1W8EA

3d structure of cota incubated with hydrogen peroxide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
510
structure length
505
Chain Sequence
b'TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 505
sequence length 510
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA02
2XU9A 3JT2A 2Y1AA 1ZDSA 2IWKA 3BVDB 3DTUB 3UABA 2W88A 5I28A 2EIMB 2VW6A 4HHWA 1JZFA 4PCYA 2GI0A 5D4HA 2VN3A 3ABKB 4NERA 2PPEA 2YAQA 1SFHA 4P5RA 1E5ZA 5I26A 1M9WA 1CYWA 1KDIA 2X88A 5AKRA 3X1FA 2MTAA 1SF3A 4W1TA 3OQRA 2QDVA 1AOZA 1X9UA 3H56A 1PAZA 3FPXA 3G5WA 2FT6A 2IH8A 3U25A 1RCYA 1ETJA 1GW0A 3NSDA 4WTQA 1GY2A 5ANHA 4YSUA 1L9SA 2DY2A 2HLEB 4L0PB 4BWWA 4GP5B 6PCYA 3ASNB 1M57B 3FQYA 1WS8A 2BP8A 1N70A 3T6XA 4GXFA 2IWFA 2YAEA 1CURA 1JZHA 4A2FA 2VSMB 1AIZA 1AZNA 1OCRB 1FWXA 4DP1X 4P5SA 2BZCA 2AVFA 4G7SB 3FPYA 1TEFA 1SHWA 3PAZA 1A65A 3NSCA 1L9RA 1R1CA 1OE2A 1BXUA 2BW4A 3FSVA 2X87A 3QJRB 5I6PA 2YAMA 1KCBA 3X2QB 4DP0X 1ID2A 3AG3B 8PAZA 2DYRB 3H4HA 4YVUA 3OMNB 3WKQA 1N68A 4KNSA 1M56B 4F2FA 2OCCB 4AX3A 1V55B 2FNWA 2BHFA 4JHUA 9PCYA 2FT7A 1L9QA 2P80A 3SBRA 3GXUB 4A2HA 2AZAA 2XYBA 3NYKA 2FQFA 1YLBB 3N55A 1EHKB 2PPFA 4YSPA 1ASPA 1AZCA 2UXFA 2ZWNA 3NP4A 3NJIA 7PCYA 4Q8BA 4AKQA 2UXTA 2XUWA 1JZGA 2OJ1A 3MX0B 1GR7A 2I7SA 2DWSA 2OV0A 4DP7X 3ZDWA 1NTDA 4N4YB 1JZJA 5A7EA 4FAAB 2NRDA 5B1KA 1KBVA 3CVBA 1FFTB 2PCYA 1BEXA 2DYSB 3NT0A 3CDZB 1BXVA 1VLXA 3AG1B 4KO6A 3T71A 2P80D 3S8FB 3FQ2A 2TSBA 1ZIBA 3CDZA 3T9WA 1JERA 2EINB 4GY4A 1KGYE 3KW7A 2WO3B 1BXAA 1ILUA 2IDUA 2PP8A 1J9SA 1OF0A 2W8CA 1ET8A 1OV8A 4BK5C 1PNDA 3S3CB 4QLWA 4A66A 1JZEA 3C75A 3CG8A 3CZUB 3QJTB 1HFUA 4AI7A 4A2EA 5TK2A 1L9OA 1OCOB 4E9XA 1AS7A 1SFDA 3IEAA 2B08A 1NWOA 3AY2A 3EF4A 4A2GA 4F2EA 2BWIA 2UX7A 1AG6A 3CVCA 3ASOB 5PCYA 1SDDB 3FU9A 1AQ8A 3QJVB 2Q9OA 2BW5A 1OCZB 2XVBA 2FQDA 6PAZA 2YAOA 2HRHA 1PZBA 4E9QA 1KYAA 3X1BA 3PLYA 1SDDA 5F7BA 1KV7A 5IY5B 1AZBA 3H4FA 4M3HA 1ASQA 2PPDA 3ZX1A 2UXGA 3UGEA 2I85A 3X1NA 3NP3A 1ILSA 3PAVA 4BDVB 3NJFA 3S3BB 2QPDB 1XB3A 2VSKB 2BP8B 4HAKA 1NIFA 1W6WA 3OMAB 5I6KA 3HB3B 4BDVA 1PCSA 3T6WA 1BAWA 1AS6A 2VM3A 1J9TA 1PMYA 1QLEB 2RACA 2N0MA 3D12B 3ABGA 2FWLB 3FSAA 3EH4B 1RZQA 2PP9A 1E65A 3TBCA 1E67A 1NPJA 3SBQA 3AZUA 2JKWA 4E9VA 4A2DA 3NJLA 3WKPA 4YSEA 2EIJB 3NSYA 4GYBA 1NIBA 3V9EA 1E30A 5B7FA 3L45A 2H47C 1A4BA 3PXLA 1OOWA 5B7EA 5B1JC 2JFCA 2FQGA 2EILB 1NICA 1L9TA 1RKRA 2PPAA 4GP4B 1HAUA 1HAWA 1AG0A 1SF5A 2FT8A 4CSPA 2HXAA 2CAKA 2HX8A 2VW7A 1J9QA 3DKHA 3FYEB 1PY0A 1IC0A 3X1EA 1AAJA 1KDJA 4W9ZA 4YSTA 5I6LA 1MZYA 2A3TA 3GYRA 2FTAA 4NAJA 3ZBMA 1NPNA 1XMEB 4HHGA 2XV0A 1L9PA 1J5DA 2B3IA 3T6VA 2CBPA 4KOBA 4KNUA 5EHFA 1EZLA 2YQBA 3TU6A 3AG4B 1WA2X 2IDTA 4ZK8A 2GSMB 3EHBB 3WNIA 1PLAA 2GIMA 3OMIB 3V9CA 4UAHA 2DV6A 2WSDA 5I6NA 2CUAA 2IDSA 1GS8A 1RZPA 1X9RA 3RYMA 2Y69B 3ABLB 4YL4A 1ZIAA 1IKOP 4DP2X 2YARA 5B3SB 4G70B 1J9RA 5AFAA 1AACA 1DYZA 1NINA 2UX6A 2VMJA 5LDUA 3WIAA 4HCFA 2H5UA 2H3XC 4DPAX 3QJSB 2BP0B 4F7KA 3JTBA 1MDAA 2CCWA 1W8EA 1ET7A 5I6MA 1BQ5A 2WO2B 2AFNA 2BP0A 7PAZA 4BXSV 2YAFA 1GY1A 3OD3A 3S3DB 4N8UA 1NIDA 1GSKA 1JVOA 1NIAA 3T6ZA 3DIVA 3S8GB 2VW4A 3FU7A 2GC4C 1XB8A 1URIA 2FJSA 2PLTA 2GC7C 3X1GA 4BXVA 4A68A 5E9NA 2E86A 1OE3A 1GYCA 2FQEA 4MFHA 2XX0A 5I5MA 2PPCA 1WA1X 4YVNA 2IAAC 2PP7A 2YXVA 3NJMA 4Q89A 2YAPA 4X4KA 4YSCA 5B7MA 3TA4D 1ET5A 2IH9A 4HIPA 1ASOA 1IBZA 1WA0X 3FSZA 4AKPA 1A4AA 4CSZA 2ZOOA 2HX9A 4NB7A 3KW8A 1JVLA 2YAHA 4EF3A 1ZDQA 3QJQB 2ZONA 5B1JA 5I6OA 2QPEB 2XWZA 4RH4A 4M4RB 3PAUA 2GHZA 1UATA 1MZZA 4JKNA 2HRGA 5D4JA 1SJMA 5B1AB 2J57A 1QNIA 1WAEA 1BQKA 1BQRA 2JXMA 3NJHA 2XXFA 2IWEA 3NJJA 4QKTA 5TK4A 1KBWA 4HCGA 5I5JA 4BWUA 3SQRA 1AZRA 1TEGA 1DZ0A 1MG3C 1AR1B 1OCCB 1FA4A 3ABMB 4G71B 4AZUA 4ENZA 2R7EB 2ZXWB 4KOCA 1CC3A 4FA7B 1AZUA 1F56A 3QJUB 4KNTA 1CYXA 2UXVA 2R7EA 1AANA 1GS7A 4G7RB 2DWTA 4TXVB 3NSFA 4YSQA 1JXDA 3UACA 1PF3A 3HEIB 4YSOA 3WI9A 1B3IA 3MBWB 1NIEA 1SHXA 3FYIB 4UANA 4DP6X 2XXGA 2BWDA 2IDFA 2Q5BA 2LLNA 4G7QB 3ZIYA 5D4IA 1JXGA 2QT6A 4GP8B 3WG7B 4E9WA 3FQ1A 2BO0A 3FU8A 3FS9A 1NZRA 2GBAA 4K9JA 3AW5A 4YSAA 1PZAA 3UADA 3UAEA 3NJNA 2GB2A 4DP4X 4E9RA 1GS6X 1I53A 4YSDA 2XV3A 1SNRA 4KO5A 3IE9A 1A3ZA 4PAZA 1ADWA 2I7OA 4E9TA 2XX1A 1XB6A 1MG2C 2CJ3A 3EH3B 2PCFA 3AG2B 1PLCA 4AKOA 3NJGA 1PNCA 1PLBA 1T5KA 4HCIA 4YSSA 3SBPA 3TASA 4HALA 4KO7A 2CALA 1BYOA 1IUZA 3PCYA 2J5WA 4BWTA 3IN0A 3NJKA 1JXFA 1IBYA 3BQVA 4DP8X 1J5CA 1QHQA 5FC9A 3ERXA 3EH5B 4JHVA 1CUOA 4DPCX 2AZUA 3N2JA 3OM3B 4HZ1A 1NWPA 4DPBX 2HX7A 2YXWA 3QQXA 1A4CA 1TKWA 1V10A 4G72B 3UAAA 1JOIA 2TSAA 3FU7B 2XV2A 2J55A 2IDQA 1JZIA 2EIKB 3FSWA 4DP5X 1ZV2A 5PAZA 3WNJA 1W6LA 2J56A 4UF7C 5I5IA 2BZ7A 1PZCA 2MRYA 1AS8A 4A67A 1OE1A 3QPKA 3IN2A 2AANA 4DP9X 5B1BB 2QDWA 3TBBA 1ZPUA 3PPSA 1TU2A 3FT0A 4E9YA 2VM4A 1A8ZA 4WKXA 5F7AA 1E5YA 4YSRA 5AZUA 1BYPA 2HZHA 2XLLA 4E9SA 3CVDA 1V54B 1WS7A 3GDCA 1KCWA 4KO9A 3IBOA 1NDTA
chains in the Genus database with same CATH superfamily
3Q8EA 2RH0A 4DN4H 2EDJA 2ZAIA 3L1OL 3A67L 5EEVA 2F58L 3P3TA 4DW2L 4FQXB 1N3NA 1JZFA 5ESVA 3IKKA 4HFWB 1O0VA 3ABKB 3BWZA 3HHRB 3OLDA 4PJGF 4YHIA 5B3NA 5IZ7A 3SDCB 5L0QB 3AFLA 2CM6A 1XH3A 4CGTA 1BYNA 4JR9L 2WTPA 3X1FA 1QBMH 1QFUL 3AY4A 3WJMB 5EORL 3MODL 2F18A 1RP9A 1G7MB 4FYTA 1FI8C 3H56A 1NSNL 3PNWB 4NAMA 2OI9B 3RIAK 1EEZA 5I1EL 1VEOA 2ZCLH 3ETSA 2WLNA 1F02I 2CU9A 1QHPA 2PWEA 4LLUB 2OMTA 1XCQA 5GGSY 4KK9C 5ANHA 4YSUA 1JGEA 1I1YA 4LKCB 3C2SA 1CR9L 3N50A 1UADC 3DIFA 3U6XA 3BT0A 5CGYC 3OKDB 4KXCA 1PQZB 3FQRB 5J4MA 3MLVH 3QHZH 4G83A 2R15A 3AM8C 4KKBC 2XG4A 4PFEA 3S3JA 4MA7H 3SDXB 4H26B 4ZSOB 2QZ5A 4RAHA 5HGAB 4IKLA 4OFIA 3TA3B 1CE1L 2BVUA 4Z0BH 2VDNB 1TTBA 3M17A 2CKBL 1F3DH 1N19A 3MOAH 5AYQA 3WO3B 2NYZA 1X4YA 4U1MB 2V8LA 5IB5A 5D7KD 1BLIA 1KCBA 4Y19D 1ID2A 1Q9OB 1WK0A 3VFVB 3IVKA 1EGJL 2DYRB 3ILDA 3ECBB 5DFAA 3QI9D 3LD8C 4UU9A 1I9RL 4RFEB 1NMAL 2YMXH 2BHUA 5E5MA 4AGLA 4G9FE 2EXWD 1U8NB 4KI5C 1P5UB 3QAZB 3HB3C 4BRVA 1BV8A 1AC0A 3NYKA 1QYGH 4JFWA 3R18A 4L9DA 3HZKB 5IB1B 3B43A 3IDIA 4J3UA 4OH2A 4OGQC 2H26A 1CO1A 4LHUA 4Y1TA 5T3ZH 3VXSD 2FL5A 2KKQA 3MRMA 3GSUA 1JHLH 4U7SA 1JHKL 3VXQB 6TAAA 2OV0A 3HRPA 4B9PA 3V8OA 2IOOA 4NQCE 4OLUL 4ZUVB 3K2KA 3WJJC 4MDJA 1A7NH 3U46A 1A6WH 5DO2C 3V4PH 5IMLA 4JREC 3IS0X 1M2OA 5E9DE 4DOHE 4L29A 1AJ7H 4HJEA 3F5WA 5IM7A 5L2JB 2NY4D 3CLFL 3ETBJ 4U6VH 3DK0A 2D7TL 4HGWB 1HILA 2VT0A 4L3CB 3U9PL 4KH9A 5BV7C 4M6NL 1N26A 5T3XE 1DQTA 3L1EA 3FT3A 1THCA 2ESVA 4ODWB 2P5PA 1WBXA 3CZEA 3MJ8A 1TJMA 4QXUL 3IETA 2EDBA 3A4DA 3TH3T 2RMNA 2X4UB 2IBZY 3LVTA 2VQTA 1OAZH 5I66A 5IR1B 3LVEA 2VOTA 3LH8A 1AXTH 1JZEA 4G9FB 4JRLA 5DA4A 2J8UE 1GOHA 5BUAA 1DBKH 4U1HA 2QFRA 1KBPA 1L9OA 2FWOA 2VLJA 4HMEA 1I3RA 1JPGA 3EF4A 1A14H 3LPPA 3ATFA 4IKIA 4Z18A 2ZX8A 4LLVA 4O9HH 3SZ6A 3GK8L 1RHFA 1D5BA 4FJYA 2WVVB 3F85A 2NOYA 3D39E 1XF2B 5I71B 3UGUA 2WXJA 4BFOA 1OSEA 2ITDA 3IGAB 1P84J 1KYAA 2LU3A 1W8OA 4MGXA 3CBKB 4NQCB 5C07A 1BEYL 2GEQA 5T3ZD 2PPDA 2IPUG 1DSFH 1M1XA 1XGTA 1BG9A 3S4SG 3KAAA 5E9DB 4DOHB 5KSBE 3UZQB 2CK0H 1S7RB 5EBMA 2G5BB 2ZUUA 4H0LC 1MHHA 1PG7H 1XR8A 1CB4A 2O6EA 2EEDA 4A6YA 4NUMA 4KBPA 4OAWA 4CL7A 2GUOA 3SY0A 2ATKA 3V5DB 4KJQC 4XN9A 4NQSA 1M3IA 3MRHA 1G9NC 4J6IA 4K9EC 4WI3A 2C4FU 1FNHA 4AQEA 3LRLA 1FNSL 2IJ0C 1FAKT 1SJEA 4CN1A 4YSEA 1JP5A 3KVDD 1RZIA 2J8UB 2G2NA 1MEXL 2Z7YA 5F7LB 3BKJH 4AV4A 5B3JF 4LB8A 3MOBH 1R24A 1MKFA 4U7MA 1WAAA 4BHUI 3HNVL 2PO6A 3UDWC 1YYLL 5FCUH 1JK8A 1MJUH 3MBXL 2OL3B 1U8HA 2DQJL 4NUQA 1ND0B 4XNBA 4YDKH 2X6AA 1ZVSB 1ADQL 5K1JA 1AG0A 3MCKA 4NC0B 2CAKA 3D39B 3LKPA 2VW7A 3UJIL 3GBNH 2MOVA 3WXWL 3GPSA 5HHQB 5EU7C 1F2XK 2WKLA 4L4VA 4FA8A 4D8OA 3L4CA 4MD0A 5CSZB 3PL6B 3GYRA 2MQ0A 1N5YH 1M05B 5DRWA 1N4XH 3QB7C 1B6DA 1U58A 5KSBB 1ZD6A 2NTFA 4QPEA 1O5PA 3UJJL 3HFML 3NA4A 1A2YA 5T33L 2BWQA 4ZK8A 2GSMB 5HHVL 3MOQA 1X9LA 2DL2A 4F57H 5FWQA 5EG6C 4HULB 1CE6A 3BW9B 4HP5A 1EMTH 4MJIA 2OMXA 1CU4H 2FJFA 4YR6B 5TDPB 3RNQA 1GS8A 1RZPA 3AS2A 3CN1A 3QEQE 1K4CA 4LEBA 1L5GB 2Z8VC 4M7JL 1DTUA 1FLRH 2QZQA 4YE4H 5IWLC 4LRIC 1NINA 3QIWB 5D2LF 1J87A 4NPYB 5LDUA 1XCXA 4G80A 1KGXA 4N2AA 4PJ9B 4DPAX 3FNKA 4KZCA 4QNPE 4H25B 1BGXH 3OKLA 5T1MA 3ZPDA 4MD4A 4QIRA 4BYHA 1XGZA 5DD1H 4WU5B 3F7YA 3IGLA 1FVEB 3RU8H 3AWGA 2WXGA 3EDEA 4BXSV 5CFHA 3GMQA 1GY1A 5AW5B 4PYGA 4H0HB 3FQUB 5EMYA 4L8CB 1JVOA 1T04B 3ZHFA 3Q8BA 4FQQA 3RG1C 4KUCF 3WFDH 3BUPA 3S8GB 4AENA 1MQKH 1WBYB 2VW4A 2CMRH 4ZFFA 3BFOA 1GA2A 4FC3E 1UWYA 2GC7C 2ZOLB 3X1GA 4XPAL 2G5UA 4NT6B 5CBEA 2O1AA 4XPFL 5F1NB 1HWWA 3DJ9A 2FBOJ 2NNAB 5DEGA 3TIDB 5L9DL 2FSDA 1WA1X 2UZYB 3CVIL 4PJFA 4XRCB 4AUJA 4LE8A 4Q89A 3A67H 2YAPA 5B38G 2EVIA 4QR7A 2XHNA 1BVLB 3N9GH 4XNZB 4E0RA 3HBPA 4NP4L 5E9AA 2ED6A 5IJVB 5JW3L 3IDNB 3GIVA 1J86A 3WJLA 1WBZA 5D7SL 3LRMA 4XZUA 1VCBC 4F7PB 1CBVL 1JCKA 1JVLA 4W6YB 3VTTA 3QEQB 4QHPA 2FHFA 4U0QB 4JR9H 5E94A 3WDJA 5JW5B 5KVDE 5F0JB 3VG0L 1QMUA 2XWZA 5EORH 4WV1A 3MODH 1Y6MR 3QHTC 3HE6B 1UATA 5C8JB 5D4JA 1NSNH 1SJMA 2UZIH 4NFBA 5GS1A 5I1EH 1IBGH 1G1YA 2X89D 1BQKA 4P2AA 3AT9A 1U3HB 1ZAGA 5DDHB 4HOXA 2IWEA 4JL2A 2HVKB 1OZUA 1KPUA 3W5NA 3HC4L 2VITB 1ZLDA 5H94A 3QIUA 1TZIA 3MO1B 1OCCB 2DQ6A 5LQBL 5SX4H 1EEYB 3RJQB 4U4BA 3T4AB 4FA7B 2AKRB 3OV6A 3IJ8A 5EU3B 5T5NF 4JUTA 5HHOE 4AQ1A 4KZEH 1G7HB 3PWNB 1AANA 2VR5A 4WJ5A 3ATAA 1MHEB 3UACA 5I16A 2BSTB 1A6TA 2CKBH 3O6LL 3DPBB 1K4DA 4PRHE 4DUXA 4PJBF 1Y18A 4HIIA 2BXZA 2YGOA 3OJVC 3OKMB 3IJYA 3CFNA 4B96A 1G9ML 3HG0A 3PG2A 1JXGA 2QT6A 3HRZC 5KVGE 4L1DA 2DRUA 4YBLB 5JLZB 2PTVA 5MI0B 2EDYA 2VGLM 3OKKB 3EKCA 3ZZQA 4XBEL 4YSAA 4BHUA 1P2CB 4YIQA 4E9RA 4DP4X 4ESKA 1YY8B 5G5DA 5DS8A 3ARFD 4XXDA 3UTPE 4ZPVA 4MDRA 4BBWA 3GMMB 3QQ4A 2I7OA 3BI9X 2C9RA 4NWUL 3UBXB 3CQPA 2XX1A 4C56A 1U2YA 1W72A 3AG2B 4BE5A 2ZXCA 1HINL 3QE5A 1BLNA 5E1HB 3S36L 3NJGA 1LDPH 4K71B 4PHXA 2A9CA 2JIXD 4ES8A 1EERB 5EB9A 5DO2D 4XX1G 1KWGA 1NCUA 2GAZA 2XXCB 3HS0C 5DI8B 4R83A 4BK8A 5I8CB 2CCLA 2DYPA 3HVNA 3MRCB 3FAWA 2QJDA 4GXVL 3BAEH 5AW3B 3VXME 2YSTA 3NJKA 2YOAA 1G9NH 1T7XA 5C0FB 2AXFA 3WFHA 1PU0A 1DE4B 1KFGA 4F37F 3LKOA 1T20B 1DJGA 4PD4K 4CC4A 5BO1L 2XG5B 3IU4H 1CYGA 3R06A 4LPTA 8FABA 4ZZKA 4PRHB 4G72B 1U8CB 2WLLA 2Z31B 2WBJD 1T80A 3MX0A 3U9PH 4UM8A 4WWKC 1AHWB 1KG0B 1U8IB 4E42A 1LGVA 4J3XA 4X6DE 2KS0A 1E8WA 4QXUH 1XIWC 4PJIA 2VR4A 4Q9QH 4AQOA 1XFPA 3OAYH 1BZ9A 2DS4A 3UYPB 3HG5A 2ZSWA 1CMOA 5GZNA 3OB8A 1SMAA 3QJZA 2GHWB 2NUPA 1WT5A 3E2HB 3TBBA 3RUGA 4DEPC 3QC5X 1Y1UA 4JY4B 4G1MB 5FM5M 1TPXB 4LEOB 3QUXC 4JRFA 4PD4J 4E9SA 5LGKA 5BRZA 1SYSA 2IAMD 3CVDA 5ESQB 4M8RA 3RFRA 1KCWA 3L3OC 5CINH 2P5EE 1NDTA 3VU1A 1WCBB 3GK8H 2IWKA 1ZA3B 3SE6A 1DUZB 2Z1KA 4WUKL 3KYAA 1NGQH 1XSOA 3MYJB 3FH7A 3UEQA 1FNGA 3QQDB 1OTUD 1U8JB 3VXMB 1IKNA 1XHHA 2YAQA 4Q6IB 5T1KA 1YN6B 1BEYH 5K1VA 3MKGA 3Q0HA 1E5ZA 4PJEF 4N28A 1C16B 1M9WA 1QLRA 5A7BA 3G5YA 1NC4B 4LMQE 1X5FA 4WO4A 1GZQB 2BY1A 2DLIA 5J8OA 3OQRA 3RB5A 5GRUL 1KIUB 2IBGA 3M86A 4D9LL 1PAZA 1NCCL 2CHWA 3VXTA 5K9QG 4JB9L 4YHZH 1JS4A 3GI9L 3LNDA 2BNQE 2UVFA 1AE6H 4FN0A 4LP8A 4K5MA 2C7UB 3AVEA 5JQIB 4DO5A 3TBSA 5FUCC 1B4LA 1SN5A 2HLFC 2R0KL 3IGUA 1Q0YL 1IM9B 3QO1A 4JS7A 1CFBA 3TGXA 4EPSA 1U9KA 4UIKL 4X7DC 4YFDB 1ZXKA 1ACZA 1EJ8A 2DTML 2ZKHL 3FO0H 4NLAA 4G6ML 3KBFA 4XWGL 5TE4L 4JY6B 3O2DL 1Y6KR 3F83A 5C0CA 6FABL 1NGYA 2ZAGA 3CZFB 2FATL 4JGJA 1HI6A 2AVFA 5E8EA 3MC0A 4N2CA 1SHWA 2DIJA 4YEEA 3FCGA 2P5EB 4LSTL 2OXGA 2DQJH 4WHYH 4OZHF 3N44F 4P59L 4UNIA 5EOTB 4A1RA 3NPSC 2DQCH 1IGTA 1L9RA 4CJ0A 1ADQH 4QY8B 5JIIA 1CICD 5ETUB 3BXNA 3CPUA 3T0EE 5CD5C 2Z93A 3WXWH 4PVLA 1NCBL 2FD6L 5BZZA 5F6HI 4IDJL 8PAZA 1MW1A 2D31B 3JXAA 5SV4A 3H4HA 5CN1A 5CO1A 4TQHA 1SY6L 1ZWIB 2OSXA 3MZTA 1CZ8H 4MNQE 1A64A 4BINA 3O4OB 4FFTA 4F2FA 3UJJH 3HFMH 1QRNE 1L0QA 4M1CC 9PCYA 2R29A 4D0DA 2CGYA 5EV7A 4GG6E 3DX4A 3RZCD 1IM3D 2X1PA 2BNQB 3VD7A 3ILEA 4KJYB 2VL5A 4IU3B 2JJUA 2WLYA 2WP3T 1CGTA 4P9HC 5DMKB 4M7JH 2N4IA 4Y0GA 1ZHBA 1XF5B 4Q8BA 4XO3A 2YD6A 1TQSA 1FZKA 2FX7L 1JZGA 2LR4A 1PKQA 2IH1B 2COQA 3ULVL 1XH0A 4RFNC 2OK0L 2DWSA 5DJ6B 1P4LA 4WI2A 1XD1A 3U1SL 3COOA 3I3DA 2QQQA 2DICA 3LQAL 4NQDA 2HG5B 1H6TA 5C2BH 2W60A 4IKJA 2YA1A 3UMNA 3P4LA 3NCWA 3FB8B 3BUDA 1DLFL 1D7DA 4CMMB 9CGTA 4GNKB 4HX1A 5T1LB 3AG1B 4NBZB 4UTCA 2DIAA 4J12A 3S8FB 5FK9A 3U0PB 2JNZA 3T0EB 1YJDL 1MFDL 5C0AE 4P8QA 2PYED 4H1LH 4P07A 3TWCL 5L9DH 1H6EA 1HH6A 2K7QA 1PNDA 3HUJE 4OZFH 2V5SA 4MNQB 5HHPA 3PIQA 3CDFA 2WYZA 3RY4A 5ERWB 1BZQK 1QRKA 3GUTA 3CFIC 1QRNB 4NP4H 2NLJB 2VIRB 2EVHA 5JW3H 3IDYC 3ZE1E 1XF4B 3AM8A 1NGPH 2V37A 3MV7A 5IB3B 5D7SH 1D7BA 4PJHA 1CBVH 1HEZB 1SFDA 4YOKA 2UZXA 3PHAA 3D08A 2B1AL 3VQ1C 5JZ7C 4QRAA 1IAII 4QTHA 4DUVA 5AENA 4CW1B 2ENQA 3HI5H 1ZT1B 4DQOL 1YEHL 2DJ4A 5DVNA 3T08A 4XTRD 4OLYH 1JF1A 12E8H 2VDPL 3FTVA 1DO5A 1H15A 3V6ZA 1PJ9A 2R0LL 3D0VA 5A2KH 5CWSA 4P06A 1HHGA 1UZ6F 2Z91A 2NSXA 1MPAL 4BDVB 3PQYD 1TYEB 1KACB 3Q2WA 5DJ8A 5GRJL 1KEMH 4QOKE 5F3FA 5IB4A 3MN8A 4NQQA 4HK3N 5LQBH 4I89A 4BRJA 2YEQA 1Q9WA 3ASWA 4N2DA 3WUWG 2Q6WB 4DKEL 4KZDL 2VXVH 3MTRA 1NGWB 4TUKL 3VRJA 4MYWB 1NGZB 1DQQB 1SYVA 2AQRA 5C0AB 2A6KA 35C8L 4C47A 4X8GA 1T2QL 2ITEA 2W9DL 3FTZA 5LKNA 4FYSA 2ICEC 5B39G 4E41D 3HUJB 1T2JA 4B7LA 1OQXA 5FS5A 4JFSA 4WI7A 3LAFA 4HGKC 4F9PC 3WD5H 1SGKA 5HGBA 4K8RH 1S7WB 3FCBA 4A39A 3ZE1B 1HJBC 4L05A 1UEMA 2D3JA 4LBEB 3WJJA 1QFWH 1AO7E 3QWOB 3EYFB 2APTA 3FHAA 3BZ4A 1A6PA 1S8DA 1V7NL 4XBEH 1XDTT 4TNWF 4O51A 5IKCB 3GMRB 4P2QE 4PWIA 4IW4C 4UOQA 1FZOB 4ODBD 4WW2F 1WIUA 1M6OB 4N2FA 1Z9SB 4RRPA 2FHCA 2X4OA 3RHWK 4YZFE 5LG6A 1UYWL 2O6PA 4PJXA 3NSXA 5I6LA 1PD0A 2Z34A 4PBDA 1HINH 2XTJC 4R2GD 3S36H 5JHDD 4NX0A 1SEQL 5EU6D 3QR1A 3JUZA 5EWIH 4IOFC 1B3JA 1MHPH 4TF4A 5BZXA 1JFQL 3TU6A 4QOKB 1BMGA 3MDJA 2CJUL 2EEXA 4XP5H 1MFAL 1KIRB 4GXVH 4UZGA 4MHHI 4JG1L 5E8NB 4KK8C 5C2UB 5C70A 4JFYA 1ZGLB 3MQIA 2R2BA 2YEZB 3MLYH 3CDCA 4YAQA 4KKPA 3MRNB 1FSKB 2GSIA 2XIIA 1LMKA 2FWUA 4WKZA 1AACA 1M7IA 4EI6B 1SEBB 2IIJA 3HG4A 4OCRH 5HYJA 2GFBA 2BP0B 2ADIA 5HVWA 2CCWA 5AB9A 3FU3A 1JIBA 2DD8L 1WCQA 3KJ6L 2OMBA 1AIFB 3BFWA 1AO7B 4NZUL 5F3BB 1E5BA 3E6FB 2YAFA 1MAMH 2XWJA 3QUXD 1KTCA 4HEPA 3L3KA 4K8RD 3ZSTA 4P2QB 2F53E 4O2CB 3KS0J 1HHJB 1IBFA 1A6AA 4NQXB 5CIPH 1VGEL 4X7FC 4L3EA 3VG9C 3FU7A 3NGBC 3B3BA 3E1ZA 3L3IA 2IPTL 2Z9TA 4I7ZC 5BS0D 3U7YL 3J2PA 1MUJA 5DT1L 3SKUD 4RISL 4PUBL 4XVOA 5GJSL 5AOKA 1YEJH 3B9VA 1JYVA 3NQKA 2NDGA 2PPCA 1QSZA 3ESOA 3GMNB 4R96B 2W38A 4MX7B 4QHKI 1EO7A 1Y1DA 4LCUA 4EI5C 4U0RC 1FORL 3L2MA 2LLLA 2VLLA 3UTQA 3KPOB 4AKPA 3MMEA 3L9RA 2A4CA 3HZVA 4H13C 4NZDA 1SXAA 4UTBL 3THML 5AVQB 4HAGA 3UDWA 1PGRB 3GJFB 5AQ0A 4EXKA 5GRUH 1HHIA 3TNNB 4BFRA 1QI4A 4C58B 5ESAB 1NCCH 4BQ8A 1HN1A 1LD9B 4ISVB 1AMXA 5JPNB 2WXOA 4RAVB 4ZNEE 4G5ZL 5HYSB 4PCKA 2PR9A 5GGQL 4QKTA 4CJ1A 3F6LA 5LCVL 3RWDA 4HJJL 4JZNB 5DD3L 1S46A 1U8KB 1ZVYA 4OFKA 4UT7H 4ZOCA 1Z9OA 4PCSA 2UY7B 4UIKH 2F53B 3A24A 4IRZL 2ZKHH 1JHTB 1FN4A 1PTZA 2DB8A 4GH7B 5F1IB 2X4PB 2B5IB 5M7QA 1NJ9A 4NO5A 4L9LC 4AIZB 3AJ7A 6FABH 3NCBB 5L7XH 2EABA 3KDMA 2FATH 3RX8A 1DFBH 5DJAA 3NK4A 4PMFA 4M61B 4YSQA 1JXDA 3E9TA 4LSTH 5ANMA 3VG0H 4P59H 5IWLA 4WFEE 3F7PC 2F5BH 4LRIA 3QZPA 3HC0A 7TAAA 3ZE0E 3QP3A 4Z7OF 3DROA 2PW2B 3DARA 4NO3B 3K74B 2FD6H 2VH5L 3MBWA 4JM2F 1WO2A 3BP6B 3N85L 3V0FA 4Y5VC 5I8KH 4LVNC 3BDYL 4PTTA 4J7RA 4GRWH 4S1DC 3KPNB 5LNDA 4EIBA 3GSOB 4L1LA 4N90D 3ARPA 3E0GA 2A83A 1R34A 4OCLC 2QLVB 1GGIH 4BFGA 5IFJA 4O02L 1B9KA 1HKLL 2A6IA 3A6BL 1QFHA 1UCBL 1K3IA 4N3TA 2ED9A 2Q3ZA 3L1FA 5FKPB 1FG9C 1QFWI 2B77A 2CA4A 4NRXB 3TM6A 4W9JC 4B9CA 2H2SD 4UAOB 1OXYA 1U91A 5IMOB 4FQ1L 1CQYA 2NNRA 4XODA 5D93B 1JDDA 5GGSB 2H6PB 4TNVF 2J5WA 4JJ5B 1MF2L 3QFJD 1I1FB 2PYEA 1MVUA 2BX5A 3U1SH 5FFLA 4OI7A 4DAGL 4WWOA 3STBA 4ZO6A 3RB7A 4N2EA 3K80A 2EVJA 3CC1A 5IREA 3LQAH 5EO9B 1L7TL 5IHZA 1RZFL 4Y5XC 3IJ9A 3G7TA 3SGDH 3CFUA 1DLFH 4X99B 5HY9B 3IWVA 3VM5A 5AZ2L 3NCYP 2D7OA 2A9MH 1JOIA 1SUHA 4G6FB 3DRTA 2VABA 7CGTA 1T1WB 3ZE0B 1EZVX 2GIXA 3FRPG 1ZV2A 5PAZA 3KGRA 5EUOA 2H1XA 3IPBA 4I5BA 4Z77B 4XNQA 3TWCH 1K2DB 3QHFL 3RURA 3HTLX 4MA1B 2BOLA 2AANA 3SGKC 1T5WA 3BLKA 1GCYA 1ZPUA 5EEZA 5DK0A 4DO4A 2X9ZA 1PX3A 5ABAA 1O6SB 1A6UH 5JPMC 4W9KC 2E47A 2Q10A 1Y7VA 5IBTL 1Q0XL 1E40A 4DIXA 1WYJA 3Q7JA 3WNKA 4DKFL 1VCAA 4BKTC 2M2DA 5E8DL 3KXFE 1YNLL 1CFSB 1NLBL 3LZFL 5KTEL 3MCG1 2VDPH 5DZJA 5DZNA 5LAXA 4PY8I 2R0LH 1NEZA 4X8JB 2V6HA 1YQVL 2J21A 1F0LA 2P4AB 3HRZA 1MPAH 2N7BA 4MA8L 1AGEA 5D6CB 5AW6B 4GLRI 1F1GA 5GRJH 5HI4C 4MJHA 2VSCA 2C26A 2ZKXA 3KBPA 3ORJA 5D7JB 1R3IL 5A16A 2M26A 3DHPA 3IFNL 1AGBA 4UIMB 5T5NG 5IROD 2ROYA 4TUKH 4V1DB 3OB0H 1JGDB 5MENE 1XGYL 3O6FC 3BH4A 1RSYA 4AEIL 4UUJB 2H1PL 2W9DH 4OY9A 5CNHA 2O93L 2G60L 4P5TC 3P11L 1QBAA 3T6XA 3HS0A 5DYOB 1CURA 1NDGB 3HZMA 2ZAHA 2VDNL 5CS7A 1Q72L 2VLKD 5JHDA 5EU6A 2PW1A 1FNFA 1S3KL 5HGDA 4NKOB 2Y25A 4OB5L 3MRJA 2FSEB 2GTWA 3V4UH 2KPNA 4NQVA 5CAYB 1V7NH 4P46C 2CHNA 5I1KH 3NSCA 2GSGB 2EDLA 3HI6H 3L5IA 2UV3A 5IQOA 1ZT7A 4HUWA 3FCTB 1G6VK 3KXFB 3QJRB 1LEKA 4WWKA 2PABA 2W0LA 1TFPA 4NO0B 5KYUA 1KN4L 2LHAA 3DPDA 4WUUD 1XIWA 5FECA 2CUHA 3V0JA 1AGDB 3RGVC 5TGBA 1B0RB 1N68A 1NMBL 2P8PB 3QQ9D 3DUUB 1JFQH 4WGVB 1V55B 2CJUH 3MBEC 4HWZA 1MFAH 1FFOB 2P80A 3RWJB 5IMKA 4LSUH 4PGBA 3ZRSA 1RL1A 2W81C 2ZOKA 2C9QA 2FQFA 2VDOB 1CK0L 1HSBB 5MENB 1UM5H 3QUXA 3D87B 4GS7C 4LCWE 3BUTA 3K2UH 1F4XL 4FNUA 1QAWA 3NABL 3L3OA 5JXAL 2O6DA 2LVCA 2FYVA 1QR1B 3GM0A 1FPTH 4Q6KA 1N2RA 4U6HB 4HIHA 2DIEA 3QQNA 1AOHA 5BS0A 4B5EA 3T2NH 3VJ6B 3SN6N 4HYTB 3S2AA 1R3LB 4GRLC 3MGOA 4Y4HB 4LL9A 2NRDA 4MNGA 4QDGA 2FIKB 3MFFA 3HLKA 1SQ2N 3WXVL 2HLAA 1KV3A 4L23A 2ICWB 1L6XA 4AC4A 3SDYL 3POHA 4NXKA 2JKLA 2W94A 2WXIA 3MJ9L 1NLDH 4NN7C 1GVIA 3CDZA 2NSMA 5F9JB 2YMOA 3RBSA 1MRDL 3L5XL 2WO4A 3U7YH 3SE8L 3MNZA 5DT1H 3LQZB 2YJLA 4PP2B 4RISH 4PUBH 1CLZL 1WJ3A 1ILUA 1LNUA 5AW9B 4MSWA 1ZSDA 5FM4A 1OV8A 4BK5C 3QXAB 4HLJA 3ECQA 2HJLA 3MFGB 4M62L 3QORC 4J8RA 5E0QA 5KYYB 3ZKND 5LNEA 1G84A 3CUPB 1G5GA 2GJ6E 1JGVH 2OJEB 4HWNA 4WFFD 3V79C 1J5HA 1RUPH 4K23H 3NRFA 4UTBH 1QW9A 3DURB 3ULUE 3KLAA 3AY2A 3GSVA 4LCWB 5LB1A 3D85B 1ZGLP 1M2VA 4K5PA 1AQ8A 3TBYB 3G5VB 6PAZA 3HAEG 1FG2A 3B9KD 1VGKA 3PHQB 1QBBA 4OGAD 3VA2C 4TQEH 3W81A 1MCOH 2VDKB 4Y4FD 3QS2A 2X2UA 3LX9A 5EOCL 2PTTB 1S7XB 4LSSL 2I85A 3MRPA 1BOGA 4HETA 3GJEB 1E43A 5CGTA 1I8KA 5LCVH 2H2PC 4PJ8C 1HHKB 4POZD 3K6NA 4I4WB 1A4JB 2NPLX 2IBBA 5TPWL 3VWKD 4YFEA 1CDBA 3AREB 5HGHB 4IRZH 3T0BA 1FL5B 2FUQA 3IAQA 1P7BA 3TPUB 4OIIL 4F1SA 1TR7A 2HAZA 4R4FH 1UH2A 1OB0A 2BSSB 3AT0A 4WY7L 1RZQA 1TIUA 5ID0B 4BFJA 2QSVA 3CN0A 2YR3A 5FUOL 1FNEA 3QULA 2WMPA 1NBVH 5AEAA 2OL3L 1KYOK 3CN3A 5EFIA 3L4WA 2DBLL 2DW5A 1DJXA 2WCGA 3ZYIA 2VH5H 3S4SA 2GJ6B 1FCCA 1WFOA 3P0GB 4NN5C 2DLGA 1DQML 5GGUA 2YD0A 4M8QA 1TZHB 4UQDA 3RWFB 4DGWC 3BQUC 3TJEL 2GTZB 1QSEE 4LQFH 4BSVA 4O02H 3VMOA 1HKLH 2YMTA 4PJ5D 3WHE0 3WNNA 5DJCA 4BKLA 3A6BH 4XMKH 1UCBH 1WSST 4IYKA 1ANUA 4NOFA 2FTAA 1ICTA 1GKOA 3KYOB 4F8TA 4LSQH 1K8DA 5AW0B 4KNUA 3ZK0A 5AB0A 1EZLA 1KYOJ 4FQ1H 1H5BC 3SKOB 3HBQA 3M1CA 3HPLA 1MF2H 1Y0LA 3U4EB 4WWPA 3ET9F 2QGBA 2W9EL 4QF1A 4JAMB 5DD5L 2YLKA 3IS1X 4RDQG 6CGTA 1Z5LB 4YL4A 5J13C 1L7TH 3DSFL 3H0TA 4TN9A 3DX0A 1FYTE 1SXZA 1E50A 4PRAA 3QDJD 1FJ1B 3CSBA 4KKAC 5AZ2H 5AB2A 4MA3B 5DJZA 1T21A 4XCEA 4M93B 5AL8A 2KZ1B 3GIZL 2YOCA 3E6HA 1VZIA 2WO2B 2DWEA 1GOFA 1GJIA 1T22B 3DA0A 5J9PA 4LLDA 1VESA 2FJGA 3QHFH 3SO3B 3DK2A 4PGCA 1DANU 3OD3A 4J3BA 4DH2A 3LNHA 2ZOWA 3T6ZA 3KM1A 4JO5A 1T5XA 1QSEB 3V5HA 2A9NL 3CVHH 5JORA 3BKYH 5H35A 2NXZB 3EJZD 3NAAL 4IIQC 4KJWD 4NENA 3CFKA 5AVYB 5C71A 5HP5A 3SE9H 5CILL 2J72A 4KDVA 4NBYB 4XBGA 5T1DH 2YSSB 4QCIB 3RQ3A 3JWNE 5MEPA 1XGQA 1Q0XH 2DM3A 5F8RC 1JN6A 4FXKC 2ICEA 3SQBA 3TA4D 3NUKA 4DKFH 4MKTA 5E7FA 4ZS6C 4GXUM 2QVTA 4CNIB 5GGRY 4F9PA 4XMXA 3BWUF 1SQMA 1YNLH 4Z7QE 1NLBH 2JI3A 4FXLA 4YS4A 5KTEH 3E38A 3OJ2C 4X80L 1AKJA 5KSAB 1ROWA 2BCKB 3ROOA 2Y2WA 5F6IB 5EEWA 4MA8H 1FYTB 3BZDA 3D3VE 3NCYS 4YHML 3LNIA 3VFUA 3ARYA 1S5HA 2XZAL 4FFWD 1KELL 4LPWA 5B1AB 1YDPA 3IFNH 1BVKB 5DSCB 5IQ9A 1B2WL 4H8WL 3O4LE 1UEYA 1E6JH 3BP4B 5IBLC 3WEMA 1XGYH 2I5YL 1D5RA 1CJYA 5ICYA 3VD3A 3ALWA 2H1PH 4XNYL 4GG8B 1CFVL 2VQ4A 3BIBX 5EBGA 5I5JA 2GIYA 1PD6A 3VTAA 4YJZL 4ADJA 3V7AG 3BT2H 5J0BA 1S9VB 4EN3C 3DYPA 2OJZL 2V8MA 4HS3B 3CQQA 4WUUA 3QUYC 4KKRA 2FDBP 4NZTL 4OB5H 2KZBA 2AJ3B 2XA8H 4LVOB 5JQ6H 1M1SA 2PWFA 1DLHA 2F19H 3ELAT 1A4KA 1QI5A 2P5WD 3C09B 5FOJA 5DEFA 2X6MA 3UTSA 2XNAA 2WYHA 4QXTA 3V6BR 1L0XA 1GC1L 3WIHL 5SWQB 2FCBA 4GW5A 2G2RB 1KFAL 1JNNL 4Z7QB 4F7MA 4J4PC 3DX1A 1G0DA 3DX2A 2YFOA 2V3DA 4HKZA 2CGRL 4KROB 1BM3L 4OBSA 3NFSL 1WUNT 3H6AA 5HDWA 1XSJA 3OSKA 3NJNA 3D3VB 2N7AA 5K9OA 5EBLA 3T3ME 1KCSL 5AVZB 4FD0A 2R0ZL 2BVOB 5EEYA 3L3DB 2ID5A 5HI5C 5C09E 5C0NC 3LSOB 2QVMA 1IQDB 3O4LB 3O3AB 4A63A 2R2EB 3ZDYF 1YY9C 3F04A 4Z3JA 5JXAH 4GRLD 3CFJA 4HCIA 2FR4B 4XC1L 2Q8AH 2YD3A 4PG9B 2F7OA 3RPIB 4YHYB 2F7RA 3EYUH 3US1A 1TCRB 5JUEL 2XTLA 2JMRA 1N59A 1SM3L 4KI1A 2CD0A 4BZ2L 1KMGA 3VQLA 3DGGA 3H9YA 4M6OH 4MAYC 4EI5A 1V3MA 2X9WA 3AS3A 1BP3B 4DP8X 4YDJB 3POCA 3KL3A 3QEUB 3NFNB 1NOFA 1TQWA 1BFTA 4YLBA 4GSQA 2ATPA 4AVKA 5TDOA 3SJVE 3WXVH 4JRYD 5FYLH 4NM8L 2VC2B 1MFBL 2D3VA 1QA9B 2PCPA 1D7FA 3NCMA 3Q3GA 4GFTB 1QKZL 1S7SA 2YQGA 2BOCB 3D2TA 4DNLA 1K6QL 1ZHNB 4QRPE 3QORD 4BH8A 2C3VA 4AITA 1MRDH 2DZEA 2FEDD 1BF2A 4G3YL 4R8WL 3SE8H 4X6CB 1FVDA 3VDBA 4BA0A 1PZCA 4UCFA 3TN0C 4X6CF 5LGJA 2MRYA 3D25A 4WFHE 3HLAB 3LRGA 1ZV9A 3QQ3A 4M62H 3ZKXB 3T3MB 3RIKA 3VMNA 1T0NA 4OUOA 1RZJC 3FQ4A 2WXNA 4TSAL 4ZDHB 2VM4A 4ZFOL 3S35L 5C09B 3DO7B 5AZUA 3Q9QA 4L9LA 1IBDA 1F6AA 5D1XE 2CR3A 4JFTA 4U1NA 3F2LA 1J88A 2VWEE 4AZ8B 3LB6D 3VWKA 1CL7I 1HXMB 4PV1C 1FC2D 4PREB 3WIFB 1D5ZB 2KERA 2RCSL 4FQIL 3IMVA 1KIQA 2HKHH 2QGEA 2I07A 3G6DL 3RILA 1LK3H 2FZ3A 3OKEB 3PP4L 3BEVB 3MRKB 5F7UA 5HSFA 4GI8A 5EOCH 2RAMA 1WZ1L 5GRVK 4FP8L 1EFXD 1NMCC 4Y5VA 1MI5D 1R3HB 3V0AC 4EUPA 1Q0EA 4MMYB 4NZJA 4YLCA 5MERA 3MU3A 1K72A 3SJVB 4X6FA 4Q14A 3MLXL 4H0IA 5F7KC 5TPWH 3TXAA 3QG6A 4UNUA 5FF6A 4FYRA 1XGUB 3MGTB 1Z6JT 3FPXA 4FFYA 1UTDA 5ALCH 1K9TA 1A3LL 2YJQA 2LTQC 5AKSA 3SKNB 3QUZD 4QRPB 2K0RA 2TAAA 5FYLD 3TVMC 2E9GA 4QRUB 4FFZL 4AXWA 5CD3A 4CN4A 4L0PB 4WY7H 3LEXB 2Z4TA 1M57B 4RMWA 2H8PB 5AL0A 5FUOH 2V2TB 5C0GA 1CXEA 1C08B 1MCSA 4PJ5A 5CJBA 4FLOA 3RDTC 1FFRA 4JM4L 3VGEA 2BNRE 4I3RL 4MCNA 4L3AA 1OOAA 4N24A 1U92A 5FDWB 1BMZA 2OX5A 5FV1L 2D8KA 5ECGA 5DJDB 1KB9J 3LZQA 3SPVA 5D1XB 5CBAB 3DYOA 4LNRB 3TJEH 3B2VH 2MKWA 3M46A 2V33A 4RX4A 4X4YA 2VXSH 5I1IH 2HKFL 3FSVA 2R9HC 2WCSA 3OGOE 1MJ7H 3R1GL 4D9RD 5JR1H 2E7BA 1IAKA 4BK4A 1XBDA 4FI6A 4OZ4A 1GPOH 2YUVA 4WEUD 3FRUB 5DYFA 2C9AA 3NRQA 3FTGB 3GJFK 1IC7L 3REWA 3VNYA 2D0GA 3DMMB 3SGKA 1O9WA 2BHFA 4NNXA 3CFDA 1VRSA 4JLRB 1UGNA 2VDRB 1ZLVH 1KXTB 2W9EH 3MV9E 2NYKA 5CEZH 4NGHL 4JRXD 4XNAA 1HWGB 2ADFL 2DQFB 3D4ZA 4F80A 2HT2C 4OD1L 4WK4B 1UXWA 2XQYK 4DGUA 1YEDA 1KLUA 2OJ1A 2NY7L 3ILQC 3WTXA 5IGXL 3BMWA 1RJYA 1DVSA 3DUSB 1P5VB 3X3FH 5EF2A 3MUGA 3OR6B 2BNRB 1CDYA 3VM7A 5I1AB 5A2CA 3I9AA 4OI9A 3LHPH 4AGQA 1JPST 1YO4A 5I75B 1FH2A 2WLIA 3EYOB 1KBVA 3UIZA 3BUIA 5FUZL 1HQRA 5C6WH 2F74A 4FQ2L 5DVKA 2E76C 3GXNA 1NBYA 4HKJA 4M5ZL 3SPGA 2A9NH 4XMUA 2NNXA 3NAAH 1IZKA 4G8EB 1JERA 4LEXL 4KPHL 1OGAE 3VFPA 4DF9A 1VACA 5CILH 3V4VB 3O6FA 3PWLA 4W6WB 5E0FA 4G42B 3W9DB 3ZJAA 2XZQH 3TL5A 4N87A 3TBVA 4XH2A 3U36A 1DQDL 3KPPA 5E08L 4OD3H 5IVXF 4P5TA 3G5XA 3NCFB 4YK4B 4YHIB 2P52A 2CHDA 1NAML 4U4IA 4X80H 2AEIT 5ILTL 3MV9B 4RQQA 3DOIA 5BZDB 1OAUH 3WFBL 3C6SB 1OGTA 5AOZA 1QSFD 3JZYA 1HL5A 4W9HC 4ZUWB 1EJOH 1FAIL 4FQHB 5D1QD 2WZPD 3VSQA 5A6LA 1U8QA 2CSPA 4A7GA 5E2UL 5EZOL 5CEZD 2KC0A 1KELH 1RMFH 2VKWA 3D18A 3DDGA 4JQIL 2UYLB 1HK6A 1B4JL 3BPNB 3WYRA 1YN7B 1PDKB 2OMTB 2X44D 3BIKA 4KQ0A 3IXTB 4EN3D 3AXIA 1JGEB 1NC2D 2I5YH 2WIIA 3CVHA 4R6UA 3U2SA 2OAAA 3T2PA 4PGDB 5I74C 2WTRB 1CFVH 2E8ZA 3QUYD 4FJZA 2WWKT 3JWOL 4W9DC 4YXHL 3RGVA 4PJGA 5I6KA 4NZRL 4KUCD 4RNRA 4PLNC 4HFUL 3O8XC 2R1YA 4P3CH 3MBEA 2XG4B 1F13A 4KVCL 3WL9A 3U4BH 2OJZH 4QRBA 1XF3A 1IKFL 1ZLWH 1U93B 4PR5A 4DKDC 4QXGL 3QGVA 4ES9A 3HS8A 1R5IA 2KMWA 1OGAB 4X9FA 3DTDA 4NZTH 5K69A 3UPCA 2MMXA 5LGHL 5JOPE 5DC4B 3C9NA 5FYKE 4OZGA 3BVWA 1T1YA 3NJLA 3QZNA 5AZEL 3HOGA 3WKYA 2O72A 5EU4A 3VAEA 1GC1H 3WIHH 4CU6A 2A74B 4MYPA 1KFAH 2ERJB 4XN1A 3IVKB 1QACA 2P8LA 3U6RB 2Y6SC 1EAOA 1WFIA 4KQ4L 4QHMB 4GRLA 3RWEB 2VLRD 2FQGA 2CGRH 4PJ7A 1BM3H 2EILB 1JPTL 1BFVL 1NICA 2NXYC 5E5MB 3L08A 3LN4A 1L9TA 3I2CL 3SYCA 2ITFA 2QLYA 5EU5B 4A37A 4OF7A 2R0ZH 3ARDB 3S96A 5JMOC 1JRHL 3ARBB 4HPHA 4ZO7A 2G75B 4P2OB 1ED3A 4W9ZA 3P2TA 4PS3A 5A2AA 4NO2A 4N6RA 4AH2A 1NPNA 5I9QC 5EBWB 5B39A 4JRYA 2GK2A 2ZOTA 3V7MA 5DQ9A 1SXSA 4XC1H 4K0OA 4P2RA 3KLKA 3R8BB 3GSUB 4OFYA 1MY5A 1BQHB 1FIEA 3C8KA 3QUKA 2MWCA 3NIDE 4BK5A 5JUEH 3TEXA 1G6RB 1SM3H 2WLKA 2GBTA 2XC8A 3QORA 4QWWC 4RGOL 4BZ2H 4LF3A 1Z9PA 4MDJB 2OR8A 3MLSL 4IGBB 3CLEH 2VDML 1PIGA 3BZFB 5IMLB 1UOLA 1LO5B 4H8HA 4DP2X 1BFOA 5D7LD 4JFQB 3VE0A 1ZMYA 3NVQA 3TTYA 1CCZA 3QJSB 2DMCA 1QKZH 1MDAA 2ZUXA 4FFVD 4RMQA 5D7IE 5ID1A 3K5RA 1K6QH 4DZ8B 3WN5C 1FE8L 3DRQB 4G3YH 7PAZA 2OFQA 4YQXL 2JKJA 5BCAA 4FQPA 1NCAL 2MHAA 1IIIA 2V5YA 1F6FB 4KRMB 3JWDL 2Q1EA 4URTB 5I1DA 3RI5K 5DC9B 5MHSE 1SXNA 1EFXA 3FT1A 1URIA 3KDPB 1G9MC 2OMNA 3S35H 1KY7A 1UKTA 1WITA 4ZUSA 2E86A 1JPGB 4YEFA 1QUNA 4OT1L 3ROLA 1BD2D 2PP7A 3PFQA 3JV0A 1ET5A 4HIPA 2ITDB 3NIDB 4HWUA 4FQIH 1NQBA 2J5LC 1EXGA 3G6DH 3ZMRA 1GGYA 3FSZA 1JFHA 1MLBB 3PP4H 5B8CC 1NBQA 4YXKH 4PRIE 3HAEH 3MCYA 3VCLB 4ZNCD 1ZLSH 2OMYB 4U6YB 2Z6FA 5H4YA 4X7EC 2NY3C 1QLEL 1BIIA 3BQUA 2QPUA 5LAPA 2ZWSA 3FHQA 3SGEH 2I9TA 4XGZB 3QNXA 4MJIE 2D3LA 4KRPB 3DGDA 4ODVL 5C0BA 3UZEC 4JO1L 3RDTD 3KMDA 4DEWA 4NQSB 4Q9CA 3MRHB 2B3RA 4H8PA 3U7WH 4RGNC 4AQEB 3OPZH 2DPKA 4RWYL 1I82A 3LNFA 1YECH 3FF8A 3SQRA 5I17A 1H5BA 4O5LH 1B9ZA 4F24A 1RZIB 1WFTA 2OCJA 3OJDA 1UVQA 5D72H 4I3RH 3KCPA 2GYSA 3GEWB 2IOIA 1GSMA 1TETL 2PO6B 4I18B 1EWHA 1ITCA 1WAAF 4FL4B 2R7EA 1ONQB 4AYDC 1LWJA 4YXLL 3KVQA 2ZYIA 5GQBA 4F9LC 4GQPH 1NOLA 3EJYC 4WNQA 5FKAA 1JVKA 2OMWB 1BX2A 4DZBB 4MD5A 1FZJA 3WI9A 3MCKB 1IQWL 3CFMA 2O61A 3LKPB 5FYJH 3FYIB 4KGLA 3O2VH 1E8ZA 4N2HA 3AADB 2I26N 3BAJA 2ED8A 1K5NB 4XPTL 3C60C 5HJ3B 3WTTA 2WNKA 3BHBA 1X5JA 3O41B 2OSLB 2X5PA 4CC1A 5DRWB 4PRIB 1R5VB 1VAHA 4B7IA 3D05A 3WKNA 1U21A 4D8PB 1U58B 3CX5K 2AXWA 2ICWJ 1QOKA 3ARQA 3F64A 4AM0B 2QKIC 5D96B 5C3IA 1IC7H 1PZAA 4ONFL 4AJ0A 4L8DB 3BGFC 4TVPL 4N0UA 4JFHE 1O6VA 1VFOA 2BSBA 4MJIB 3RNQB 5CN3A 4MXVE 4IIQA 4OLVH 4L8SB 4L3FA 1TTRA 1RULL 5F7DA 4NGHH 4U1JB 5AW8B 1G1CA 1HZHL 4X83A 1C1EL 1DR9A 5AUMA 1IC4L 3RGBA 1I9IL 2R1WA 4OD1H 5J1AA 4DN3L 4G80B 2NY7H 3NZ8B 4HS6B 3EOAB 4FXKA 1EO8L 1F45A 1CG9A 3OKLB 2E0PA 4MD4B 3IN0A 5IQ7L 4GIPD 4IBQA 5E95B 3F7YB 1IO4C 3N1GC 1KENL 4WDIA 4M29A 3FTYA 1EHLL 3MRRA 4G1EB 3KPRE 3S5LA 3VFMB 2YUXA 3EYSL 3J7HA 2YHGA 3OG6B 4FQ2H 4K15A 4Y19E 1BECA 1W80A 4WU7A 1V10A 4ZMXA 4AENB 4M5ZH 1FIGL 4PS7A 1XSIA 3PJLA 1KCVL 1WD9A 4XWOD 1D2PA 4AEEA 2YD9A 2WINA 4NEHB 1FLTX 4H2CA 2CM5A 3MRGB 1W6LA 4W93A 3BZ5A 5D2LA 5DEGB 4XVJL 5ISZE 5FYJD 2EO9A 2WQXA 4K94C 3LZNA 3JZ7A 1OE1A 3QPKA 5E08H 1DQDH 4BZ1L 4PJFF 3N42F 4UOW0 5DC0A 1TU2A 1YEEL 4EN3A 4WKXA 5F7AA 1NC2A 1HIML 2OW6A 1NAMH 2LU4A 4BD4A 2AQQA 2GJZA 1DJYA 1V54B 3VXSE 3QUYA 3GDCA 4UDUA 3RNKB 2K4AA 5J12B 5J6SA 3NCJL 5HVFB 3BE1L 3DJRA 1R19A 4WI6A 5K59E 5DRNA 3BH9A 5E2UH 1G7QB 3WTSA 5GS1B 5CP7B 1D9KC 4ZAKC 1URLA 3TO4D 5SWSA 3ZL4L 1UJTA 1BG1A 4LSVL 4L0ZA 3ZHDA 2W9LA 4I2XA 5I76A 2BIOA 1CD9B 3CXDL 4GBXC 4I0KA 4J4PA 4NRYA 1CYWA 2ZWYA 3VU2A 4FEMA 4HUVB 4LOUC 2IADA 1TZIB 2DLTA 2DN7A 2QDVA 2N1TE 4P4KD 2OS7A 4YXHH 5E5RB 3ULVC 1RZGA 1TLKA 4KQ3H 1HYRC 4HFUH 4LCYA 4RBPH 3BO8A 4Y19B 2VRKA 3AAZB 4KVCH 1IBHA 3QI9B 2GW5A 2VLRA 2Y24A 1GYAA 1GW0A 3G08A 4AQAA 2YPLD 2KBGA 1M71B 3BVUA 3B2PA 3OX8A 4EEEA 1AQKL 4FI7A 1ECZA 3FB5A 4HJTA 4QRQB 5LGHH 3F7QA 1WISA 5DEJA 4U6TA 3FQXB 1XAUA 5AZEH 3RPKA 3SKMA 1XF1A 2P47B 2VKXA 5FAAA 5JW4M 4JGMA 1YJDC 4MRBA 3MV01 4MAYA 4DP1X 1FWXA 1AQDB 2XRAL 5LBGA 1BWMA 3D51A 4P5SA 4JFFD 5LG1A 4ZMWA 3VXSB 4ANXA 3GSWA 3GXPA 4PP1C 3S35X 5DVLA 3VFOB 4HHAA 1JPTH 4YIQB 5JOFA 3PHSA 4EDXB 2GY5A 2VE6A 1J8SA 2XPGB 3I2CH 3NN8B 3VD0A 1J5IA 1I31A 3X3GL 2ICCA 5IF0A 3RUGE 1CDGA 1L9NA 3I84A 4MAUL 4R3SA 1TQCC 5T3ZE 5E6ID 3R8QA 1W8NA 2WW8A 1IRAY 1BXUA 4JO2H 4DSYA 1GYVA 1JRHH 3FB6A 4QWWD 2BFVL 4U1SB 4W4NA 3FW6A 1FFPA 2WQAA 1VFAA 1JBJA 2R2HA 3D50A 4HBCH 5DZAA 3QWRD 4HOWA 1OM3H 2XI9A 1KY6A 1M56B 3I50L 2OCCB 5DHVH 4WI8A 1J0KA 3G6JA 5MEOA 2F1BA 3IF1B 4QHNA 4JVPA 4LGPB 4RGOH 1HC1A 2AGJL 3IWUA 1YQ2A 4R5VA 2FEEI 3MLSH 4APQC 1DBBL 1YLBB 2APFA 2VDMH 1OALA 1P6FA 2Z64C 3LKOB 3VB9A 1K85A 3R06B 7PCYA 5DUMH 3LEVL 3EOYG 5C0RL 1HHHA 2WHVA 4DGVL 4ZMLA 2Q3AA 4PTUB 1MCWW 3MX0B 3ZZLA 2BOBA 3LH2H 4AJYV 5TE7L 3DHUA 5FHBL 2D3NA 1JZJA 4IMLA 4Y4KD 1FE8H 2VXQL 3HE7C 3FU6A 1JWUA 1TZ8A 2BK8A 1BD2A 4YO0A 4PJIF 3O45B 2DWDA 1NCAH 4B9IA 1T3FA 3MRLA 5KN5B 2DI9A 2HRPL 2JJVA 3JWDH 4KO6A 2NUPB 2ZQKA 3IJ7A 1MFNA 3RUGB 2AQNA 1YEGL 2EDDA 4N8VA 3X12A 4Z23A 1MCRA 3M1BA 4LESA 3I9PA 1R33A 3T8XA 2QQLL 1PD1A 4YHOL 3GZQA 4OT1H 1JPFB 3TVMA 1J9SA 2VAAA 1D2OA 1S2EA 4DGIH 3KCWA 1GIGL 1C5DA 3V4PB 4PN6A 3FO1A 3N1PC 3P9MB 1FNGB 3CZUB 3FQNA 3QJTB 4AI7A 3RDTA 5DHDA 2NY3D 3RLSA 4ZI8A 4B5ZA 4OCWL 3SD2A 2K8QA 1N6UA 3MNVA 4X98A 3IMUA 3G5YB 1I3UA 3BEWA 4YHLL 5KW9L 4FTVE 2VDKL 2WCPA 4HC1A 2HTLC 4H8UA 4I3SL 4G7YL 3IGKA 1NL0L 2N01B 5C08A 3ARGC 3FU9A 1FFNB 1G7IA 1QLEH 4RGND 3VXTB 1H6FA 3CIQA 2DQIH 4NC1E 4WJG3 4R0LB 1XEUA 3DI3B 5J3HD 3BH8A 4MZIA 4N2MA 3TYFB 4IHOA 4MQ7B 1RH8A 4HKBA 4HIQA 1LJMA 4LIQL 4C4BA 1UHVA 1NM4A 2Z4QB 3T2QA 3APMA 5EZJA 5JMRA 3VNZA 3Q5YA 3QO1B 3C5ZD 1DEEB 2BY2A 2ETWA 2V2XB 4QJ5B 4DFIA 1PMYA 2YKLL 3IGFA 1UJ3C 1TETH 1OTTD 2CRYA 3D52A 1P7QD 4XO8A 4YXLH 1LVEA 4QMEA 3EH4B 2BERA 1P4BL 1IGTB 4Y88A 3H2WA 4CMHB 1IQWH 4JKPL 3ULUL 1QO3B 1ETA1 4KKCD 4NCC1 4ZUUB 3GLDA 2X6BA 3FFDA 1ZE3H 2Z7WA 4JPQA 5ENWA 4QRSB 1OGPA 3T77A 5C6TL 5B7EA 2V9UA 1KULA 4XPHL 3IFLH 3QIBD 4LK4A 5D70L 5GGRB 1A0QH 1RKRA 1IC5H 2PPAA 2D9CA 4TVPH 3S37L 1HAWA 3EGDA 4YDVB 3N06B 4D0DB 5F9OL 2HX8A 2ZSVA 3DKHA 1J9QA 4KFZC 2IOMA 5DZ9A 4XVUC 4MXQC 3DVIA 3FO2B 2VL5B 1BBDL 3QFDA 1RULH 1N7ML 1OW0C 2BVPA 3CMOL 3KLSA 2C1PB 3SHSA 3MRDB 2YD5A 3VYPA 5LXGL 1HZHH 1NGXA 2XV0A 1UKSA 5KANI 3ZR5A 1FZKB 4MAZA 1UA6L 4HDIA 2N3JA 3GUFA 2ADGA 3HKZA 4UINH 1IILE 5ECJE 4XVTL 2K1MA 1U2HA 5IQ7H 4QAWA 3OZKA 4NUJB 2V7NA 1FFQA 4ODUB 5K39B 4LL1A 4XXWC 3E8VA 3SCMC 4AL8C 2WQUA 1EHLH 4Y2DD 2W07A 2VZTA 2LFGA 3FUNA 4HJUA 4GUOA 3GHEL 3EYSH 2AJVH 2QR0A 1D3CA 3QXUA 3WIAA 4UILL 3CTTA 4MJ2A 1TITA 4CU8A 1FIGH 4TUJA 4ZXBC 1HYSC 3P4NA 4JM2D 3SDAC 1UD2A 5KYXA 3GNMH 2DQTH 1H6UA 4XVJH 1F1DA 4XI5D 4GI6A 2DM2A 4OM0H 3R7QA 3NIGE 5D7EA 2FECL 3FO9A 3PIQB 4HPOL 1DO6A 1A21A 4XOCA 3QEHA 1Z3GL 4UTAA 2XOTA 1A6VL 3HW7A 4R97B 3O8XA 1RK7A 2WWOA 1YEEH 3ZKMC 3PE9A 2GC4C 2WLZA 4L37A 3RWHB 1G9EA 1TVDA 5E00B 4U05A 4ZAKD 4A68A 3RKDC 4Y16D 3QYNA 1U8PB 4PJHF 1OE3A 4FMFA 4M7LT 1GYCA 4LLMA 4OGYH 1CXHA 2BSCA 4P0DA 4P4KA 3B1TA 2XFXA 4PRBA 1IGCL 4X5WB 1M53A 3EYQD 3B3IA 1P6WA 2IH9A 5F7YC 3UP6A 4HZLB 3ZL4H 4PJXE 2KDGA 5FGRA 3FJTA 1MWAH 4Z8FL 4MS8D 4LSVH 1YVLA 5CWSB 1JF5A 1HHGB 2OQJA 3DX7A 5DHYA 1WGVA 2FHBA 3QUML 5I1HL 3OAUH 3VFSA 4GFXA 2J2ZA 2YEVB 5IB4B 5IIEB 4Z1PA 3WNLA 3P4OB 3D5OF 4CDGC 4Z5RB 4WEBH 3B6SB 5IV2A 4OFQA 1KWKA 5DQDH 2HVJA 4KI5F 4BQBA 5ACLA 3VRJB 2OTUA 4XCFL 1LP9F 4P9ML 1YC7A 1SYVB 2YC1A 4JFFA 4PLOB 5D2NC 3S2CA 3MGAA 2JK5B 5IMMB 3Q01A 4KRLB 4PW4A 3ARFB 1VB9A 1T7VA 2G3NA 4BWUA 1I8IA 3NIGB 3VXRD 2FH6A 5D5ME 4PP1D 5IB2A 2XQBL 3U83A 3B7TA 4RAUA 5F71A 1UOVA 2NUTA 1I1RA 1LO2L 4NPKA 1U95B 2JIXB 2XRAH 1RURH 4U1IA 3FTXA 3HMWH 4G7RB 4JREB 2HSIA 4NAQA 4IBWA 3IK2A 1WLHA 4O51B 3LKQA 4B50A 2CBTA 3X3GH 3HNSH 3H9SA 4GXUN 3L95A 4NNYA 1RUMH 4MAUH 3HPJA 4UT9A 1R75A 1FGVH 3L4ZA 3T3PE 4IQHA 1BZ7A 4PJXB 4FQXC 5F3HA 3KWUA 4NKDA 1GAFL 1KBGH 2EIBA 2IDFA 2D4DA 4RFOL 3WN5A 5D4IA 2HN7B 2BFVH 2EJ1A 5DTFB 3C5JA 3DO4A 3TBWB 3SDCC 1MCNA 5L0QC 4LHUG 1WIOA 4N0RA 2WBJB 3K8KA 4K07A 1GS6X 2WYTA 3N0AA 3QPXL 2PCFB 1QTSA 1FHNA 3CFCL 4PAZA 5AW1B 2EYSA 3P1VA 3KLHC 2CKBB 1AR1D 5DR5H 2DLFL 2OI9C 3OKOB 2EUWA 3HCVA 2J3SA 1FNAA 4V33A 1JWMA 2VXUL 4G6AC 3QCUL 2CBQA 1T5KA 3CSTA 3F8UB 3HE7D 3WNMA 4WKZB 3X11B 3B7RL 1XCWA 3PABB 3LEVH 32C2B 1INEL 4B9GA 5C0RH 4ANVA 3QNZB 5D5MB 3D1MC 5GZOD 2IAMB 3W56A 4AW7A 1CIUA 3PWPA 3CH1A 2DQGH 5FCSH 4E5XB 3K71B 2VC2L 3MA7A 2YQ3A 5CCKL 5B8CA 3EIFA 1PSKL 5HYQB 4DPCX 2AZUA 3EJUA 3L3KB 4HZ1A 4Z7VA 4WGWB 3KPLA 3C12A 4Z0XB 3TA3C 4A38A 1H3PL 2HRPH 3E80A 4X5QA 4JN1L 1A6AB 3H3KA 3T09A 1RY7B 1YEGH 3FU7B 1ZKAA 2IDQA 5CJQL 3T3PB 4BQ9A 2CDFA 4IRJD 5DHVA 3UZEA 2QQLH 3WNJA 3L4YA 2ITCB 3GMOA 3O6ML 1G43A 4NYLA 4YHOH 5C0IA 2EO1A 4R7XA 3NEXA 1A9EB 3BUBA 4M5TA 4ALAC 1GIGH 2YWYA 3B8SA 3FULA 2F61A 3HS9A 2ATAA 4P5KB 5C0EA 1KGCD 2VLLB 5A6MA 2AV1A 4MASA 5I8EA 5A2FA 4F91B 1P5UC 3SKJH 3L9RB 3CDYA 3HZVB 4XP9L 5C7ZA 3QAZC 1QI3A 4YMPA 2APVA 1VFUA 5GHWH 2WN3A 2P43B 5C9KA 1ZV5A 4F9LA 1SVBA 4IBSA 2XVKA 4FNRA 2X0WA 5DMIH 4G7YH 1HHIB 4JNXA 3GI8L 4Q7DA 2VW6A 1WWAX 1E8XA 1T1XA 1I8MA 2NQCA 1XT5A 4W4OC 1P7QA 5I26A 3AU0A 5I8OL 4K3HA 3KNBB 1S7VB 4QTIL 1PAMA 1J8HD 3I6KB 3I75B 3M8OH 4KHXH 4KTDH 1CICB 3MR9A 3WS3A 2MCG1 2GK0A 2ZJSL 2QKIA 3LZRA 4TOYH 2DMGA 1FN4B 5D4QA 3CSPA 3G5ZA 2EC9U 3LXCA 2CIIA 1CQKA 3CBRA 1ETJA 1E6OH 3MCLL 5CHNA 2EDQA 1XBRA 4TLTA 3DHJA 1I85C 2DY2A 3SSGA 5KS9E 4FABL 1A1OA 4GP5B 2O5YL 4OQTL 3ASNB 4AUYA 1V05A 2FRGP 4JK0D 1P4BH 1HXYA 1WS8A 4QGYA 3A6CL 2ZKMX 3HC0B 4IMKC 1WFMA 4MB4A 4AYFA 3RZCB 3HG1D 4TNEA 1IM3B 3IRZA 4F2MA 4HJ0D 4I48A 2Y6TE 4HIXL 3DX9B 3BIAX 1WGOA 4YGVB 3HJ0A 3GRGA 4H20L 4L1BA 3WDHA 1LE9B 2YK1H 4L8BA 4PTTB 3HZYA 5C6TH 3IDXL 1ZA6B 4XPHH 4XVUD 1HH9B 1CFTA 1NAKL 4G7SB 5LBSL 4F7CB 5D70H 1U33A 3QEGL 1F4WH 3FTSA 2DI7A 2G3MA 1MCPH 1JPSH 5IFHL 1QPPA 2Y22A 1GW6A 4J5VA 1R46A 1RK1A 3Q05A 5I6PA 5IK3A 2YAMA 3OAZK 5DFVD 4EZJA 3PQYE 3GZOA 3O0RL 5GSVB 3MA9H 4UQEA 4Y2DA 2BSRB 3AB0B 4PLKC 1U6AH 1N7MH 3UYRH 4BM7A 2AI0H 2VDRL 4POUB 1U91B 4LPCA 1TJGH 2I69A 3LV3B 1N8OE 5AAPA 1UA6H 2X4TB 1UURA 2L7JA 3HKFA 4TULL 1ZT4B 2UWEA 2AEWA 1MVUB 1I3VA 2R1XA 1R5WB 2AZAA 1MN4A 3EFOB 3A21A 4E41E 4X4ME 1AXSB 1IJ9A 1SY6A 2A0LD 3SDAD 5KS9B 2OP4L 1JGIA 4B41A 4TV3A 1SOKA 3DXAE 4IU2B 2UXTA 1ZLEA 3GHEH 3WMPA 5IEHB 3NA9L 1G4RA 1HOCA 4HD9A 3AS1A 3DRTB 5C3TA 2XVLA 2VABB 1D9KA 4ZAKA 2EH7L 4TKWA 1GTFA 1RFDL 3QXTA 2P42B 4GSUA 1GMIA 2QKSA 1LXMA 4U7KA 4X0NA 4J3WA 4NDMA 2P24B 3TFKD 3I3BA 5EUOF 1B88A 1BM7A 4GBXA 3ZKMD 5CEXB 5B1KA 5SWZD 1KNOA 4X42A 5LWYL 2PCYA 1T66D 2WKOA 1MJJA 4LFHG 4XCCL 2X6CA 3E1F1 3RKDD 3RTQD 4AK1A 2F15A 2BINA 2K4WA 2J12B 1A6VH 2HH0L 2P26A 1FGNL 3QA3B 1O7DE 3RX5A 4HU2A 1HSAA 2Q7YA 2YKKA 3QRGL 3PQYB 1DZBA 3VSTA 1KUMA 1VFMA 1KPRA 1BXAA 4HW6A 4XMTA 4GQ9H 1IGFL 1AGCA 4AC2A 3PL6C 4D9QE 4KVNH 4N20A 1TTCA 2ADJA 4BEIA 3CG8A 3CSYB 3VFWB 2A38A 5KYWA 3LIZH 5SV3A 5LAXB 1R0AH 3BP7B 1OCOB 3QDMD 1NEZB 3TJHD 2B08A 3AQXA 4E41B 4A7QA 3SZKC 1SVZA 2UX7A 3VXRA 1ZRUA 4ELMA 3QJHA 3QUMH 3HR5B 4H1LB 5LO7A 1NUDA 5F1OB 3DXAB 1NUGA 3GMLA 5KZCD 4LVHC 4MJ5B 2DDQL 3KBEA 3TT1H 4E9QA 4OZFB 4PRPD 1E8YA 2VR7A 1KZQA 3WN6A 2PCXA 4PLJC 4CDHA 3N43F 2F8VA 5FEBA 2XWDA 2EIZB 2ZPKL 4PJCE 4M1GL 3RE0A 1NIFA 3FC8A 4HUUA 4FLHA 1JV5A 5DMJB 5FPIA 1BAWA 4PBWD 2XQBH 3B2UC 4NZ8A 2HWZL 1SUJA 4R2GB 5F7HA 5JHDB 4GAYB 5A3ID 1KB5H 1OP3H 1PYWA 1WWWX 3FN9A 3RA7L 5E99L 2CA3A 4NQVB 1MWAA 3CDGA 1B4TA 2QV2A 1OEZW 1ORQA 5DVPA 1AI1L 2OYLA 3TBCA 3WEXA 3IMWA 2X2YA 4A2DA 1ZT7B 2NY5L 1YG9A 4O2EB 3UTTD 5J11B 4Q2ZB 5E1GA 3Q8AA 2JSFA 4ZX6A 3I9IA 1GTNA 4F7EA 2C1OA 5K33A 2IGTA 2WQSA 4HAFA 3IMTA 1GAFH 5E8PB 4RFOH 1QHOA 3HE7A 4JMXA 5LHDA 1PY9A 2B8OT 3FHEA 2ZWLT 4DWHA 4G6AD 1TCMA 4MVBD 5F44A 1DCEA 1OB1A 3MV8D 4U2YA 1QBLL 3L3JB 3QJFA 3CFCH 3HE6C 4BKSC 3ZTDC 1IJNA 3QR2A 4YWGH 3K72A 5FGCE 4JM0A 3MNWA 1VPOH 3P2BA 2VXUH 1U3HC 2A3TA 2H0PA 5DU7A 3KR3H 4PB9L 4ZX3A 1HDMB 3QCUH 3L3OB 3C6LD 1AYRA 5HI3D 3HI1B 4KY1L 4KOBA 4U6XA 5TF1L 1N2RB 4PJCB 1UT9A 5HYIA 1M42A 1INEH 3AG4B 4PJAA 1WA2X 2L3BA 2Q20A 4U1KA 5BS0B 3FQWA 4R5XA 4MXWH 4IRJA 4UNTA 4PS8A 3PJNA 5EIQA 1D5IL 2YGPA 5JA9A 2I27N 4DTGL 2EDWA 4RDBA 4JCMA 4G8GE 3UC0L 3EYVA 2ENJA 3T4AC 5CCKH 3VD9A 4MNGB 4F7TA 5CJXC 4CVZA 2KT6A 3BZEB 1PSKH 4L2YA 4JFVA 1KOAA 4N2KA 1ZSHA 3V0VA 4PJDA 1DYZA 4NNPH 4P3DA 5EO1A 1H3PH 1YEKL 4EAEA 4HG4J 2V5RA 3ARGA 4JN1H 3W39A 5I1LB 4F7KA 3O3EA 5CJQH 4FKHA 3CZJA 2D7QA 3MNZB 1IMHC 4N90E 2AFNA 2OR9H 3EFDL 1YNTA 3IJEB 4MJ6A 4UMGA 5DJXA 1T6BX 4FEIA 4OLEA 3L8QA 3W9EA 1JD9A 1ZSDB 3I3EA 4PBVC 3LXBA 1U3NA 3CU7A 3UPAA 4YBLC 2HJLB 5MI0C 1TJHL 3UO1L 3MJ6A 4LCIH 5F96L 1S7TB 4BV1A 3VD1A 1NKGA 4KZ0A 2AJZB 2ZX7A 1PZSA 4OGZA 1RPKA 1UJ3A 4XP9H 3UPRA 1TMCB 1J8HA 5FGCB 1RZ7L 5IT2L 5KBDA 4N0FA 4DGYL 4CVXB 5E7BA 4MFHA 5I5MA 3BGMB 3QFJE 2WB1A 1T0MA 4K71C 2IAAC 2YXVA 3NJMA 4EO5A 5ACZA 1TOXA 5J06A 4Q9RL 1ORSB 2J6EH 2Z0UA 2WNGA 5FO7A 4HCRA 2JB5L 4QT5B 2HX9A 4S1RL 1EJ6A 1MHCB 3P77A 5ABDE 1Z2KA 1Y6NR 5CIPB 1BOGB 3KW8A 4G8GB 1G7JB 1FO0H 4XP6L 4A6YL 3NJXA 5I8OH 2QEJA 4WLCA 4QTIH 2QPFA 1LEIB 3OGCB 1N6QH 1INDL 2LFEA 3HG1A 4GKSA 3MHZA 5FA4A 2JXMB 3FFCA 5DC2A 4N5EC 1JDAA 2H1LM 3G04B 1DUYB 4H8QA 3NJHA 2RQ8A 3MTXA 3GBLA 2Z31C 3MCLH 1AHWC 5AD0A 1FL6A 3LZLA 1IEAA 1OW0A 3KPTA 4Y89A 5KSVA 5TK4A 4OQTH 2QMKA 5FOBA 1HL4A 3MACH 3A6CH 2ILLA 1A9BA 4GRWE 4WNJA 1N64L 4ZYKA 1F3DJ 4FS0A 1PX8A 1CFQB 4QYOA 2FIRT 3FOLA 1FBIL 4D0CA 2DEWX 3X13B 3S4SB 3OPUA 3RKPA 3RL2A 3E2HC 4H20H 4KTEL 5ELIA 2F54A 4XXWA 3SCMA 1TPXC 2HTKD 4M8QB 3UAJC 5LBSH 1NAKH 2AK1L 3SPHA 1FV1A 4UM9D 3VFGH 2NMSA 4H8VA 4XE0A 2NY1D 3QFJB 3B5GA 4NQCD 1X5ZA 1TSHA 3UOAB 2AK4D 4BKLB 5ICXA 3T65B 2HKAA 5J57B 4ZXBA 4R7VA 3HC3L 3SDAA 5I73B 2I60H 2G3XA 1KF9B 1L3WA 4Q74A 4Y2LA 5E2VH 4MMZB 3STLA 3MPCA 4IKKA 1SLWA 1OLZA 1QFOA 2CDGB 4JFOB 5T3XD 2XV3A 4ONHB 3VFRB 3DVNA 1X7QA 4LDCA 3VQ2C 4JVUA 2MPVA 3RWCA 5BJTA 5F89A 1A1MA 3BKML 1PLCA 1DVFD 1B2YA 3DOSB 3RL1A 4JFDA 2OP4H 2XXMB 2OMVA 3SBPA 3EBIA 3LRKA 3NA9H 2VLKE 3K91A 1KPVA 1TXKA 1U8MA 1KT2A 3FN0L 4GRWB 3CPLA 3UYOD 5IOPB 1PZUB 4AEFA 4NKQB 1NFKA 3U9WA 1RFDH 1XZWA 2NZ9C 1JXFA 3REVB 4S2SA 4OLZH 2A5UA 4DHLA 3ERXA 4LLDB 2FJGB 4X4XA 2W0KA 4PGCB 2WV3A 2CDEB 2YO3A 2XTSA 5L6YL 5LWYH 5IG7A 4BUHA 4XCCH 1VHPA 2Q8BL 4NXSA 3TC9A 4HQQH 2HX7A 2NX5E 4IBLT 3V5HB 4WHCA 1VFBA 1A4CA 3X17A 2YD1A 4Z7UF 5JORB 3MLZH 5H35B 1UB5B 4XMPH 3U7AA 2HH0H 3I02A 3FUEA 4WUUE 4NFCA 3VD5A 1EX0A 3BP5B 2XWRA 4XBGB 1U2CA 2CO4A 2IDCA 3LMJL 4YBQC 5D2NA 4GAGL 1XGQB 5L4JA 1IGFH 2A9AA 1JV2A 4ZMOA 1JN6B 1JUFA 5C0DA 3TZVD 4EE2A 3UFIA 3ZGIA 5L2KD 4XO9A 2E4FA 4M5YH 3O4OC 2QTEA 5BQ7B 1A8ZA 1T03L 3ATDA 1YMMD 3KWWB 4OI8A 2RQEA 2H45A 2BVQA 2HT3D 2OMUA 1FNLA 4I0PD 3VFUB 2JKIS 2BS8A 3BVDB 1HTYA 1S5HB 1NFDE 1S9WB 3U1QA 2W88A 5CXPA 2DDQH 2VLKB 3DECA 2NY0D 4Z7WE 4UV4L 3GO1H 5IFAL 4JUSA 3GKWL 4WZ9A 4FQXA 5DJ0B 2ZG2A 3HG3A 4P5RA 4X9YA 4HFWA 5B38B 1AD0A 4KK6C 3SDCA 1F58H 2W59A 5AAWA 2ZCKH 4M1GH 2KLSA 3IRPX 2NX5B 3WJMA 3KYNB 2I25N 3GGWB 5BQDA 4L1SA 2HWZH 1LO3L 3AGWA 3FUIA 4WUUB 3NSDA 4B60A 5CLXA 3DETD 3T0EC 1MCEA 5E99H 4XNMB 5KVDH 3NTCL 2VDPB 4LLUA 1QVOB 2G3ZA 3EFFB 1A4KB 1AI1H 5DEFB 2ZCLL 2XNAB 5GXBB 1Z9NA 4GW5B 1G9HA 2VDQH 3OKDA 2ZX6A 2HMIC 1AZNA 1RQ5A 1LQBC 4XX1E 3HE6D 2CLVB 4G11A 3G3LA 5KJ4A 5DK2B 5FA3B 3H53A 3IMRA 2K8MA 1W72L 3GTNA 3D69A 4H26A 3SDXA 4ZSOA 5IVZB 1PZDA 2HFGL 3DX3A 4EIUA 1L3NA 3TA3A 1NFDB 1R1CA 1QBLH 1L9MA 4LAJH 4MA7L 4Z7WB 5DMGC 3LRSB 1NBZB 2APXA 4P23D 4PU2A 4U1MA 2DMKA 1EXUB 4PB9H 3MOAL 2CCVA 1Q9OA 3VXNB 3EUUA 1KB5A 1N0XL 1NA8A 1OD7A 2FT7A 4IK6A 4A2HA 4GJTB 3QZBA 2WKGA 1U8NA 1P5UA 2FX9H 3VGHA 5CZXC 2YMXL 1EHKB 3BCDA 2PPFA 1HCFX 4LDEB 4Z7IA 5DHXB 4K3EL 2ATPB 1OVZA 5TDOB 5EEXA 3EO1A 4MQTB 3JWOC 3NP4A 3FXIC 2B2XL 5G4OA 4KMQA 3HZKA 4RWHA 1YEKH 4UQAA 4WJKB 5IB1A 2WY3B 2L04A 4CKVX 1S7SB 5JW4N 5JIPA 1OSZA 2YPVH 3H8NA 2Y5QA 4BH8B 4AMXA 3SOTA 4DP7X 1D6VL 3N41F 5EUKA 4U33A 4W4OA 5SX5H 4FAAB 3VXQA 5I30L 3FTUA 3V6FA 3EBHA 4LCCB 5T3ZL 3OC8A 4D94A 4FZ8H 4ZUVA 4JG5A 3TV3L 4UQ2B 1JHLL 1UXLA 1DJWA 4IBZA 1DSWA 3B9KB 3JT0A 3QQ3B 3UO1H 4AVHA 3SYQA 4Y4FB 4UQBA 5F96H 1A7NL 2ARJB 3VQMA 2KPWA 5L2JA 5IJDC 4HK0A 4P57B 5JNYB 1MNUH 4L3CA 1PLGH 1T7YA 3QNYA 1RZ7H 3SBWC 2P8MB 5IT2H 1I85A 3VWKB 1OF0A 4U6VL 4LHUD 3AQDA 2EKSA 1J0IA 4IMKA 5HHOD 2I07B 3JVGC 3ZW3A 5IR1A 4GSDL 4KC3B 4X5LA 4MCYB 4S1RH 1PZ5B 3QDJE 4J3VA 2F08A 2X3CA 4TSCH 4XP6H 4A6YH 4LVNB 1F00I 2K70A 4F2EA 1JK9A 4YL9A 3W5MA 1AXTL 1P9MC 4X6FB 1NCOA 1FSKC 2XZZA 5FF6B 1MCKA 3HNTL 5HVHB 1UWXK 2WVVA 1LL1A 1N5AB 1KV7A 5IY5B 1AR2A 3R19A 1XF2A 1Z1WA 5DXWA 1G1OA 3IGAA 3X1NA 2HG0A 3ABZA 3NP3A 4NFDA 2XETA 2DH3A 3K5SA 1REIA 4NQCA 3X14B 5C0GB 1KLGA 1BBJB 1YC8A 2AK4A 1GGUA 1MLCA 3DI2B 25C8L 5E9DA 3EJRA 5B1CA 1AS6A 4TQ8A 1MH5B 2VM3A 2JCWA 4FQLH 1S7RA 4FKEA 4H5SB 2Q87A 2VXTH 5BPPA 1WDAA 1U92B 2G5BA 1ZXQA 3LN5A 3LCYA 1DSFL 2JJTA 2J6EA 2CK0L 2WLJA 4I1NB 3SPVB 3BKCL 3IDJA 1LQSR 5AW2B 4OJYA 1WPCA 1RXLA