNOA 4M68A 2YZLA 4R8QA 4CQGA 5LVNA 4CFWA 5D12A 4ZTNA 3RP9A 4FEUA 2BDJA 3NGAA 5KZIA 5CZHA 4GUEA 3VS0A 2PPQA 4IAIA 4W4XA 2QOQA 3KXZA 4FSQA 4TKSA 3VULA 1JKTA 3Q52A 3BU3A 2EWAA 3UMXA 1J7UA 4F9AA 3KCFA 3BYVA 3W2SA 1OM1A 2UZLA 3O51A 1I09A 5EHOA 3LFNA 4NFMA 2C5VA 3P23A 3H0ZA 3ZLYA 3OTVA 1AD5A 3OUNB 5CZIA 1Q8YA 3DZOA 3F3ZA 2GHMA 5CEKA 3HAVA 1H1SA 3DJ6A 2CDZA 3P86A 3W10A 4E6QA 5ETIA 4RVLA 2O8YA 5EH0A 4DEHA 5ETAA 3ZUTA 4L68A 1H28A 4YTFA 5EYCA 4U3ZA 4ZK5A 3QQHA 2Y4IB 4K1BA 4BCFA 1LEZA 1WBWA 3QTWA 4BBFA 4BCNA 4CRLA 3A2CA 2IF8A 3F3WA 4FJVA 1YKRA 3BQRA 3E5AA 4IX5A 4GK3A 3TKIA 1ZOGA 3W0OA 5J9LA 3BE2A 4B99A 2YM7A 2F7XE 5JGDA 5J1VA 1A06A 3BQCA 3DNDA 2R64A 4GVJA 2XNPA 4TYIA 5AUWA 3QC4A 2W1ZA 3M11A 5IISA 2PMIA 4FOBA 2BIYA 4IDTA 4IZ5A 4XG4A 3PG1A 5JFXA 3O7LD 4BC6A 5KX8A 4WUAA 3UNKA 3MSSA 2QOHA 4NT4A 4FVRA 5IU2A 4G6NA 2V7AA 2OSCA 3PIXA 4MF1A 3GU6A 1HCLA 3TZMA 4QP8A 5L2TA 4TYHB 5DRDA 2E9UA 4C4FA 1A48A 2I6LA 2HAKA 4GIHA 3C4CA 4U5JA 2UZTA 4C2WA 4R6VA 2IW6A 4J52A 2F4JA 1F5QA 3MI9A 1GIHA 1SNXA 2VWIA 4EL9A 3QTRA 3MJ1A