1W8EA

3d structure of cota incubated with hydrogen peroxide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
510
structure length
505
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 505
sequence length 510
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA02
2E86A 1WS7A 1W6LA 3QJSB 2WSDA 1OV8A 4E9YA 1ETJA 3BVDB 3WNJA 3EH4B 4DP1X 4F7KA 3PCYA 4UANA 1WA2X 1GY2A 1PZBA 3UAAA 2FT6A 2HX8A 1GSKA 1L9SA 3CVCA 2CBPA 1EZLA 2A3TA 5F7BA 4DP6X 1OCZB 3PLYA 1JVOA 1XB3A 2HX9A 2PPFA 2IDQA 2R7EA 3ASOB 7PAZA 1J9RA 2UXTA 2I85A 1IC0A 3N2JA 2GB2A 1AIZA 3QQXA 5B7EA 2VSKB 4HZ1A 1CURA 4A2HA 4AKOA 2DWTA 2ZWNA 2FNWA 3NJNA 3NJLA 1A8ZA 4YL4A 4G71B 3SBQA 5B1JA 3OMNB 3WG7B 4YVUA 4JHUA 1KDIA 4AKPA 3ABGA 1M56B 4A68A 2BZCA 3OMIB 4KO6A 3FPYA 1CYWA 3FQYA 3RYMA 3N55A 2BP0B 2HRHA 2HX7A 1XMEB 1SNRA 1L9TA 2J56A 2J5WA 2BP0A 4YSAA 5F7AA 2EIMB 2FJSA 2TSBA 1JXGA 1JZJA 3TBBA 2VM4A 1VLXA 1ZIAA 2ZXWB 1GW0A 3V9CA 1SFDA 3G5WA 4HCGA 3GYRA 4MFHA 2QDVA 2QT6A 2Q5BA 1AS7A 2CALA 4F2FA 3OD3A 3T9WA 1HAWA 1L9PA 4NB7A 1NTDA 1QNIA 1TU2A 1BEXA 4G72B 5AZUA 1OE3A 1KV7A 1SHWA 1ZDQA 4G7QB 3FU7B 3EH5B 3QJUB 1L9RA 3MX0B 1AQ8A 1L9OA 4YVNA 3H4FA 1BYPA 2QPDB 2DYRB 2BWDA 3NSFA 3TU6A 1DZ0A 4E9RA 1T5KA 3OM3B 4HHWA 4F2EA 1PLBA 4GP5B 1TKWA 3CDZA 1OF0A 4E9SA 2I7OA 3FU8A 3NJJA 4GXFA 2PCFA 4YSEA 1PCSA 4GP4B 5I6NA 1PZCA 1XB6A 3EHBB 3NT0A 5I6PA 4QLWA 3AG4B 1EHKB 3FS9A 4BK5C 1IBZA 3ABKB 1PLAA 1KBWA 1ZPUA 1RKRA 1AZCA 2XYBA 1QHQA 2EIJB 1AZRA 3FYEB 2JFCA 3FSZA 1PNDA 2XV3A 4PAZA 2XVBA 2YAEA 3NJKA 1ID2A 1TEFA 2MRYA 2HZHA 1FFTB 4PCYA 4Q89A 4BDVB 2DV6A 2ZOOA 1AS6A 2BO0A 1NWOA 4RH4A 4G7SB 1ASPA 1W6WA 1AACA 3UADA 4X4KA 4DP8X 2NRDA 3NP3A 4GP8B 3FPXA 3FYIB 1AOZA 3C75A 3EF4A 2WO2B 1QLEB 1CYXA 2AZAA 1IUZA 1NINA 3AG1B 1HAUA 4WTQA 1MG3C 2IWKA 4G7RB 1NDTA 3CVBA 1TEGA 1A4BA 2JKWA 4JKNA 2H47C 3HEIB 1KCWA 3ZDWA 2DYSB 2H5UA 1PNCA 4M4RB 1X9RA 2XLLA 4E9XA 1JXDA 1A65A 1E5ZA 1NZRA 3TASA 4E9TA 1JZEA 1NPJA 3L45A 1BAWA 2YAPA 5D4JA 2UX6A 4HIPA 4DP4X 1SDDB 1MZYA 1URIA 4ZK8A 3S8GB 2CCWA 3ZIYA 2FQFA 1SDDA 2X87A 1BXAA 2FQGA 2IDFA 2P80D 4E9QA 5IY5B 3QJQB 3ZBMA 3AW5A 4DPBX 1MG2C 1J9QA 4BWTA 1IKOP 2GSMB 3WNIA 1JZIA 1BQRA 1SF5A 1ADWA 1HFUA 1AZUA 2ZONA 4BWWA 3T6ZA 3WI9A 3X1GA 1B3IA 4YSSA 2W88A 1FA4A 1AG6A 4GYBA 3X1FA 1AANA 4A66A 4BXVA 2QDWA 2YAMA 2IAAC 2GIMA 2GC4C 4KO7A 1J9TA 1NICA 1NIEA 1ASOA 2YARA 3ABLB 1RZPA 3ABMB 3KW7A 3IN2A 4NERA 2PPEA 3MBWB 6PAZA 2PPAA 1F56A 1N68A 2UXFA 2CUAA 4E9VA 1CC3A 3FU7A 3ASNB 4KOCA 4W9ZA 2DY2A 1M57B 2BHFA 1AG0A 1JZFA 2FT7A 1JXFA 4TXVB 2BP8B 2PPCA 4FAAB 3H56A 3CZUB 1GYCA 2B08A 4YSRA 1RZQA 2GC7C 4HCFA 1NIDA 2YAFA 4KO9A 4KNTA 4L0PB 3QJTB 2YAQA 3KW8A 3S3BB 3SBPA 2AZUA 2XX1A 5I6KA 3D12B 3FSVA 3SBRA 1OCRB 2VW4A 3PAVA 1J5DA 4YSDA 1ET8A 2BW5A 2HRGA 2IH8A 2MTAA 2WO3B 5I6OA 2BWIA 1IBYA 2FT8A 2J55A 3DKHA 3WIAA 2IWFA 4DP9X 4YSOA 1GS6X 1WS8A 1X9UA 3CVDA 1V55B 3S8FB 4K9JA 4HCIA 4NAJA 5ANHA 3NJIA 1N70A 2N0MA 5B1KA 3PPSA 2IH9A 4BDVA 1BXVA 4A2GA 3PAUA 5I28A 2FWLB 2PCYA 3JTBA 1AZNA 1WAEA 1OCCB 1J9SA 3X1EA 3V9EA 1YLBB 1WA0X 2I7SA 3WKPA 1NPNA 4YSPA 1NWPA 2EINB 1ET5A 2BW4A 2FQDA 3AY2A 4BXSV 4ENZA 4YSTA 3S3CB 1R1CA 2PPDA 3OQRA 3NJMA 3AZUA 5AKRA 4KOBA 2PP9A 2HLEB 5TK4A 2X88A 2QPEB 4UF7C 2YAOA 1I53A 1ASQA 1ZDSA 6PCYA 4HAKA 3FU9A 4A2FA 5B7MA 4YSUA 2XXGA 1E5YA 3AG3B 3FSAA 3UABA 3BQVA 4BWUA 4CSZA 2BZ7A 4DP0X 2VSMB 3EH3B 3T6VA 2RACA 4DP2X 3QJVB 1AAJA 5I5IA 3CG8A 2YXWA 1PF3A 2R7EB 1PY0A 1E30A 2LLNA 1A3ZA 3ERXA 4QKTA 4A67A 2FTAA 4HALA 1OE2A 4P5RA 3X1BA 1BXUA 3FT0A 2UXGA 1PMYA 4A2EA 1CUOA 1MZZA 4KNSA 4UAHA 1SFHA 2XV2A 4DP7X 2IDSA 5B7FA 1FWXA 1RCYA 3NYKA 2PP7A 1OCOB 3NJHA 1L9QA 3T6WA 1PLCA 2OV0A 1GS8A 2GHZA 3H4HA 2AVFA 4AX3A 2H3XC 4YSQA 3FSWA 1KYAA 4CSPA 2YAHA 1NIAA 3IBOA 2Q9OA 3SQRA 4N8UA 4DPCX 5TK2A 1BQ5A 3U25A 2TSAA 1KCBA 1OOWA 2HXAA 1GY1A 1JZHA 4DPAX 2AFNA 1MDAA 1GS7A 1JOIA 1A4AA 4HHGA 3UACA 3QPKA 2CAKA 5B3SB 4EF3A 5B1AB 2YQBA 2CJ3A 5D4IA 2P80A 1AR1B 1E67A 1SHXA 2FQEA 2B3IA 3T71A 3X1NA 3AG2B 3DTUB 4DP5X 4A2DA 2OCCB 2GBAA 2EILB 4JHVA 3TBCA 3GDCA 1KGYE 2AANA 4AKQA 1A4CA 2Y69B 2VW7A 3DIVA 5AFAA 2BP8A 2UX7A 3FQ1A 3NSCA 5LDUA 3IEAA 1ILSA 2J57A 1E65A 1PZAA 7PCYA 4WKXA 1JZGA 3NSDA 2GI0A 3OMAB 2OJ1A 2XWZA 1M9WA 1NIBA 5PCYA 3UGEA 2YXVA 4AI7A 2VN3A 3S3DB 3FQ2A 4KO5A 5E9NA 4AZUA 5I6LA 3CDZB 1PAZA 5I5MA 1AS8A 2PLTA 4GY4A 1KBVA 5B1BB 3PAZA 8PAZA 4N4YB 2JXMA 3NP4A 1BQKA 3JT2A 3NJFA 4E9WA 1ILUA 3NJGA 4YSCA 1XB8A 1UATA 3T6XA 1SJMA 2IDUA 1BYOA 5I26A 4Q8BA 2VM3A 3PXLA 5FC9A 1ZV2A 1NIFA 1ET7A 1JERA 3TA4D 4FA7B 1J5CA 3NSYA 3IE9A 4G70B 1KDJA 1ZIBA 1GR7A 2XU9A 3UAEA 2IDTA 1JVLA 5I5JA 1DYZA 3WKQA 4M3HA 5PAZA 3GXUB 5I6MA 2XX0A 2EIKB 2IWEA 5B1JC 1AZBA 5EHFA 2XXFA 1WA1X 2PP8A 3HB3B 2DWSA 2UXVA 4KNUA 3IN0A 3QJRB 3X2QB 2W8CA 1SF3A 1W8EA 2VW6A 2Y1AA 9PCYA 1OE1A 1V54B 2VMJA 1V10A 3ZX1A 5D4HA 4P5SA 5A7EA 4W1TA 2XUWA 2XV0A
chains in the Genus database with same CATH superfamily
1BA9A 1A4JA 5I1CH 3GZQA 4WI7A 4E9YA 3BVDB 1PZ5A 4GNKB 1KTKE 3EH4B 3RY5A 3ZHDA 1A9BA 1T7WA 4BQBA 4ORGB 3RU8H 5L7XH 4O58L 2EDTA 4J8RB 4JY4A 4PR5A 3KR3L 1UENA 4DEUA 2GKIA 2AW2A 3CPUA 2A3TA 4E36A 3IFNL 3HKZA 1RIVL 3VD4A 3UBFA 1R34A 2IDQA 4FABH 1DVFC 1MKFA 3W81A 1KCRL 3ECWA 3TVMC 4GKNA 1ZWIB 3BE1L 1YJDL 4Y4HD 4P23D 3QIWA 3OC8A 3IJ9A 4APQB 3S88L 4W9LC 1EPFA 3MOAL 4UOW0 2DEYX 2QJDA 3BP6B 3WY1A 3VRJB 1GOHA 1A4KA 1KTDB 4FCHA 4RX4D 5DK2A 4NBXB 1GZPA 1JHKH 4I85A 3CFCH 4GG8A 2EADA 4Z78B 4KO6A 1H3GA 3BVUA 1MCPL 4JREC 1AGFA 7CGTA 1R9FA 2APBA 4Q6IC 4AIXA 1OAQH 5TH2B 2APXA 2GUOA 1G6VK 5CLYA 4KMQA 3RWDA 1DBKL 3VXSE 4Z7WE 3AWGA 3ARVA 1CFTA 4YLQT 4KDTC 1WFUA 4YSAA 3SKOA 2ERJB 2CM5A 2R2BB 3FUFA 1WWBX 3VFNB 4C55A 1MUJA 3AUVA 3HUJE 4HCGA 4Y4HB 2W65B 4PJ9A 3N9GL 4LEOB 4U3SB 1FG9C 4NLAA 4MQ7A 4TVPL 2VN6A 4FKEA 1EZVX 5JDJA 4J6RH 5DT1H 4K8RH 5GJSL 1TU2A 3Q8CA 2TAAA 1SHWA 1PQZA 4L29B 4MCNA 4AVHA 2OTPA 2G4EA 3QNZB 1YPZF 3BPNC 4G8GA 2ZUQC 4JFXA 4ZTOL 2JB5H 2L8AA 2RCSH 2ZT9C 3GKWL 4PJBF 1FAIH 3LRLA 2VDMB 3JTSA 4H0IA 2JCWA 4I0PD 4ZUUA 3ZDXE 3JVGA 1DZ0A 3UC0L 2FH8A 3AXHA 3MRNB 4GAYA 4HHWA 3BKMH 5FCSH 4F2EA 2PW2A 2ALAA 2D03H 2PXYC 1Q1PA 3QIBC 1JPGA 4C59B 2WZ5A 4K7PH 4YE4L 3IFPB 5IEKA 2EH7H 3ZE1E 5C7XL 1RZ7H 3QG6A 4TSCL 5FW7A 1A6UH 2MH4A 4NN5B 3QXAB 4P07A 1EHKB 4MNHA 5JDSA 1PG7H 4OB5L 4OZFG 4HIIA 4Y1TA 1TOXA 1OP4A 3BVTA 2NLJB 1N5AA 1NLDL 5T3XL 4UT9H 3MXVL 3QDGA 2GJRA 4UV4L 4F8PA 2H8PB 4Y5VB 4P2RD 1BHGA 3DBSA 1WD9A 4DVBA 1G1CA 2E0PA 1RSYA 1FI8C 1PJWA 2VUOA 2ZKMX 4K5OA 5JHDA 3RZCB 5DMKB 2X1QA 4NP4L 1UTDA 3O9WB 4JPIB 2HSIA 1RIUH 3QIUD 2J1WA 5LGYA 1NANH 2VO5A 2ZOOA 1AS6A 3SY0B 2ORBH 5JPNC 1Q1JH 3NPSC 3X11A 4AEHL 4KZEH 3O4LE 1U4FA 2PW1B 4Z7OF 3U46A 4CUCA 2NRDA 4HH9B 1IQDB 4NNXB 4LVOB 4WWNA 3QNXB 3FPXA 3HNSL 1P2CA 3C75A 1EBPA 3TPUB 1ZCRA 2ZPKH 3WIFB 5DURD 3T0WA 1H3PL 3VFMB 3VX1A 1T21A 2GT9A 1CU4H 4GBXB 4ZMLA 5I66A 1VSCA 1MCOH 1THAA 2ADIB 4YX2L 5HSFA 3FULA 1IC4L 3IDGA 4F24A 4HEPG 4NKOA 3EOTH 1JD7A 5HGDB 1W72B 4RGNC 3R4DA 4MBOA 4G9DA 4F9LA 1Q94A 1A9VA 3G5YB 4XX1E 4E9TA 3KPNB 3GS0A 3LRKA 4GRLC 4JN1H 5LGJA 1LM8V 3LSOA 4U6YA 4JLRB 4QRUA 5E2WH 4CVWA 4B53A 1RLWA 1SDDB 1GPOL 1L4IA 4AJWA 2D4FA 4PP1C 4YPGB 2PWEA 5JHLH 2QHRH 1M6OA 2HJFA 4D0BA 1A14H 4KMLB 1ES0B 3DX7B 5DURB 5J1AA 5K9JL 3Q6FA 4WCYH 2EEXA 3BUYB 3ZBMA 2A77L 4DN4H 1JE6A 1E28A 1NMCC 3PP3K 5ISZA 2NY0D 5FLUA 3VO0A 2XG4B 1BQRA 4JKPH 5KS9E 2VXQA 3GK8L 1GJWA 5AWNH 3MA9L 5HYQA 2HG5B 3FQWA 5BW7A 4O02L 3ZRCC 1RZIB 1BG1A 4W9DC 1KEGH 3VE0B 1LO4H 3L13A 1AG6A 5BRZB 3X12B 3NG5A 2XZAL 3EGXA 1AANA 4X5QA 4QPEA 2YAMA 2BY0A 2BNRE 3VH8B 1EX0A 4FF9A 3D3VE 4KTEL 1J9TA 4X7TA 3SE8L 2TRHA 2R2HB 2B1AH 4BV1A 1BVLB 1KGWA 1Z1WA 1TQUA 1MQ8A 3S8WA 4NERA 4U1HA 4Y4FA 5DFAA 3G6JB 5CN1A 5B8CA 2WNKA 4N2IA 5C0EA 4D7BA 3AB0C 3P0YL 3QQNA 2R1XB 2GIXA 4KGJA 3O3DA 1WWWX 2VDMH 2PWFA 3CFTA 3F84A 1YEGL 5D93B 1UXWA 1WBZA 1T0NA 3JV4B 4P2OC 3MUGA 2CRIA 3KPSD 4PJCB 3BLPX 1JV2B 1X6LA 5J6HB 4NQCB 4ATWA 1M05A 1QEWB 2YAFA 3BP5A 4KO9A 2IMMA 2VCOA 2HCZX 3L4WA 1FZOA 1WZ1H 5DFTA 3LOWA 2FZ3A 5F7UA 1MWAA 4V1DA 4XCEA 2NY5C 4XB7A 4LNVA 5ERWB 3MLXH 1BSIA 1S7VB 3OG6B 3EG9B 2WMPA 4YC2B 1JK9A 1G9NL 2EVFA 3QHTC 2HRGA 1EMTL 5BRQA 3WOVA 1RJYB 1FNSH 2EYTA 4I18C 1FGVH 3T77A 1WS8A 4OFPA 4B3EA 1K8DB 3QG7H 1TJHH 3OZ9L 5CJQL 4QNPF 4PJHE 2BS8A 3Q2VA 1BEYL 3GZOA 2HLFD 3ZSTA 5IB4B 4RMBA 2WXHA 4XVOA 1Q9LB 3FB8A 3HFFA 4BSJA 3M46A 2NCMA 3X1EA 4G7VH 3RVUC 4AL8L 5GS0L 1PTZA 1WA0X 1DQDL 2IANB 2KT6A 2FD6L 3G6AB 4XO8A 1R5WA 5BZZA 1AZVA 3W3BA 5EU6E 5F72S 1DANU 2DQDH 4MAYD 2DM7A 5I1IL 1NCWH 2F53B 3MBEB 4N90D 1B2YA 1R75A 2BC4A 2KYIA 1BG9A 1ZXQA 1XGUA 3ARED 3AZUA 1V7ML 2X0UA 5H94B 2Q87A 1ODAA 2MOQA 3QNYB 4TNGA 3RIFF 2BNUA 3LQAC 3K2IA 1BIHA 1IM9D 5AL0A 1W72H 5DD3H 4YHIB 4P2AA 2B4CC 5B7MA 5T5NF 3OG4B 1GGUA 2WN3A 2QQQA 4WLCA 3RWIA 2O5XL 2NTFA 4HGMA 3ULUL 1G7QA 1C12B 1YEJH 4GAAA 3EDKA 1G7IA 1MRFH 1XCQB 3ARGD 4TL5A 2YGNA 3VWKA 1L7IH 4WV1A 1ZHBB 5JUEL 4Z7VE 3A4DA 3MV7B 1KEML 3QEUB 2ARJA 3EO0B 4F37K 3PFUA 3EYFB 5EIQA 5JPMA 3NCEB 1IE5A 1DHKA 3PE9A 3WHXA 2GK0A 4AQZA 1MY5A 2WLZA 1ZGLA 2CCVA 4KMTL 1H5BB 4Z7UE 1XFPA 4YGVB 3HI1B 2FATH 1CO1A 2K70A 4JFUA 3L9YA 2WQ8A 1M71A 2WVSA 4W4NA 5T3ZH 3V2AR 1GS8A 3PHQB 1DVFD 2GG1A 2GHZA 1WLHA 5JQHC 5DHMC 4BSWA 3H9SA 2VLMD 1J0IA 3AXLA 3TVMD 4BFIA 3MV01 2YAHA 3I02B 4EOWH 2VDLL 2G2NA 2JJSA 5C0NC 3U4EB 4GIOA 3FF7A 1XR9A 1WC7A 4RQQA 1S7UB 3LKPB 3IXAB 5KYYB 2MHAA 5FHBH 3H3PL 4JK0D 1DQKA 5ABAA 2KZKA 4IIQB 1A6WL 1PCXA 4AQ8C 3UTSB 2XN9E 1JF5A 3BFOA 4NDMA 4ES8A 2O5ZH 3L5XL 3L1OH 3KPOA 4JG5A 2P80A 2K78A 1LWJA 3VG9C 4KX8A 5IIEB 4MJ5B 1BOGA 1E2ZA 1COBA 5IJVA 4F27A 5C0GB 4JPKH 1PY9A 3BPLB 3VSUA 1Q9KB 4MMXA 3SCMC 3SYPA 2OMZB 3QC5X 2FO1A 3QEGL 3MXWL 4G8FA 4WI8A 3S6CA 2MMXA 1T20A 4PHZA 4X2UA 5AFAA 3HE6B 5LDUA 1NAML 5DC9B 4YL9A 2I26N 5I1DA 3UPRA 1QFUH 2ICEC 1UOVA 2QVFB 4WKXA 3UZQB 1PEZA 5DO2C 1KN4H 5A6LA 3DK0A 1M3IA 1NIBA 2GITB 5E1AB 2ZSWA 3MRCA 5AW0B 4AYDC 2ZOLA 2WAQA 3EYSL 3RWGB 1YQVL 4ODXB 3IU3B 1FJ1B 3F12B 1AIFB 3P9MB 5D7HA 5ALBH 2NXYC 5GS2D 4APXA 5KTEH 3K46A 3LZPA 5A43C 1JP5A 4PCKA 1OGTB 2C7FA 2ROYA 3GGWA 1KPUB 5I8EB 3IFLH 4MD4B 1D9KC 3CZFB 1WTGT 2W07A 5AG8A 1KXVC 2DIAA 4OI9A 1NFAA 4WFHD 1XGYL 3II1A 4IYKA 3QIBD 2PXYD 1SJMA 5CUSH 2YPLA 3WLWC 4Q8BA 3UBXA 3ROLA 3PXLA 1E43A 1BZ9A 3GIVB 1HSBB 1AD0A 5FCUH 2XOTA 3EAKA 3TA4D 1UCBH 4R7LA 1KBGL 5D7KE 1IGCL 5F0MB 3ATAA 2V2TB 3RWEB 4ZTPL 2SEBB 4MMZA 4QHKI 3CH8A 5DVNA 3SGDI 2Y2TA 4KHXH 2MPAH 1DJHA 2Y1AA 3C5SA 1CK0L 4G5ZL 5CZXC 1OSZB 2C9RA 3HBGA 3JSSA 3NK3A 5D7LE 5CEZD 1Z9MA 1CFNB 2WKGA 4L8BB 4W1TA 2I9LB 3MNMA 1M2OA 4BBWA 4KQ4H 4IKLA 4QOKD 2XNAA 2BMKB 2GTWA 4YNYB 4RLDA 4OY9A 3IMUA 3RGHA 1PKQA 4ORGA 3UAAA 5IJCC 4C56E 2Q8AH 1UCTA 2VB5A 1IGTB 3GMNA 1H6TA 3MNWB 3T4YB 4J8RA 3FMGL 3ZTEA 3IVKA 3UROR 5CSZB 1MJ8L 2I69A 2LV4A 4N24A 5D1QB 2VZ1A 3HAEB 3VSTA 1VACB 4FQ2H 3N40P 4P2CG 2CLVB 3CX5K 2UZXA 4RGND 3F7KA 4XNXH 4TNEA 1ZWIA 3GTNA 2DICA 4FFYH 1F1DA 4L3ED 5KVEL 4LBEB 5DO8A 4GRLD 4C4KO 3D39D 1DVYA 2GBUA 4LSRH 1U2CA 5D1XC 3VRJA 1M56B 3EYVA 1KTDA 4A68A 1Z5YD 4PS4H 4N8VB 3LKRB 4PP1D 2CR3A 3FQYA 5KSBB 2Y06L 2NW3B 4Z78A 3C2AL 4ELMF 5H4YA 4W9FC 5TH2A 3L54A 2ZQKA 3P3TA 5L2KD 2IXQA 4RWYH 3R8BB 2EIMB 2GK2A 1G6RB 1MJ7L 2DQUL 5DHVA 3DSFH 4OCNC 2DH3A 1QRND 4U6TA 4GMTH 5A2LH 2R2BA 1JVKA 3DHMA 3IMVA 4MFHA 3VFNA 4CNIB 4BD4A 4N25A 4DN3L 1NCTA 3ZZQA 2YMXH 2EDOA 3KYMA 4QRTB 4RZKA 3N40F 1FP5A 4CMMB 4U3SA 3G5ZB 2EIDA 5JNYB 4RFOL 1YEEL 5IFAL 4NZJA 5ESVB 1XHHA 4UTAH 1R5VB 5CLTA 1PVHA 1YYMH 5FA3B 3DX9B 4X4YB 1MIML 3GD1C 4GI6A 2QFPA 4L29A 3QNZA 5I1EH 4OV5B 1K4DB 3VD9A 1P5UC 2DI8A 3L3DB 5FM4A 3SGKC 4KGLA 5J13B 3D85B 3ZDYE 4E9RA 4ADIA 4EN3B 5JQIB 1TSRA 1QLFB 15C8L 2OCFD 2RALA 2OKMA 2W80C 1MVUB 2ZX6A 2NZ1A 4ZO9A 3MRNA 5CAYB 1S9VB 2H41A 3HRPA 4OKDA 4NHCL 5DF0A 1PCSA 3H8NA 3K4AA 1RZFL 5HI4D 2KUTA 5MEPB 5DHXB 5CNHA 2VDKL 1CQKA 3FF8A 3PP3H 4NKIH 3GF8A 5AAPA 1JBJA 4OLYL 4GEIA 5GRWA 2Q86A 3AS1A 1I8MA 1DZBA 2AJVL 2DM4A 1UM5H 3WTSA 4HZLB 3VA2C 3T6QC 1S8DA 3G7TA 1DJSA 4XX1G 2NLJA 1MVFA 1YEIL 1U8OB 2XV3A 3MDJA 1Z66A 1VZHA 4M6AA 5K5YA 2H8PA 1L6XA 1RPQA 3DGDA 5EA0L 4ZSOB 3RA7L 4JDTH 5D7IF 3L3IB 2K4WA 2HFFA 4BK4A 5DMKA 3RZCA 2VLLB 3O9WA 2WCPA 4JPIA 1S2EA 3KBPA 3N43B 4ZTEA 4PJ5E 4K4KA 4CJ0A 4WUUD 2FE0A 3SY0A 2E9BA 4G1EA 5AVZB 3LKSB 5JIIA 5CHNB 2PW1A 2NDGA 4U0QB 3RY6A 1QLEB 1WHPA 4KUCD 3SDXE 3DDGA 3AG1B 3EW3B 3GWJA 4NNXA 3QNXA 3VVVA 1E4WL 1XD1A 3TPUA 1Z5LA 4XB8A 2BSCA 5LWYL 5G55A 3WIFA 1A4BA 3ETSA 2VDRL 6FABH 4ICWA 2BWQA 4JPWH 4GBXA 3RVUD 3ULAB 5C07A 3UERA 1EFXD 2IOOA 1KCWA 1QFWM 1UUSA 4EI5C 3RIFK 1JPFB 4XBMA 3CFEA 4DWHA 2ADIA 3H3KA 1YPZB 3VYOA 5BUPA 4OCYL 1HCZA 2DQHL 2CGRL 3MRDB 1W72A 4PJBB 5HGDA 4E41E 1EZUA 2QKIC 4NJ9H 4PB9L 2AEIT 5DMIL 3T2LA 4ANXA 4CA4A 3HAEH 2EVGA 3G5YA 2XI9A 3KPNA 4HIPA 5FKAB 3UAFA 1CXKA 4IRZH 4JLRA 3ZYZA 1LL1A 1SDDA 3FUNA 5D71H 5FO2A 1UVQB 1N6QL 3QK0A 4IQHA 2BDNL 4MZ3A 2NSQA 2DJSA 2ROXA 5EWIL 3HC4H 1ES0A 1JNLH 3DX7A 1HJBC 4GW1B 2YO3A 3BUYA 4RGMB 1NDGB 3ZVVA 4AY0A 5T1DH 3MFFB 1JGIA 3TTYA 4A6YB 4YDVB 3R4RA 1A7NH 1XIWC 1C8QA 5E56A 4UOZA 4ZOBA 3NSXA 5SWZE 4BWWA 5EIIG 2FX7H 2EVJA 1G6RH 4DKAA 2E7LA 4JG1H 4DUXA 5ANME 2F58L 1P7KA 2X6AA 1RZIA 1RUMH 1M53A 1D6VL 3FOLA 5GZOC 2E4TA 1EDQA 3VE0A 4A7GA 1G7LA 2GIMA 5BRZA 1P53A 3X12A 5KSUB 2WGXA 4PWGA 1I9JH 2GEEA 3MV8D 4ODSH 2PYFB 1Q0YH 1F6LL 1U95A 5FGCB 5AVTB 1LJMA 1UH3A 1IC7L 1YEDB 1DJGA 5FOBB 2R2HA 4W9GC 2JNZA 1A1OB 1N68A 2PPAA 2PYEB 1BVLA 3OHXA 25C8L 1IGFL 4O9HH 1BREA 2NPLX 1FFOA 5JO5B 2ICWI 3G6JA 4X98A 1UD2A 4LCWE 1BD2D 4EBQH 4F7MB 1DEDA 2Z1KA 1AXTH 2R1XA 4HF5L 4PJDF 4WENB 1IT9L 3IJ7A 4N0UE 4OTXL 1EJFA 4RA0C 4X5XB 2NY7L 4KKQA 1JXFA 4X5PA 1C5BH 4F93B 3ZZSA 4NPKA 4LLQB 3I2CH 4ADJA 3EFDH 3OXRA 4GPVA 2R69A 3L3KB 3KYOA 3RP1A 1OHZA 4PJCA 1JV2A 4JM2C 3TBWB 3TH4T 5J6HA 4NQCA 3SCMD 1INEL 1QEWA 4S0HA 3PDGA 2QVKA 4RMSA 2VERN 3BVVA 3WD5H 5ERWA 4M5SA 4HS3A 3UIYA 1S7VA 1UJ3B 5DO2D 3EG9A 2CO7A 4WW2F 2WUCH 5T1LD 1RJYA 3L8QA 4LAJH 1Y6NR 3QRLA 4P9HC 1HE8A 1K8DA 2NXYD 1AYRA 3X17A 2QV2A 2DQGL 5B1KA 5JHBA 1K72A 1BFVH 4A2GA 1AE6L 1D9KD 1SZNA 1WAEA 2COVD 1F11B 2JKLA 2BPBA 3GO1L 5IB4A 1FNHA 2OYLA 1SXAA 4NUPA 3KL0A 1QW9A 5J11B 1Q9LA 1E4HA 3WLWD 1QLEH 2AITA 1GJUA 2DQ6A 1OEZW 3T04D 4CN6A 3QULB 2XJKA 2IANA 4YDLC 1M7IB 4TNWF 2F9BT 5M95B 5A6MA 1S7XB 3T0DA 4RMVA 3UYOD 2AXGB 2MCPH 3GI9H 4K7FB 1NCGA 2WIMA 3MBEA 4MB1A 2EDRA 4ANWA 1ASQA 1Z9SB 2CA3A 3GSNB 1XAUA 5H94A 4MJIE 3FTSA 4JQVC 3V0WH 4BCZA 2COQA 5GGQL 4HS6B 4KVCH 4YHIA 1ZEAL 5LBGA 2F5AL 2WV3A 3EH3B 1KCLA 1C12A 4H8HA 3AGWA 3TWYA 1XCQA 5DEGB 1IGML 1XSOA 4WK0B 1OE2A 4TPRL 3MV7A 1K2DB 4DEWA 1CL7H 3QEUA 5BNXD 1FZKB 3EO0A 3O3AA 4V33A 4NCDA 4KVNL 2KZWA 1UD6A 1S4IA 1S78C 2W59A 1EV2E 2X1XR 3E6FB 3H2QA 4OQ1A 4P2QB 3QXDB 3POCA 2OLDA 2PP7A 2YOAA 4YGVA 1KWKA 3M17B 1N6VA 4A6YH 4K94C 4PG9B 3T3MF 1CJYA 3C8KB 5D96C 4FFYA 4JE4B 4Q52A 2FVNA 1KJ2A 4PJ7A 4AC2A 3LHAA 1QA9B 3PHQA 1V27A 2ZG2A 3CK0L 4S11A 4QJ3B 2EXYC 1TSHA 1XTMA 4PN6A 3BKCH 5INCA 2PTUA 3I02A 5GRXG 3TN0C 1WPCA 2LU5A 3A23A 3PIQB 3U4EA 3ULUF 2VNCA 1NLBL 2J71A 3MRQB 1S7UA 4DPAX 3B9EA 3IXAA 3WO4C 4HHGA 5D1XD 1MCHA 5HPMB 3LQAL 1P6FA 3AU1A 4YDZA 3ARFC 2B4CL 3OKNB 3UTSA 1AR1B 1E67A 3T71A 1SN0A 1QZ1A 4M8VA 3MLZL 2WLYA 5K9QG 4NNPH 4LT7A 1MFEH 2H1PH 4WY7L 1WCQA 2YBRB 1F6AB 2J8HA 4B95C 4DERA 1XH1A 2ZUVA 3V4UL 5C0GA 5D70L 2VDPL 3TT3L 1Q9KA 1IEBA 3F65A 3N50A 4UTAA 3BDYH 4P06A 2EH8L 2GI0A 1C1EL 1NGYB 3HE6A 4OF0A 3SE3A 1LLAA 3GSQB 3UZQA 3DSNB 2AEPL 2GITA 3FB6B 3T0VA 5GHWH 4LCCB 5DD1L 2R2EB 2JELL 2QR0B 2OYPA 3RWGA 4DO5A 1FJ1A 3I9GH 1AIFA 3P9MA 4WFGE 1EGJH 3MLRL 3LPWA 1OGAB 4FTVA 1BQKA 5MI0C 3FFOA 2JKSA 3VNZA 2Z64C 1OGTA 3H9HB 5T1MB 4EIUA 1YA5A 1KPUA 4MD4A 4XBGA 5HHNA 1N64L 4K2UL 4LCIL 1NEZG 3FJTA 1MEXH 1SM3L 4J3OF 5GS1C 2F7IA 2OI9C 3VGFA 4HHAA 1NIFA 3DRQA 4LCUA 2HG0A 3IGLA 4JO2L 3CZNA 4NC0B 3GIVA 1HSBA 4GO8A 2H0EA 4G70B 4NQDD 4H2CA 1TXKA 3EUDA 4PRDB 5HYJD 1DYZA 2H4EA 3UYPB 5I76B 2IOMA 2EZ0C 3N44F 5L6YL 1AZBA 4LF3B 1H6UA 1HQ4B 3IF1A 1FO0A 3ALWA 3L9RB 5E8NB 3QORB 4DQAA 3PNWA 5KYXB 2V2TA 1V3LA 4NXSA 5DZ9A 1AGBA 2SEBA 3IDMA 1QTPA 4K73A 2XKNA 1BJ8A 3LQMA 1XCXA 3UG4A 4MB3A 4MA7H 5CR8A 4BQ9A 1ED3B 2Y6SC 5MENE 1A9EB 1HL5A 4LASH 2E75C 1OSZA 1IAIH 1R6VA 3GSNH 3ZZ1A 1CFNA 3MUHL 1IB5A 2I9LA 3K0WA 4MBRA 4N2EA 4DOHE 1XF2B 1MFMA 5KJ7E 4L8CB 1L6ZA 3HR5B 4B9KC 4XNBA 2X09A 2BMKA 4WEUD 3VSVA 4AEEA 1I1AD 2VKXA 2G75B 3MJ7B 4YNYA 3U30C 5I0ZA 4NQDB 2C3XA 3LHPL 3A22A 2HTLC 3CSBA 4PS8A 2CO2A 4U33A 4WUKL 3NA9H 2HX9A 3P0VH 4KRNA 5GISH 1IGTA 3T4YA 4LPVA 1LP9A 4AW7A 4BZ2L 3EJJX 2Y2WA 5CSZA 1S7RB 2XPZA 2WJ7A 3IWVA 1M6UA 4JO4L 5E5MB 2AJSL 4EI5D 1TPXB 4AKOA 5D1QA 1ZTXL 3HAEA 4PJFE 4HCRL 2M26A 1VACA 5I30L 3OKKB 1ZVHA 4RRPM 4WEEA 1HILA 4OFYA 3VWJC 1MLCA 3FHQA 4JZNB 1DJYA 2Y72A 3LMJH 2VRAA 4PRIA 4AKPA 3I6KB 3PABB 3QJFA 1I1AB 3LEVH 2CHWA 2ATPB 2ZX5A 5AVXB 4N8VA 1KGJA 2W9EH 2NNFA 3LKRA 4YHNB 5J56B 1RAMA 5IVNA 2Y36L 1S7SB 3PQYB 3OPUA 4AMXA 4UZGA 3DC0A 4JW3A 4LAQH 3KCPB 2NQ3A 4HS8L 4Y4KC 1T4KB 2VL5B 5AOIA 1SFDA 1RUPH 2IGFL 3V6ZB 4YHPB 1DDHB 2W5PA 4PV8B 5EZOH 4JRXB 1GC1C 1XIWD 3EJSA 3D4CA 3T9WA 3TL5A 3BGMA 4CNIA 2CG9X 5IHUH 1QNIA 4OV6F 1KC5L 3I84A 4XP9L 5DJ2B 3VG0H 5E2UH 2CK0H 4RDQF 1NSNL 2G5RA 1ZDQA 3HZ3A 5DRZB 3SJVD 4CMMA 3IKKA 3G5ZA 1X7SA 4JJHA 3DXAB 4M5ZH 5D2NB 5GZOD 5IMOB 2J44A 4JQXC 1ADQH 3HMXL 2Z92A 1R5VA 2Y07H 3BPOC 4I0KA 5DJZB 5FA3A 3ZJAA 4KRPC 3DX9A 4JB9L 4NZUH 5K33A 3PFQA 4HPYH 4WI0B 2BWDA 4FLQA 4W81A 4OV5A 4JFHE 1JK8B 3L3DA 1QR1B 2EEBA 2WYTA 2E4FA 4F8TA 4D8PB 5LHDA 3CVHA 3CDZA 5CZKA 4Y89A 5JW4R 1EHLL 3AY4C 1QLFA 2Z7UA 5I19H 1UURA 2JKXA 4L1LA 3QS3A 4KV5E 4NRZB 1MVUA 2XVGA 3VUAA 2AF2A 3GINA 1S9VA 3TIEB 4DKEH 4EN2A 4KTYA 2XWJB 2IFFL 4WHTA 3WN5C 2EDMA 1S6NA 5CKGA 1ZS8B 4IRJC 3SKNA 1KENH 2WXNA 5MEPA 4NO2A 3OSKA 4POZD 3BSHA 4JM2D 3FC8A 2WYIA 4AV4A 5JW3L 4HZLA 4YHZL 4R2GC 3ELAT 2EUVA 2Q76B 5F97E 4BK8A 1BM3L 1QSFB 3U1QA 4HLZG 3NJKA 5AVRB 4ESKA 4LVHC 4B0MM 2BSTA 3H85A 3ZTDC 4ZSOA 3ZQWA 4ELMB 5IB2B 1KCKA 4LSUL 1NAKH 4LLUB 1JDCA 1F45A 4MLIA 4S1SH 4HOXA 1ACZA 2VLLA 1DBJL 1GGCH 2P5PA 4AK2A 4HDIB 3EF4A 5EZJB 3ILEA 2AXFB 4J23A 1EAPB 1K85A 1SBSL 2GCYA 3U7WL 3NAAL 4Y9BA 3U1SH 1Z3GL 5CHNA 1ZLVH 3S97C 4G7RB 1HDMB 1NKRA 1O0VA 2EECA 4JPQA 4KX9A 5LGHH 2VQUA 4TNWK 1QSED 1UA6L 4I87A 3QE5A 1E7UA 3U4BL 2GY7B 1PKOA 4U3XA 4H25B 4HKZA 4E9XA 3K1KC 3D52A 1A6PA 2C9XA 2J73A 3CSYB 4GSUA 5BS0E 1OARL 3EYQC 3VB9A 1YPZA 3HMWL 3VYNA 5D4JA 2YAPA 3MRDA 1EWHA 4PJBA 4ZUWB 4QXUH 4PWIA 3B1TA 2A38A 2BFVH 5I1GL 5IT2H 1SYSA 2FLBT 3KWWB 1E6OH 4H5SA 3DVIA 1EAJA 2BINA 4WSKA 4I77L 2YKLL 2ZJSH 3VAEA 1UVQA 3KPQA 3SO3C 3KEHA 2H0FA 1BBJB 3TT1L 4G6KH 4M7LH 5E8OB 4XPFL 1BJ1J 3AGVA 1TMCB 2O61A 4GW1A 2F54E 1MFUA 2X4OB 3QXVA 1NDGA 5F9OL 1F4YL 2Q8BL 1JWMB 2ZKHL 3MFFA 2E5EA 2YXFA 1NUDA 2MKLC 3U4AA 2WLLB 1K8IB 1S78D 2WWNA 3K6IA 4G3YL 4AXWB 3GRGA 1SDAB 3MGOB 3MTRA 2A6KB 4YDIL 4EIGB 2Q10A 3AXIA 5D7IB 1VIWA 3T2QA 4DQOH 1KIQB 5LCVL 3BXNA 1UEYA 1WEJH 1WIOA 5HJBA 2HA1A 4JMNA 5KSUA 3ZRFC 5TQ0L 2EXYD 1W91A 2PYFA 3P9LB 4HOZA 5ID1B 2OL3L 1CC3A 3TN0D 5IR1B 5I0DA 4L2LA 5CKAA 1A1OA 3DYOA 4R97C 2PYEA 4YDNA 4BZ1H 5JO5A 4XBEL 2HMIC 1HNYA 1AG0A 3MNVB 4GXVH 3B7UX 1RMFH 2O6EA 3ARFD 2PPCA 3N85L 2CRYA 2ZAGA 4HJJH 5K9QI 2AEOA 3QDJE 4JANA 4X5XA 2J8UF 4F15C 3NZUA 4N0YL 3LNFA 3RX8A 4YFLI 2OJEB 4MA8H 4PTUB 3STZA 4LLQA 5G4NA 1KY7A 4A2MA 3CIAA 1JL8A 4FMFA 1NIDA 3L3KA 3TYFB 3DO7B 2W0FA 1CBVH 1OCWH 1J1XL 4MZRA 2IPUK 4ETQB 4GS7C 4OCLC 3O2VH 1HEHC 4AM0Q 1H0DB 1YUHA 1B0GB 1FORH 3ARDC 1DCLA 2XFXA 5AG9A 3KVQA 3IDNB 2BRRH 1UJ3A 4IM8A 1QVOB 4NQUA 2Y5TB 1I9IL 4LPYA 4NAJA 3B3IB 1AP2A 4LRIA 3FW6A 1YEHL 2QVMA 1EUUA 4AENA 1RU9H 3IYLW 2WB7A 2MOVA 1KF9B 3P30H 1TZIB 5I8OL 4N22A 2PTVA 1OCCB 3QWOB 4I5BB 3C6LB 3DBXB 4JUSA 5FUCC 1JF1B 1X5IA 3HPJB 1BWWA 4M61B 1ACXA 3KR3H 1F11A 4OGAC 3RURA 1MSPA 3X3FL 5IFHL 1RIVH 4IGBD 2ZOTA 2FEJA 2AJYL 4MD0B 4M93B 5CGTA 1FDLH 2Q1EA 4PSPA 3GS7A 1KCRH 1BMZA 2HLEB 5H37G 3QUHA 3IETB 1M7IA 2D3JA 3BE1H 3BVNB 2EZ0D 4UBDC 1ZDSA 1S7XA 3QC6X 3AAZB 4Z8FL 3CXFA 1QBML 4FP8L 4ONHA 1M7XA 4K7FA 4X6CF 5DQ9B 2XXGA 1Z9SA 5CEXB 1J5OH 3CDGB 3NFNA 3HFML 1MH5B 1HNGA 5L8KB 4DW2H 1Z9OA 3CN0A 5BRPA 4HS6A 3FB5B 3MCLL 2D7TL 4OGZA 5ESAA 5FGBA 1OM3L 3MREA 4L18A 1MCPH 3WKNA 5DGQA 4G11A 3PWNB 1DN0A 2X89D 1TVDA 3IPBA 3FT0A 5DEGA 1N2RB 4S1QL 4IGBB 3S96B 3HG1A 3IAPA 1K2DA 5F1OB 2NY3C 5FECB 4P9HL 2D7PA 2DL2A 2OSWA 3R8QA 2HTLD 5F7DB 4EXKA 1L9QA 5I0XA 2F68X 5AW5B 2AAVA 4LU5L 3L5IA 3MV9D 1WV7T 4UB0H 3QXDA 5GGVH 3CHOA 4TVPH 4AQ1B 5FYLL 3D5OF 5DRWB 4PG9A 4L1DA 2DBLL 4PGZA 4S1DC 2I9TA 4MXQC 2IPKA 3UZEA 3C8KA 3O3BB 3SQRA 3BD4A 1F90H 1KN2L 1QA9A 2D2CC 4QRPB 1BQ5A 3U25A 4K23H 3UAJA 4ZX4A 2CO3A 5GJTL 4YBQC 2YOCA 3VWJD 2X2JA 3DLQR 4NPJA 2VAAB 4RISL 3VGGA 3U79A 3LQZB 4JGUA 1R5IB 3EYUH 2YQBA 3CZKA 3MRQA 3UC0H 3F64A 2Y23A 5EU5B 5EU4B 5HPMA 4WJG3 3TONA 4YE4H 4J5VA 3OKNA 4KI5E 1TO4A 3GRBA 4TSCH 3MV9B 4KHTL 4AVJA 1LHZA 3O6MH 4X7CC 1I31A 4Y4KD 5AEAA 3GDCA 2EUZA 4WO4C 2OQJB 4RDBA 3V6OC 5I1KL 4FLOA 4HVBA 1XR8A 1F6AA 3VXRB 1OANA 5AOJA 2FYYB 4JRWA 4PI2A 1NLDH 1VF5C 4JKKA 3NSDA 2XVLA 5EBLB 2J1KA 2BCMA 1E9QA 1ADQA 4LLWB 5T1KD 5JIMA 4HC1L 4PB0H 4LSSH 2GBVA 1NGYA 2ZF8A 3SDCB 1I7RB 1AS8A 3CDCA 3HN8A 3HHSB 3S3JA 4K94L 3DSNA 4NP4H 2J21A 1F2QA 3FB6A 4XZUB 4KRPD 1RJCA 2XQ0A 3RPKA 2QR0A 4J7RA 2R56L 1BV8A 3CN2A 2YS4A 3P3RA 4FFZH 3MCKB 3K2UL 1OGAA 3O4LD 3DUHA 3UTQB 4JVWA 1QOKA 1DEEB 3T6XA 1HL8A 4QHPA 3H9HA 3O3AB 2IC2A 3A4EA 4Z3TA 3FUJA 3D18B 5AKVA 4G80B 4X5LA 2QQLL 3N1PC 4XP1L 1GYVA 4QHNB 1KXQA 4YX2H 2XU9A 4NWTL 4R7DB 5I18L 5BUAA 4IRJD 2ED9A 3O45A 5PAZA 3GXUB 5I82A 4Z7NB 2OP4L 2WNGA 2XXFA 3MAWA 2OCJA 4R8WH 3WN6A 1CDBA 3CHQA 5I76A 2WBJC 4FG6D 1J8RA 1EO8H 3KPLB 4JHZA 4LF3A 4ZW6A 2VLKD 4R2GD 3HRZC 2GFBB 1NCAH 3L9RA 3O0RH 4TLKA 4YK4C 5E8NA 5EC1B 3REVB 5CJBA 4JKWA 4TVUA 3GKZA 3G3LA 2XUWA 3KLQA 5FO8B 3IDIB 1JGLH 4LSPH 5TE4H 1A9EA 1W6LA 2ZF9A 1U3HB 2Z7ZA 3QJSB 1S3KH 2CPCA 2GBTA 1SJHB 3O6LL 4IBQA 4PRHE 1KCUH 5EN2B 5FA4B 1EZSA 4IBTA 1F8TH 5ETUA 1ID5I 4L0ZA 2GSIB 1TF4A 3MRHB 4MNGE 3BRDA 4K3HA 4UIMB 4XBPB 4L8CA 1XZ0B 3HR5A 2RGSA 4AJVA 3MJ7A 2G75A 3E6HA 4I89A 4JFEB 5ADOL 4N87A 3EJZC 1E4JA 4BFOA 5AENA 3VMPA 3MA9H 2J1XA 5H8DA 3WAKA 4HZ1A 3MRJB 4DTGH 2Z8WC 1YMHB 2YWZA 3CHRA 1VEOA 4HG4K 1VGKB 1INDL 2M8XA 2PMZA 2ZWYA 4M9PA 5IEHB 3NJLA 4NLHA 2UY6B 3EYQD 3KWVA 4FZEL 4IKNA 1LE5A 3FSOA 2X0WA 2OTWB 4KTEH 3RIAF 3HVNA 4ZZKA 1BZ7B 1CD0A 2BNRD 4I9WE 3BOVA 4QRQA 3D3VD 4O2FB 2QQNH 4JZNA 3REWB 1S7QB 5DTFA 3B9KC 2NY1C 4AE0A 3P0YH 3I6KA 2J56A 5FGSA 5J89A 3WXVL 3C6SB 32C2A 2XY1A 4NT6B 2XYCA 4F5CE 3BEWB 4PJGF 3U7YH 2PO6B 2ZNXA 2D0GA 2P26A 4YHNA 1M1XB 4OR1A 1S7SA 4KZCA 3QFJB 4XNMB 1J87A 3PQYA 4PBWD 3WY3A 3C60B 5J5EA 3N44B 3WFCL 4HSCX 3KCPA 4LKCB 3TNNB 1UB6B 1NAMB 1T4KA 2VL5A 1DDHA 3WUWA 4PV8A 3KGRA 4U1LA 3DOSB 4HAGA 1RHFA 5I8CB 3H55A 3IJEA 5DJ2A 1S7WB 5HJGA 1UKSA 1QBLL 5C0CD 2WPGA 2DD8H 4YVNA 3DXAA 5IMOA 5D2NA 2AQ1A 1HXYB 1EMTH 1HZHL 1QWHA 2DYRB 5BJTB 1MFCH 3I9AA 3TU6A 1MCQA 5DJZA 4PY7B 2JCCF 1SLVA 3JWOL 1WBXB 5CJQH 3TA3C 2PCFB 1U8CA 4WJKB 1QR1A 4CN4A 1P7QB 3GUFA 2H1LM 4D8PA 2YIHA 4CKQA 3VTAA 1X4XA 3P02A 2HAZA 3EHBB 1BM7A 5LGKA 5SWSE 3Q06A 4RCAA 1IZJA 4NRZA 4AL8H 2OR8A 4UTBA 5GS0H 4EUPB 2ETWA 1L0XA 2CWRA 3TIEA 1CFVL 2IQAA 3SGJC 4F7EA 2V3FA 2XWJA 4RWHA 2B5IB 5J1SC 3TOPA 3HZMB 3K2MC 3MRLB 1QQDB 5EU6D 2XWEA 1PNDA 2C5DC 3V9FA 1V7MH 3Q01A 3GIZH 1JWSA 2TRYA 4H0HB 3TFKC 1OOAA 1GC1L 2FECI 4KKZA 5C08E 5CILH 4GRWF 1QSFA 4PD4K 1FSKC 1FV1B 4BDVB 3S5YA 4OAWA 2DV6A 3ARDD 3JZ7A 4Y19E 5D2LE 2O5XH 3ULUH 2L04A 3UADA 1AKJD 1QASA 3L4TA 4NHUB 4ELMA 1CLOL 5IB2A 3QWNA 4LLUA 2WQVA 4H7VA 2NW2B 5JUEH 3ZU8A 4TUUA 3GSVB 1KEMH 3QAZC 3S9DB 3UDWC 5AAWA 4HDIA 1OGSA 3ETTA 3O0LA 4WRLA 2W9DH 2AXFA 3CVBA 1EAPA 1MI5A 1ERNA 3O2DH 4M62H 5K9OA 1WISA 1YEWA 3P1VA 1F0LA 1KGCE 1HDMA 3CFQA 3HEIB 4OGAD 3PL6A 2Y7NA 2B77A 4M4RB 2PNDA 4BFFA 2Z1PA 1A5FL 1G43A 1C16A 4K3DL 5E6ZA 4H25A 1EJOL 1P9MA 3VXNB 4L8SA 3CSYA 3L95A 3CN4A 5AB1A 2ZUYA 4U1KB 1F4AA 3A67H 1WZLA 1AKJB 3LS4H 1N12A 4WEMB 3B6SA 4LKXA 3S8GB 1A6AB 4ZUWA 1NCCL 3D69B 3A0OA 4MKTA 3H3PH 4FLSA 1XH2A 1A64A 2O6DA 1TEYA 1TVHB 3SGEI 5CP7B 4ALAC 4NN7B 5IW6B 3GEFA 1T03L 4LOVA 3L5XH 4WEBL 3FB7B 1BYNA 3WS6A 3AFLA 2ZUWA 4CMHC 4Q9QH 2E3VA 4NZTL 3WNIA 2HFGL 4J3OH 4MZIA 2LLGA 1BBJA 1X5JA 2EAEA 5E8OA 3ALPA 1LNUB 5D1ZD 2ESVD 4U1NB 2J2ZA 4KRLB 2NY3D 3P4OB 4HH8A 3QFDB 4XWOC 3UMNA 1JWMA 3MN8A 1BW8A 3QEGH 3X1FA 1K8IA 3NCBB 1GVIA 1NGWB 1FRGL 1NAMH 3MGOA 2GC4C 2BLFA 3KH4A 1WFMA 2ZOWA 3F7VB 5FM5M 4F1SA 5D7IA 4OCMC 4GG6F 3F7LA 4S1DD 3E1ZA 3RWJB 4MXQD 3KW7A 2FYVA 4XNUL 2EDYA 3ESMA 4OLWH 3BUIA 4KKNA 4CU8A 3GNML 3BJ91 3L6FB 4GW5B 3ASNB 5DR5L 1UZGA 3P9LA 4YBQD 4M00A 1PAMA 2XKUA 3WEXA 1BVZA 3PDDA 2GJ6E 2VJ8A 3LPOA 4HWUA 1ZA6B 1KTJA 2BHFA 4PG2A 4PGEB 5IR1A 4NENB 5D1ZB 3U82B 2ESVB 3W11C 2F1EA 5KN5B 1QBAA 1XGYH 3K3QA 3MNVA 3ALXA 3RWCB 4GMSH 2P5EB 2VJ0A 4HUUB 1FNEA 1NM4A 1O7VA 5CBEA 4M48L 2OJEA 1WHOA 4WO4D 1G7MB 1IGCH 3TYFA 3DO7A 5D7KD 4EUPH 2UYLB 2I07A 5KSVB 2VDNB 3WTXA 1A3QA 1Q72L 4UQCA 4KTDH 3H7BB 2BJML 4ZTPH 2D3NA 2X70B 4OJDH 4ETQA 4J4PC 1Z6JT 3LD8C 1U30A 1HHJB 3MQIA 3UTTD 1IBYA 2Y7QB 1U9KA 1C5DB 4Z18A 1VFAA 1CK0H 1H0DA 2FBRA 4NUJA 4L48A 1B0GA 2E6PA 4NQXA 1KLGB 1AMXA 4UM8B 3TJEL 3IDNA 4FJ6A 1OPOA 4WIQA 1DSFH 1QVOA 4B9CA 2Y5TA 3W0WA 2EYRB 1N4XH 2PCYA 3NPZB 1PPIA 5JXAH 2CBTA 4N8CH 3EGDB 4L5FE 4OZGF 1TZIA 4GSDL 4LB8A 2XC8A 1DQML 3LNHA 2VC2L 3OAWA 4J3UA 5HVWA 5FWQA 4I5BA 3C6LA 3B8SA 3DBXA 3OLDA 4NSKB 1JF1A 2WY3B 1FPTL 1OAJA 2PABA 3FMGH 3HPJA 2QMJA 4M61A 4OSUL 5C0BA 3VGBA 2XQYA 4H8WL 5F88B 4O2EB 3S2CA 1J0YA 1TQBC 3UTTB 1OAZH 1AZZC 5C09E 5DHYB 5EC2B 2SODB 1I53A 5KVFH 4ZX3A 4AMWA 2WBWB 1AY1H 3PXHA 4NQEB 2FX8L 3O3EB 4QO1B 5IWLC 5L88L 5CSGA 1HC1A 5K1JA 2YD7A 3BH8B 4DSYA 5IHWA 3N04A 3BVNA 4QRSB 3QZMA 3SYOA 2DTMH 3B5HA 4KH9A 5KVEH 2KL6A 2X5PA 4F7TB 5DQ9A 3TCXA 3I85A 43CAA 5CEXA 3CDGA 3GJFK 2XBTA 1MH5A 2Z65C 2RACA 4G6JL 4PJDA 4JFQB 3Q9QA 5DJ0B 2J8UB 2AV7A 3FB5A 2R7EB 3QUYB 3D0AA 4V11A 2IWGA 1TYJA 3X1BA 3GHPA 4LLYB 3TO4B 4HOMA 1IMHC 2VR8A 4Y1AE 2G3ZA 4XNYL 2OMYB 4OZIE 1MJ7H 2DQUH 3CQPA 3O4OC 4BM7A 4A7SA 2NSXA 1N2RA 2XV2A 2Q6WB 5C7ZA 2IDSA 4LO9A 4O02A 4F58L 1CGSL 1CFSB 2ATKB 1OCOB 1S9YA 1UKTA 5IOKA 3F7YA 1HH9B 3EJZD 5HHVL 1MFVA 1RVFL 2EC8A 5F7DA 4YSQA 4BH8A 3R7RA 3Q2CA 4RFOH 1HWWA 4FJYA 4P05A 5DJDA 1MHHA 1P6AB 3WJJC 5I0VA 1H3WM 5DRWA 4WW2A 1AGEA 3FXIC 1QP1A 3L3JB 3PUCA 3CWGA 3O3BA 5KYNA 4MS8C 1MIMH 5D6CA 4FXKB 2R29L 3LH9A 3CH1A 4QRPA 2UWEE 4XP4L 1WGOA 3C5ZB 4J3VA 3HCVB 3M07A 4CN1A 1U8KB 4RX4A 1MY7A 4K7PX 2XQBH 2V7NB 2VAAA 4PJAF 3PGFL 3B9KD 2NY1D 2MSPA 5AZ2L 3DO4A 1OSPH 3PHOA 4N0FB 5AYUH 5EU5A 1UT9A 2MOGA 4Y2OB 4FNPA 2CGZA 3F8UB 1I8KA 4RESB 1J8SA 1OF2B 5EU4A 4NHCH 3TX4A 3CJJA 5CU9A 5B3JE 1RZFH 1IC5H 4YAQB 5D5ME 1N19A 4GXUM 3KLLA 3HG4A 5CWSA 5F96L 1T0MB 4OLYH 5DYFA 1EO7A 1QO3B 3BP7B 1F4XL 1BF2A 2OQJA 4X6CB 5BZWA 4X83A 3TO2B 3CXHJ 5E24E 4K5PA 3VXRA 1K9TA 4EI0A 4GO6B 2EUWA 2UZYB 3OMAB 5PCYA 4XOEA 1USQA 3P69A 2VN3A 1BDYA 4JVUA 1UQSA 5EBLA 3B34A 3FQ2A 4NRYB 3KNBA 4NZ8A 5EA0H 3ENEA 5I5MA 2N7BA 2VDNH 3ATBA 5IW1B 4F8OA 2HFTA 3RA7H 3PAZA 2LVCA 3B9KB 3SDCA 1I7RA 4MB5A 3HHSA 4K9EH 1M1SA 4GAFB 3FT4B 4XZUA 5EUKB 5ACLA 5JOPD 4PJ5D 3OF6D 4TQHA 3VM7A 1XB8A 4KK9C 3KYNB 3VD2A 3TA3D 4MNQE 1JGEB 2P5WA 2NY4B 1HJCA 2Y3NA 1E4WH 3WDIA 5LWYH 2ZP8A 4OCRH 3OJDA 2NX5E 5ALCH 1LD9B 5HHME 4GFXA 3LAFA 4G80A 1DVXA 3RGVC 4DCQB 3VXUD 4QHNA 1DLHB 1BAGA 1MQKL 1I9RL 3HG5A 4L4TE 3TNMB 3QJRB 1RQ5A 2DQHH 2CGRH 2ZX9A 5SX4I 3VI4F 3VI3E 1DFBL 4PJIE 4F8QA 3OLEA 2J20A 4PB9H 2EDBA 5DMIH 1FF5A 2VDOL 4LDLB 3KPLA 4E41D 4KUZL 3P4MA 3TFKD 1IRAY 1LEKB 3IRCA 2NZIA 3REVA 3P73A 2ITEA 4JEGB 2KI6A 3KPRD 4PY8I 1OVZA 1AC6A 3T2NL 3MTXA 5JORB 1F58L 4OGYH 1N6QH 3PCYA 3UCRA 2L7UA 1SJHA 1U36A 3L7FB 5IM7B 1WA2X 1DUYB 1QMUA 3CAFA 1Y07A 4XVJL 1NCOA 2DI7A 5EN2A 4ZT1A 5FA4A 4QJ5B 3IU4L 1N59B 4Z76B 1I4FB 3BH4A 4XVTL 2ODIA 5E2TL 2JSFA 2NCEA 5AUMB 2GSIA 3CCHB 3MRHA 1FBIH 4UIMA 3UH8A 2NT0A 2A1WH 1XZ0A 4C4UA 3CBRA 3SDDB 4TKWA 4C4KT 3IGKA 2AQ2A 4URKA 4JFEA 3N2JA 3TBSA 5SWZD 4UDTA 1J0JA 2F58H 5CJOL 3BKJL 5LNDA 3MRJA 2UUDK 1YMHA 4UQBA 3SBQA 3KPRB 4I1RA 5L4JA 1VGKA 2GYSA 5F6IC 3DI3B 1UASA 4ZAKB 2C9UA 4HKBB 1KDIA 2OTWA 4TUOA 3SY6A 3FRPB 1BZ7A 2ZAHA 4LP4A 1N0XL 2WXOA 4R0LB 2D7NA 4O2FA 2HX7A 2YJQA 3WL9B 5DVKA 3REWA 4H26B 4F57H 4OFIA 1SJVA 4JFFD 3VACA 5ENWA 4HJ0C 4XHQA 4HF5H 1IT9H 1JZJA 4OTXH 2XIDA 2VM4A 3C6SA 4H1LG 1SLUA 2WTPA 2NY7H 1ZIAA 2YBGA 3BEWA 4NT6A 2K6YA 3ELQA 2PO6A 3GBLA 3GYRA 3LEXB 4PV1C 3V4PL 3S5LB 3ZOAA 4JRYD 3V5DB 2H2PC 3QFJA 3G9AB 3C60A 2D2OA 5JZ7C 3GHBH 5LBVA 4Z3HA 4GKOA 1NAMA 3GTTA 5AZUA 1MN4A 3L1FA 4XWOD 4RAUA 1AH1A 2BP3A 1VPOH 1F86A 4FNRA 3GXMA 4U6HB 4QD2E 3DOSA 4DZBB 3NH7L 1WH0A 2WXMA 5I8CA 3SHSA 1JGUH 2VLJA 2VISB 3ZDZE 2J6WA 1L9OA 5A3IC 4MCYA 2W95A 4RAVA 2QPDB 2FWUA 3JYBA 3TFBA 3C09B 2ADYA 2Q3ZA 4LP5A 3J07A 2AHIA 3FO2A 1AQDB 4PY7A 1OF0A 1ZVSA 2I7OA 3ATDA 1JUFB 1WBXA 2DQGH 2PCFA 4X4XA 2C9SA 4UM9B 2AKRB 3MYJB 4KC3B 1P7QA 1AE6H 3MODL 3GMRA 4KY2A 3BUTA 3W11D 5F9JA 3GO1H 1NMBH 4JO1L 3AG4B 3HR6A 4Z0XB 1MW3A 5DS8B 1KCSL 5HJDA 2J3SA 5TDPB 5B39B 1T89A 4M1GL 3TZVC 1YEKH 1AZCA 4EUPA 4Z7IA 1QHQA 5EF2A 2Z91B 1A3LL 4Z7WF 3T2OA 4TVSa 3HZMA 3MRLA 5F89B 1WAAE 4C8XA 5IROC 3E2HB 4NM8L 3PS6A 3MLYH 5E6IB 4MXVE 1FFTB 1NL0L 4J4PD 2P4AB 2EDNA 4IMLB 1Q90A 4XXDB 4MJID 5GGQH 1J12A 2XWBA 5BVPL 1ZEAH 4PJGB 4R26L 1JZDC 3KDMA 1AHKA 1UYWL 3GHEH 1E2VA 1I1YA 4GW4B 3DJTA 4WDIB 1T2QL 4YFEA 2DH2A 35C8L 2WO2B 3IPEA 4NHUA 4URTB 1SVZA 4X42A 1IGMH 5E70A 4NEHB 2NW2A 2A74C 2NXZB 3L3OB 1VEPA 1RJLB 3GSVA 1NGZB 3OX8B 1NDTA 4P2RE 4PBDA 1TQCB 2X9XA 1BQHB 4JKNA 4MDJB 4UOJA 4PMEA 4LHUB 4Y2DC 1VHPA 1WD8A 3I3EA 1E40A 2DYSB 1A6VL 1X5AA 3LS5L 4QAWA 1JNNL 4MRCA 3T5WA 3C5JB 1E5ZA 4J27A 4UI2A 5F93C 2YGVA 4M4RA 5HHOD 1BBDH 3ZE1F 4HETA 3GSXA 4JL1A 2AGJL 3B5GA 2J6EL 3ARXA 2JCCB 3CK0H 4DP4X 3GSRB 4JGMA 3IGAB 1FNAA 2CCWA 3MBXL 4U1KA 3UTOA 3Q43A 4EVNB 5IVOA 1CVRA 3RWHB 2FJGB 3CSFA 4Y5YA 2V5RA 5TDOB 4ZODA 1II4E 4P8QA 4RGOH 4KQ0A 3D69A 1A66A 1W0WB 3UYRH 4FI7A 4IJ3B 5F7MC 4MKMA 2H9GA 4O2CB 3N91A 5JA9A 5CP7A 5INDB 5IW6A 3V5KA 4GSQA 5EEYA 5EBWB 2ENJA 5MP6H 3FB7A 3MLZH 1QR4A 4QTIH 2DLGA 3HZVB 1MHCA 4WY7H 4NOFA 4FLRA 1OAKL 1CT8A 1LNUA 4QXVA 4YSSA 1TJIL 1RZJC 2ITFA 2A6IA 1A25A 4U1NA 3V4UH 4AJYV 2BXZA 4OLUL 3QFDA 4AYID 5D70H 3TT3H 2BS71 3FQXB 4FQXB 4GRWB 4ODBD 3KJ4C 3SDAC 2JWYA 5HGBA 1AC0A 4DJMA 4L8DB 2EH8H 1SN2A 1YNLH 1C1EH 2EEFA 1NGWA 4Q2ZB 1FNFA 1B0RB 3F7VA 4BQ6A 1IEHA 4X6EB 1F56A 2PR4L 3IAGC 3RJOA 5DD1H 3SD5A 4MS8D 2JELH 2CNYA 4R4FL 2HTKC 3AS3A 4GW5A 3L6FA 3MLRH 4R7NB 2P42B 2D31B 4FI8A 3GLAA 3QCUL 3O4OB 1ZA6A 3DIDA 5LG1A 2O4EA 2YFOA 1N64H 4LCIH 1SM3H 1NC4D 5C0AD 1SEBA 1QUNB 2GTQA 2X9WA 3KXFB 4JO2H 1HVXA 2QZ5A 2P5EA 3INUL 4KDTA 1UH2A 3QZPA 5AKTA 2FX9L 4HUUA 4GEJA 4HK3N 2V4LA 4EQ3A 4PJEE 4DKFL 4E2OA 1OCRB 3KD4A 3PAVA 5E1IA 2FO4B 2QGBA 3EJQA 1KFAL 2UYLA 5KSVA 2MTAA 2IADB 5KS9F 3H7BA 3QCTH 2X70A 2B1HL 4YSOA 1GS6X 2P43B 1HHJA 2NYYC 3QEQD 4PJXF 4BGLA 2Y7QA 2E8YA 1C5DA 4LMQE 5B3NA 3ULVC 3KPSE 5MEND 3HG2A 3TEZA 1IO4C 4B9YA 3C8DA 1KLGA 3D05A 1UOLA 4UM8A 2YA0A 5DQJB 1U8IA 1JDDA 3FONB 4GRMB 3H3BC 1T83C 4LPWA 2YD1A 1HOCA 1FYTB 2EYRA 2IANE 3TTSA 2YSSB 5CLWA 4GAJL 3EOAB 4KK9D 4ZUSB 4PFEA 4NCC2 3AS0A 4R90L 1YC8A 3D2UD 2F53E 3EGDA 3LHPH 4OIIL 1NCNA 4KKPA 2EINB 4MWFB 2PXYA 3C9NB 2CO6B 4R5XA 2Y1YA 4WTWA 2XXMB 3AT8A 3OQRA 3SE4C 4A55A 3QPXL 4FYSA 1HQRB 5F44A 5HGAB 4GG6B 4BZ2H 4D0DB 4OU3A 1AMYA 4O2EA 4UT7L 5EOQL 3RGVD 4JO4H 3DI2B 3W57A 2E46A 3QEQB 4PW9A 3S4SG 4HAKA 1ZTXH 3ZYJA 4B41A 3KGTA 5DHYA 5EC2A 3L17A 4AIEA 3TV3L 4NQEA 3I6GB 3L9EA 3O3EA 3QZWA 2DQJH 5E9DB 2OYKA 3U2IA 3ZL4H 2RH0A 1GKEA 4QRSA 1VFBB 4NX0A 2F19L 4NC1C 2Z9TA 3QJVB 4A39A 1AAJA 2R23B 3KAAA 5C97A 3K91A 5DLLA 5IJKA 1TUPA 4ABVA 2OR9H 4A67A 3T0EC 2VT0A 4JFQA 3D2UB 4YLCA 1PMYA 2MNUA 4N90E 5DJ0A 2J8UA 1OB1B 3ILQC 1A7RL 1N7ML 4Y5XC 2D3VA 2CK2A 4KI5C 4LLYA 1WE5A 3WXWH 5TDNB 1WFOA 4HS8H 4NUGL 1ZAGA 2OMYA 1UT1A 4YHLL 3O8XC 1XO8A 1ZY9A 1HZKA 3DMMC 4PJHF 1QX1A 1JNHA 4LVNB 4P46C 4ACTA 4M7ZB 5EBMA 1R3IL 2AVFA 4YQXL 3DIFB 3T8VA 4TLSA 3FCSB 1HH9A 3S3SA 2N7AA 3DPBB 2QHLA 1IZKA 5CM1A 5M94B 2H3NB 2EIZB 3TEUA 3FOMB 4DPCX 2OL3B 2NZ9C 3WKML 3ZQXA 3BIKA 4GRWH 5CEYB 1YHPA 4BJLA 2JKIS 2XWRA 3GPSA 1JZHA 5KSAB 3H54A 1MHPL 4ZD3L 3P3YA 1T1XB 2HT4C 5CGYC 1CE6A 3WCYA 3VU2A 2J5LC 3LZRA 3D39A 4FQQB 4OZGB 1CZ8H 4JFDB 4R5VA 5AB9A 3C5ZA 3HCVA 5CLZA 3GLEA 4JFHD 1U8KA 3RHWK 2OTUA 5FFGA 1TYEB 3AG2B 3X1NA 2V7NA 2DKUA 3PJLA 4JHBA 1PX4A 4OCWL 4M43H 4HJ0D 2VLME 2KKQA 2EILB 1DANT 4MHHG 4B96A 1A7BA 4Y2OA 5L2KA 3B9VA 4IRSC 1OF2A 1MRDL 5DJXA 3CGTA 1CXFA 1JMZA 4YAQA 2H2PD 3BQUB 1X5XA 2NUTB 2UX7A 3FQ1A 4KPHH 3NSJA 3NSCA 4NBYB 1XCTA 3NCWA 3HNTL 3OC5A 5JZ7D 1E65A 4QCIA 1JZGA 1T0MA 1ZLDA 3TO4D 1QO3A 4W9EC 4YHZH 3TO2A 2H32B 1GTNA 2MQ3A 3Q8BA 2UZYA 3OAUL 4Z7UF 4HJEA 4LGRB 2ED8A 5DD5H 2BS9A 3T4AB 4BELD 4KAQL 4OQTL 2PLTA 2UUDH 3WY4A 4IBWA 4NRYA 5AW2B 5A3ID 1B6UA 1X4YA 2P8LB 3FH8A 4N4YB 5C6WH 4BHUI 5IW1A 4XCFL 3P2TA 3C12A 2X4SA 4WWKB 3RPIB 5LDSA 2BOLA 3OWRA 1MNUH 2OXHB 3RKDC 2P9RA 1DBJH 1OQOA 2CHXA 1ZVNA 3FT4A 5I26A 3QNFA 1CCZA 1UADC 1SBSH 3NZ8B 1ET7A 3TEYA 3QJOA 4N5UA 4U1GB 4NRXA 1ACCA 3D4YA 3NGBB 5I9QB 3QIWC 5CCKL 1EXUA 1TQSA 4XAWH 1BF8A 5CXPA 3L08A 3VYPA 5I6MA 2EIKB 3UL4A 1YMMB 4P2OA 1LD9A 2DZEA 4Z7AA 2CBMA 2UZPA 1MFNA 4HWNA 3X2QB 1DJXA 3UO1L 4KROD 4MS6A 1DLHA 1MIEH 1NQBA 2GI7A 3HMWH 2AEQL 4BUQA 1G9MC 3H6AA 2DLEA 4WFHE 5IROD 4XNQA 3FUEA 4XN4A 3F05A 4PJAB 3RL2B 1NC2D 5GSVB 4YXKH 1XEUA 1LEKA 3T0BA 1FE8H 4C4BA 3KJ6H 2AQSA 2OPCA 2AK4B 1G7JB 4PRPD 2BSSB 2WOBA 3FFCA 4NO0D 1NCHA 1UXSB 4KKCC 5JORA 1U92B 4HIXH 1SY6L 1YNKL 2YKLH 4I77H 4I18A 4NXKA 5FFLA 2FT6A 4AH2B 4E5XG 3W39A 3L7FA 2F61A 1LMKA 4WUUA 5E6RB 3TT1H 1DUYA 2OZ4L 4XPFH 3GXDA 2VXSH 2QEJA 2ARWA 4UILL 5FUZH 1N59A 2JQAA 1I4FA 3ASOB 3CCHA 5IQNA 3R0NA 5CEZE 1F4YH 2ZKHH 1T2XA 4KROB 3QQXA 3DJSA 4KY1H 3SDDA 4HJ1A 5E2VL 4HBQA 2WQAA 4MA1B 3GPEA 3DDFA 3P77B 4IBSA 5E08L 1UZ6E 2XN2A 4QOKE 5KWYC 3OAYK 4G71B 5E1GA 5LCVH 3BN9C 2BH0A 1QFWI 3V79C 5F0LB 1IGIL 1VJSA 5KSBE 1CR9L 4YFLF 1KB9J 3BZFB 3VU1A 4PYHA 2QSTA 5JW4N 3RYMA 4HKBA 3VD1A 4U1SB 3BP4A 3DX8B 1JZ6A 4X7EC 3ZO9A 2OL3H 4D9QD 1BVNP 3FRPA 2IH1B 3A21A 4R0LA 4LSVL 2ZCHH 1FLRL 5LXGL 3WL9A 2CIKB 4X6DB 4PWFA 4P5MB 4UZSA 4ETYA 3FTXA 1FQ9C 2ZYHA 3N85H 3G5WA 4RGNE 2EKJA 4JM4H 4CDGC 4Y16B 1MAML 4CBZA 3P3SA 2O26U 1M7UA 5I74C 4L3EE 1KTCA 3QDJD 4KX7A 3ZTJH 2DYPD 3LEXA 3S5LA 3V5DA 1D7FA 4Y9FA 1IKNC 3VI4B 2WLJA 2XT1B 1BEXA 4WVRA 4YXHL 2GEQA 4HSAC 4L3CB 3LZFH 3QHFL 1J1XH 4WI3A 3CLFH 4N86A 5DZPA 3SDAD 1T4WA 2WLIA 4U6HA 5CIPA 4DZBA 4TM9A 1CLYL 4UV7L 2DDQL 4HBCL 2ZICA 4P9MH 2VISA 1M4KA 3S2AA 2H32H 3BKYH 1QRNE 1GH7A 1UZ8B 2CBOA 1BVKB 2W92A 4AYEC 1I9IH 4CILA 2GVYA 3PWPD 5IESL 1ETB1 5FYJD 1YEHH 1VA9A 3FU8A 2H0PA 2HTKD 1GA2A 3WAJA 3JZYA 4N3UA 1YC7A 1MAKA 1JUFA 5I8OH 3BWUF 3FU0A 3GBNL 4NGHL 4PWKA 1PZ3A 2AKRA 3MYJA 4LBAA 4UAOC 4WGVB 2YJLA 3ABKB 3JV0A 4HWZB 4AJ0A 4PVBA 3P9WB 5G4MA 4Z0XA 4XCNB 4DEPB 1AZRA 3V5HB 3FYEB 4OF3A 1NGPH 1XF1A 5B39A 3QDMD 2AK1L 2BRQA 2Z91A 3CZSA 4L1SA 2VRQA 3L16A 3II2A 3NQIA 4K0OA 3GS4A 4JFPB 4NAMA 2VERA 2VITB 4BGDA 3FTGB 2XPGB 2MRYA 2HZHA 4XVUC 5F89A 1JXJA 1QBMH 2CSPA 3N1MC 5E6IA 1G1OA 4U6VL 3HFMH 3K6SA 2CLZB 4FQHB 2NYYD 1EXHA 1AACA 3ULVD 1NEUA 2WZ6A 3WIIL 4YXLL 4PJGA 1OM3H 1A0QL 1D5ZB 4AUYA 2PCXA 3SPHA 5BW7C 5C2BH 4GW4A 1VRSA 1HAUA 4WDIA 4G8IA 3EXLA 3E80A 1SGKA 3RFZC 4GUCA 3QZLA 5F7NC 4S1QH 4JFVA 1EXGA 3OX8A 1YPZE 1P4BL 2YEVB 1NGZA 2BNQD 1D5RA 3ZDYF 2CHNA 3FO1B 4JVPA 4MDJA 1BQHA 1F42A 5AVSB 2XA3A 3TCTA 3VH8G 3ZT7A 1RURL 4BZ2A 4DGIH 2Q7AA 4XE5B 4LHUA 1NOLA 5DJ6A 4JO3H 4QRRB 5GRJL 5GGTH 4HCRA 2KH2B 4Y4FC 5B8CC 3C5JA 4OW6A 1K5WA 3BH9B 5F21B 5FYLH 1R33A 1BAWA 4ABUA 2DBLH 2EDQA 1KB5L 3VXPB 3B5TA 2Y7SA 5T33L 2XN1A 1WUNT 1BX2B 1KN2H 3MO1A 2JCCA 1LQBC 2E9GA 3GSRA 3CIQA 4HXAL 5A2FA 1AI1H 5GJTH 2IG2L 1OK8A 4EVNA 1UWEH 4RISH 3STLB 2OAAA 3RWHA 3AW5A 5F0JB 2FJGA 4DPBX 4MVBC 5TDOA 1NJ9A 2X6MA 4JY6B 1AQKL 1JGVL 1W0WA 1S5HB 4BWTA 2YRLA 3FO0H 1CE1L 2ZWSA 3T0ED 1BECA 3CX2A 4O2CA 1SF5A 2NY6B 3S7GA 4S1RL 1WCBB 2AJ3B 3EBGA 3ILQD 3NJXA 4Z7WB 1MW2A 1H6FA 4KI5D 5JIHA 1JTTA 1GZHA 5E8PB 3O8XD 4BRJA 3DMMD 2E7MA 4OD3L 1BPVA 4PD4J 1KY6A 4BXVA 2IAAC 5E51A 5EFIA 4P46D 4LXFA 1OZTG 5J12C 1FIEA 4MAZA 1ZV5A 2VLRB 4CBPA 4FQXA 1Q9WB 1TTGA 1NCDL 3VFGL 4HC1H 3MR9B 4L8DA 5BQDA 2WHVA 2F8OA 3LYRA 4Q2ZA 5EZPA 5IMKB 2NZ9D 1B0RA 1E5BA 1KOAA 4E9VA 4CVXB 1B4LA 4OLZL 5E8DL 2FDBP 5DC0A 1ZANL 2HT4D 5CGYD 1KNOB 1EDHA 2G2RB 2R56H 1ZSHA 2FT7A 2WZPD 3NCJH 4HPOL 2BP8B 2JIXB 4R7NA 1GYCA 2D31A 1U3NA 3QR0A 4MHHI 3B37A 4GKZB 3MV8E 5KYUB 1IAOB 3VJ6A 1NANI 3RJDA 1E2WA 4PSRA 2QQLH 2GABA 2IIJA 1CDIA 2XHNA 4IRSD 4ZMAT 1QUNA 1KYOK 2D0HA 4G9FB 4HT1H 4XMPL 4DFIA 4MXWL 3HI5H 3DVFA 3CLEH 5DJAB 1FVCA 1BD2E 3ECVA 2EICA 4X6BB 2FO4A 3VQ2C 3C8HA 2YPVL 2ZKWA 4W6XB 1DSYA 2HN7B 5JPMC 4X7SH 3K72B 3T8XA 5IQ9B 4IKIA 5E1HB 1OSEA 3PPSA 4OD1H 2C3WA 4WK4B 5DUBB 5FYJH 3WV0A 4FXGB 1EEQA 1P5UA 5DQJA 3RKDD 2A99A 3RWFB 2E59A 3FONA 4GRMA 5DMJB 4FG2A 3VVWA 1TTUA 2EP6A 1FYTA 2OMXB 3SEPA 1SXZA 1DVZA 2YSSA 4U1JA 2V33A 4HIJB 1BLIA 4ZMWA 2V17L 3TWCL 4XR8C 5ADOH 3BZEB 4QHLB 5HDOA 3QIWD 4MWFA 5J6GB 4PEEA 2CO6A 5KW9L 5FHAL 5HYEA 1HQRA 5HGAA 4GG6A 4D0DA 3GI8L 4PLNC 1MWOA 4FZEH 3FT3B 1E5YA 5ITBL 3TJHD 4Q9RL 4YZFF 4PR5B 3CUPB 1JPTL 3ARSA 3I6GA 1CXLA 3T6VA 1SMAA 3HJEA 1MDTA 5E9DA 1QTSA 2D9CA 4EO5A 1I82A 1VFBA 2MTPA 2WINB 3O6KL 3P11H 4NN6C 3EDDA 2DEXX 4RMTA 1R3HB 1TNNA 4YHYB 2F7QA 4MMXC 3QGVA 4KKCD 4K8RC 1FH5L 4FQIL 4P2QE 4WHCA 3KGUA 4PJ9D 3A47A 2DQCH 4L1TA 4Z1PA 1OB1A 2LE9A 5B7FA 3WFCH 2AI0L 2BY2A 1A4KB 2OV0A 5DK2B 3FQTB 3BSZL 3Q8EA 3PJNA 5A7BA 4QNPE 4CSPA 4PJXB 5LCVA 4OCXL 4ZDHB 3RVXC 3DIFA 4HD9A 2IMNA 3LXBA 3FCSA 1UWFA 4HUKB 2H3NA 2LT9A 4X0NA 2TSAA 3ASWA 3FOMA 5JR1L 1QBLH 3SKOB 1JFQL 2XN0A 3BN9D 1XWVA 1YVLA 2OL3A 1NUGA 1S5IH 3ZR5A 2GTZA 1HZHH 4Z3JA 1MCDA 3DX2A 1MUJB 4F8NA 5KSAA 1E9OB 3UTZB 4PJ9B 1T1XA 1VADA 3JWOH 2IAMC 4ZYKA 4G1MB 1RZKH 2XZCL 4FQQA 4OZGA 1V7NL 4JFDA 2X6VA 3MOBH 3V0VA 4PM1A 3BI9X 3NACL 2VR3A 1AFVL 4Z5RB 3QAQA 5F1NA 4G8GB 4MASA 1DLFL 2FSDA 3QDGD 4HJGA 4JFXB 3FTVA 5TE6L 4AKQA 5KYWB 5EOCH 3DIVA 3HC0A 1CFVH 4DK3A 4WFEE 3MA7B 5F9WB 3AUWB 2J57A 5IUSA 2CBQA 3BQUA 5JHDD 1M9WA 2A6JB 1SJXA 4U3HA 5D1XE 5I6XC 1SUHA 5EEUA 5EIIB 4LE8A 1RI8A 2OW6A 2H32A 3VX0A 1AD9B 2CMRL 2BIHA 3OAYH 5A2IH 5KJRL 1MCCA 4HWBL 3QG6B 3MLSH 4OCSH 3T4AA 5IP4A 1FZJB 4ZS7L 1KLUA 5GXBB 3QQ9D 3NJFA 1QFOA 5KG9A 2P8LA 4FFTA 1ACYL 1HHKB 4Z95H 4WWKA 1GZQA 4HIIB 3RPIA 5DVMA 4P4RB 1N5AB 2VC2B 2OXHA 4PJHB 4J39A 4HOWA 4WI4A 1MRCL 1WIUA 3GJEB 4DVBB 5I74B 4ZS6C 5HP5A 2LTQB 2E76C 1J0HA 2F08A 2X6CA 4YWGH 5BCAA 3NZ8A 2BZDA 1KJMB 3LIZH 4Y88A 2R15A 1WP6A 3RPBA 2C9AA 4A7GF 4APQC 2CZNA 1X5FA 5GRVL 2ZCLL 3BVXA 2VR5A 1OD9A 4FI6A 4YHML 4P5KA 3X11B 3HI6L 4HISA 4K3DH 5FK9A 1YMMA 3RDJA 4OFDA 1MHEA 3FCTB 3S36X 1JDAA 3MROB 5DYOB 2GUYA 3U46B 5ADPL 5DSCB 3IK2A 5A7EA 1FL5A 4YN3A 3Q5OA 1KXTB 4XVUD 1WS7A 1T21B 2GT9B 3THML 1OV8A 2EACA 3L3GA 4FKHA 4RFEB 4PJAA 3RL2A 1ZT1B 1NCCH 5I66B 1E4KC 5GGRA 2AJXL 4LL4A 2ERJC 5ISZD 4ZNEE 4NQDE 2CJUH 4H20L 2AK4A 4NFDA 4NKOB 2Y24A 5HYJE 5KG9B 1T03H 3T65B 1GSKA 1UXSA 1CGWA 1U92A 3B83A 4Y4HC 2V2XA 1MFAH 5F3HB 4AH2A 3GQFA 1JVOA 1N67A 2PPFA 5LGJB 3W2DL 1F02I 3IDYB 4OZHA 1SMDA 1HN1A 5B38G 1TZGL 4H8UA 1WGVA 5GGTA 5BZDB 1CURA 3SKJH 3BJLA 5FYKD 1M6OB 2HJFB 4D0BB 4D8OA 3ESNA 3NJNA 3QZOA 5J1AB 1FRGH 2WXLA 3P77A 3VXMA 4ODTL 1U93B 4PS3A 2ICCA 3D2TA 1FIGH 3IDXH 4Y4FD 4XN7A 1WFIA 2P8PA 3C87A 3I6SA 5ISZB 5E23A 4ZPVB 1PD1A 3SB3A 4NBZB 3BZFA 1Q4NX 1TLKA 3GNMH 4HGKC 5AVYB 4H8PA 5HYQB 2DWXA 3DX8A 4U1SA 5FKPA 3RBGA 1LO3H 3JTTB 1HXMA 1GGIH 4NN5C 3LDBB 5EU3B 2XN9B 4JRXE 3EGXB 3B2DC 1CLZL 1RJZB 4N3TA 4P5MA 3BAEH 2QT6A 5ICYA 1HOEA 3EXJA 1H3XA 2CALA 4MJ6A 1LDPL 3SPIA 2FBJH 3OD3A 4X7TB 4KXDA 1DQJA 5DQDL 4V1DD 2YZ8A 4Y16A 2VR9A 4Y5VC 5EO0A 2ZG1A 3FU6A 4XNDA 4M48H 4G72B 3DXAE 5C0EB 5BXFB 3HG0A 4ZFQA 3M1BB 4WU5B 3VI4A 1PYWB 2PCPB 3ZTCC 3RZCC 2YUZA 4HC1A 3O9WC 1Q72H 4L3CA 3NCYP 2BJMH 3O3DB 4YBHA 3Q1SL 3B1UA 1RHHB 5J1TC 2WSKA 4LMQI 1YYCA 1FNGB 3GXPA 5F0PB 3JQOB 1TTFA 3RY6C 2HLAB 3MUGB 1IBFA 4LVOC 1I3RA 4UINH 5F7YC 3CDYA 3N1QC 1UZ8A 1M05B 1BVKA 4GBXC 4KITB 4JAMA 1W9XA 1I9EA 3ARUA 4U4IA 1D2OA 2FZ3B 2VR4A 4S10A 3VW3H 4RSVA 2XWXA 3SJVE 1B90A 2WMPB 3DGGA 1VB9A 4BK5C 1DQMH 1IBZA 1WT5C 2VC2H 1IQWL 1LEIB 3ARFA 4MJHA 3VXNA 2ICWA 2WWOA 1FPTH 1WWCA 4L4JA 4OSUH 2NTSP 4M1DL 4H8WH 3G04A 3QCVL 1XDTT 4PLKC 3V5HA 2VDOB 1OAUL 2YAEA 4TSAL 5HDBE 1JPSL 5H2BA 3FU3A 2FX8H 5L8JB 2R4RL 2VITA 2OMVB 2XPGA 3L48A 4L4VA 1BWMA 3DJ9A 1KCVL 3Q8AA 4WQOA 4GQ9L 4N2LA 3S5ZA 3V0IA 4DP8X 1KULA 2X2YA 1BZ8A 2K3TA 3PWVB 4G6JH 4FQHA 1R5WB 3ZMRA 3LZLA 2AERT 3MVSA 4ADGA 3IPFA