1W88B

The crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
324
Chain Sequence
b'AQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA SUBUNIT
molecule tags Oxidoreductase
source organism Geobacillus stearothermophilus
publication title A Molecular Switch and Proton-Wire Synchronize the Active Sites in Thiamine-Dependent Enzymes
pubmed doi rcsb
total genus 111
structure length 324
sequence length 324
chains with identical sequence D, F, H
ec nomenclature ec 1.2.4.1: Pyruvate dehydrogenase (acetyl-transferring).
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w88B02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w88B01
2BP7A 2Q5QA 1UM9A 2E6KA 2WVAA 1RP7A 4FEGA 5EJ9A 2JI6A 3EXFA 3UPTA 4JUBA 3IAEA 4QQ8A 3LQ1A 5EJ8A 3ZHVA 2QTCA 5AHKA 3EXIB 2AG0A 2Q28A 2VJYA 3EYAA 4K9NA 4WBXC 1V1MA 4GP9A 4K9LA 2R5NA 4C7VA 2BFCB 3UK1A 1T9BA 2W93A 2G25A 4K9OA 1YI0A 3ZHSA 2C3MA 1JSCA 3ZHTA 4QELA 1UMBA 1UMDA 2VBIA 2FWNA 3DV0A 1X80B 3EXHC 3EXHA 2G28A 2BFCA 5I5GA 1POXA 3RIMA 2BEWA 1B0PA 1MCZA 1V16A 1ZPDA 2Q5OA 4GM1A 1YBHA 2EZ4A 1N0HA 3EXIA 4D5EA 5EJ6A 1NI4B 1TKAA 2VK8A 1PYDA 4K9QA 1WCIA 2UZ1B 2R8OA 4RJIA 2JI9A 5I5EA 4MPJA 1V11A 2FN3A 2VBGA 1X7ZB 2WVGA 5EXDA 1X7ZA 3M7IA 1X7XB 4MQ5A 3HWX1 2J9FA 4MZXA 4KXUA 2BFEB 1UMBB 2BEVB 1OLSB 4K9MA 2JLAA 5DEIA 1YNOA 1OLSA 1DTWB 3AI7A 1ITZA 1UPCA 5ESDA 4MPPA 1UPBA 2XT9A 1V16B 2VK4A 3AHJA 4RJKA 3DVAB 3EY9A 1Z8NA 2O1XA 2JGDA 1X7XA 2YICA 4KXYA 2IHVA 1V11B 4JUAA 3M6LA 4JUDX 3DUFB 1T9DA 1QPBA 2EZ8A 2X7JA 1OLXA 4JUCA 4JU8A 1OZFA 4JU9A 2JIBA 3F6EX 5EJMA 2O1SA 1QGDA 1L8AA 2OZLA 2PGNA 2Y0PA 1V5GA 1AY0A 1PI3A 3JU3A 5EJ5A 1GPUA 1OLXB 2C3YA 3EXHB 1X80A 4D5GA 4XEUA 2JI8A 2V3WA 1QS0A 1YHYA 2JGDB 3E9YA 4K9KA 1W88B 3MOSA 4KXXA 2JLCA 3DVAA 3F6BX 4GM4A 2J9FB 1X7YB 2BFBB 1OZGA 2IHTA 2Q29A 2BFFA 3EXEA 3FLMA 1DTWA 4Q9DA 5ERYA 2XT6A 3FSJX 2BEVA 1PVDA 3M34A 5DGTA 2Q5JA 2VBFA 2C3UA 1WCIB 3HYLA 2UZ1A 2QTAA 2Q5LA 3OE1A 2EZUA 4ZP1A 2NXWA 1KEKA 1UM9B 5EJAA 5IMSA 1PO7A 4GG1A 3LPLA 5ERXA 4JUFA 2Q27A 3EXFB 5HYVA 3AHIA 1T9AA 3DUFA 5DGDA 2C42A 5HGXA 1U5BB 1R9JA 2BFDB 3EXG2 4FEEA 4COKA 1NI4A 2XTAA 1V5EA 1OLUA 2BFFB 3EXEB 3M49A 3OOYA 1YHZA 1NGSA 1TRKA 1X7YA 2BFBA 5K6TA 1UPAA 3KOMA 1Q6ZA 2WVHA 5EJ7A 5EXEA 1V5FA 3ZHUA 1T9CA 1OZHA 1W85A 1QS0B 5K2OA 4KGDA 2AG1A 1X7WB 4QPZA 4K9PA 5FEMA 3ZHRA 5HJEA 1POWA 2DJIA 1V1MB 1OLUB 2G67A 4C7XA 2JI7A 3HWWA 1YI1A 2BP7B 2OZLB 2EZ9A 3EA4A 3FZNA 1V1RA 4GPEA 5EJ4A 1TKBA 1Y9DA 3IAFA 5HHTA 3ZHQA 2IHUA 2UZAA 5I51A 4KXWA 3AHDA 5C4IA 1OVMA 4GM0A 1BFDA 3AHHA 2BEUB 1W85B 5I4IA 2C3OA 3AHEA 2C3PA 3AHFA 2BEWB 1TKCA 2PANA 2VK1A 1YD7A 1UMCB 3LQ2A 4JD5A 1W88A 4MPRA 3EXG1 1UMDB 2R8PA 3DV0B 1X7WA 4RJJA 3L84A 2PGOA 5K6RA 2PDAA 2YIDA 2BFEA 1U5BA 2BFDA 4KXVA 3AHGA 1UMCA 1IK6A 2IEAA 2EZTA 5K3SA 3AHCA 3LQ4A 2C31A 1V1RB 3D7KA 2BEUA
chains in the Genus database with same CATH superfamily
2WAYA 2VP5A 1UOPA 2J33A 2B4QA 2ENWA 5K1ZA 1JQDA 2JI6A 4ML3A 1G21A 3SYLA 4PO3X 2V0NA 1U3FA 3GR6A 3P4XA 4R40A 1PK8A 2IWHA 4CMIA 1ZUWA 1XGKA 3LF2A 1VLVA 1Y3DE 3EPHA 2QXTA 2JATA 3KHTA 5EWJA 4OCZA 5GJWC 4CMEC 1QGYA 1U0HC 5FADA 3N07A 2R47A 5AW4A 1YDEA 1CPYA 4AULA 1YBAA 3RHZA 2KLHA 5DM0A 3HVJA 4A0FA 4JI5B 1H94A 3CLUC 4W9NC 4D80A 1Y9AA 3A0RB 1PR9A 3DTYA 3FCYA 2ZOSA 4WZAE 1ATZA 4ZMSA 1C4OA 2WYIA 4X6YA 3RAFC 1Z6PA 4RS4A 5HQ3A 3OTQA 4CM8B 4L16A 3OIUA 4MTCA 4LZJA 2VJDA 4DV5B 1HYQA 4OB7A 2AX4A 2WWWA 3H7IA 3LHKA 2BMVA 2Z8XA 4MVCA 5FULA 1JIQA 3DDHA 4BKMA 5LQKA 1Z2EA 3FFWA 5A0VA 1EINA 2DUMA 2HNAA 2LIPA 1LSOA 1CQPA 2GHRA 4KXLA 4WXRA 2ZJ5A 721PA 2XCLA 2LP4Y 1TM1E 3BCHA 4NMLA 3H6GA 2VFAA 1P9OA 4LWZA 8ADHA 2XZLA 3RC8A 2X4DA 3QFCA 5F3WB 2Q5CA 4BFUA 3SS9X 4UXHA 3NDBB 1AQYA 2ANBA 2YS6A 2GUGA 4OB8A 1P33A 2B8JA 1JHVA 3O7MA 2JRCA 3WYDA 4TL9A 3CR7A 2XSZA 3C3DA 3C45A 3H13A 2REXB 3Q2IA 3SLKA 5DP2A 1GNTA 5JASA 2TYSB 4KFCA 4JS0A 4ZAVA 2YXPX 2XGOA 4ARCA 3DFUA 4B6OA 1X42A 3WHKA 2HY7A 2BI8A 3GGOA 3TW6A 3NJ8A 2W71A 4G0ZA 1O87A 1JYFA 3H8WA 4KJZA 4A16A 3OAAD 4IIJF 2X0RA 4GC9A 5FPSA 2H2GA 5B3LA 1O54A 1SUIA 2JLQA 2XYRA 2QTGA 2J4FA 1JI3A 1XC7A 4HTAA 4NHEA 9MHTA 3PYXA 4Y0AA 3VR3A 3L0YA 4X63A 2VO1A 1YCDA 5FTJA 2NO4A 4N76A 2VPTA 1SOMA 3AIMA 3DR5A 1XEFA 4YRCA 4PS0A 3PBKA 5JI3E 1CLUA 1CV2A 5A7GA 2HB6A 3V4RA 2D59A 3P4YA 4Y2JA 3OZRA 1DIHA 4Z2AA 4FEYA 1D2MA 1KOJA 3PRJA 4NHOA 3O0TA 2XHZA 1GSIA 5I47A 1E98A 2ZAYA 3ER6A 5KQSA 1E2BA 3L4EA 4HNHA 1Z2DA 1C29B 4GZLA 4CEIB 2QVCA 4EOGA 3UC5A 2P8JA 1POWA 4NAUA 4AZSA 4DMFA 4KWEA 4D4HA 2QRZA 1YOBA 4RMJA 3WHLA 4E08A 5A4DA 1IQUA 1B15A 1VMAA 2VEOA 2E1PA 4Q47A 4EB3A 3OKAA 5MFZA 1MN6A 4JASB 3TLEA 2XXAA 2DP4E 5G0TA 2XQKA 4HV4A 3AHHA 1XCBA 1TXGA 4GBMA 2QMHA 2JLZA 3R9XB 5LBUA 2FWJA 1KVTA 4CEIA 1A7AA 4NJOA 3QOWA 2ZGVA 4MA5A 4B9AA 4EKNB 1Z63A 2O8DA 3I2GA 2Q2VA 3QMPA 4GVXA 2W8BB 5JRZA 3V34A 1TCBA 4F4UA 3ZC3A 2IOFK 3AV0B 3Q3GE 1YZHA 2WJPA 1YBVA 1Y0BA 4DJEC 4BJ5A 2M98A 4B73A 4Z54A 1W6UA 1CKEA 2H08A 1NVEA 4F3CA 3PHCA 4Q0MA 5HKOA 1INLA 3LRPA 4MUXA 3VO8A 1ZCAA 2HMTA 1X38A 4ZCLA 4B4KA 5IJZA 3ZQUA 4G56A 3JSXA 1E1CA 4U7PB 5BYAA 4CR7A 5AW0A 2PSSA 1UXHA 3I09A 2QRGA 2YC4C 4PLFA 2DHEA 4S12A 1DHRA 4RHYA 5IW8A 1SUBA 5F9MA 3TZBA 1DINA 1YA6A 4ZZ3A 4MMYB 3G5MA 4MVJP 3HYNA 4DLPA 1D03A 1X9GA 2BFWA 4L57A 1TZJA 2GZ3A 1JAXA 2OXFA 2AMYA 4HLUA 2C7QA 3HI4A 2ODTX 2GA9A 4RL4A 2O8CB 4E5MA 3ZCXA 1EJ2A 2FVYA 2PGJA 1TA9A 1IATA 1AKYA 2QVBA 2FEXA 2QE7A 3EMDA 2WHRA 4I5FA 4DDWA 1V43A 3OZCA 5KHOC 13PKA 1OU4A 3PWTA 3GT4A 3NO4A 3VR6D 3A2KA 1EUDA 1IHOA 2PD4A 1KYVA 2J3LA 5DGCA 4BWVA 4D8XA 3UMMA 4OQPA 3SICE 1PEKE 2RGGA 5DRYA 2ZB4A 4YP1A 1Y5LA 3DDZX 3OZSA 5CAEA 4ZTUB 1P0CA 2E82A 2PBRA 3ETCA 4QYWA 4WZAB 2G63A 6REQA 2EFGA 3E53A 2XUZA 2ZLBA 4UM9D 4N9QA 3RLFA 5JLJA 1VJGA 5IAGA 2P69A 3E23A 4EA6A 1JEYA 2IS2A 1M6VB 1PYOA 4MKRA 1NC1A 2W9XA 1M8KA 2AL7A 4ZEMA 2FJUA 4G1MB 1LEHA 4DV3B 1J2JA 4D4MA 4HH4A 4EGAA 2TMDA 1KIFA 5KDLA 3H6HA 3EXHB 2O3RA 5ILGA 3JPWA 4QPJC 5K45A 2LNDA 5EXPA 5DZSA 4KR6A 3SZRA 3K9CA 1N5OX 3FVRA 4I4CA 2I1QA 2C5EA 2DB3A 5AKHA 1D4ZA 3LDHA 5AXBA 5BY2A 2HBRA 3OUTA 1JYEA 3AESB 2D5BA 2R6GA 5FWXA 1F2TB 1I9CA 1LTKA 1N2OA 2JCYA 3VHRA 4I6GA 2NUPB 1YR3A 4ZT2A 1NVXQ 2PX8A 2WD7A 3S44A 3T5GA 1H65A 3UANA 1J2TA 2XWSA 1UIRA 3U62A 4OXQA 3K16A 2CT8A 2CLEB 2ZT5A 3P9YA 5B37A 3BWDD 1JDVA 2B30A 4MPTA 3UKOA 2J3EA 2Z2IA 3RF6A 1IAQA 1ZMRA 2J09A 4C89A 1E8NA 1UJ6A 1ZICA 3X1ZA 1E2LA 2JAPA 1K7SN 2Y05A 1NOJA 1R4NA 1Z82A 1EB8A 2V6IA 4KAXA 2BPOA 2FPGB 4OP1A 1T9CA 1CXZA 2HXGA 3AVPA 3M4YA 1S2LA 3NNSA 3DTVD 2F3PA 4BO5A 2WVJA 4ZJPA 1I5RA 1GNQA 2VPWA 2VKTA 4MITA 1QZ3A 5J63A 1U8AA 3T4UA 5CXUA 5HJEA 4E5PA 1G5PA 1P8JA 3VH1A 1A8IA 3B5JA 2PJDA 4F1JA 3AIIA 4HGQA 1GQRA 3CURA 3OZTA 3PCTA 3KXPA 3NYQA 3QELA 3T94A 2NACA 2G3YA 2G71A 1W85B 2NXNA 3Q0EA 3RQSA 2VEDA 4YT4A 1K88A 3QVVA 2ZZKA 1V3TA 4TT8A 5DBOA 3HBMA 2W2XA 3TRDA 2RHWA 3L7NA 1R0CA 4BE7B 1XRSB 1WQ1R 3RC2A 3DDCA 4HDAA 1VA5A 3D7KA 5IARA 3HBAA 3H7AA 1GUZA 1OWPA 3FM9A 3KLNA 2NYAA 3NAQA 4O3FA 4H1HA 1B1CA 1OFIA 1U0JA 3LAWA 4NJEB 3WDKA 2BGNA 3RVPA 3ZH2A 2VNAA 3ZGZA 1X1DA 2BVNA 4RVCA 4Z9FA 2J4CA 1N1DA 1PVOA 4Q9NA 3MERA 2R5NA 2OPBA 2IPXA 3KSMA 4WKPA 1HL7A 2KI5A 3MNFA 1GUAA 2Y0BA 3F3YA 4KUHA 3ZNNA 3HP1A 2JFWA 2VATA 4MP3A 1QFSA 4TWBA 5KTNA 2P62A 5HIKA 3AOGA 5IEJA 5EUCA 3AR5A 3DZDA 4AJ9A 3OEHA 1O94A 4LE0A 4GDMA 1NLZA 5FUMA 4DZTA 3QF4A 4XR9A 2MDTA 1OT3A 2VBCA 3WRXA 4QHSA 3ZJ4A 4ACBA 2XNKA 4D0LB 4KQWA 1CK4A 1PSWA 1BGVA 5BURA 1OHHD 3CYFA 1VBFA 3KPJA 4M98A 4P84A 5CW1A 5LBTA 3EVZA 2CJXA 2ZANA 1JG7A 5J58A 1EU1A 4PQYA 4GQAA 3R2JA 2F8MA 1Q95A 4KACA 4Y2TA 4H1WA 3W6NA 4XOUA 2IPMA 2ZJZA 1P1CA 1K6MA 5BR1A 4ZYWA 3K9WA 2QMQA 4RJLA 2K2WA 4F6CA 4BMPB 4LC9A 1C9MA 3K6RA 2Q7OE 3CNQS 4JU8A 5DBHX 3FZYA 3GWZA 1ZGZA 4JJ4A 3WNCA 3E2IA 4OXXA 3RV4A 4DSOA 4WBNB 3G3EA 3RRYA 1OAAA 2QX7A 3CW9A 1O97D 2V5VA 3G7UA 4XEUA 2NO9A 2Q4EA 1COWA 1F7VA 2YJTD 4NABA 4N6NA 4D7AA 5IT4A 2MSCB 2REQA 2L82A 1VRWA 2FFHA 4NU8X 4UVGA 2CYCA 5K51A 1W36B 1WNTA 5K3CA 4ITRC 5JYCA 2B61A 1ZG3A 1JKXA 3PQDA 3OMWA 1EESA 3S81A 4XYGA 3ECAA 5AW1A 2HQOA 3DAPA 1DDGA 2BD0A 4PC1A 3LUBA 4WK6A 2PSEA 4RQUA 1ADGA 2XCQA 3WLTA 3F5SA 7MHTA 1KMQA 3W8RA 2W4QA 3T3DA 3REQB 1T9KA 3FZEA 3NUGA 3EUEA 3JQQA 1EAMA 1OBVA 3I0NA 3VR0A 3DMNA 3TW8A 1DRUA 5E95A 2BGKA 4GUDA 2N75A 3RSZA 4EY8A 3VVCA 1I7QB 1WVIA 1JVNA 1K0UA 3NC1C 4KBFA 4O4HA 1IN1A 1N2CB 2XNHA 4XD7A 3ZXYA 4OFBA 4D9HA 4TUYB 5FIUA 3WGLA 2EKBA 5IH3A 1E1DA 2MWMA 2C7OA 1AC5A 3SKXA 2IU3A 3VI4B 5E38A 4S1TA 4PGFA 3QSYA 2QW1A 3F3KA 4GM0A 4BFLA 2P2NA 3N0TA 1A7UA 4JI8B 2PANA 4IQ8A 1W94A 5B55A 3M9LA 2XQGA 2VZ9A 2GM4A 3LHSA 4FOSA 2WD9A 3QOXA 3VZDA 1JHYA 4NYJQ 2BFEA 3IAHA 4RK0A 1H2YA 5IHPA 4ZHQA 1XNGA 5LXTF 3Q12A 4MUEA 2O2EA 4KVAA 2KJQA 2Q5QA 3CLRC 5AW7A 2IYXA 3HDYA 2JGMA 4ZK6A 2JVJA 2CXQA 3M33A 1F0KA 1L4FA 1OI4A 2YV5A 4MI9A 2VJYA 3X1JA 4LOIA 2EG5A 4I81A 3AH8A 5LU8A 4DRXB 4PIMA 3CLSD 4YBZA 4RKWA 4KQ2A 2L0XA 2FUNB 5ALEA 1NBME 2QMZA 3B38A 4ALNA 1CS0B 4C07A 2VHTA 1IC6A 1NN3A 2P27A 4CMCA 1FX0A 5BR4A 5E9WA 3EYWA 1XKXA 2XF2A 2UVDA 2VNSA 3HSSA 5JWRA 5JG7A 2CMFA 2OBMA 3IVGA 4UBMA 5LQSA 3ZNQA 4BZXA 5ADHA 2OCIA 1SY7A 2FN3A 2DR0A 4K8OA 4L6IA 1WMFA 2G77B 3HKCB 1RC8A 2J9ZB 2VNJA 4ZVTA 4JMPA 6LDHA 4CHTA 2R9VA 1WZ2A 2BLNA 1XZGA 4JJ8A 1T3TA 4QOJA 5EJIA 1RPNA 2POCA 4BNHA 4CMEA 4DV1B 2B5VA 3DE6X 4BKOA 1YNOA 1W0KD 5FORA 1P29A 2EL7A 4X1KB 4N01A 4BO9A 1MRZA 2R6DA 2ODBA 1DBPA 2EX4A 2OAP1 4ARBA 4B8YA 3KQOA 4UUOA 3ZDEA 5JSZB 4UW9A 3EGCA 2AG5A 5HMMA 1UFRA 2IDJA 4TXNA 4DV0B 2Z6UA 2I4IA 3NOVA 4BJ6A 4QUEA 1ZN2A 4ALMA 4DG5A 2JJ2A 2P4QA 3H5LA 4GVPA 1YRHA 1AY0A 4NZYA 1EWKA 5CURA 3RO7A 7YASA 1GHTA 4AS1A 2PKWA 4EP1A 2ORYA 1X80A 3HBFA 2JAWA 3RVJA 3NAMA 5I48A 3D3QA 1ML3A 3HKEA 2REOA 4I1YA 4U2KA 3WDMA 4B3XA 4HB4A 2NTYC 1L4GA 2PUJA 1Z5GA 2BBWA 3NQ41 4LYYA 1XQVA 1X8XA 3MXTA 4MUBA 3GLVA 2YJ3A 3MUEA 3LQYA 4JB2A 1Q21A 1Q0ZA 1YL6A 4ZVUA 1JS1X 3V8QA 3A1NA 1C8VB 1OI3A 3NOQA 2GF0A 4P32A 1ZNXA 3SF8B 3TAXA 2IBSA 2WKRA 3THWB 2OGZA 2EIHA 2V65A 4LDJA 4CLOB 2WI8A 1G59A 1OX5A 1QHNA 4RK1A 2B34A 3RFFA 3QJ5A 1Z5NA 1FFWA 1KRHA 1GGNA 1M1NA 1U81A 1T0HB 3KB2A 3RSQA 4B3RB 1AXRA 2XJ9A 1NYTA 3DLCA 1V45E 1A3CA 1NX9A 1W1WA 2EJTA 3MB5A 1Z8FA 4ND4A 3TLKA 4E14A 3TIIA 3UMYA 2ERYA 3KUCA 3IDZA 3NASA 4OB6A 5BNWA 2TRSB 4B48A 3RADC 3FBTA 3U31A 3U4HA 5DYGA 2FUG6 1RJDA 5D3ZA 4ZQCB 3K8YA 3OTHA 5CA0A 3KJIA 3QENA 3LUKA 1UBRS 1Y8AA 2AW3A 1L4EA 2XEXA 1Q7BA 3DJYA 2ZAIA 1VHQA 1G2OA 4B7CA 1WB6A 3H5NA 2ZXFA 1NLYA 4BB5A 5BMVB 2C1ZA 5LMZA 3IPRA 2R8PA 4L2IB 1DIGA 1SXHA 3HCPA 2VHYA 3SMVA 1KFCB 5LM3A 3RYCA 4G67A 1MA0A 4QU5A 2OUIA 5P21A 4D41A 4ZAFA 4Q39A 1PR5A 1XPUA 4ZYTA 2MU1A 4RQBA 3HU3A 4XEHA 3THOA 1RP7A 1ZK4A 2I5PO 1I7PA 2J3MA 3I8OA 5I7EA 3AQ4A 4HB3A 3K32A 4LHXA 3WIVA 3W2TA 4LZPA 3ADDA 3C43A 3D5TA 1U2TA 1NM5A 3WAGA 5CT9A 1JZQA 4PO8A 2Y77A 1SVLA 2J0UB 2B1QA 4EDFA 4R7TA 3V9AA 3C3YA 3S99A 1MQAA 2G28A 1NVVR 3N75A 4MUYA 4RY9A 2Q5OA 1U1FA 2OECA 2FOXA 2RIRA 1JKFA 1BMDA 4IHQA 3RHTA 3I6MA 1DBRA 1K3TA 1ZUHA 3EVCA 1JDNA 3BK7A 3DHNA 3V3TA 2VF7A 5C18A 5DULA 5D5QA 1RI1A 3EWSA 5LMNB 2HLPA 3NETA 3L07A 4C4PA 2VTEA 5CBKA 3RBAA 5TEWA 4JJKA 2O59A 3O93A 2PFKA 2BFEB 1RZUA 3GGDA 4CF7A 1WPQA 3HXTA 4FIDA 3ER9A 3U9LA 3PA6A 3ZY2A 1NYLA 1WMBA 5K3EA 3D6TB 5JNWA 4E51A 3R3UA 3WXBA 3FKSA 4R69A 2J46A 2ZBGA 4J1SA 1GZ7A 3Q7PA 1TAUA 1XCJA 2AS0A 1LLQA 1JEQB 2PD6A 4KXFB 3REGA 2E4UA 1L5LA 3WL6A 3TVTA 2YY7A 5A4KA 4DR1B 2CSXA 4U7HA 2CEKA 4TS1A 1XK6A 4TMTA 3IAM1 4FGLA 3SR0A 5E3HA 3WLLA 1U04A 2RB4A 2V96A 3F74A 4M8NE 4JOSA 4P4GA 5HJ2A 1EXMA 4HJXA 2F3UA 2C20A 1TA0A 2CDCA 1EXWA 3QE2A 1NWCA 4RY0A 1ZXBA 3RS3A 5KNDH 4K2HA 4OK5A 1SKAA 2ZIFA 4QRDA 4CL2A 3E22B 3O8QB 4BMNA 4CDNA 2QRPA 1EXNA 4RTOA 3DZHA 3GUHA 4LDAA 2RCYA 4HN2A 4OHFA 4O4LB 4B2YA 4J0QA 3N2EA 3EXFB 3U1BA 4ECEA 3PQEA 3NEJA 3VTAA 1SUEA 3H5WA 4DV4B 3K0BA 2BR3A 5KINB 1EP3B 2AFHB 3KLMX 4IJQA 1OAOA 2QR5A 3EVAA 1ESNA 5LQCA 3STWA 4KDRA 5H9WA 1DC6A 3AFMA 3LL4A 3D8UA 3DHYA 2JJ2D 4XQGA 1D7AA 3P96A 3ZI7A 5JCJD 1SKQA 3JQDA 5DNYB 2P9EA 2QAGA 1TM4E 1AXGA 3ELWA 2GPJA 3CJQA 3L0ZA 1UP6A 1BRMA 4RO0A 2CDNA 1SU7A 3EHDA 4JJ6A 4OM8A 3A8TA 3EOBI 4A82A 5REQB 1WSBA 1GSAA 5I51A 4QNMA 3NOOA 4KRFA 4JP2A 3IMKA 5C8VA 4DSZA 5AUNB 4LPSA 5CT4A 3K35A 1UMDB 1R0XA 3GPCA 2XKAA 4JITA 4RZ2A 4AY2A 3FAKA 4O02B 3WP0A 2A7QA 2JZNA 2PFGA 4AMBA 1MABB 2OL4A 1A71A 4N5IX 4DM7A 4JLNA 2R97A 3J80A 4D57A 5DM1A 1XALA 4N5NA 5GZ6A 1SR8A 1JEOA 3AB8A 4K9NA 3IQIX 1D0SA 2WAMA 3FWYA 1DO8A 1U7UA 3SDBA 1GTVA 5I3ZA 3HY4A 4I50A 4DGSA 2DQSA 2YYZA 2HLDA 2WSBA 2RAUA 4ER6A 1EK5A 1KYIA 1E3WB 1QH1B 2F3SA 1KY5A 1V8OA 1ZA2A 2C59A 4P8RA 3USES 4EHKA 4QGSA 4OHPA 4YRNA 4TLLB 2OKCA 4JZYA 2HJSA 1T1SA 3HZOA 4PHGA 1G7TA 1LQUA 1OI2A 1CUBA 1H9BA 3IVRA 3O2SB 4XTCS 1IHUA 1L7EA 4Q48A 1N0VC 5E9AA 5JXJA 1RVDA 1WRBA 1C3JA 2H1SA 3TJRA 4RWEA 1KGSA 4X3PA 5JJBA 1D6MA 2XA9A 1VYHA 1BKSB 1NL3A 3A2MA 2EX1A 3BF7A 3HKBB 2HC9A 3G0GA 1VI6A 2C82A 2RAFA 2O1XA 1PWXA 2DKNA 3MTIA 3SJZA 1K92A 2IXAA 4KTVE 1SMKA 1YZTA 5A4IS 2YVLA 3GCXA 3VRHA 3VOTA 4G4GA 2AX3A 2QVGA 1CZHA 4QDZA 2GXUA 3VPSA 2Y0PA 4U7DA 3I72A 4UMDA 1KY2A 3GRVA 3Q3VA 3H2ZA 4H3VA 4Z7QB 3CXRA 3WLQA 4JSYA 2BI7A 3QLJA 4KRGA 4M46A 4F8JA 4JC4A 3FTFA 4B2IA 4FDMA 2GBPA 2HSWA 3F71A 4U3JB 2HA3A 1JZTA 1B6SA 1Q57A 2YWCA 4WTOA 3RUHA 3V1MA 4DSAA 4JXXA 4G84A 3KT6A 4J3NA 1QGZA 5F5XA 3OETA 5B7NA 1K7FB 2W37A 1RJ9B 2HF9A 1CYDA 2ISCA 4KAAA 3OQIA 3T1VA 4IHKA 2C96A 3A6KA 4IH1A 4L3VA 4LA4A 1J20A 2GF2A 1NP6A 1TVEA 2QLFA 1M6YA 3IIJA 3MGGA 1PT8A 3QQ5A 3EDCA 4HWSA 4L0CA 4YROA 1T1IA 2O0KA 5MGNA 3WWOA 2G72A 1BDBA 3AESA 2GTPA 2ZRJA 2HPHA 3WTBA 4FCCA 2APJA 1PS9A 3OX3A 1ICIA 1I5EA 2F6RA 3KEGA 4XCVA 3R5TA 2H7XA 2CJWA 3R7LA 1C3LA 4HEA1 1E7MA 1FRQA 2MSLA 2ZPTX 3GMTA 3HRHA 3K1YA 4IP0A 4URHA 3IERA 4IIVA 5BYBA 1T43A 3P1JA 1T34A 1ZQ9A 4FCVA 4JT2A 3VPBA 1ICEA 1P1JA 4IS3A 4DMMA 2PG3A 3QKSA 4HAZA 1Y9DA 3KSZO 3OZIA 1M6VA 2HEIA 5CCEA 1IN6A 1NJ1A 2FPWA 4XWYA 5AVJA 5THQA 1VJDA 5C8XA 1VE5A 1J56A 1PHRA 3RKSA 3LXRA 1SKMA 4L5AA 5ICCA 4XJVA 5AYVA 3TIGA 2XZTA 4MB0A 5AIBA 4PYOA 4QX6A 3MT7A 4CF4A 5JC1A 3HC7A 4RVUA 3KKNA 4U3JA 4F4JA 1GAEO 5E7QA 5HZHA 4P0PB 5IC4A 1EGMB 4ZO8A 2QN3A 1E0DA 1F1BA 2VWQA 3D7NA 3R1IA 1DJOA 1CERA 4GYYA 4WFQA 3G2MA 3GNSA 4BLUA 4D2IA 4G2TA 1Q0UA 1XP8A 4E94A 4JT4A 5B2EA 1W2GA 1KMCA 3HB1A 1Y80A 1UKEA 3KVYA 3MJVA 2EWMA 2XITA 1W87A 2AEMA 2X41A 4JEUA 3V5NA 2R60A 2UU9B 4MRMA 4I3HA 3KYIB 3JRWA 2YINC 3DV0A 3SLGA 3I04A 4FNMA 1KP2A 1E1CB 5I5GA 1P5ZB 5FA8A 2RGAA 5HF6A 3JYHA 4M54A 1Z4PX 4Q4DA 4WOPA 4X7RA 4C3UA 1OBHA 4YFYA 2VYCA 2Z98A 3OMXA 2RHTA 4HX9A 3ZGYA 1IZ8A 1W4RA 2FA9A 1JAYA 3EZ9A 1XE3A 2GN1A 4RJIA 4BMYA 3SNHA 1YCGA 4EKGA 1JMYA 3DO8A 4HT3B 3ZWMA 3KIPA 4PCAA 3ZCUA 3B12A 2RGEA 3AO0B 1T2UA 3BGVA 2C9ZA 1KJ8A 3I1IA 1ZI8A 3B85A 4AG3A 2ZUVA 3BWBA 1QGUA 1UMBB 2P75A 2AFIE 5DNAA 1PK9A 1UJMA 3DAYA 3BSYA 1H1LB 4MQMA 5ALKA 3EIOA 2BH2A 2CEAA 1H2AS 4LOLA 3KETA 5SZIA 1ISSA 3K0HA 1E2NA 3NR2A 3PRKE 1MB3A 3VV2A 4CCYA 1TQHA 4NOMA 4PG8A 3BWVA 2PUCA 1VIVA 1O6GA 1JECA 1PGPA 2WINI 4RMHA 1E2EA 1NJ6A 4S24A 1Z38A 5FQOA 3IKTA 1V7ZA 2CUTA 2HLDD 4CCWA 2A9VA 1ZM9A 1ND6A 2N42A 2QT1A 3NTUA 1YASA 1ZRHA 2BN4A 1C1DB 1QO0A 1P18A 2YXBA 1JDBC 1Y7PA 1UQRA 3X44A 5JHHB 4BYGA 4GR4A 4HGRA 5BVHA 4OK6A 2XUGA 1KQNA 2EKZA 5EQDA 5I9MA 4BJHB 3ZZTA 4ZVVA 3CX7A 2ZRHA 5C5IA 2IEBA 4RKQA 3SQDA 2BMEA 3OAAA 4FE4A 4GX1A 1B0AA 1W2WB 2FWAA 5FHQA 1JR3E 1XV5A 1IZ9A 3QVLA 4B3HA 1US8A 2JAHA 3RK0A 4FD2A 3OKPA 4WCVA 4UJ5A 1E2FA 1KO7A 1NTRA 1I3OA 1U0TA 2CMKA 2P2CA 4WXPA 3K94A 1W7AA 3IBSA 2AKEA 1JEQA 4TZTA 3ORRA 4IIUA 2JK0A 4KNYA 2JIPA 1EIWA 3ZY5A 2O0LA 3M49A 1FLDA 4I8IA 5EWJB 2WYWA 4GD3Q 4B75A 4ICIA 4JK3A 4RZIA 2GPTA 2OESA 2CVHA 2OVFA 3D6HA 2Q0HA 4EHAA 5JMPA 1CCWA 2X0EA 2A1UB 4F45A 2CJPA 3LCCA 4KQGA 1E66A 1YI1A 5DSTA 1V1RA 2IXFA 3KDPA 3W6PA 4EMBA 5DTEA 4A1FA 1QQTA 3AVUA 1I2MA 2Q0XA 2UZAA 4KXWA 4EG5A 5FLXA 5I4IA 2V8BA 2YFQA 3E5HA 3AHEA 5DV9A 4B4DA 3O8QA 3P32A 1RABA 4F91B 1LSJA 2PT9A 2XB9A 3BWXA 5CRIA 5GONB 2YOFA 2YWGA 3UN1A 5A06A 5C8DA 5KZMB 5U9CA 4N3GA 5DXJA 2AKYA 4A15A 4BUJA 2X9GA 2R68A 4LBYA 4Q24A 5EJGA 4BMOB 2QUJA 4UU8A 2R8BA 3SP1A 4GQBA 3T3GA 3WWYA 3Q4GA 1AHPA 1U02A 3HDQA 3MJFA 3LF1A 3JRNA 4WVLA 4EMTA 3DAFA 4INAA 3PICA 1Z36A 2PWPA 3RSFA 1T9GS 3WKEA 4CEHB 1ZX1A 2R4QA 3LNTA 1RHMA 1F2UA 2FFJA 1LDYA 1L8QA 2X8AA 4NBTA 1SPXA 1O57A 3PP8A 4J0GA 5K8JB 1PZXA 3BC1A 1N2GA 1S8AA 2DY1A 4L2IA 6Q21A 2O8EB 3IUNA 3IILA 1J8QA 3KFVA 4OEHA 5AOVA 1FU8A 3ANSA 1EYZA 5G41A 1V25A 4Y1RB 3QH4A 2ZJ3A 4W99A 4UHHA 2I7XA 3GMDA 1SVWA 4JGGA 3T34A 1ODKA 3N2ZB 2HHCA 3ASVA 3I0ZA 1YMVA 1NZFA 1CUFA 3GLQA 4US0R 3NT2A 4EI8A 2ZJOA 4LJKA 4Q3LA 1CUYA 3PQ2A 1OASA 5HKLA 5TV2A 3EJ6A 1PW7A 1C8KA 2J3HA 1RYYA 2NADA 1PWYE 4C4SA 1KARA 1OLSB 3TG2A 3B7PA 5CK4A 2XGGA 2VAMA 3KZXA 1XD9A 2BDTA 4EYKA 4RJTA 4RQTA 4PRZA 3KSUA 3EG9A 2R96A 1ZNYA 1B2RA 1GQOA 1QLWA 1R0ZA 1IN5A 1TTHA 2R7MA 2Z08A 1J0XO 2Q0SA 2Z2YA 3G0BA 3HHEA 4KWTA 5TC4A 3IEMA 3RT9A 4QDJA 4Q3NA 3DE7X 2HWWA 5ECGC 4EQ6A 5BN3A 1AF7A 5HQ3B 1RYEA 1U7XA 4N8SA 2EQ5A 2OBBA 2QPOA 2D1QA 1RQ7A 4RK7A 3T7IA 1U11A 2ZRCA 4RSMA 1J0DA 2CKDA 3B1WA 4IOJA 1RRVA 2RHMA 4UNRA 4IOLA 4Q4JB 1W88B 1RQ2A 2JJYA 4E5KA 4LFAB 3INYA 4JV5B 4K6MA 3VR6H 1EGAA 1MG5A 4W1PA 1SXJB 4JY7A 2QP3A 2XA2A 3P9QA 2G1AA 3H0CA 5FNVF 4CIBA 4P08A 3ESCA 1G5FA 4M76B 4DRZA 1YFLA 1HLGA 4ND5A 5CX1A 3UATA 4R4JA 4X66B 1QR6A 3LPAA 2NMVA 2REBA 3S5JA 1K89A 1XL0A 4V0SA 4TXLA 3R23A 1B42A 2IT1A 4DJAA 1WKCA 5B1YA 2DM6A 5JAHA 1JLLB 5ADUS 2PUFA 2YS7A 4HFJA 1IM5A 4JT9A 3FNFA 5TSDA 3ZTWA 4AP5A 4B3BA 3Q10A 4KO3S 4EO7A 2YTZA 4EUNA 1GTMA 1PT7A 2HJWA 3O4HA 4NPHA 1GLVA 1B0ZA 3U7RA 1DAEA 1O9BA 3GIWA 3OIWA 4XYEA 1ZZGA 1SOVA 3OUUA 2A5YB 4S35A 3IDFA 3V55A 3PPYA 1LK7A 4G0QA 4YCBA 1MDBA 4WBNF 9LDBA 1R9GA 2PRIA 5CK5A 3QOYA 1FUUA 4RPIA 1NBMA 1ZVMA 5DGXA 3V8VA 3ZU4A 4AKTA 3THWA 3IKJA 5H80A 1P2UA 3I34X 2F1KA 3LK6A 1AIPA 1HG1A 3QE3A 4MHOA 5TRTA 1GN9A 1XB2A 5I7HA 4BFZA 2ZDQA 4IJ6A 1D2AA 4BAGA 1YJQA 2ODAA 2I54A 1Y3CE 1JG3A 3Q3IA 4L4SA 5EIFA 1GRCA 1M1YE 1LX6A 2XMBA 5FNZA 4EGCB 5LQUA 1P0FA 4HWOA 1LI5A 4IDHA 3AY6A 1TZ2A 4L72A 5ESRA 3VXKA 2P67A 5JATA 4I1PA 4TLCA 5LXTA 3LIIA 1STOA 5EMJA 3H9UA 4PTLA 1EQAA 4HXYA 1O2DA 2CDAA 2Y2UA 1PTJA 1ZFNA 3IT3A 3L4SO 4P86A 5E0OA 4D1YA 3IAEA 4Q7QA 4OQYA 4PLCA 1USKA 2OB1A 4Q4AA 4KBYA 1K8ZB 1ZD5A 3AUXA 4UHEA 3CWQA 4ZHQB 5LD2B 4MGYR 2ATVA 2NUTA 3PGMA 2IY8A 1N4DA 5JD3A 2GZ2A 2WFLA 4UC0A 3HP4A 3KKMA 2VNHA 4URZR 5D1HA 4IKPA 3WIEA 4JB3A 5TIIA 1PZHA 3DVRX 3GC6A 3KOXA 5JO0A 2WWHA 1CD5A 3SJUA 3WHIA 3FSGA 3RYTC 5BWBA 1GUDA 2H48A 3H9GA 2R25B 1YTLA 3OCWA 5BN5B 2DPXA 4YJ2A 5AVRA 4YRPA 1WBDA 3BB3A 1U0FA 3AYZB 4DSNA 5LDDC 1J8YF 1REQA 2VWGA 3OU6A 4YPOA 2QE6A 4FP9A 4X7MA 5I9SA 4NPCA 1OB5A 3OT1A 4BVFA 3CIFA 1N2SA 2GXSA 1J0CA 1S8OA 2ANCA 5FCDA 5J59A 3UJAA 3CUVA 3ZDZB 1PX0A 3QXGA 5LMCA 3VYUB 1L5VA 5ALLA 3ANLA 3NHZA 1I5OA 2HSZA 2HNBA 1Q7CA 1KI8A 3D8NA 5CPBA 5BN5A 3IAM6 2AXNA 2QQ0A 4CMHA 1M1YA 2CVPA 4YJ3B 3K1JA 1NBOA 2ACVA 2H2IA 5CA1A 5K0TA 4IX9A 2HO4A 4G9EA 4HDOB 4UVEA 1XHEA 4EF4A 3II6X 2GJSA 1T6YA 4Q21A 4Z1OA 1Y8ZA 1Z4JA 3OPYA 1QS0A 5LOVF 3DCIA 4ZO7A 3MOSA 4JI4B 3ZWKA 3SZLA 2XLCA 3E1SA 2N1BA 4K5QA 1FTWA 2Q2QA 4OSPA 4C1NA 1RM4A 2VDWA 4JHLA 5JVDA 2QD4A 3L8YA 2IHZA 4BIIA 5SICE 1JHOA 4RIGA 2FQQA 2Q5HA 1NVUQ 4INZA 5E4TA 1L5NA 2NU6B 5AVQA 4DN6A 1A1SA 2GERA 2Q27A 1OV4A 1LFDB 3WL3A 1T2DA 1Z0AA 1KJWA 2ZCUA 4BZZA 3M2PA 4IJKA 4LZZA 5AM5A 2Q6KA 3UHOA 2VJQA 2UAGA 4R1SA 1OIWA 4I1RA 5AK4A 5CT5A 4MQFA 2O4UX 4NH4A 4AYTA 3ZDDA 1IEQA 4C6TB 2A88A 1KJIA 3DYIA 1J9ZA 3A1SA 2WV7A 2YVKA 1FYFA 3WBBA 1NVAA 4CG3A 3I9NA 4IHJA 2RK4A 3U3ZA 4CUKA 1KORA 3Q8MA 4F2WA 3IV9A 1CY4A 5AKLA 4UXIA 4M9ZA 4MGKR 3Q3HA 3IPCA 4UUPA 2QLJA 2FR8A 1K6EA 2FR0A 2P2YA 1KZ1A 2Z43A 3G49A 1H23A 2IYZA 2PMCA 2QTNA 4Q3KA 1D0IA 3UCXA 1SD2A 4WFIA 5JADA 4AJ1A 3JR7A 1EWYA 4BQFA 2EQAA 3LGXA 3PFWO 2ZROA 1G7CA 3O21A 1PYGA 1VLLA 3H5RA 2D2VA 4EYSA 3KQKA 2IHJA 1Z5WA 1Z2PX 4TLMB 2X8WA 3ZV3A 2GAFA 3H11B 4EYEA 5A02A 1WF6A 3KUKA 3MBOA 4QEZA 4HBGA 3FHLA 4BL5A 3R0QA 1JB9A 5CIQA 3G2IA 2XCIA 1DQSA 4JZKA 2VHQA 3OPYB 5FF9A 1ZHOA 1BKDR 1NF3A 1R8SA 1E3DA 2PX4A 1OYWA 4IINA 4LYAA 1XZLA 2NV0A 3KPVA 3LBIA 4ZVRA 4KQ6A 3SZMA 1ORIA 5FWDA 3JYPA 4WOCA 4NARA 4WBNA 2P9YA 2GXQA 2I62A 4K0RA 4K46A 2FJPA 4QXAA 3EH2A 1TLTA 4AN4A 4G26A 4BU0A 5EHXA 2JLYA 4XQ0A 1KAGA 1N34B 5ICSA 3TUZC 1S5PA 3UK6A 2I87A 4A8HA 3ZW8A 5CR9A 2AR9A 4YWJA 5EZ5A 5FWYB 3N39C 4PRYA 3RRMA 1CR2A 2P9ZA 1YVEI 2QM7A 2ZJBA 1P6XA 3QEKA 3CZPA 3TSOA 1KMNA 1MU0A 3T6KA 2Q3LA 3FUUA 4JLOA 2P9CA 4F7DA 2C2WA 3ACBA 4QLOA 3UTDA 4CIVA 5JD5A 1C4XA 1W2HA 2HCRA 3QPWA 2YMMA 3DE4X 5DTJA 5HE9A 2HU7A 4AB1A 2VHVA 3R76A 3WS7A 4C03A 2BEJA 3ADOA 4BX9A 2IXEA 1BS9A 5JH7F 2F67A 1NXWA 1UJNA 3VM6A 4AZ3B 4H4EA 1RP1A 2IX3A 1KI3A 1OA0A 2WABA 5IUKC 1VKNA 5TF0A 4YQFA 3DKVA 2P79A 3KAQA 1W46A 1OLSA 1KQ3A 2IUEA 4CM4B 1LBSA 1NLUA 1CUWA 3CMCO 4WKBA 5ANRB 1Z17A 3FRJA 2JIQA 1DJQA 1V9SA 3BJZA 2XMCA 1JEJA 2JASA 1KE1A 1HDIA 1IEXA 1T3GA 3BK1A 3FPJA 1QP7A 1NONA 1XQWA 3KTFA 3I4CA 2WWFA 3QFSA 1FRZA 1V11B 4XWTA 4X9XA 2QX8A 5HF5A 4F86A 1HGXA 1X2BA 1ULSA 3QFFA 1OLXA 1KNXA 2VT3A 3K4HA 4RIEA 1FQWA 2PGNA 4N5HX 4EW6A 2DMRA 3UXHA 1TD1A 4DIEA 2VDUE 4FFLA 2JFVA 1F0YA 2UV8A 4R1OA 5B30A 2FUEA 4DREA 3TLGA 2O8EA 1KEWA 3DPIA 3LX6A 1P2GA 1HRDA 1FC0A 3ZK9A 4OHOA 1VLQA 3SJBA 5BT8A 3NMUF 2JIZD 2LR0A 1RE1A 2QD1A 2JHAA 2HU8A 1KERA 1U1GA 2IUTA 2Q29A 3FJOA 4XPZA 1D4OA 1VL0A 1LZKA 2XQFA 1CDEA 3Q9LA 4O0LA 2OBLA 5A9SB 5BW8A 1RRFA 5A4AA 4I4IA 2PEYA 5FPKA 3GLGE 1KC3A 3ZZNA 2P91A 3LQRA 4PLTA 2C78A 3V32A 3ZIDA 2BF4A 1U4SA 3NWJA 3RW9A 1IU9A 1X39A 3F5QA 4POOA 1UKZA 2HV8A 2V1XA 2ZAMA 4HAXA 4W63A 3THSA 3MRXA 3Q6MA 3WBKA 1LJLA 3DEYX 1O3YA 1LCIA 4QOEA 3D31A 1BE0A 4RLSA 3B2QA 3CCCA 2Z5FA 4EHLA 1K8XB 1MJGM 1HORA 3FW1A 2B3TA 3PPWA 4FGWA 1AUQA 4BQSA 4BOYA 1DU4A 1M34B 4BU1A 1SXQA 1QIHA 2H1HA 3PFIA 5TR9A 3PL1A 5DH9A 3HXQA 1ZUD1 1KPHA 1UBJS 1WD7A 1QH8B 2AVNA 2QZ4A 1CULC 1Q0PA 2X5XA 4PPYA 1KI6B 1X3LA 3GX1A 2FSVA 5M7EA 1LWOA 3TEFA 2DBVO 1G98A 2YJ4A 2RH5A 1DPGA 3QMWA 4OKNA 1NR1A 3WYFA 1GDHA 3NIFB 2XTZA 2B21A 3HJCA 2DT8A 3D2BA 1TEHA 1VL5A 4FSHA 4RPKA 2QTLA 4PNHA 1AQIA 3HVKA 2R0QC 3SM9A 1C3EA 3TLMA 4ZDIA 1RHRA 1FFBA 4URVR 2PGOA 3WLFA 1N6RA 4ZI7B 3EDYA 3IBYA 1B41A 4P5EA 3WLRA 1L6RA 2YYAA 3WJ1A 2FRVA 3LVFO 1KJZA 1N2CA 1UWCA 1UXIA 4O4HB 1EE2A 3U5ZB 1OA1A 5IP5A 1WETA 5IRCD 2FNAA 2I78A 1XDUA 2I80A 3GCDA 3STHA 3PXEA 3JQ6A 2F8LA 2ORIA 2R86A 1YS9A 2ACWA 1SHLA 2JGJA 3Q8KA 3LP6A 2OQIA 1TIKA 1KOFA 4X1IB 1YI0A 1A5AB 3ZHTA 4K9DA 3KOWA 4FR5A 1DAFA 5K8VA 3RPEA 1OYVA 1YWGO 4NCIA 3R41A 2BMJA 2RG7A 3KYDB 4AMZA 3P5SA 4OHUA 3ZTTA 1FS5A 3F3SA 4JNKA 3UYLA 2V6GA 1TCVA 2BE9A 4NQZA 1KYYA 1W59A 5A7FA 1R2QA 4FXOA 2XY4A 3F96A 4LYDA 3S2YA 1N6LA 5EINA 2GZDA 4MZXA 2QZPA 3R6LA 3ZE6A 4A3SA 3AINA 1PJ8A 1RCFA 1UT5A 2I34A 4LQCA 5ESDA 2B9EA 4ZOAA 1AKEA 5EPUA 4B9EA 2EBUA 4I1IA 5ILOA 5C3UA 4TL7A 1GRVA 1Z8NA 1KO5A 1U9ZA 2JJ1D 4LXGA 2CFRA 5ENVA 3UWSA 5BQ3A 3N0WA 4KYIB 4TKLA 4EPXA 2QTFA 3SYKA 3FLAA 3UOGA 1L5MA 2C00A 1HFJA 1NBIA 1AS3A 1U2RA 4AIIA 4PFQA 1GCIA 3ANNA 3L6CA 4DIFA 5K0BA 4WVFA 1P80A 1XAJA 5KOJA 2OV3A 2X8JA 3D5QA 5DPMA 5JAOA 3PPXA 2IVFA 4CEJB 1OLOA 1SCUA 2GESA 3HNPA 3FYHA 4WJLA 1U3DA 2EAUA 2X0KA 3JTEA 3GAZA 2PLFA 3PTZA 4OYLA 4X94A 1H4TA 2C5HA 3O95A 3VFDA 3N6RA 1VE3A 1G4UR 4NL4H 3P27A 3AVTA 4BKPA 5GZ1A 1E2UA 1J1UA 1PV1A 3NEAA 1XAIA 3W5CA 4GSKA 4ARIA 1UEJA 1E3EA 5LQRA 1IUOA 2BIFA 2CLIB 3ZN2A 4H3KB 1SEVA 3AUSA 3JASB 2ZVQX 1JA1A 3EXG2 1J8MF 3KJZA 3R9KA 2XTAA 5G40A 1KR5A 1QHFA 2BAGA 2GK7A 2I1WA 3L8FA 1RAIA 1F17A 3BMXA 3JARA 4QREA 5DWVA 3I2YX 3KDAA 5E6RA 1NKVA 3CF4G 4CMBA 2AI1A 1ZK3A 1VGRA 1ZRMA 1W5EA 1R5BA 1DHTA 1U1EA 3E03A 5HP4A 3KELA 3LXMA 1WUYA 1U3CA 2ZAOA 3F73A 3W5AA 4U7WA 3N3BC 4FGKA 3BXPA 4N0PA 4AP9A 1ACMA 2Y1WA 2PYIA 3DFMA 5AO9A 1T5DX 1TKBA 2DUWA 3ZHQA 4LXTA 2CE2X 1FP7A 5LLDA 3HK2A 1W49A 2QPTA 3HJAA 5TGTA 3HV0A 1GLNA 5IVIA 4LK3A 4LDPA 1ODFA 4KSYA 1QLJA 3ZZ1A 4MW0A 3JZMA 1TI7A 4GUAA 2VPXA 3P71T 3DV0B 3NIDB 3DMHA 3KV1A 1KY4A 5K6RA 3JQPA 3FKSD 4EGSA 5EAIA 4CLRA 2WQ7A 2Q1WA 3L4KA 4HVAA 2IEAA 3AIKA 2FPPB 5BVHB 2ZSIA 2FUCA 4N6OA 3FGPA 1P1BA 4GOLD 3BPSA 3HN6A 3I4FA 3ND6A 1HY3A 4NRDA 2I3DA 1N8SA 2NWQA 1AH2A 2GJ4A 4RJ2A 1IZZA 2DQKA 3ORQA 4N6GA 1E2QA 2V74B 1ZI9A 4Q4HA 1KQPA 3ASUA 4NH0A 3TW4A 4IH4A 3B6ZA 5JLAA 3VYRB 1VIDA 3EZ7A 2NYUA 3LUDA 1FNNA 2ISSD 4K3VA 2WM8A 5JYDA 3G0HA 2I1LA 1XEAA 1TJYA 4R51A 4HSGA 4MHTA 1Z73A 3ABSB 1WS6A 3T5BA 1VYTA 1EA5A 1ZN9A 3QKSB 4WMLA 5FWXB 2WBLC 3A28A 2BLLA 3ESBA 1TB4A 1Q16A 1QE3A 1Q11A 5D5HA 3VJMA 2VQ6A 4RD3A 4E4YA 3ORSA 2FF7A 4M9UA 4V2IA 3M81A 3G2PA 4YCNA 3ILYA 2NVOA 4PXYA 4LIPD 4FW8A 3TCXB 3H3JA 2OLJA 4RK5A 2Q46A 5D85A 4KHZA 4IICA 3OJCA 3ZWCA 3L43A 3P2JA 5E6UB 1USIA 1NW6A 3AYXB 1XLTA 3U7JA 3GT3A 3GP8A 1OZFA 4HS4A 4D9JA 1G38A 1NUSA 5DNCA 1FSZA 3QV2A 5BW6B 1ZOIA 3DW1X 2W8ZA 3AXTA 4P4UA 4UFOA 1M5UA 3VOAA 1SB9A 2I22A 1AO0A 4RCZA 5KTOA 1FDRA 4DQVA 3CH7A 1KKMA 2D7CA 1FTQA 2SNIE 2WF9A 2ZSFA 3VISA 4F1KA 1E2IA 5K05A 2ZKLA 1WMSA 2GVNA 3D8TA 4Q4HB 2O07A 1BQEA 2Y68A 1FDOA 1W4AA 3RS8A 2GZMA 3QLTA 4OLJA 4EMUA 3QUBA 5ARCA 5LVAA 2OZVA 5A4MS 1Z18A 1VLJA 4RM3A 4B84A 4LFBB 3HR8A 3BMNB 3KVRA 4EVRA 1B8UA 1C30A 2I1VB 2H6EA 4AJLA 5GZ3A 1MABA 1SCBA 1KZGB 2XQJA 1X13A 4V3CA 4DXDA 5DBGA 2ZT8A 4FT4A 1FZQA 5B1HA 3T06B 2NAFA 2O05A 2YFHA 4CM5A 3LFUA 2DTDA 4O2AA 2G07A 1DGQA 1UBNA 3E9DA 3D9QX 1UPAA 1V41E 1C50A 4H7PA 2JGIA 2IYTA 4LCJA 2XW6A 4FZRA 5J4LA 4HYEA 3B51X 4RDIA 4ZICA 4ZQGA 1UC9A 2PPVA 1FP1D 2O1WA 1BX3A 1SC6A 3H2BA 1UPTA 2OCLA 3GAAA 4KO1S 5E4FA 1YQDA 3F9RA 4TTSA 3W5SA 5K0ZA 4PINA 1UBEA 1CNMA 3JQ8A 2GCGA 3LPCA 2W83A 4J0IA 1K7YA 4YJDA 5CTAA 7ADHA 4B3TB 4OHRA 4PM4A 4CR6A 1WPRA 3UGTA 3PF8A 4Q3AA 4I1SA 2AZ4A 5FP0A 2O7RA 2PNJA 1XO1A 1NLMA 5B36A 5BN4A 5KTSA 2PDAA 3CFYA 3FMVA 3R3YA 2ES4A 2B5WA 2CGEA 3O4FA 4DV2B 2NZWA 1KH2A 1WLYA 4JT8A 4LMRA 4ZT5A 4C4TA 1DADA 2G1PA 4KC0A 2M6RA 2O8VA 1HLPA 3JZAA 4YPVA 3NH6A 3IE1A 5IVHA 3FPCA 3P9ZA 4YH1A 3MJTA 3SJAA 3V80A 1Q20A 4DQXA 5EWMB 1FBNA 3FROA 1OB2A 2ZZMA 1MB0A 3UH1A 2ZJ1A 2Q5FA 3C3EA 3KOYA 2DFDA 4G1EB 3EN0A 4B1FA 4QT4A 4MUMA 4NPAA 4QU9A 4YAWA 4D3FA 1CUAA 4E2YA 4EB8A 1L6IA 5FAKA 3M6VA 1SO8A 3RHFA 1XWIA 4XGRA 4KR9A 3BH7A 4H08A 4ZCTA 1UMDA 4TTRA 1ZY2A 5CLJA 3IBGA 3W2EA 3ZE7A 1W4LA 1YJCA 3IEKA 1AN0A 3K6KA 2O7VA 1SZPA 2CYAA 4WT7A 1A72A 1PL0A 3JQRA 4LTMA 4S2EA 5CNMA 3T12A 2E2WA 2PZEA 3FSRA 3LHDA 3L7MA 4QGFA 4EHBA 1VI5A 1Z0DA 3JVEA 1OYYA 3Q41A 1G8YA 1UJCA 1VP3A 3DVSX 4R1QA 4PPQA 4H15A 2GYYA 1IG0A 5AW3A 1Q2XA 1K5DA 1I36A 3X1YA 4NENB 2UUPA 4P92A 2YXLA 4KAJA 1S3IA 5HBRA 1EUCB 1VZ3A 4N48A 1YZVA 1K4MA 1XTBA 1M0WA 4KMMA 2QV7A 4US1R 1YDFA 1J33A 4ZV7A 1Z0JA 5TPWA 1DVRA 1DC8A 4QWMA 5CB0A 4AY4A 1DJNA 2JARA 4LISA 1HDXA 1FL9A 4AF8A 2AUNA 3LC2O 5J1TB 5K3AA 3VU9A 4DDKA 1RZVA 2Q3CA 2UYQA 5JECA 3IJPA 5IJWA 2VNIA 2FPSA 2O9JA 2DJ5A 1W96A 1G1AA 3FTCA 2OCPA 1I4LD 1GADO 3LT2A 3O73A 2G1JA 3JWIA 4XASA 3ZHUA 2EFJA 1A04A 2TMYA 1Z6XA 2N47A 3DWGA 1G2IA 2C83A 4KI7A 4R5HA 4DR5B 3A4LA 2ZI6A 2F48A 2ZB8A 2IX9A 4FX2A 4NQRA 2NUAB 1HT2E 1QVRA 2FHSA 3DGEC 3DKIA 4KXMA 3RE1A 2H1VA 3I45A 1HYHA 1XDGA 3PUYA 3UFXB 4LN1A 1I3LA 4FONA 4NICA 3S2EA 4QZVA 1MW8X 3WK9A 1KDZA 4LHEA 2FZEA 4ZYVA 4D8VA 4DM3A 5I9IA 1GTSA 1BOFA 1IULA 1ODIA 1V0JA 1PEDA 2X2EA 4WGFA 3WKDA 3DV9A 3R5JA 3P0IA 1I33A 3AKEA 1H9AA 4O8CA 3B36A 4KYVA 1BE8A 3QI7A 5DLEA 3IDAA 1GL6A 2EGHA 4P4TA 4YXWA 4MWTA 1XQXA 3WL5A 4UD6A 1TM2A 4G5XA 2DTEA 4V0NA 3D4IA 1OJLA 3CZ9A 2A0FA 4RXTA 3TR6A 4YREA 3W77A 4F56A 4TROA 4Y6RA 4HEQA 2DERA 4GZ5A 2PR7A 3U48A 3THYA 1NNEA 3FCSB 4G4JA 3IHKA 3LHIA 4EYGA 4AN1A 2C92A 3JS5A 2NO0A 2GARA 2VN8A 3DMTA 3JAWA 3JVDA 2YNMC 5A05A 5C80A 3IALA 2D0OB 5BSUA 3SQNA 2D1TA 2ZUBA 4D81A 3VAYA 2B7BA 1ISJA 1CR4A 1E3MA 1AZSC 1FNCA 4P93A 2NVUB 4GR9A 3BXXA 3PNMA 1VKJA 4JL5A 4Y9DA 5BYKA 3SC2A 1QV9A 1RRGA 3SX4A 2WFAA 1RSZA 3UAGA 1C7ZA 5FH9A 3DXXA 5L3SA 3K09C 3UWDA 1HTWA 1KAHA 3JWEA 4ZHQF 4MVWA 1CZOA 1XBTA 1V3UA 4JI1B 1OX6A 4RTRA 3ROMA 3GLGA 4D8YA 3WE7A 1QF6A 1N75A 1K68A 5HF9A 1YZKA 2COEA 4OHYA 3RIHA 3QU5A 1D2GA 4GO1A 1H2XA 1PWZA 5A9SA 1AJEA 5FA6A 2EJBA 5I4CA 1TJNA 2HRRA 1XVTA 2QN6A 5BSEA 3FF4A 2SCUA 2J5KA 3N2LA 2Y4OA 3GZTB 4ZTBA 1VBKA 1J23A 1VSBA 1RDFA 1WDWB 5ESWA 1FQJA 1E60A 1X80B 3E35A 3BB4A 1VECA 2CLKB 1POXA 4KH1A 5IBRA 5JE8A 1QG6A 3B9QA 1CRLA 3R74A 1Z6ZA 1V6SA 3QU4A 4DNFA 4CJXA 3B20A 3GJQA 2VP6A 4L9AA 1SNYA 1V11A 1CX9B 2VP2A 2XZDA 1I14A 4RGBA 2GUWA 3LVQE 1UFQA 1XN4A 2HD4A 3G82C 1KH3A 1N3IA 2JFZA 3LP8A 3OP1A 1R12A 2G6TA 3O5AA 4RLFA 1PDWA 5DOVA 1S96A 5F2OA 5L6MB 4LGYA 2VPPA 4RETA 1E2PA 2D1SA 3FFTA 1WZUA 2D4AA 2QY6A 3AKCA 3ESXA 1X7XA 3BF8A 3JYQA 2OD9A 4Z0HO 3U4MA 2YICA 2HIHA 2R2GA 3LT1A 3UYKA 1KPGA 2MMGA 3PJFA 3D3WA 4HK4A 5ADVA 4ZZ0A 2AJTA 2B82A 3IUYA 4X8HA 3Q0IA 3L82B 4MCJA 3ZDRA 1W76A 2X6TA 1HPLA 3PC6A 4V0LA 4X64B 4EQ6B 2WSSA 3X1KA 5BN3B 4X8OA 5LBIA 1QIDA 2RGNC 1FX0B 4HMPA 4MDHA 1MJNA 3ET4A 4X1OA 3SDSA 3A14A 1HF3A 4D56A 3ZWDA 3OJEA 2CFCA 2VRWA 2W6ZA 1YHNA 4YBRA 3C4JA 3QX3A 4REMA 1AK1A 5FJJA 2ECPA 2PWAA 3C7AA 4YRLA 5BSWA 3DXYA 1QFJA 2FETA 3CEAA 4BNDB 4R8MA 2PQMA 4MW2A 1AS2A 3G02A 4IWNA 4EY3A 3CB4A 2GN4A 3EVDA 2F3TA 3H9QA 1ZD1A 3I12A 3AZPA 2ZKIA 4JUFA 1MJGA 4DJTA 1EDOA 5JDIA 1H9CA 3FPFA 3FYDA 3PQ7A 4HNUA 3M6FA 1BYIA 1SRRA 3NKLA 1BD4A 3KTDA 5ICMA 3GELA 4M6WA 2QYOA 3TR0A 3OJXA 4MVXA 4PLWA 2EQBA 4B3GA 1RXUA 2FEAA 2TS1A 2TECE 2CJYA 3OTWA 5CB8A 1ZOPA 1KEVA 3BWMA 2UYHA 1LW6E 3JD3A 4IO0A 3EULA 2H11A 3K8OE 3UA4A 1TEXA 4RGVA 1O0SA 2ZWOA 2ZYTX 3H4IA 3QU7A 2QRVB 1C0KA 5EMHA 4RTQA 5K0GA 4M1SA 3GCWA 3VA7A 1LDGA 4MV1A 4OK3A 4BMCA 3HNOA 3PC7A 3A6HA 1QO9A 3M9XA 4JC0A 4BEVA 1IZ7A 3K3PA 1SBTA 1ZISA 2V5UA 2XZPA 1M7HA 3A1WA 3RJMA 3S7ZA 1G8HA 1R5NA 1N32B 1R6XA 2VJCA 1E5DA 4U2CA 3WB9A 4B4WA 4I3GA 4EG1A 1VIMA 3AHGA 4NAVA 4QG7A 5SYNA 2ZWVA 1SC4A 3LQ4A 5ALTA 4ZCSA 3KR0A 2GZSA 2IZOA 2LTAA 4LHVA 1QK4A 1X1RA 2WKPA 2BWJA 4JI0B 4GBJA 4ZRDA 4LYFA 2QAJA 5E1DA 3S1AB 3WIDA 4XM1A 4J0DA 5KUTA 4ESVA 2GLXA 3IYLW 2RHOA 3MD0A 3ZHVA 1ULTA 3ZBPA 4O4LF 2Q41A 1C9JA 2REQB 3ZW9A 4DEYA 1F48A 3NT4A 5I8WA 2AF4C 3A31A 1SG6A 4GI7A 4MA0A 3ADBA 3U5TA 1QHSA 4QXQA 2GJ8A 1KJ9A 1SHJA 2FW7A 3C16C 4XM2A 5U4XA 4J3FA 3TQQA 4PX9A 2AQ8A 1C1XB 1T24A 1SVNA 4TYQA 5B7PA 5HEKA 1H0KA 3QYPA 2EXXA 1Z74A 2XE8A 1YC2A 4F04A 5IYZB 3SI7A 2H06A 3L1IA 1V2HE 4LE2A 4N18A 3TMYA 2CN1A 1MH1A 3N8DA 2AN9A 4IVQA 1GP2A 2X1LA 4NDNE 1TZMA 1PT9A 1E20A 5CYGA 2H17A 1A9SA 3R5KA 4NATA 4TV8B 4Y9UA 3GDWA 3ZGOA 1NMZA 3FTPA 4FSXA 4TVSA 5SV2A 2OG2A 4X90A 3GP3A 3VNQA 1LPMA 4ZDKA 3NT5A 3GJSA 3KQNA 3GJRA 4WN3A 4F3NA 4UNNA 4JOQA 5C31A 4M0MA 4BNLA 2YYSA 5HJ5A 2YWHA 5ITVA 3G7SA 4EHIA 1L5SA 1ZM7A 2ALJA 1BNCA 3EOZA 3R3ZA 2AFIB 1MVNA 4JUAA 4N03A 4F5WA 3MJDA 3JQBA 2IZ6A 4FN5A 1DX4A 3VU9B 5A62A 1E89A 3PEVA 4PFJA 3TM5A 4OLAA 1S4MA 3DEFA 2HUPA 4XJXA 4BFYA 2HF8A 3KX2A 3BZBA 5HZMA 4NBRA 1G8PA 4Q1BA 1AXEA 4MWGA 1KFKB 2QJTA 2JA2A 2PZMA 4JROA 1H1LA 3IV7A 5CP8A 1XRNA 1I6WA 4L75A 3FCOA 3FLMA 1SC9A 2FQ1A 4M53A 5SZKB 2LDBA 4DM4A 521PA 3HO6A 3KFLA 3G79A 1GO2A 4L8FA 3QVMA 5CLLA 4BLOA 1OMOA 1BWPA 4YCDA 4UTRA 2BGMA 1TO1E 3RS5A 3KQLA 4F8EA 1SXGA 4YEDA 4DR2B 2GT1A 2GAIA 5IX8A 5HRAA 1DFGA 1T9AA 2NU9A 2EW1A 3S55A 4B6JA 1S2DA 1S3SA 3A6GA 4NMWA 4F60A 3BERA 5C53B 1SEPA 4G81A 4TUYA 1MOSA 4YRSA 1PQWA 1C8LA 2DRIA 1FCJA 2Q1XA 1QDUA 5F5LA 4KGDA 3QHAA 2P2SA 1XNRB 4J2TA 3N5CA 2ZE7A 2CXRA 1H3EA 4Z6KA 2V3VA 1JDTA 4TN1A 2CFTA 4PQEA 1HNZB 3FSGD 3ZWXA 2CLMB 2B92A 4Y6SA 1A4IA 2NV2B 1KU6A 1YNSA 3AFNA 3KQTA 3NHWA 4C87A 4MR7B 4S05A 1JRLA 2F62A 2J31A 2VAVA 3BMNA 4L78A 1O6BA 3RUDA 1DKUA 3NDIA 4N49A 5EXTA 1M0EA 3B6JA 4QYSA 1KRWA 1JSXA 4BN4A 1KTVA 5LNK6 4U6QA 3JATB 1VGQA 2IYUA 2P65A 4AN0A 1KYXA 1L5HB 2BJWA 2PRZA 4WLFA 2QTZA 2V6MA 2BTQA 2WU3A 3U80A 4OA8A 5IK2A 2YMQA 3LBNA 3EK2A 3WC4A 2Y0CA 2B36A 2ZUUA 4OMUA 3AGQA 1FOEB 2CFOA 2F3RA 4ZN6A 4EL5A 2YBDA 3MCWA 3MWYW 4LI3X 1A9PA 4YJFA 5K7SA 1QB7A 3QA3E 3UICA 2AW5A 3NBUA 3V4ZA 3UC9A 4ZO6A 3URKA 3E0QA 1Z45A 4GXQA 4G63A 2ZTSA 3BHMA 4FLEA 5EKUA 4UQOA 3KHKA 4KG7A 4HAWA 2WAXA 3EXHC 3EXHA 3GFGA 4DNQA 1ISHA 4GM1A 1VKRA 4PV7A 3CVYA 1FDIA 3KOZA 2A9OA 2VL7A 5BV0A 4P3OA 4IUYA 4D26A 1FLVA 1WNFA 2JIDA 5J1SB 3AV3A 5KS2A 1PFWA 2JI9A 1XMSA 1VFNA 1ZM2A 2VHCA 1WA5A 4OMDA 5CITA 1SUCA 5C37A 2ORED 3B9RA 3ICPA 3CEPB 3FCCA 1UBCA 1NKSA 2J6CA 3H2JA 3HDHA 3RSCA 2RGWA 4HUTA 1A7KA 2ONCA 1RT9A 1Y5IA 3GRUA 4PZLA 3O3OB 1FFSA 4QQRA 4TTIA 1OFVA 1F4LA 5FB3A 3T99A 1WU8A 4M83A 1HFWA 3WYNA 3AFGA 3SC6A 4BVHA 2GD2A 3BA1A 1ZK0A 2VSXA 2VYND 3IUSA 1H2WA 4O4JA 5AK0A 3UJDA 1T1GA 4FFNA 5LA6B 4BLWA 4Y1GA 1FMJA 1TYEB 4YUAA 1QVAA 5CFZA 5EWLA 3N6VA 1FFEA 2O8FA 2BBTA 3GEBA 3ITKA 4KXNA 3PKJA 5ALVA 1Q7EA 3AU8A 2ZIUB 3BEOA 3IXMA 1VCMA 2J48A 4N82A 2FPPA 4E12A 1CJUC 3MILA 3WA7A 2HPVA 4GQIA 1Q5PA 3VMMA 5DFAA 2G5TA 1ZDMA 1GAJA 1JJ7A 1GEEA 2E9SA 3HYRA 4M3NA 3KAKA 4DR4B 5JZMA 2JFHA 2ZYGA 4J07A 1QIIA 2PZGA 4PLYA 3P9IA 2ZU6A 4LVOA 4EKYA 4GBGA 3HCAA 1IJBA 1E96A 1EVYA 4OJYA 2X0FA 1T8UA 3ESAA 3E8XA 3FSJX 2GF9A 4IV0A 10MHA 3GHHA 4MV4A 1JDZA 5KVCA 4DJ5X 2NV6A 4MS1B 3V4LA 1KXJA 3TKLA 1WV0A 3E4CA 4B0OA 2X1VA 5JCZA 4NYMQ 5CT6A 2QUBA 2OA0A 3MJEA 3MWLA 3TEMA 1XRJA 3EG5A 4LWPA 3VTKA 1EVQA 2WDPA 3SZGA 4ETWA 4RIIA 4PWZA 2VSYA 2CZCA 5EE9A 2HZ7A 3NFRA 2PUGA 1Z6AA 1IH8A 5JAMA 2NZ8A 4LZAA 1ZVVA 3RU9A 4EZBA 1GG2A 1MAWA 1RYFA 2XD9A 1TADA 2RGRA 1OLUB 3PQ4A 3FKQA 5JJ5A 3CEJA 4HQLA 3UMVA 2OZLB 2VQSA 2YHIB 2IYWA 3LE8A 3TMKA 2ZSBA 2E48A 4I3FA 4QUAA 5JPDA 1GCAA 2QB5A 4R2WA 3VDXA 3RUFA 3ZZUA 3K1ZA 3NTVA 4EELA 3CNLA 3ETLA 2Q1TA 3FI9A 3IAUA 1EBUA 3M4XA 4RNCA 4DCNA 4EAQA 4EJSC 3EPPA 4EG0A 2EFEB 3DJFA 3LW7A 2AA3A 2CMDA 1SQ6A 1M76A 3LT5A 4NP6A 4MLDA 2HZBA 5LOVA 5C7LO 2BDEA 3LLUA 3SIWA 1F8XA 4KN9S 1I4OA 4LDQA 1WDTA 3HABA 3TS1A 4EJFA 3C2QA 5GQSA 4DDHA 4NY1A 4A91A 4HNAB 4DQUA 5ARBA 4KO8A 2WP0A 5HM8A 4FHGA 1A8PA 3QXXA 4L0QA 4ZYYA 5HOQA 2IYSA 1MZVA 2P2ZA 3KQQA 4YP7A 3KJEA 3PGKA 4PSCA 3RAPR 5JNRA 1GZ4A 4M7PA 4DTIA 1QHXA 1VDMA 2XX3A 2ZITA 5EN4A 1ZSVA 3ZUPA 4YMVA 5E6RB 1VLMA 2GSWA 4KDFA 2P68A 3V2GA 1FNMA 1R6TA 3EXAA 4IIFA 4RGQA 3OT5A 1CZNA 4X41A 3WGJA 1YZNA 1JIKA 4BASA 2PYZA 3KZKA 1JFFA 3FWZA 1AKMA 4MKHA 4O29A 3WLMA 3AI3A 4QM6A 3R3HA 2IV7A 2VIIA 5KYYB 3PFHA 4EUHA 2BFOA 1QTNA 1H3NA 3HUTA 2CYBA 2QU7A 3NHPA 5F9FA 4FFPA 3PFNA 5GM1A 5IM4F 3COZA 4Q7JB 4R2MA 2W2TA 3GPIA 1UPCA 7GPBA 2GNOA 4M8KA 2OORC 2XTNA 3NG1A 4JR2A 1VJRA 3K9QO 2JCVA 9ATCA 2G8NA 3ICOA 1YS7A 2O5CA 1HFKA 1ZGBA 4ZT4A 2HJGA 2G40A 5TF4A 1YUNA 2BSXA 4C29A 4M49A 3F0TA 2H2WA 1J7KA 2GN0A 1BQ3A 2FZWA 3S2IA 3LDAA 1RQGA 1I7LA 1SUPA 1WHSA 1H2EA 4J03A 4L15A 4ZWNA 3NNDA 5AVVA 2F8TA 4BLTA 2Q9BA 4M0LA 3RWMB 1UL1X 4WN9A 2QUZA 4EVSA 5J47A 2LCFA 3DLIA 2XOKD 5CD9A 1E2MA 4WINA 3EDQA 3PVSA 1Y1RA 4JOBA 4CMIB 4FM9A 2D5IA 3VKVA 4EPRA 2FP4B 5LLSA 2AB0A 3RLIA 5JS1A 1GPBA 2YHIA 2F3QA 1CLEA 5E7IA 5SZHB 5KNCD 4L08A 3VNAA 1R5JA 2PM8A 3KKLA 3FNHA 1IHXA 1RU3A 2ONZA 3NCTA 5UKDA 3VU1A 4YUWA 3V00A 4DMGA 3L3BA 4CCAA 3HUEA 3N53A 3SBDA 2ILVA 3ZE0B 1UBHS 3DLAA 3OSZA 1ECJA 2BFBA 5AT1A 2XWBF 1YFJA 1CJTC 1Q7TA 1H2HA 3DYBA 1HX7A 1O96A 2V9CA 1M6HA 1N9GA 2WLTA 4M21A 4TTVA 2ZTUA 2I65A 3NHUA 4X1IA 1UC5B 1Z0KA 3OKCA 1FDUA 3OZ7A 1J0EA 1NFQA 2XADA 3DGFC 3EVFA 4KQJA 3EC1A 4UVIA 3HWWA 2JBHA 1ZCBA 5T3UA 2CLCX 3E1KA 4YTEA 5FOSA 3ZHCA 1WZNA 3DV2A 1KZHA 3BSFA 4BIMA 1OZAA 1UWVA 1W29A 1DUVG 3UOAB 4C76A 1Z47A 1J0AA 4GEKA 1IG3A 3LA6A 4GE3A 4HYQA 3QY9A 1QZZA 2C3PA 3PDHA 4BNXA 1M2FA 1NNSA 3B7WA 1JIJA 3DOUA 4LTNA 3WIUA 3PLNA 1U63A 3R8XA 4B6FA 1UP4A 5C1IA 1QCCA 5KJCA 1ISMA 2BGWA 5I3CA 2P3QA 3S8MA 4A8JC 1DEHA 1DX9A 1N1GA 2XAUA 2FDXA 4BVGA 1E3TA 2I2DA 2FPKA 4C5AA 3IB6A 1EDZA 1O95A 2XJ4A 2JZCA 4ZT3A 1X86B 5K8TA 1BKYA 2IUUA 2AZXA 4YRZA 4BLRA 3EW9A 5CH3A 4AFNA 4PFSA 2D2EA 4QO7A 5LD2C 4QPNA 3QEAZ 1LRKA 1V1MA 2IF0A 1VG1A 2DE0X 4OGWA 1IZ0A 3F5DA 4A5SA 2H8KA 4CTJA 3O6VA 1UINA 4HO1X 2JLRA 1H93A 3ETEA 3M3HA 4DSUA 4JI2B 1RWVA 1A4XA 1Z8HA 2OVBA 3FXAA 1FF9A 1MQ9A 1UK7A 2AXEA 2Q21A 2V9PA 4PWYA 4XSGA 1YR8A 2VCEA 1HURA 4GX0A 1GPWB 2PL5A 4D0RA 4WCFC 2HGZA 3EGXA 4PZAA 2CD9A 1OKKA 2IEZA 3P52A 5DSZA 2MOKA 5HUJA 2WAOA 3B3AA 3KVVA 3SBOA 5IAAA 3TVYA 5FWYA 3WKAA 5JDCA 1SBHA 3IBTA 2PRYA 4G25A 3QHQA 4FMCF 3C1UA 3KYCA 2EYUA 4R5MA 1UKCA 2V9ZA 5KOHA 3A9SA 1KPIA 1ORDA 4JQOA 1YDHA 3HCNA 5LYJF 1GG5A 3WKCA 2JEZA 5SYMA 4BO7A 3RS0A 4BXOA 2AOXA 1S2IA 3WQBA 2W2VA 4RF5A 2L69A 1G42A 3V46A 2GCEA 4MKGA 5DEOA 4XVQA 2CBZA 5I6DA 1PI3A 1MNAA 5YASA 4ZQEA 2PXXA 1VRVA 3X1XA 4AY3A 1GPUA 4DUGD 2AFRA 3LH5A 4YV7A 5I7RA 1X74A 3VPFA 4IAOA 1W93A 3B78A 4DJFC 1PP4A 4YCCA 2BYTA 1NM5C 1OZGA 4JP8A 3OHPA 3UT6A 2R00A 1QX4A 3A3KA 1F3OA 2NO5A 2P41A 4I7EA 3HG7A 5D01A 1YIDA 3UXMA 2FDCA 5ALZA 1U2EA 3Q7RA 2ID7A 1P7WA 3AVVA 5KAMA 4FK8A 3VSDA 4C0KA 3HFRA 2YWRA 3C87A 2IZZA 1XTKA 3MS7A 3G1UA 1T2FA 3AR9A 4NZPA 1DARA 4YAOA 3WGKA 1WCV1 1ZOOA 4ZIRA 1DELA 3TPCA 3UPUA 5JJKA 4JR1A 3GT0A 3LT0A 1P4HA 4DR7B 2FOIA 4NCNA 3B5EA 3I2JA 1VG9B 1JHXA 1X87A 1RYDA 2E21A 4OXRA 4HTFB 1CY0A 1BCSA 1HE5A 1Q1NA 1CQIA 1SHZA 1ZJ5A 2QVYX 4KN5A 3VYTB 5HPYB 4JHXA 2FSVC 2ACEA 4DXAA 1O03A 2EP5A 3KJHA 2X13A 2QAGB 2HUNA 1I6MA 1Z2AA 1ZESA 3E7DA 4NONA 4UBIA 2VDKB 2A78A 4Y0NA 2QTWB 1T5OA 2XODA 1OT5A 1PQPA 2PTHA 3PNPA 1C3VA 3UMCA 2JEOA 1O77A 1SA0A 4CU5A 4UAGA 1FU4A 1Z68A 1V6CA 3UT5A 3I83A 1TQ6A 1VDZA 2FMUA 1U5BA 1PZMA 2QW0X 2XT0A 1NI5A 3Q8WA 4JBGA 4QJIA 4NFHA 3GGCA 3ESYA 4I99A 4LK2A 1Z28A 3IJEB 3K70D 4O4LA 3BJIC 2ISQA 4IDFA 3LQKA 1S8NA 3NJ4A 4OQFA 3EEOA 3JQCA 3OTGA 5E8JA 4DA0A 4EATA 3E18A 5H0IA 4ILEA 3UO8B 1ABFA 4UM9B 1SQ5A 5AHKA 2AG0A 4W5QA 2O5EA 3KJQA 1QG2A 4LRUA 4H59A 1WHTB 3TGWA 3LNCA 2QT0A 2EARA 3WRYA 5KYWB 1CUCA 1LTHR 1M2EA 1Y3HA 2JFXA 3FGNA 3DLTA 2O2ZA 3L9WA 4RACA 4TLEA 4UCFA 3U4GA 1NP3A 1UEIA 2WB2A 1NRWA 3KZMA 4FS8A 4K9SA 3I37X 1SIOA 3I3OA 4L0MA 3BGWA 1ZCZA 4J4HA 2C2ZA 2WHEA 4MKZA 3GGJA 3DB2A 3PYLA 5IK2D 2Q7XA 5BUCA 4BRUA 2G17A 1LQTA 2C0CA 2G5CA 1HT1E 1R8YA 1ORHA 5I5EA 2HL6A 3AJDA 4GXTA 1U6IA 3ZCTA 2B8NA 2QIOA 4F9EA 1M2WA 1R3UA 1NZJA 2LRHA 1AQLA 2ZIGA 1CZKA 2JJ1A 2COUA 3HWX1 3IC5A 4M87A 3VPHA 3SS8A 4BJ3A 2OYRA 3UHFA 3O90A 1C1XA 2XCUA 1UFVA 1YQEA 1K0FA 1E6LA 2IV2X 3WMWA 4NJMB 1OSNA 4INPA 1EUCA 1QAMA 2WF6A 2A9KA 2ZVDA 1NJ5A 4ND8A 4QLAA 4BLPA 4E2ZA 3K5HA 3KOOA 4FQ7A 3VPAA 4Q4AB 4CG0A 4D9EA 1KEEA 1LFAA 2QRQA 1MO5A 3ZHZA 2P9HA 4PLVA 4MUGA 4UAJA 1Z2OX 2O1SA 5ELMA 4TT3A 2ZRFA 3KXLA 4U0KA 5CA1B 4QHYA 3HACA 2Z83A 4P7KA 1N92A 4RTKA 4DLVA 3BAFA 3RVKA 2CZQA 4Q16A 2V3WA 2D8MA 2PK3A 1UC8A 3KXDA 4G5RA 4K9KA 4D42A 4RTLA 1ARZA 2WJWA 4UATA 4F92B 2PBLA 2OHFA 4RV9A 3UV3A 2XGSA 3BDVA 4KWIA 1QRTA 3EBOA 2GD0A 1QTIA 1NVBA 5HQTA 1WF3A 3QRWA 2EGUA 2QRVA 1BX1A 5FOQA 3JWJA 2B4TO 3HVUA 4ZCMA 3O9ZA 4LDRA 5NULA 4LJ9A 1FRNA 2EL9A 4OJQA 2ZRMA 1EWTA 3DT9A 1ABEA 2PIDA 1XMOB 1EHIA 3HJGA 3NBMA 3CNOA 1GV0A 5ALNA 1V8FA 4IFBA 5E1BA 4K0KB 4C0HA 2W6QA 4DARA 1DC4A 1N2CE 4BV3A 5K4AA 1JQJC 3ZJUA 2IGTA 1MJHA 1URPA 3OZEA 3TUIC 5I9NA 4KMSA 1GZ6A 1RLUA 2AG1A 1MENA 1N2XA 2BC9A 3NNNA 4MAAA 2AMVA 4F4IA 4UASA 3BILA 4AI6A 2WHPA 4C7XA 5DHSA 2FU5C 4H0CA 1KDOA 5HWSA 3I8XA 4WQMA 1F7UA 1NXSA 4FNOA 5BR7A 5T8KA 4FR0A 4G1BA 3O4JA 3EFOA 3L1JA 1WKVA 3GDHA 3N1UA 4NE7A 4QL3A 2HPAA 2OM6A 3GRRA 3PDUA 3TDKA 5IWCA 1ZRNA 1CQZA 2R1ZA 2QG4A 2O7QA 4IRXA 1SVUA 1DAMA 3DTTA 3H4MA 3IOEA 2C2OA 4OFWA 4J91A 2AXPA 3HU2A 1D7OA 4C3ZA 3RRBA 2E7ZA 3GU3A 4OY3A 5EUQB 4G0NA 1B3RA 2WZDA 3R6WA 1VI2A 2ZQ5A 2BTEA 3NIBA 1UAYA 3UPTA 1F12A 1KSHA 1WMAA 1I1OA 3DWFA 4AURA 1VOTA 4J8PA 5JIBA 4XGQA 2Q2WA 4EPYA 3WISA 1E7WA 1V96A 1XVUA 3LFHA 3LLSA 3DQPA 1UF9A 3QPUA 7AT1A 1OFGA 4XFKA 2FG5A 3T54A 2X8BA 1OFUA 3T9FA 1ZHHA 2V7QD 3JY6A 2VT2A 2Z9BA 3NTXA 1CUDA 1Q15A 2J7PD 3BGOS 2E5FA 2COKA 2EFYA 3V8NA 4DLZA 5GPBA 2NP6A 3EIEA 3QVOA 3GLIE 4RM2A 2QSUA 1U2GA 4RVDA 5TPZA 2XUAA 2ZRDA 2G4VA 3O4VA 4IXTA 4YONB 1PKEA 4V1CA 5ES4B 5IFLA 3BAZA 4CKCA 1G4HA 2ZJ4A 1XJCA 1FUEA 2ZUSA 1AKWA 4IVRA 4BB9A 4HRXA 5EIOA 4K9MA 5TJ9A 1IWPB 1F20A 4FOLA 2GD6A 2ZJ6A 4TWAA 4TSKA 4TWJA 2PAAA 3E5MA 4DABA 4OAPA 4UOZA 4UZEA 2BW0A 4OOFA 3AP1A 4MV5A 4MUIA 2XA1A 3S68A 2Q3DA 3RV3A 2HHAA 4OJTA 5JEEA 2O3QA 3S27A 1TK2A 3RC3A 5HTKA 4CR8A 2ZUWA 2GPAA 4TWRA 4V03A 1OH5A 2CLFB 4NX2A 1S0UA 2VP9A 4MH0R 3L4JA 2ZBQA 5GAJA 2OK8A 1AGXA 2PD3A 3CINA 3MBIA 4FNGA 4OHWA 4MVYA 2H7CA 4FOTA 3P9XA 1W47A 2CWWA 4WCDA 4DNPA 2VQEB 3BL5A 5FI5A 4FHZA 3HFSA 1M10A 1QXSA 4L22A 1NX6A 3LDUA 2GB4A 2GBGA 2MIIA 2XBMA 4B3IA 1Z8DA 2VOEA 3ND5A 2A0YA 3WGTA 4GE0A 3QF7A 1ZD4A 3UAYA 4B45A 1NW9B 1RMQA 4XSHA 4G0VA 2ZIWB 3TIXB 5CLGA 4FFBA 4Z5XA 4OFXA 3VX3A 2YL2A 1XZHA 3V8MA 3P20A 2WJ4A 2J5RA 4WN9B 2HSGA 4JVLA 2BGGA 3QBJA 2Y66A 3IVCA 4TT3D 1RC0A 4BP8A 3ENWA 1P8AA 1YC5A 1LPBB 5EYPB 3RGGA 2DJIA 1Q84A 1LSSA 3UF0A 2WJAA 3C8MA 2YFKA 1U28A 4JLSA 4TLAA 5CJJA 2H5EA 4WXHA 2CLSA 5HIMA 5JY1A 1B6RA 1A4UA 2C88A 2QMUA 1AKQA 1WU7A 3RRZA 3RTGA 3P9CA 1MKYA 2CFIA 4J0CA 3GI1A 1N2ZA 2BDUA 3R77A 4MWBA 4JQYA 1BTOA 4KPUA 2VK1A 4O1IA 5ITZA 1XDWA 2JLWA 2W8BA 1B43A 1RFGE 3OCUA 1TIBA 4H0FA 4H9GA 2FOLA 1BGXT 4J49A 1AN9A 1KXZA 1YFZA 3M6AA 4MV9A 3E3NA 4EITA 5L40A 4IWXA 2A0WA 2PA0A 1KQGA 1D4FA 3T1QA 2CDRA 3D1LA 4LCEA 4B35A 1GUBA 4CI0B 1CR0A 1NUPA 2V4MA 1TD9A 3SY8A 5JH7B 1K86A 3FDZA 3MCAA 3RJTA 2PSJA 1NVMB 3FMFA