1W8EA

3d structure of cota incubated with hydrogen peroxide
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
510
structure length
505
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
total genus 143
structure length 505
sequence length 510
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w8eA02
1JZHA 1AR1B 1PZBA 1EZLA 5FC9A 1QHQA 1AQ8A 1JZGA 3CDZA 4RH4A 3CZUB 3KW7A 4N4YB 6PCYA 3T6XA 1A8ZA 4BWTA 3EH5B 2VW7A 3FSVA 1R1CA 1SDDA 1CUOA 1WS7A 1XB3A 1TEGA 1M56B 3SBPA 3S8FB 2Q9OA 2FQGA 2BP0B 2BO0A 1JVLA 2PCFA 1L9SA 3NJIA 3QJQB 3ZIYA 1NIEA 2XVBA 2OJ1A 2DYRB 1KCWA 4HALA 2YAFA 1YLBB 2CAKA 3NYKA 4YSCA 1EHKB 1WAEA 4P5SA 1A3ZA 4DP7X 1HAUA 5B1BB 1SF5A 2GHZA 2AVFA 4ENZA 3OD3A 4A2HA 2BW5A 3ASOB 2AZAA 3UGEA 4GP8B 5F7BA 1E5YA 1OF0A 2R7EB 1KV7A 2YAOA 2ZONA 4QKTA 1NIBA 1BXUA 4YL4A 3S3BB 4DP6X 3FS9A 3FSWA 4E9RA 4DPBX 3X1EA 1M9WA 3S8GB 3S3CB 1PY0A 1KDJA 3FPXA 2XXGA 1GS6X 1RCYA 3FYEB 4QLWA 3X1FA 5I26A 1BEXA 3ZBMA 4YSSA 3TBCA 2CBPA 1W6WA 3MX0B 2EIKB 1ADWA 1J5DA 4E9QA 2AANA 3L45A 1TU2A 2LLNA 3NSFA 4UF7C 1J5CA 1NIDA 5B3SB 2FQEA 4M4RB 1L9RA 2IDQA 3PAUA 3WI9A 3FSAA 1HAWA 3NT0A 3X1NA 5B1AB 3ABKB 3WIAA 3X1BA 2MRYA 2XU9A 3AG3B 1BAWA 2VM4A 3QQXA 1ET8A 1HFUA 3OQRA 4BDVB 2IDUA 3EH4B 3CDZB 1JERA 1IBZA 4FAAB 1AZRA 6PAZA 1GY2A 3PXLA 2PPEA 1AG0A 2CJ3A 2QPDB 4JKNA 3IEAA 3IBOA 1FFTB 2BWDA 2ZXWB 1AIZA 2PPDA 2FTAA 2R7EA 4UAHA 5I6PA 4ZK8A 1OCRB 5I5IA 5EHFA 2BP0A 2DYSB 3WKPA 1AG6A 3WNJA 1PLCA 2FT6A 2FQDA 3FQ1A 3EH3B 1GY1A 3NSYA 2GSMB 3PCYA 1CYWA 3UADA 1J9QA 5AKRA 3NJGA 2AFNA 2FWLB 2YXVA 4F7KA 1CYXA 4GYBA 1J9RA 5B7FA 3AY2A 3CVBA 5AZUA 5D4IA 4HHGA 1ZDSA 1AANA 1M57B 4YSAA 2IWKA 2XV0A 3JT2A 1OE3A 5B1KA 5AFAA 1SDDB 3GDCA 1JZFA 2DV6A 5I6MA 3T71A 1AACA 3NJMA 5D4HA 7PAZA 2IH8A 3V9EA 3HB3B 4A67A 1ET7A 4W9ZA 2XWZA 1AS8A 3H4HA 1SF3A 1JXFA 5I6LA 4MFHA 1ASQA 1TKWA 1W8EA 3AW5A 3NSDA 1SFDA 1MG2C 1GYCA 5D4JA 1B3IA 2DWSA 2EILB 2IH9A 1BQ5A 4WTQA 2IDSA 1NDTA 2ZOOA 2ZWNA 3NJNA 4KOBA 4BXVA 5PAZA 2XUWA 1WA2X 4KO6A 1KBVA 1OE2A 3NJJA 1RZQA 2QPEB 1DZ0A 1UATA 2OCCB 2YAHA 1GS8A 3X2QB 3UAEA 1AS6A 1MG3C 4AX3A 4A2FA 4DPAX 5I5MA 4NERA 2XV2A 4NAJA 1KGYE 1WS8A 2E86A 1OV8A 1NIAA 2TSBA 1KDIA 2XXFA 4YSQA 1OOWA 3UACA 1AOZA 3T6WA 2P80A 3ZX1A 2IAAC 2EIJB 1BXAA 1IUZA 1N68A 4AZUA 2BP8A 4DPCX 1NIFA 1L9QA 1OCOB 5B1JC 2IWEA 1MDAA 2PP7A 4DP8X 3FU7B 3UAAA 4YVUA 2BW4A 3WG7B 3AG1B 1SHWA 2WO2B 1BYPA 3QJSB 1URIA 3DTUB 1AZUA 2EINB 5B7MA 5I6KA 4YSUA 4A2EA 3ERXA 3RYMA 2VMJA 2UXGA 1E65A 8PAZA 3OMIB 4Q8BA 1JXDA 4A66A 4A2DA 1ZV2A 2JFCA 1NWPA 2QDVA 1QNIA 4DP4X 2BZ7A 4KNUA 1JZIA 3TA4D 2GI0A 3SBRA 5PCYA 4F2EA 3IN2A 2IWFA 2H47C 1AZCA 4AI7A 2GC7C 3BQVA 1CURA 4BWUA 1J9SA 3H4FA 2VSKB 3OMNB 3BVDB 2UX6A 2XX0A 1JOIA 1NZRA 3PPSA 2EIMB 2J56A 1PLAA 3H56A 1DYZA 1AZBA 4E9VA 2HXAA 2OV0A 1PAZA 2WSDA 4BWWA 1SJMA 4UANA 3EF4A 1A65A 2RACA 4A2GA 2HX8A 2UX7A 1ET5A 3MBWB 3WKQA 2HRGA 5B7EA 3N55A 3FSZA 4A68A 2X87A 4KNSA 4YSEA 3DIVA 4CSPA 2TSAA 4G7SB 1ZPUA 9PCYA 2B3IA 2WO3B 4K9JA 3PAVA 1ETJA 1ID2A 4YSOA 2HX7A 5I28A 2J57A 2Y69B 3OMAB 2VM3A 2VSMB 2Y1AA 4Q89A 2XV3A 4PAZA 1OCZB 3FPYA 2J55A 5LDUA 3S3DB 1T5KA 2PPFA 5ANHA 1QLEB 4BXSV 1GSKA 1VLXA 2BHFA 4YSDA 3FU7A 3FU8A 1KBWA 3NJFA 1KYAA 1BQKA 1MZYA 4KO7A 1PF3A 3QJTB 1A4AA 4DP2X 4YSRA 1NPNA 1SFHA 2YAEA 1NPJA 4HAKA 1SHXA 4HHWA 1JZJA 2PPAA 2BWIA 4DP0X 1A4CA 1PCSA 2I7OA 4G7RB 4G72B 4YSTA 3ZDWA 1PMYA 3CG8A 1JXGA 1V54B 4PCYA 4YVNA 4HCGA 4AKQA 1ASPA 1PNCA 4W1TA 1J9TA 1ZIBA 3V9CA 1F56A 2VW6A 2YAQA 1E5ZA 2X88A 2HX9A 1IC0A 2H5UA 2HRHA 4E9XA 4E9WA 5I6OA 4HIPA 2BP8B 2UXTA 4E9SA 2PLTA 2H3XC 2FT7A 1BYOA 1NTDA 2FQFA 2YARA 3TBBA 5IY5B 4AKOA 4WKXA 2PCYA 3EHBB 5B1JA 4KOCA 3G5WA 4CSZA 4BK5C 2VN3A 1AAJA 1PZCA 3FQ2A 1RKRA 3U25A 1NINA 2YXWA 1WA1X 4EF3A 4DP5X 4HCFA 1A4BA 3NP4A 3QJRB 2J5WA 5TK2A 4GP5B 2GC4C 4GP4B 3NJHA 3C75A 1IKOP 2GB2A 3HEIB 7PCYA 1XB6A 2PPCA 3ABLB 4KNTA 3ABGA 1NWOA 2YQBA 1V55B 4HZ1A 5F7AA 4GY4A 4KO5A 2JKWA 3PAZA 1AS7A 4KO9A 4NB7A 3KW8A 2XYBA 5A7EA 1ILSA 1CC3A 3AG2B 1TEFA 3ASNB 2FT8A 3PLYA 2YAMA 3NJLA 3NSCA 3DKHA 2CUAA 3IN0A 3AZUA 2A3TA 2HLEB 4FA7B 1E30A 3QJUB 4N8UA 2VW4A 3FQYA 2N0MA 4GXFA 1OE1A 2YAPA 2BZCA 1FWXA 3WNIA 5I6NA 1GS7A 5TK4A 4YSPA 2QT6A 2Q5BA 1GW0A 2FNWA 2CALA 2XLLA 3T6VA 2B08A 4E9YA 3N2JA 1PZAA 3NJKA 3ABMB 1RZPA 3FT0A 3NP3A 3QPKA 4BDVA 4F2FA 3T6ZA 3CVDA 2PP8A 4L0PB 4JHUA 2W8CA 2NRDA 4JHVA 2IDTA 4DP1X 4G7QB 1JVOA 5I5JA 2GIMA 2GBAA 2JXMA 4G70B 3SQRA 3X1GA 2I85A 4DP9X 1I53A 1ASOA 1PLBA 2XX1A 2FJSA 1ILUA 1X9UA 5E9NA 1L9PA 4M3HA 4X4KA 3TU6A 3T9WA 3TASA 3SBQA 2PP9A 1XB8A 1IBYA 3JTBA 2UXVA 1W6LA 4HCIA 1MZZA 1BXVA 3AG4B 4E9TA 2AZUA 2QDWA 4TXVB 1L9OA 3D12B 4G71B 1BQRA 2W88A 3UABA 3QJVB 1L9TA 1X9RA 1OCCB 3CVCA 2I7SA 3GYRA 1WA0X 2IDFA 4AKPA 2DY2A 2MTAA 1SNRA 1ZIAA 4P5RA 1JZEA 1PNDA 3FYIB 1FA4A 1V10A 1NICA 2DWTA 2CCWA 2HZHA 2UXFA 1KCBA 1XMEB 1GR7A 1E67A 1N70A 3FU9A 3GXUB 3IE9A 3OM3B 1ZDQA 2P80D 1AZNA
chains in the Genus database with same CATH superfamily
4LVOC 3KS0H 3A0OA 1XGRA 4LSQH 3MXWH 5JW5B 3BKJL 4LLDB 3G5ZB 1MFCL 3K72B 3TA3C 1FYTD 2SEBA 5ID1A 2IALB 4PRDA 3QDJE 4NZRH 1NCOA 4J3XA 3DGGA 4NJ9L 1J0ZA 4WV1C 4OFVA 3QT2A 3S8FB 4CNIB 2AK4A 5LCVA 2EXTA 2D2OA 1XCQB 4MKMA 1JVLA 4WI6A 3TO4B 5HYSG 3H9SA 3T6QC 5JTWA 3BVVA 1ZD6A 4ZTOL 3HPJB 4IBWA 2X0UA 3GPEA 5K39A 2Z4QB 3VXRD 3ZYJA 4ODXB 3DX8A 3L9RB 4CN6A 1HAUA 3B9AA 1SXCA 2C7FA 1GAFL 4OLXH 3MROB 4A2HA 3B1UA 3MRMB 1N7MH 1KJVA 4PJXB 3RIAK 2MPVA 1D3CA 1JGDB 1NKGA 3UGEA 5KSBB 2R8SL 3O3BA 1HXMA 2DQIH 2R7EB 4Y19E 5E99L 5KVGE 3ALXA 3FS9A 3PNWB 2ESVA 3OJDB 3DV6B 4JPVH 2X41A 3LKPB 5FLUA 4XVSL 2XXGA 4PBDA 3VRIB 2VXUL 2PO6A 3NH7H 1MUJB 1FFPB 1ZLUK 1LO3H 1P4BH 3DJ9A 2EQDA 3H9HA 2VDQB 5CJOH 5EZIH 1LYQA 4ZMYA 3MQIA 4O02L 3BPNC 1FDLH 2ZX5A 1X5MA 2CHWA 1YEJH 2XBTA 5E2UL 1XF5B 3DIFB 3LEVH 1DTUA 5AZ2L 3ZTNL 5C7XL 1BLNB 5BOPA 3KYNA 1FAKT 4N2EA 5K9QG 3BPCB 4APQA 2QHLA 3TYGH 4NZUL 1I4FA 3MACH 1J5CA 1O9WA 1XGQA 2FGWH 2Z92A 2EDDA 1SN2A 3QDJD 5ENWB 4CU6A 3ECBA 2WHVA 4EVNA 4YC2C 1J8SA 1BIIB 1HCFX 1IGTA 2V6HA 3STBA 3X1BA 4QRRD 1ET8A 1KB5L 2D31B 5FYLL 2V9QA 3A4EA 5ECJE 5ABAA 1B9KA 1J1XH 2YLHA 4TLKA 4KQ4L 4ZUUB 3VYOA 3G5ZA 4BDVB 4X7SH 1EANA 5CIPA 4PRDB 3QORC 1QHPA 4XODA 5DK0B 5DR5H 5LGHH 4MA1C 3JWOC 4M61A 2AK1H 5D7IB 3ZYOA 5I1JL 1G7QA 2OMYA 1BZQK 4HGKC 4KX8A 1C16A 4D2NA 4UAHA 1AIZA 2HTKD 4O4YL 1XIWD 1U58B 2AQTA 2DLGA 2ICWI 3ROOA 1YC8A 3KNBA 4AUJA 3DA0A 3QZOA 3B5GA 2A74B 3C6LC 1MELA 5TE4H 4K15A 4MQ7B 3MGTB 1QSEA 2XN9B 3GMQA 5D2LE 4BGDA 1WQVT 1DUYB 2FEDC 2X44D 3V0WH 1RUAL 3PL6D 4WDIA 5FO9B 4FNQA 1JGUL 3I84A 4HF5L 3ZZ1A 2YD0A 5DZPA 1AKJB 1GJUA 2BIQA 4N2HA 3QNYA 4A7SA 1T2JA 2LR4A 5C0DA 3DWTA 5AZUA 4M43H 3OSVA 2CE6A 3UZVB 2D7NA 1IARB 1MW3A 4S1RH 4ZAKA 5FKAA 2XXCB 2FLRT 5DYFA 2DQCH 3ASWA 3LZPA 1MJ7H 4UU9A 2V3EA 1UA7A 3HB3B 2Y7NA 4D9RD 1VFMA 4JFDE 2ZD0A 3RZCA 1SOSA 1SLUA 4F3FA 4TNFA 4MBOA 2VRKA 2Y6TE 4WEBH 5B8CB 3VD7A 1TKWA 5HDRA 2AXGA 5F9DC 1N18A 4FZ8H 4OD3H 1AJ7H 2BCMA 4MMXB 4YHZL 3JTSA 5TQ0H 4XMVA 4JQXC 1X5AA 2LQRA 4X9GA 1H3PH 1HZHL 4JEGB 3P3TA 4NNXB 1ZOXA 1HEZB 2DLFL 5TDPB 4KO6A 4PJFF 3KDMB 2BVTA 4NKIL 5IEHA 5E8PA 1DQTA 2YSSA 1QD0A 3JVFC 1I1YB 1MG3C 3HNVH 4Z7IA 2FJGB 2VDNL 2VIRB 4MAYA 1BZ8A 3H6AA 3NEEA 4UT7H 2FZ3A 3BRGC 5T1MA 5H4YA 3LV3B 3QHZL 2EEAA 5EIIB 3O4LD 3F5WA 5IZ7A 2Y7SA 3HC4H 3MO1B 5IVXE 5SV3A 3ILQC 3ZPDA 4HQQL 4PIBA 3BWUF 2FATH 3P1VA 4GSQA 4LCUA 1Q38A 4N1CA 1KTDB 1Q0YL 4ZUWB 5A2CA 3MJ8B 1UT1A 1L9QA 1QSEB 1VFOA 3NFSH 3T0EA 3ZSTA 3VNZA 4LMQI 4WCYL 5DFVC 5EC2A 1MHCB 5EOTB 3WG7B 4FXKB 4ZZKA 4HLJA 1XMWA 4NNYA 1KCUL 5JHLA 3DTUB 3TZVC 2CO7B 5KYWA 4EIBA 3UTPD 1T03L 3ILDA 5T3XD 1GPOH 4QRPE 5KBNC 1WTLA 4KKAC 1JDDA 4DKDC 3U0TA 3ZL4H 3VXPB 3QIUD 5T1LB 1KB9K 1QBBA 3DXAA 3A67L 4HWNA 4N25A 4Q56A 5TGBA 5CP7B 2W60B 5GRVK 2L4OA 3DARA 2WBJB 2B9AA 5T3XL 4UT9L 5B38B 4X4ME 1KCSH 3ZDYB 5AYQA 4AQEB 1BM3L 1OAJA 4FFZL 4R8WH 4QO1B 3N42B 3VFRB 1JXJA 4QWWD 3SDCA 4XE5B 3BQUD 1NOAA 2IWFA 4D3CL 1TIUA 2N3JA 5HHOA 4WEUD 2AC0A 3AITA 5F0LB 5DC4B 3MLZL 1HSBB 4LSUL 4N2NA 1KPRB 2OYPA 5CEXB 3FT2A 1YEWA 3EIFA 4OZHA 1I8LC 2Q76B 4NIKB 1Z2KA 2X4RB 2Z91B 3GS7A 3QARA 5D9SB 3BSZL 5I5RA 3BVUA 3N9GL 4JY4A 3CIQA 4L8SB 1BJ1J 2CLVA 2ZCLH 3S48A 4AEIH 4XNMB 3IJSA 4RX4A 5CJ5A 3L5XH 4GO9A 4P99A 3SDAB 5A16A 1DDHA 1K8IB 4CSPA 3LQAH 4G7SB 3KCPB 5AVXB 3WFBH 2NW3B 1CZ8H 2F6AA 4K9JA 1KXTA 1CLVA 4RMWA 3WLWC 5DEGB 1SGKA 1T80A 2E75C 4JG1H 3VFGL 1U2HA 3D25A 1MCNA 2XZAH 1HDMA 4BM7A 1EJOH 1MVYA 1YJDC 1YMMA 4IU3A 2V2TA 3FO1A 5I1LA 4IU2B 3WIHH 3TZVA 4BXSV 4JO5A 5IK3B 3FL7A 3B9KA 3MRGA 3UFIA 1OTTD 5TDOA 3C5ZD 5EU4A 5I73B 2A4CA 1UCBL 3TO4A 3G5VA 3QDMA 3UTOA 3QJTB 4BKLB 2NYZA 2YFNA 1FNAA 4K71B 1ZLWH 1NPNA 3TXAA 4PHXA 2H32B 3GC3A 3LQZB 1VHPA 3QQNA 5FECA 2F68X 4LQFH 1CDBA 3F7YB 5KYUA 5JPMB 4HXBH 2OSWA 1C8QA 4G7RB 2IJ0C 4ZD3L 1JD9A 3B6SA 2FYYA 2QEJA 3QG7L 5LXGL 4Z7UB 1RLWA 3IDGB 2YK1H 2R2HB 3HN8A 2IXQA 1HJBC 5I16A 3V4PL 1FL3B 1LQBC 4S11A 4MXWH 2ORBH 5HVHC 3K2KA 3F6LA 2NX5D 1IC0A 1FORL 2H5UA 3VGEA 2YS4A 1AE6H 2KERA 4KUCD 4CVXB 5IBUB 4E9XA 1SPDA 4JO4L 2HT2C 1B88A 4FQ1H 1H3WM 1X7SA 1Q94B 4KMLB 5DWUL 4U05A 3VA6A 4BFRA 2YEZB 3TBBA 2E27L 5JXAH 1M7UA 4KPHL 4XVTL 1MAMH 3ARPA 1J8RA 1K4CA 1WCBB 2RB8A 2WZAA 1DBML 5C0AB 1ZGLB 3QWRD 3CFIC 1JDAA 3OHXC 5FYKD 2YXWA 4BGLA 4MMZC 1WA1X 5D9SA 1R3LA 4JRYB 5HGBA 1KYOJ 1E9QB 4PVMA 4I3GA 5I8EB 4UILH 5FUZL 1D5MB 5DDHA 3R0MA 4WU7B 1AD9B 1JRHL 1RJCA 3ABLB 4NQEE 2XICA 4AH2B 4MCYB 4NFBA 4C4UA 4Q58C 3SKMA 1LO0H 1ITBB 2PYED 3O81A 1IZJA 2AAAA 3THMH 5T33L 2OMWB 2MKLC 2YWZA 3RWJB 1YYCA 3KL5A 2X6MA 3D25B 5HXMA 3ARZA 4P49A 4ESKA 3JUYA 1N3NA 2YAMA 3EOAB 2ZTBA 4F27A 5GGVL 3RPIB 2GI7A 2UUDH 1AH1A 2O5ZH 1IRAY 1OTTC 2VW4A 4N8UA 4G8GB 3V10A 4RFEB 3MJ7A 2E9GA 5J12C 5EB9A 3QQDB 5HYSB 4LO9A 3SZ6A 4P2QE 1GCYA 4BRVA 2NOYA 4HH9A 5EWIH 5J5EA 1ZSDB 4XMPH 2A6IB 1MHEA 4C56B 2X9YA 2Y5QA 2Z64C 3ARSA 2F53D 5DD5L 5AWNL 4ZFGL 5I66B 2C7UA 3FUEA 3QZWG 5FGCE 3EYFB 1S9VA 2Y36L 3OB0H 2C9XA 2R29H 3ISWA 2V0AA 5CN3A 3HG1A 3SPIA 3SQRA 1RU9L 2X2YA 5IW3A 3GHEH 4PB9H 2HT2D 4OFKA 1DVZA 5I71C 3LN9A 4UDUA 3HPLA 4Y4KA 2GEEA 3VFTB 4PRPB 4J3WA 3VRLF 4Z7OB 3MJ9H 4L4VE 5C07A 2G9HA 2R2EB 1L9PA 2RALA 4IRSB 4YDNA 3SHSA 1U93A 4AUYA 4LPWA 5DZLA 4OIAA 4HPOL 3C60D 2E4TA 4HKBB 4H40A 4XNDA 2HT4C 5GJTH 1JNHA 1M7DA 3VI3F 4KKLD 1NCHA 2F8VA 4HS8L 5BVPL 1UD6A 3WHXA 2NY4B 4HWUA 1WFJA 5B38G 2J25A 3PWVB 4HZLB 3CPLB 2I07B 3K6OA 4O2FA 3U4BH 2BSSA 2D73A 3UC0H 3RWJA 1N8OE 3CZKA 7FABH 4E41A 5I0XA 4IDJH 1CGUA 5JUEH 1VCBC 4EDWL 2V17H 1E27B 2WM0A 4PCKA 1IGFL 4XP1H 4YAQB 3IDUA 5FGBA 4PTUB 2NNAB 3FOLA 5DGQA 1WZ1H 1DEDA 1K3IA 1PTZA 1W72B 4H2AA 3K6NA 3SDYL 2KDYA 3C6LD 1JYXA 4KHXL 4P0DA 4PV9A 4NQSA 5E4EC 4JKMA 2CK2A 3S3PA 3VGGA 1NL0L 4N0CC 3P9LB 1I85C 3TT1L 1J7VR 1LDPH 1JWSB 3C2AL 4CMHB 4X8CA 5DYOB 3WS3A 4BZ2H 4G8AC 1Z3GL 1JGLH 3L4WA 4LLUB 3OKDA 3OKOB 1A6UH 2ZZUT 1YEFL 4HJ1A 4WGVB 2Z1KA 3PL6B 3BJ91 4ZOAA 4OCWL 1CLOH 3VXOB 5CLWA 1JNLL 1HOCA 2OXHB 1IEBA 2XG5B 1TCMA 4JDVB 2F7PA 2D7TL 2OMTB 3FOMA 5FA4A 4GKSB 4KUZL 1MHPH 1S5IH 4M02A 1WAEA 2OW6A 5KSAA 1MIMH 3DX9A 4DP7X 1CFNB 1FO0H 5C08D 3NEOA 4L8BB 1A14H 1JHKL 2XKUA 5B1BB 3QO0A 4PW9A 3CJJA 4IBQA 2P24A 3EYSL 1QI3A 2RA1A 2NYYD 1MCHA 2VMEA 2WCSA 3NFPB 4QAMB 5CZRA 1JCKA 4QKXB 4GMTL 4KDWA 1GGBL 1J5OH 1YPZF 3TVMD 4P07A 3TOPA 5E0QA 2XQYA 3FUMA 4DCQB 3DX7B 3FO2B 4OFIA 3X1EA 1CDJA 3FPXA 4PJGA 1EVUA 2Z92B 3HBPA 3DIDA 2JJSA 4PV8A 4XMXA 4XN8A 3ZO0A 1MSPA 4GIPD 3JTTA 4HWZA 4L2YA 2KPNA 3L16A 2VL4A 1AY1L 3ARGB 5GGRY 4F92B 2WD0A 2XNAB 2IBGA 1SHMA 5HHOD 3IDYC 4HKXA 3KM1A 5SWQB 2HFFA 4JE4B 1MCIA 4Y1TA 1SMAA 3UIYA 3VXME 1NCTA 3GXIA 5F7NC 2ZUWA 4OM1H 5AUMB 5IMLA 3RL1A 2A9MH 3QQXA 1BAWA 3KDPB 3QIUB 3GSVA 2RIKA 3B2MA 1KC5L 3V52L 2EVJA 3HW7A 1QKZL 3FTSA 3OQRA 5AZEH 1MQKH 1RIUL 1Q9OB 5JIQA 1BREA 3NCJL 3TA3D 4W9KC 4QRSB 3BRDA 2J1WA 1YPZB 1DBKH 3OJVC 2J71A 4KTDL 5A6MA 1OCRB 4MMYB 3WO4B 4F9PC 5LUMA 1HQRB 2Z34A 3B37A 3BWUC 1NLBL 3HRPA 4KNQA 1X5IA 1PLCA 3LQMA 4OFQA 4PY7A 1NEZA 3NSYA 2AQPA 3FCSA 3QI9B 1CYWA 1OGSA 5T1LD 4P23B 5EPMB 3ZT6A 2ZXGA 5M7QA 1I8MA 5F9JA 4F7KA 4YNYB 1CBVL 3UTSE 1FG2B 3ZQ9A 3BO8A 4LHUA 5ISZA 3QXUA 1FZOB 2AKRA 3NPSC 1BVLA 5K9KB 3KLHD 4GW1A 3CFEA 2ZP9A 4DCQA 2QVKA 4Z7WF 2NUPA 1PLGL 4Z7WE 4Y5YA 1Q72L 5H35A 1RJLA 3BXNA 1MJ8H 4H8UA 3GXFA 4X6CF 3VI4E 4JZJB 2HTLC 3SODB 5AEAA 4WI0A 2VXSH 3HFFA 4X5WA 1X4ZA 3J27A 4AT6B 1OSZA 4CU8A 3MRCA 2VR3A 5HD8C 1XFPA 3NIGF 1L7IH 2XWZA 3H4HA 4WKZB 1FL5A 1SF3A 2AXJA 1CL7I 1INEH 4L9LA 4A7UA 3IDMA 4K2UH 4LVOB 3U0WL 3MREB 3PG2A 4ZMVA 2HJFB 4GUPA 3CHOA 1T66D 3HTLX 2HTKC 3ULSB 3T2QA 5JO5B 2LABA 1UZ6E 3NJNA 4OCRH 4XB7A 2JQZA 4FNTA 3K91A 5KVFH 3U2SB 3KPNB 1I8AA 2KYIA 5F3BA 3WN6A 3BKJH 2Q1EA 5SWZD 5JPMC 2GBUA 1ZXQA 3ES6B 2OCCB 2Y3AA 1EJ8A 2YMXH 3QJHA 4AGNA 4NJ9H 5CSBA 5CBEA 4RRPG 1OD9A 3CFUA 3MC0A 3QI9C 5DJAB 3BAYA 1EO7A 1NFIA 3EO9H 5TE7H 2OX5B 2PYEA 3MR9A 4IEFA 5IJDC 4B60A 4ZTOH 5AVUB 2JCCF 1UM4L 4N6RA 4IBUA 5IEKA 2JELL 1I8KA 2BNQE 3I6LE 1WD8A 3NN8A 4NXKA 4PD4J 4XWOC 3UACA 4XXDB 3WFZA 4LNRB 4BINA 1EPFA 5HDBB 2QSTA 5DF0A 3OKNA 2MNJB 4BQ6A 1NJ9B 1TTUA 4Y8AA 4E42A 4NBXB 4WWKA 2XN2A 2WXMA 2IEPA 2UZXA 2CIKB 2KDGA 2BSEA 4YE4L 4BFNA 1TZ8A 2DQIL 3IMUA 3O11A 3UJIL 5HYQA 2HRPL 3JYBA 1SVZA 3DHUA 4MA8H 4TKWA 5BO1L 3WENA 3IAQA 2WNGA 5JDSA 5D5ME 4Z0BH 5I1CH 2Y7QA 1FE8H 1YCSA 2IOIA 2VMJA 3BZ5A 3O0RL 4NCC1 4IS6B 5CJOL 3C60C 5EZIL 2VN4A 3PF2A 4L1TA 2OJEB 1SYVA 3U4EB 5A3IC 1HKLL 8PAZA 3N1MC 1VEMA 4Z7NE 2NLJA 3GMNB 4NS0A 2H4EA 3LEVL 1JK8A 4ZMNA 4DZBA 3V0EA 3X17A 4DP4X 4IIZA 5C0BD 3BEVA 4QRQB 2IANB 5HDQH 1QBLL 3L4YA 2FJUB 2E5EA 3L17A 1WHPA 5IGXL 2HFEA 5FWQA 3O6LL 1ZWIB 3OKKB 4MNGE 2BSSB 3REVA 4P4KD 2I5YL 3I2CL 3EO1B 1PLAA 5D6CB 5LKNA 5CZKA 4LEXH 5FYLH 1MKFA 5FV1L 2CO4A 2P8LB 1JHLL 2J44A 4PW4A 2ARJB 3KBPA 3VXSE 4DESA 3ES6A 3PHOA 3MI6A 3GT6A 1GHFH 3RURA 3RX7A 4BCZA 3RIKA 3INOA 4X0KA 1U8HB 1U8QA 3TZVB 2KLRA 4MXQD 4N8VG 1D5IL 1SUHA 3BUYA 3LKQA 3TFKC 2B3IA 1T0NA 3PDDA 3ET9F 3WMSA 2XQYK 5ESQB 1BW8A 2HX7A 3DX4A 4PJ8C 5HGDB 1K72A 3DHJA 2TRYA 4G43A 2UVFA 2NY2C 1YNLH 5AL0A 5C9JA 2BC4A 3KL0A 3DO7B 1XTMA 4G8GD 2OYMA 1M6OB 1JRHI 1YZZA 4M7KL 1I9EA 3V0WL 2NW2A 1RUAH 4OIIL 2ESVB 3OJDA 2D3NA 2FD6H 4HF5H 5E8OA 1G4MA 3VD0A 4JS7A 4W81A 4DN4L 3HUJF 2HVBA 5HGHB 4TOYL 1YAZA 4WVRA 4R4BB 1K5NA 3VB9A 2DM4A 4LAQL 1CLZL 2W95A 3MLVH 4O00A 4JFQA 2D2CC 1AP2B 1G0DA 4UQ3B 5DK2B 1ZLUH 1SFHA 4FFVD 4OZGB 1DO5A 2Y7OA 3G04A 4LGSB 3SBWA 1BQHG 3VRLE 3QR2A 4MCNA 2P7TB 5E00B 2JKXA 4ANKA 4CDHA 1PCSA 5C6TL 2GJ6A 1I4FB 4G72B 1VZHA 1OLZA 4J6RL 4JFOA 3C5XA 3CG8A 2C9UA 1KLGA 4M00A 1KIUA 4B3EA 2KUTA 1QLRB 5D6DC 5F88B 3EDDA 4W9DC 2RQEA 1VADB 3FQRA 4ALAC 3EXJA 1X5HA 2Q3AA 4HC1H 1FGNH 3HS0B 5I6OA 2VTFA 2GSIB 5INDA 3S35X 3MRRB 4ODWA 1H6UA 2NY1C 43CAB 4ZW8A 1Z5HA 3ETBF 1XZWA 3EO1A 4WKXA 4DKEL 3RVVD 3V4VA 1HIMH 2DLHA 3WDHA 4XHJC 2IG2H 1Y6NR 3W9EA 5E23A 3G6JB 3WFCH 1VFBB 1T04B 4GRWE 3WD5L 2Q8AL 1BQSA 1MQ8A 2D7QA 5D71H 3DLQR 1HE8A 3GBNH 4Q7DA 1JGEB 4KZDH 1A7PL 4QOKB 5DVOA 1A0QH 1N2RB 1O6SA 3FONB 5K5YA 1NWOA 3ZT5A 1QUNA 4PJDB 1LEIA 4HQQH 3MO1A 3BCFA 2OFQA 2P5EA 3SKNA 1ZANL 3JWNC 2FIKB 2ICWB 3T5WA 1SM3H 3C6LB 4OR1A 4UM8B 4R7DA 4MNGA 1YNTA 3L3DA 3KXFD 4TUOB 2XY2A 4YWGH 3UERA 5IFAL 4PJ9B 1XO8A 5MEOB 2FE0A 3PLYA 1UWEL 1E6JH 5H94A 5GZOD 4LL1A 3HR5A 3Q6FB 2XG4A 1HS6A 3M7FB 1CTNA 5EOCH 5EUOF 1ORSB 3C9NA 4G7YL 4JM2C 5EU5A 3OZLA 2QJDA 4TNVF 3BP6B 3HHRB 2YR3A 1XIWB 3LN4B 2JKIS 5CCKL 3QDGD 2QT6A 4YSPA 4OSUH 5AL8A 3LEXA 5T3XH 4LASH 2R83A 5EO9B 3JZ7A 4Q9RL 3OZ9L 1NCJA 3L4XA 5HHQA 2X6VA 3KPSE 2LFGA 4Y9BA 4ZFOB 4FZEH 5FF6B 5FK9A 3NIFF 4KQ0A 4WNQA 2JK5A 1U95A 4U0RC 5C0NC 1MCEA 5I2IB 4GG6B 4TVPH 1IC5H 3MODL 5JNYB 3QEQB 1EEQA 4JHUA 4P2RA 3W2DL 2ICEB 2MQCA 3FU5A 3RIAF 1KIRA 3OXRA 3QRLA 2GJZA 1FFOA 2LVEA 3UDWA 2I85A 4GBXC 1FNFA 3QEHA 4JZJA 3DK0A 3VCLA 5JW4N 1XGQB 2PN5A 4PD4K 5DJ0B 1NGZB 4LCCA 3CN1A 3BSZH 3OLDA 4JRXB 2A9NH 1VGEL 5KBMA 4HS6A 3RWGA 4LPVA 1XDTT 2WMPB 4W6YB 2DWEB 2IQ9H 1OZTG 1RUQH 1UOKA 1XB8A 4WFGD 5EC1A 3V6ZB 2EYSA 2P48B 1A7RH 2FH8A 5A16B 1OAZL 3K2UH 4RMBA 1ZTXE 3HRZA 4POYA 4YQXL 4PJHE 1JPSH 1NEUA 2BNRA 4GW4B 2EDQA 4J4PD 1TZGL 4CN4A 4YDJB 3VFGH 2A9DA 1RIVH 5E03A 4AJ0A 5CKAA 3WY4A 1Z0MA 3MBED 4ZW7A 3EFOB 1H3UA 4I3SL 3SKNB 4PJHB 2EO7A 5A2IH 5T5NG 3WIHL 1YMMB 2VUKA 2V2TB 3N06B 4GAFB 5JIPA 2I7SA 1XTLA 1LD9B 3TPUB 4N3TA 4L23A 4G59C 4XBPB 1H6FA 3V6OE 4P23D 1SNRA 3QULA 3UTZA 3X14A 3BVNA 1UUNA 4AYSA 2GK2A 1GH7A 2XWJA 4MD4A 2WBJA 2ZJSL 5FYJE 5B38A 4BFEA 3D4CA 3VFVA 4HETA 2FX7L 4IQHA 1LWRA 5FO8B 5EBLA 3K6SA 3M86A 3RVUC 3S4SA 3TA3B 1SYSB 2PCFB 3NAAL 4KK5D 4ZS7H 5B39G 1RSFA 5F3FA 5AYTA 3T3MF 5F93C 3NRQA 4B9KC 3MV01 1GZPA 3PGDB 3MFFA 3GZQA 3ARDB 3KW7A 3QC6X 3UX9B 3QC5X 3T6XA 1II4E 3QPXH 4BZ1A 1QRKA 2A9AA 2EEXA 1P0SE 1SDDA 3NA9H 1CUOA 4UNIA 1TQTA 1TEGA 2Z1PA 3SBPA 1AO7B 2EO9A 1F4WH 2HWZH 4D0CA 5GRJL 4UIKH 3VSUA 1L9SA 1P5UC 2WQAA 5D96C 2HKFL 1N67A 4XTRD 4XVTH 3VD1A 4HU2A 3FH5A 3QNFA 1E4WH 1J1PH 1B3JA 1KEML 2YD7A 3GMNA 3WJLC 1EHKB 2PTUA 3A6CL 1U3HA 4PJGB 2KL6A 4FLOA 1NGZA 2J88H 4G7VL 2QQNH 2R0ZH 1WLHA 1PG7W 1RZIB 1I82A 5FUZH 3O9WB 4CBPA 1QWUA 2BHUA 1YMHA 1KLUB 1CTMA 5F7BA 5L8KB 1E5YA 3TBYA 5IEHB 4HSQA 3VD2A 3OKKA 5D1ZB 4YL4A 1BF5A 3BH9A 5C9KA 1EERB 5D6CA 3THML 4BH8B 5IROC 5GGQL 4A04A 2FO4B 2XBDA 1SEBB 1WAAA 4JPKL 4ZXBC 5TQ2H 4F1SA 1MWAB 2Z31A 1JN6A 1IM9D 3VXMA 4BFIA 4BKTC 5I75C 3T3MB 4PJHA 5JHLL 1YEGL 3RVXD 4U1LB 1ONQB 1W15A 2VXTL 5IHLB 2P5WB 4IJTA 1OQOA 5GGSA 3HAEG 4P48A 4H8QA 4JAMA 4TL5A 1CG9A 5J56B 4ZUWA 3TV3L 3WIIL 4H0LC 1NIDA 1W9XA 4WFHE 4XNQA 4Y5VB 3QUXC 4YHPB 1IAII 3PAUA 1DQML 1N8ZA 1E4XL 1OARL 4AQAA 4R2GC 3ZKNC 4XWGL 4ZYKA 3DMMA 2C3VB 2DQHH 1INDH 4EXPX 4K23L 1MRFL 1CE1H 3A24A 4JGUA 4OD1L 3RBSA 4NGHL 3EH4B 2FBRA 1U8JA 1IBZA 2J6EA 3MV7E 1XCXA 3R7RA 3U30C 3MUGB 3IDNB 3RUGF 4L3CB 4MMXA 4RGMB 1MCPL 5HI5D 1HCVA 4P5TC 3U2IA 3GSUB 3D0VA 1AHWB 1KBGH 2ZXWB 1PCXA 3P3UA 1S7RA 4ZK8A 4TPRL 5GRXG 4XBMA 5EU6D 4ZUVB 2DYSB 5BUAA 4Y9CA 4PYHA 3OAWA 2C34A 3LRHA 3MJ9L 2JTDA 1WFUA 2G3XA 4PJCB 3HI1A 4IKKA 5FR3A 3O9WC 3T08A 4U1JB 4HPOH 4U2YA 2J8UB 1Q9WA 3QXAA 2NY3D 4MQTB 2LVCA 3IFNH 3DRTB 5B7FA 2GSIA 3TBYB 1A6PA 1LWHA 3DDFA 3AB0C 2IAND 4I89A 4R5VA 3HZKB 3KYOB 3FQWA 4NFDA 5EZLB 4O2FB 3SKOA 3TEUA 2H2SC 5ENWA 6FABH 1MNUH 3T2NH 5LBVA 3IPEA 3QSKB 3L4UA 3FT3B 2VZVA 4EI5C 3ALPA 1IGTB 3BFOA 3MSPA 2CUIA 2DICA 3QXDA 5C0EA 2V17L 5L8JB 1R5IA 1BVNP 1TZAA 3KPNA 2JKSA 3U79A 1UWXH 3MRHB 3ARDC 1NBCA 5KYWB 4FI7A 3VXSB 5AOKA 1CVSC 2OTWB 1TU2B 4M8UA 5JIKA 3BKCH 5CBEB 3VVVA 4L0YA 5MHSD 1MG2C 4IK7A 3KYNB 1RURH 1SOKA 2DL2A 3MYZA 5GPRA 4HDIA 5G55A 2WQXA 3P2DA 3C2SA 1KBPA 4BH7A 5C6PB 4CVUA 5J1SC 1XL4A 3CXDL 3OGCA 2F5AL 3B4NA 4EMZA 1C5DA 4F9LA 4FX5A 4ONGL 4PSRA 4ZTEA 2J3SA 3NJJA 1QOKA 3RX9A 2YAHA 4KJQC 5A2AA 4E41B 1IGMH 1H6TA 2IANE 4Z7QE 3GLAA 1YEFH 5G2NA 2Q86A 4NERA 2A83B 2V5SA 2XV2A 4WY7L 1I1AC 2X4SB 3P0GB 3Q3GA 3IE4A 4OCWH 5EV7A 3ULUF 3VH8G 4ZMXA 3VQLA 1H8LA 5B4MC 2TSBA 2CDEB 4MAUL 3IS0X 4JPSA 3U7WH 2XXFA 3OB8A 2A9CA 2UUDK 4MD0B 1WH0A 3WEMA 4UT6A 4G80B 5IROA 2AJSH 4OD2A 3T8VA 4ATTA 1IEAB 2JV6A 2UWEE 4FNRA 4DW2L 1A14L 1N68A 1CFTB 1XD1A 2FX9L 2XC8A 3BPCA 1FGVH 5KVEL 1C1EL 1G6RB 2KS0A 5HYFA 1H0DA 3KM2A 4PY8J 1M7IB 5F8QC 4DP8X 3FU7B 5BZWB 1GGBH 2M26A 3VD9A 4WENB 4DZBB 4CRPA 4EIGB 3SE3C 4HIXH 1UFUA 1EWHA 2FJHB 4F3FB 1WT5A 2LW3A 1G9NH 4G1MA 4YSUA 5C86A 5IF0B 1DDTA 4MA7L 4TVUA 4AZ8B 1RHHA 2BNQB 4JFFE 4JCWA 2HFEB 1QFWH 2W07A 4R4FL 1BZEA 4LCYB 2DTSA 1IX2A 4U1GB 1F1DA 2VUYA 4L8CA 1T0MA 4A2DA 2ODHA 4MMZA 1ZV2A 2YPLB 2X6BA 3HNTL 5HGAB 3TBWB 4L29B 1IAIH 3TA4D 3WFDL 2DN7A 5HVFB 1PZSA 4L37A 2APSA 4ZUSB 4WFHD 3MRHA 4MS8C 5I6XC 1CJYA 3G3LA 4ODSH 3VNYA 4E5XB 2VSKB 4YHLH 2FBJH 3OKEB 1E2ZA 3P0VH 3BZ4A 4NXSA 1IB5A 4P2CG 3O45B 3RVTD 3RUGE 1R19A 4QRAA 3RPIA 4ZX4A 3DX7A 2AGJL 2OV0A 2VQ1B 3O2VL 3CLFL 1KC5H 4PJFA 4LCUB 3ZZSA 1UD3A 1RIUH 4H8WC 5F1KC 3GMRB 4G8EB 4ZMZA 4PCTA 2YMTA 4RDQG 4AMKH 2X87A 4EE2A 3FRUA 3HI6H 1P4IL 2BNRD 3KXFB 3BWAA 3QH3B 4GEJA 4FYTA 4J4PA 4Q6YA 4BA0A 4NAQA 4CKVX 3EYQD 5D4QA 1F8TH 1GXEA 1I9JL 1GC1H 2ADFH 4UU9B 4GG8B 1ID5I 4YSOA 3ETTA 1AZVA 5I28A 3QQ3A 1E5UI 4Q89A 3TWCH 5D5MA 2J4WH 3FPYA 3GMLB 1BVOA 4OY9A 3ZUNC 3O4OC 4PR5B 5EIVA 2E7HA 4ZW5A 1A7BA 5HHMB 1NFDE 2BHFA 4KXDA 3NUKA 3GSQB 4OI7A 1JPFA 3SDAC 5GS1C 3WEAA 1MWAH 2F7IA 3FFDB 4LHUG 3TEXA 3VQMA 3AQDA 2VR7A 3MLWL 2NUPB 3HG5A 4I0PD 4HHWA 3VWJA 2PPAA 3DO4A 5DEJA 2W07B 5HHPB 5IHUH 3SQBA 1YPZE 3K6IA 3LOWA 2X42A 3ML8A 3W39A 1KYOK 4TSBH 4Q9QL 1PMYA 3ULUH 2BVQA 1DQQA 1A1NA 2DW5A 3Q6GH 4OGXL 2K6WA 3ECVA 1CD1A 4HBQA 5EBWA 4HKJB 1X5ZA 4UV7H 4XPGL 4K2UL 3U0WH 1U92B 4FLRA 2PXYB 2QQLL 4TUKH 2BXZA 4M9OA 3VU2A 5IKCA 5C0FA 5I30L 3L95A 5LGYA 1PZ3A 3BO8B 5JXEA 4JFED 3OKEA 3VXMB 1NTDA 1U3HD 5IY5B 3ARQA 3LIZH 4LOFA 4UOZA 1Z5LA 1PW3A 2AABL 2YN5A 4JM2A 3KJ6L 4QRSA 5LVEA 4NQSB 5F71A 3DTXA 4GSUA 4N9GB 4I1RA 1H15B 1CD9B 4HUKB 2V9RA 3N3EA 1KLFA 3QBTB 3P9MA 4EOWH 1BWWA 2J5WA 3FRPA 1BXXA 1HH9A 5IW6A 1YMMD 3EO9L 3FCBA 1NCBL 1E50A 3MA9H 2B1OA 4H0GA 3BAEH 4JO8A 5JHAA 4L5FE 4N2CA 3UPRB 3DECA 2BJML 5JHDB 1I1CA 1V55B 4M7LL 3FO9B 3CH1B 3VI4A 1A6WL 4EAEA 1CR9L 2WINA 4JFEE 2H26A 4APXA 2XYBA 1F86A 3BP5A 1RI8A 4PJ7F 2M8XA 3S8WA 5DXWA 4YE4H 5FOBB 2Y6SC 2XTJD 1M7DB 5EF0A 4DKFL 3BZFB 1HN1A 2NY6D 3TIDA 5CEXA 4U3XA 1AHWA 3FFCB 3QJUB 43C9A 1OTUD 2V2XB 3CZFA 2QQKL 3GSWB 5I1HH 1F13A 5D1ZD 5GS0H 2FHCA 2R2BA 1PX4A 4MS6A 4ODHH 3CSPA 1KUMA 1IBGH 3RI5F 4EN3C 3KHOA 1I8LA 1KELH 2CM5A 5HHPA 2CALA 5EA0H 4KVCL 3QDGE 2F08A 1IM9B 4G9DA 5SWSB 1RZFH 4XN7A 4ZPTA 4D9RE 4DIXA 1ECZA 1TO5A 2X6AA 4OBRA 4M6OH 1KGCE 2VZSA 1ROCA 3BLBA 4J6IA 2VAAB 4UI2A 3ZDZF 2PP8A 1I31A 4FMVA 4G6JL 4H8HA 3FB5B 4NC1C 1YYLL 4UBDD 4MRCA 2EVGA 4Q9CA 3UROR 2W8CA 3EUDA 3SDCC 1ZWIA 4S1DC 5C0FB 5JA8B 1OKEA 4N0CD 1BVNT 1J11A 5TH2B 1GRWA 5AW7B 3FDWA 3PIQA 1OGAA 1H19A 4X6DA 3LPGA 4YDJA 1ZV5A 1JV5B 2IDCA 4QEGA 5BRZD 1XVSA 4Y5XB 2ZOKB 3G5VB 3UBFA 3UZQB 3INUH 3W0WD 4OCXH 5FM4A 5LB1A 3FTGA 3IDIA 4XBEL 3VXOA 1KPVB 3EJJX 3AWGA 1HQ4A 3SY0B 5CGBA 2X2UA 4LLWA 5LGJA 2PR9A 3TWYA 4Z23A 3IJYA 2CKBB 2PW1A 3QUZA 4Y9GA 2COVD 1J8KA 2QPUA 5DD6A 4OIIH 3HVNA 2Y06L 3GM0A 5J13B 4YBQD 5F1IA 1XF2A 4PJXF 3GYRA 3P4NB 2EYRB 4H8WH 1F02I 5C70A 1WA0X 4X6BA 4PP2B 2DQFB 2WOBA 2HFGH 3UJTL 3WTYA 2MTAA 2B20A 4RNRB 5KVDE 1CLZH 5T1KD 4L4VB 3BZFA 3SOTA 3A4AA 1NBVL 2IPTH 3V4LA 3IDJA 1YUKB 3EJZD 4P9MH 2DWTA 2F53A 2VMFA 4KKZA 1K6QL 2JB6B 1DEEB 2HJLB 4ZUTB 3H6JA 1MJUH 1R3JB 2A73B 2WIMA 3GXUB 3CDGB 4RETB 5LQBH 5ISZB 2P80D 4Y1AD 2R23A 4RISL 1CICC 1PZBA 5K9OB 2OL3B 3VFNB 3CFBB 5CXPA 4KAQL 3BD5A 2GTZB 3I9AA 2H6PA 5F6HJ 3EJYC 3EGSA 4C56E 4Z7VE 4A38A 2G9HB 4IRSA 3TX4A 3O4OB 1OP5K 5DURD 1RZIA 3GTNA 4CW1A 2MNWA 4JMNA 3TNMA 1IAKB 1BQHB 1KLUA 2NY3B 5E5LA 5I74C 4RBPH 4LARL 1I8IB 1QPPA 1EA9C 2YBRB 3IXAA 2WNWA 3B3IA 4HUXB 1A7NL 2YAFA 1MCLA 3OKYA 1RERA 3V0AC 2CAKA 3V4VB 4G8GE 4TTDD 5E9DD 3NCWA 1O9VA 3VGAC 2YPLA 1BZ9B 3OHXB 1NKOA 1BD2E 4NUGH 2YD4A 2Y2WA 4UTAA 1A3QA 4L37B 2X10A 3CX5J 3LN5B 3N1FC 2XA8H 4N2BA 1O6TA 5TJWK 4AMWA 1LP9B 1LJMA 3BSGA 1B6DA 2P28B 3S5LA 5C9JB 4E41D 1ONQA 1Z9SA 5LBSA 1MFEH 1A0QL 1VADA 4Y4HD 1G7PB 3F7RA 2NNAA 2XFXA 1NIBA 5A7BA 4WZ9A 4AQ8A 4NDMA 1M9WA 3VXSD 2QGCA 1PY0A 5ITBL 3DPDA 3JWOH 4HBCH 1IC7H 3GSNH 1HNFA 4FS0A 4NQEB 5MHSE 3MRMA 1TJIL 3UMTA 1BG1A 2I07A 3WDIA 5IBLC 2HG5A 3CC5A 4L1BA 2ITCB 1ZLVK 1OXYA 2WIIA 3OPZL 4NRZB 1OGPA 4LRIC 3CSYB 5CEZE 3QDAA 3EYUL 4XP9L 2CRZA 1RUKH 1KLGB 1THCA 1BOGA 4ANWA 5CCKH 4UQDA 2QHRH 2WZ5A 3ZHFA 4OSUL 5BS0E 2DBLL 2R2EA 3B7YA 2JI1A 2GJPA 1LEGB 1JFQH 4Q9RH 2J2ZB 3MRDA 3OPUA 4J3UA 1ZJAA 2UWEA 2VM4A 5HHQB 4J3OF 3A6BH 4UDTB 3VYNA 2GSGA 1S46A 2BCKB 2CDGB 4PJ5E 3D52A 1F41A 3SPVB 4FAAB 3VXTA 1RZ8B 3WKML 4F8NA 3QHFH 2XWTA 1VRSA 2BS8A 3HB3D 4HCRH 3BVWA 4QHUA 5EFIB 5GRVL 2PPDA 3QRGL 4DAGL 3N40F 5KBDA 3QEGH 3VCLB 5H37A 3ARBD 2O6PA 1IKNC 2H6OA 2A9NL 3W57A 4LCCB 3TFBA 3JTTB 4HWZB 3WHE0 2BNQD 3I6LD 3LZRA 3KWUA 2R0WH 1Z9LA 3A47A 3ARGA 1E4KC 1NGWA 3NJGA 2CKNA 3KPRE 4BSWB 1R5IB 1XH0A 1OAZH 2CR0A 3K2UL 1OAYL 3MBXH 1U95B 3H3PH 3LRKA 1BEYH 2BNRB 2DKUA 1AANA 1NFAA 1PZUB 1Z9OA 1QW9A 2GIXA 4X6CE 4MJJA 2XV0A 3VACA 4Z5RA 4MCMA 4NZJA 4OLWH 2Q3ZA 3DUSB 3MOAH 1Q4NX 1ZKAA 2VLJD 5D4HA 1ACZA 2CWRA 5E2VL 1DJIA 1KCRH 5DEFB 2MTPA 3I75B 1XIWA 3LN4A 1HOCB 1HWWA 4IOFD 1IEBB 3SYQA 2MNUA 2WKOA 3QIWA 1CGVA 1LO2H 2VWEE 3B2PA 4S1SH 3WXWH 4ZO9A 1QSED 3SDDB 2Y5EA 1H6EA 1P84J 2PW2A 5KYYA 1JHTB 2IDSA 1SYVB 3U4EA 4L3AA 4AM0A 2WLNA 5DUPL 4XCNA 1R46A 3ZDYF 2J72A 4DK3A 1GMIA 1NPUA 4NKDB 4OCSH 1FZJA 4G9FD 2NPLX 3X2QB 3QFDA 4NNPH 3TIDB 2ZOLA 3N43F 4IBZA 2VDMB 4JY6A 4ADJA 4ENEC 4F91B 1RPKA 2EE9A 1EXHA 5DMGD 2F1BA 3NBNA 3QIBC 2EDWA 5JMRA 1E4WL 5IMKB 1URZA 3JWDH 4NQDE 3SCMC 1J87A 1GGYA 1U3HB 2J88L 5JPNC 2QQNL 4HJ0D 2D9QB 2WXNA 2O5NA 4ODWB 3HE7C 2ILLA 3DV4B 1UJ3C 1KN4L 4WI0B 3WO3B 3K1KC 4M8QA 1WVZA 2VABA 5F1OB 2H8PB 5FYKL 1X5FA 2CDFB 4KRLB 2VQUA 5DVMA 4LDOB 2O6FA 4KZ0A 3FUJA 5C0CA 1D9KA 3AU0A 4GKNA 4JB9H 4MXVE 1LMKA 2W0FB 5JHDD 1NGXB 4PJ8A 4UQCA 4YMPA 5AKTA 2X2IA 3ARFC 4CKQA 4A66A 2NNRA 4QXGL 1MY5A 3O4LA 5FO8A 1J88A 1MFAH 5DT1H 3VGAB 1RSYA 4DFIA 3LZQA 1NBQA 3TV3H 2WPGA 4BJLA 1AP2A 2YN3A 1XCTA 2I25N 4BFGA 1GZPB 4M7ZB 2YGNA 4Y2OB 2XVGA 2AQ2A 3T0ED 2CCVA 2X4NA 2BVPB 3FFCD 2G75A 4M5ZH 1B4LA 5LNEA 2MCPL 2K45A 1AZBA 4E9VA 4ZQTA 2HXAA 3EGXB 1A4KB 2XWCA 4Z7UF 5J11C 1DVSA 1AO7A 4NOFA 2DQJL 4AQ1A 5IHBA 2EEBA 2Y22A 4FEMA 3D18B 2X4QB 3IKCB 3B2VL 1EAOA 2Q2LA 4J2QA 1D7DA 1QBML 3L7FB 3LEYH 4MJIE 1BVLB 4NO2A 4DERA 4NQDD 4R26H 2F61A 2AQRA 3QJZA 4JFDB 3FSZA 4KK8C 4E5XG 4CJ0A 1L0XA 2OR7A 2VQ4A 3DUUA 2CO6B 4V1DA 3FHAA 4JE0A 1P9MC 3QAQA 4DO4A 3QUZD 2EDXA 4P3CH 1N0LA 3K5RA 3PAVA 3PABB 1PKQB 4YX2L 2EJ1A 4FFZA 2B14A 2NXYD 4JPIB 4PJEA 1AIFA 3UBXG 3W1ZA 2Y7MA 3BESR 2XV3A 1S5HB 2CIIA 4N2DA 1EEZB 3GHBH 4IGBD 1NUDA 2B1AL 3F64A 3S88H 4FQXD 4KDVA 4G5ZL 2HLFD 2PPFA 2BRRH 4M6MH 5IJKC 1KENL 3IFNL 1CU4H 3WS6C 4WSGA 3QYCA 3N1PC 2XN9E 2CDFA 4IRJB 5C0BA 1JF1B 4UM9B 1A66A 2ZSWA 2CCLA 3LYRA 1IAIM 2YMOA 4AVJA 1CFMA 5IKCB 4MWFB 5B39A 5EC1B 3T2NL 4LLMA 5BNXD 4TL4A 3HZ3A 2EDHA 3CZEA 5IB2B 4ZUVA 3HE6A 2HKHH 4X5PA 4B27A 4W9JC 3B9KB 4IBSA 4IKIA 2X12A 4PYGA 3TP4A 2B0SH 3HIZA 4XPHL 3ZE1F 3L3JB 2HX9A 2W0LA 4U6XB 5H37H 4DQAA 4P2OD 3SPGA 2JKLA 3WN5A 2PWFA 3OKNB 4LB8A 4PWKA 1BAFH 3AREC 4FABH 1IGYB 4YLQT 2K3TA 1W8OA 4FLQA 1ADQL 3BPOC 2JB5L 2LAGB 5JPNA 1I7TB 3D3VB 4NZDA 1IGML 3U25A 3DDGA 3WFHA 2MKWA 3CN4A 2CHZA 2X9WA 3LB6C 1L3WA 2ZP8A 3S37L 3DPBB 3JVGA 1GAFH 4EN3B 1CIDA 5E8NB 3VB8A 3RQ3A 1NQBA 3HEIB 5HDBF 1BOYA 2FK9A 3SKUD 1G7IB 4YDMA 1W91A 3U7WL 4TSCL 3X12B 3ULVH 4YHIB 4GBXB 4XI5C 3MRNB 1ZGLA 4P5TA 1UH2A 4YIQB 1Q9LA 2AJUH 1A6TA 4YE0A 1HYSC 1BCIA 5GGRA 5E6UB 4L0ZA 3VMNA 2VXQL 2WK2A 5A7EA 2HJKB 4O02H 1FDLL 3SDXE 1QFUH 1YEJL 4P2AA 1CICB 2FT8A 3LXAA 5DQJB 5E2UH 3VFSA 1QUPA 1FL6B 3FTUA 3ZTNH 4Y16C 5C7XH 5DJCA 2R0KH 1F11A 3MJWA 5BMFL 3EHBD 1TLKA 4QHUB 5EFIA 4M6AA 4XT1C 2X38A 2D3LA 4YHYC 3GB7B 5IUCA 2FGWL 2VITB 3ZKXB 4R7NA 5EU6B 5TK4A 3QUXA 1U3JA 4MWFA 1JNNL 4QJ5B 3VM7A 1I1AA 1L0QA 4S0SD 1TQSA 2ZKWA 1EEYB 1H9DA 1PPIA 5E00A 3H3BC 1SJHA 2GITB 4X6FB 3WNOA 1MFBL 3QPKA 4J3OD 1J0IA 3UAJD 1T0NB 3G6JA 3HHSA 1M2VB 1M7IA 4ORZC 2QADB 1EFXA 3PWPD 2NY0B 1J8HA 5EG6C 5K39B 4G7QB 1JVOA 2J5LC 4ZPVB 3UAFA 3BCDA 3VMPA 4O4YH 1AQDA 3F00A 4Y4HB 4ECNA 3AXLB 4AL8C 3Q3GB 3E0GA 3RTLA 1IC1A 4FQCL 4ONOA 3RTQD 4FQJH 4FHBD 4HEPG 4BZ2A 1U8NB 1VAHA 1XGTB 4NRXA 4WW2F 4A39A 5L4IA 1P2CB 3HI6L 2L04A 4G6FD 1IEAA 5EEXA 2ZKHH 4JFFD 1L6XA 5EBMB 2UXVA 1CIUA 1WWAX 3WJLA 1I9JH 3VTAA 1FAIH 3H1ZA 5K1JA 3ZKMD 1DSYA 4N2OA 4OAWB 4CU7A 4PRPA 4NO0A 4UMSA 2VMDA 3GTVA 2G5BB 3SPHA 1XF5A 2F53B 4QCIA 3UBXB 3D12B 4I2XB 3CCHB 5T5FH 1S7RB 5CEYB 1J1OL 4HUUB 2DQCL 1MJ7L 1KZYA 3QQ9C 4OU3A 3UBHA 1TTFA 4NKMB 4A37A 4AG4H 3D85A 4Y4KD 2OMUA 1BVZA 4Z95H 3U9WA 2Z0UA 1V05A 1OB0A 5TF1L 2UXFA 4OTXH 4XRCA 5CKGA 3DX1A 2GJZB 1BQHA 5TQ0L 1EZSA 2E9JA 1VLXA 1QRNB 1XGZA 2CQVA 3V6FA 3JXAA 5HYEA 1TTRA 3IXAB 3OSKA 1G7HB 1YJDH 3ULUL 2NQ3A 4HLEA 3Q6GL 4F7PB 4ZQKA 2VWEC 5FFLA 1L6PA 2VRQA 5CEZH 2CUHA 3FJTA 3TPKA 4RIRA 1N2RA 1O6SB 3FT3A 4BUHA 1XGYL 3KGTA 2QQLH 2VDNH 4LPTA 4PV9B 4OVUA 4WAFA 2OR9H 1W80A 2BP0B 3DYMA 5JDJA 3MMEA 3NABH 4U1NA 3RFZC 4GRMA 3QHZH 2WQ8A 4DFHA 3O8XB 2JXMB 4GRLC 4KROC 1OM3L 3SPCA 1IFGA 5JLZA 4IW4C 1ZS8B 3DX6A 4Q0XL 3LRSA 1WRFA 3L3KB 1G6VK 2O6CA 3PWNB 1M71B 4GSXA 4A7GA 2L7EA 1WO2A 2CNZA 5EU5B 4LDLB 3NFSL 3OD3A 3VQ2C 1JS4A 1CVRA 3I6GB 2CJTA 1J18A 4WCYH 4FMKA 3ESNA 3ATBA 3GF8A 4DUVA 4ISVA 4OCYL 1EMTL 1A6WH 4BK4A 1CR9H 5T1DL 3FYEB 4P04A 3P77B 1T83A 4TN9A 1F6LL 4Q4IA 5FK9B 2XN9A 4AEFA 2BOLA 5EUKB 5I2IA 3BKML 2KT6A 5F1NA 4G6MH 2XPGB 2NXZB 4S2SB 5F7FA 1J05A 1DN0B 2G3MA 4JM4L 3S4SG 1KCSL 5KBPA 3SB3A 4C59B 3P4LA 5BQ7B 1ETB1 2G2PA 4K7PY 5CUSL 5BXFB 2WANA 4GAYB 1F4XL 3BMVA 4FTVD 1NANH 2OMXA 4FOMA 5MP6H 2YKLL 3QUKB 1S5HA 2CIIB 4M9PA 3MV8E 3CVHL 4G1MB 1PX3A 2AXFB 3TVMB 4XVJL 1BWMA 2UYLA 2ZOUA 3D39A 1J8HE 3KLDA 4AIOA 1IT9H 3WEXB 4XX1E 3NVQA 1GY2A 1PJWA 4MVBD 1RZJH 4WU5B 3BPLC 1QO3B 5DCCA 1L7TH 4BSWA 5HGAA 2EDMA 4FFYL 2EIBA 3LQAL 2H3NB 1JAEA 5J3HD 1CZ8L 2MMXA 2LTQC 5FHBH 3KBEA 5HHOB 2BFVL 1J0YA 3HZYA 4B9JA 4PJBE 3P77A 1JD7A 2VDNB 2PO6C 1EK3A 2EE0A 3QUMA 1GL4B 1NUGA 4L4TA 3EJTA 4N90E 4MNQD 3B7UX 3PU7A 3UADA 5HGGS 2Q86B 5ICXB 3O4LE 4P5MA 2HMIC 3Q8EA 4BK5A 1A2YA 1UEYA 3ZYZA 1DJWA 3O41A 3O3BB 2WQRA 5I0ZA 3AB0B 4BD4A 2E74C 2M2DA 1Q90A 2I26N 1A6AB 1QEWB 3D8MA 3VXUB 1S3KH 4M5SA 3BOVA 5DQ9B 1SDDB 3F62A 5AFAA 5FUCE 3E6FA 4GO8A 5DRNB 4B5ZA 3NJMA 4XBGB 5GQBA 4PB0H 4EO5A 4UB0L 1AFVL 4XPBH 4HJGA 3HNSH 2YK1L 2IMMA 4TQ8A 1KEGL 2FJFA 4JY5L 1MH5B 4YZFE 3ZQXA 1NAML 1FV1A 2ORBL 1MLBA 3AW5A 3HC0A 3MRLA 1SFDA 5HY9B 1AC0A 4L1LA 4FNLH 2XZCL 3I02B 2CJUL 4JO4H 1NDTA 2RFXA 1QBAA 1WFMA 2VRAA 3L6FA 1QTSA 4CN1A 2Y25A 3W5NA 4Z8FL 4PY8I 2WO4A 2OYKA 2R1YA 3MXWL 4UINH 1TF4A 4KJWD 2CBQA 4UOQA 3WJJC 3EBHA 4KHTL 3LNGA 2QPEB 2BVYA 3MNDA 3UAEA 3ARYA 1KJ2L 1MRDH 1N59A 3QNXA 3WIFB 2V37A 2NTFA 2VH5H 4K8RD 2JIXB 1BFVL 1QLFB 3MLRL 1A1NB 5FHAL 1EV2E 1GKOA 2VITA 4QMEA 4RSYA 1DLFH 2HT3D 5EBWB 1NUFA 1I1AB 3IDNA 3B3IB 4YK4C 4B7IA 2A4EA 4IRJD 2IAAC 2QVTA 1DR9A 3GSUA 3BT0A 5C6WH 3SKOB 4Z76B 3LAFA 1R3KB 3IRPX 5D1XE 1OCOB 1OVZA 1JUFA 4NM8L 2ZUYA 4G3YL 3FUNA 4FG6C 4U3SA 3ZDXB 4ZFOL 4TRPH 4N90D 4HWBL 1MFEL 4UNVA 4ZS6D 2X3BA 1CFSA 2CXKA 3IFLH 4YHKL 1SHWA 4D0DB 4RQQA 1B4RA 1VSCA 3U6XS 2EINB 2J8UA 2C3VA 5SWZB 1XF3A 2VDRL 5C0DB 4XXDA 3UH8A 4LPXA 3M45A 3DRTA 1OAXH 3NH7L 5C0RL 3E7JA 1BZ7A 1BIHA 3IU4L 1QSFA 3UZEA 3IDGA 2VISA 4P2OB 3G6DH 3R19A 3IDJB 4U6TA 1LM8V 1GC1C 2P1YA 2IH1B 2XKSA 4DVRH 4H7VA 2RH0A 2E0PA 1WZAA 3DUHA 2EC8A 4X7TA 5JOFB 5EU4B 4LFHG 4OLZH 2H47C 3MNZA 1Z6JT 5JDSB 5BUGA 1KTJA 1NH6A 1RUKL 5IMMB 5ABDE 4G9FE 3O2DA 1ND0B 1FC1A 2BSDA 3Q13A 4JZOA 3GIVB 2EIMB 5DVKA 3RWHB 3VYPA 4F15C 3WMQA 3VRJA 3WSQH 5HHNA 4BWWA 4GB9A 4Y7OC 4KQ4H 1R9FA 4X7SL 1NBZB 2YUVA 2N7BA 4WEEA 4R96A 1ET5A 2A77L 3D85B 1MFMA 2XY1A 4RMQA 3V5HA 4WWKC 2XQYG 3R4DA 2H0EA 4D0BA 4KTEL 4KNSA 4KVPA 4LPYA 2TSAA 1PQZB 4CC4C 3MUJA 4DNLA 3BN3B 5F9AC 4XP6H 1OCWL 5BVPH 3Q7JA 4UM9A 5C0BB 3TF4A 2J57A 3KEHA 3WNLA 4AZ8A 3BEWB 1JK9A 4AC4A 5I15H 2W94A 3G6JF 1F5WA 1OCZB 3SZKC 4LCYA 1RJYA 3MXVL 1RPUA 1CFQA 1T5KA 1BBDL 1MI5D 2EIZA 2K8MA 5JUEL 2IC2A 2FO8A 2E7MA 4P4KB 3MBXL 3IF1B 1UM5L 1D7FA 1KBWA 3KPRD 4QF1B 4GRMB 1GIGL 4M43L 15C8L 3REWA 1FFNA 4M1CD 3IDXH 4NN7B 25C8H 2HG5B 1CQKA 4ERSL 4OJCA 4HAKA 4U6XA 5F3HB 2DWDB 4IKNA 5IB3B 4I1PA 4JR9L 4OLWL 2BVEA 3MOAL 3VXPA 1HQ4B 5B1CA 1C8PA 1FYTA 3HMXL 4QOKD 3SYCA 1NL0H 4TNEA 4LLDA 4XX5A 3C2AH 3LY6A 2R56H 4R4BA 4DGIH 5DSCB 1LO2L 3WXWL 4M48L 5I0VA 4BZ2L 3GLEA 1JGLL 2ADJB 3OC5A 4JFQB 4MAYC 1P7QA 2X70B 3QFJB 4APQC 1A6UL 1B6UA 1G9ML 3C8HA 4O2CA 1AJ7L 5CZVL 1XCQA 3MRJB 4MBRA 3N5AA 3ILPA 2ESVD 3K2IA 4GLRI 5KANG 3LS5L 3IJ9A 3MGOA 3OAYK 4MSWB 4OZFB 4U4BA 3H9HB 3OMZA 4OZ4A 2LE9A 2Z4QA 2A9BA 4RVBA 2A7BA 2O72A 2PCPA 1DQVA 3GXPA 4FXGB 4KUCF 4NQED 4BK5C 1WBYA 3VWJC 3ZHKA 1E42A 4Z78B 5AB0A 3U83A 1JGDA 5DQJA 3VFSB 4PJ6A 4GMTH 4ELMA 5CGYD 5IUSA 2VZ1A 1ED3A 2P44B 2R1XA 2APTA 4NJAL 2FRGP 1KYDA 5FKPB 5EO1B 4Z7AA 1C9SA 5KS9B 2H1PL 4XNAA 1SLXA 5FUCC 3LZLA 1Q0YH 3O8XD 4F58H 1RL1A 5EN2A 4QRRA 4OKVA 1JK9B 1O7VA 4GRLA 1AY1H 1JG9A 1X5LA 2NX5E 3AG2B 3J07A 2R69L 1XH3A 4PGBA 4XCCH 2JJUA 2R2CA 2XVKA 5FYKH 4XC3H 1HINL 3AZUA 1AC6A 3K3QA 3OHXA 1KB9J 1SBSH 3LRLA 4HKJA 4LF3A 2WUCH 4E68A 4N68A 3U2JA 1EO8L 5CD3A 2BVOA 5DHVB 2MSPA 4HGWB 1FWXA 3RZCB 5I6NA 4GMSH 2DKSA 5BVJB 1PFOA 1GW0A 3VD3A 1KJMA 4DUXA 1TQBB 3ARBB 1F0LA 4K7PL 2D31A 4M8VA 4FFZH 4R8WL 4D9LH 3HR5B 3J7HA 3VH8A 1PVHA 4WO4A 3S3JA 3PL6A 4N5UA 1R0AL 1H15A 5AZEL 1MQKL 4HT1H 1A9VA 1V3JA 3GGWB 3MGAA 3GSOA 1FFQA 5I5JA 2KKQA 2ISDA 3TM6A 3ARRA 1C5BH 1G43A 3KNBB 3DJTA 3MGTA 3GPSA 4OF5A 5I1KL 3EGSB 1HILA 5ALCH 4R26L 3P73A 4HUVA 4GS7C 5DZ9A 4NRYA 4NZ8A 1FIGL 4GOSA 3EBAA 5DWPA 2FEEI 3FULA 4AEHH 1CBVH 1KPUA 4NZTH 3IU3A 5KVGH 2ICEC 1S7WA 3SQOL 2RFXB 3L6FB 4OZFG 4ZAKD 1PG7L 2X1PA 4JPIA 4U0RB 1IQWH 3HLKA 1Q72H 2WLZA 4WTWA 3QJVB 1VZGA 3G08A 4N26A 1FIEA 4GRLB 2BIHA 1NOFA 2VXSL 4L3FA 1HH6B 1RVFL 2D03H 2OSLB 2R27A 3A4FA 3NDYE 3D05A 3WNMA 2NY2B 5H2BA 2WTRA 1MCJA 5KTEH 1JZEA 5MEPA 1HHJA 4V2CB 4NP4L 5I1AA 4LMQE 3QZWB 2J21A 2B5IC 3QVAA 4JRXD 3STZB 1NMBL 2ZXCA 1U91B 5FFOA 1LO5A 4DWHA 2QKIA 2HKHL 4QRPD 5H4ZA 1EZLA 3CDZA 4RH4A 4B9FA 2YA1A 4GW1B 4Y2OA 3EJQA 4N4YB 4W9FC 1TZIA 2XZQL 4Y5YB 5E6SB 3FH8A 4W9LC 5SWZE 3Q8AA 1MN4A 2W9EL 3IMWA 1NCNA 1T2QH 2EC9U 3BSZA 4J3SA 3MLPA 3S37X 2IFGA 3H2PA 4ZFZA 5T1MB 1Z5YD 3BLPX 4YHML 3NJIA 1SYSA 2PCFA 5D2NC 4CGTA 3C6SB 4FABL 4OB5H 5D1XB 3PY9A 5IB1A 1SJEB 5DLLA 2KZKA 1UVQB 4XNUL 2JELH 1B2WL 4YSCA 1QFPA 1R5WA 2Y9RT 2QFPA 4EQ2A 3D08A 2QSQA 4JVUA 4I0KA 3VXUD 4Y9EA 4EPSA 1SQ2N 5J8OA 3ASOB 1OANA 4V2BA 1S7TA 5C09B 4X5XA 3P11H 1P5UA 1A02N 3VVWA 1K5WA 2OS7A 4C8XA 2EADA 1KV7A 4G6AD 4QKTA 3TIEB 1U30A 3GUTB 5T33H 1LEKB 4K5NA 3TTSA 4B9YA 3GZKA 3JV4B 5DZNA 3RJOA 2X3CA 5I1CL 4XAKD 4LPUA 2E47A 4JW3A 3M46A 5CZXD 1XX9C 4R96B 1HKLH 2WKGA 4ODVL 3O0LA 3TF7C 1XEDA 2DYPB 4HIJA 1W6WA 4EN2A 3BDXA 4UQ2B 5D7JA 3P4OB 1WAPA 3PJNA 3TEZA 1KSRA 3IMBA 3DJRA 5KOVC 3VJ6A 2EDEA 5D7SL 4I3RH 4KTYA 5B3SB 1T2XA 4XVOA 4ZX6A 4RNRA 5DC0A 2VDMH 3RGVD 4LOUD 1IAKA 3O6LH 2H8PA 4ZODA 2EDLA 3ETBJ 2A4ZA 2OMZA 1MOEA 4JL2A 4XNYH 3QIWC 3SY0A 5DD5H 5AWNH 5IIEA 1TVDA 2FNBA 2QZQA 5IQOA 4K7FA 4PWJA 4JPWH 4PJFE 1ACXA 2N0KA 3SDAA 1AG0A 2EUZA 4PS8A 4DGUA 1ZLWK 5IM7A 4R90L 5FS5A 4UM9D 1RU9H 2YRPA 2FTAA 3SKJL 3GHEL 4PB9L 3KPMA 4JRYA 5HGBB 5I5IA 3NGBC 3NCBB 4WK0B 2IIJA 3PWLB 1JGIA 4FQJL 4LBAA 2Z31C 5CS7A 1DUZB 1FZJB 1P6WA 5HHOE 5KSAB 4X42A 1UOWA 3MA7B 4NCC2 2BX5A 3UYRL 3VWKC 1YC7A 3PCYA 1P7KB 2CA3A 1BP3B 3MZGB 4R4ND 5MERA 1NLDL 3TO4D 5ERWA 2ZX7A 1EIBA 2Y7QB 5ECGA 2FWOA 2NX5A 2C26A 3GJFB 3T3PB 2UZIH 1U33A 3L3HB 3S35H 1LK3L 3SN6N 3V8OA 3NSXA 5ANMA 4NPYB 4WO4C 1XSKA 4YOKA 1KB3A 2ZX6A 4WDIB 1ZHNA 2FYYB 2YD9A 5C6TH 3QJFA 4QXUL 4QIRA 2ZAHA 4ELME 5AW5B 5F7EH 3ULVD 5HI3C 3LMJH 4XP1L 1CTOA 4HV8A 3C60B 5IVZA 5HI4C 5D7JB 4UWQB 2BCKA 4Z95L 2CDGA 2NW2B 5DVLA 3ZMNA 1W8EA 3ZVVA 3RFRA 4KZEL 4L1HA 3IGAA 5IVXA 4OTXL 1RJZB 4HH9B 1MPAH 3D0LB 3B9DA 5KVDH 2EILB 3NIFE 2JCCE 1G1YA 1KZQA 2NQCA 3N85H 1JXKA 2Y4SA 2HB0A 1JYVA 2RQ8A 1T1WB 4NO0B 2IH3B 1BOGB 1LDPL 3NPZB 2X05A 1IFRA 2IQAA 2XUWA 3MHZA 4FQHB 3I3DA 4HIHB 1OE2A 1U8QB 1U8HA 1SRDA 1X7QB 3BAXA 4R7LA 4BUQA 3FRPG 3EYVB 2YRLA 1HE7A 1TQCB 2VLJE 4UDUB 1ZVSA 4YXHL 1M42A 4CNIA 2BSRB 2E86A 2AQSA 3QFJD 4PRIE 1OM3H 4FLSA 2IFFH 4LLYA 1S5IL 1UADC 3N0AA 1C5DB 3QGVA 4RAHA 5E5RB 4G2AA 2C4FU 1P9MA 3GJEB 4NSKA 5E8OB 1S78C 5F7YC 3IKCA 1SM3L 4ONHB 2A6JB 3EYSH 4WK4B 3FU3A 1KGWA 4L05A 3EBIA 1KJVB 1EAQA 2HN7B 1H5BA 2BW4A 3FUHA 5D93C 3W3BA 4Z6AT 4W93A 5FO2A 2QADD 3W9EB 5GRUL 3H9YA 3DGGB 4GH7B 4LSDA 5DS1A 5EOCL 1XWVA 4OD2B 4Z0XB 1QWHA 2C9QA 2EDYA 1ZVNA 5EZPA 2BC4B 1KTDA 2Q3XA 3H7LA 2EKSA 2GBVA 3CFJA 2MQGA 3BKMH 5GRZA 4AIEA 1UD2A 1EDYA 4JM4H 1WZKA 4YXLL 5C0JB 3TJHD 1G7LA 5J6SA 2WN3A 4X8GA 1DJZA 3K1DA 5PCYA 1VDGA 2MHAB 2P8MB 5AG9A 1CURA 2MCAA 3U0TB 4JG0L 4C55A 1G9NC 4UAOC 5BS0D 1WEJH 3FN0L 4U1MB 2EXYD 5HHMD 1CDCA 2DLEA 3LNHA 4LGPB 5AVZB 3GBMH 3H56A 5IB4A 5GS0C 4XVUC 3HPLB 3WFEL 1UZ8B 2H2PC 3Q01A 1J12A 4UANA 4OLVH 3PV7A 2O1AA 3BAKA 1JHTA 3LD8C 4LIQL 2OL3H 4IKLA 3G6AA 4M62L 2IGFL 3H0TB 1Q0XH 1S9KC 4PLJC 2YXFA 3DV4A 4L3ED 4Y2DB 4OW6A 3NCJH 5EO9A 3KPPA 4PTTA 1SXAA 2IV9A 4M61B 1CMOA 3C87A 4M93B 5DU7A 3DX9B 5J9PB 1CFNA 3TV8A 4X5QA 4H44C 4XNXH 5FHBL 1NLBH 3GXTA 1IAOA 1TZGH 4P5KA 5FGRA 3CDCA 3L1OH 7TAAA 3OXRB 1ULVA 4HUNB 4I3SH 5F2FA 3WS3B 3GM8A 2ZQKA 4FQLH 1TTBA 4X8JA 1JP5A 4WWKB 3FNKA 1DDHB 5HYJE 1AKJA 1MHHB 3SO3C 3CFQA 1U8MA 3NCXA 4AM0B 1F4HA 2APBA 2AI0L 4JRWA 1VCAA 4ZDHB 1NPJA 3K81A 3QQ3B 4AYBA 5ACLA 4NP9A 1NCAH 4W68A 2VKXA 4Y19A 2VZTA 2ZCHH 3HRZB 3DMMC 3NAAH 4ZSOE 5FX3A 2C3WA 3RWDB 2GUYA 4PRNA 3ULVC 1X5XA 4C58B 4GFTB 2C8NA 1FBIH 2XIBA 1RK1B 3HC2A 3VO0A 3NG5A 4AKQA 3E38A 4HGMA 4FXGA 4AL8L 1L5GB 3AY4A 4QRQA 3CFMA 3C9NB 2EXWD 2VW6A 2WTOA 5JIIA 3WEOA 2OSYA 1YNKH 1JF5A 3M1OA 4O5LH 5IBTL 3SE4C 1WF5A 1F4WL 1TENA 2BP8B 2HWZL 3LZFH 1WBXA 5CO1A 5E7BA 4ZUUA 4Z8FH 1JZ5A 2KZ1B 4NENA 3T1FB 4M1DL 5KVFL 2HKFH 3FN9A 1FG9C 1TNMA 4MZ3A 4FI8A 3PABA 4HVBA 5B1JA 2D8KA 4CJ1A 4P9HL 3QQ4B 4KOCA 3A6CH 4MJ6A 1AGFA 3FQ2A 1RKRA 3NIGE 4IM8A 3ZRSA 1KJ2H 5DC2A 4XC1H 3O3AA 3PHQB 4V1DE 5D1QB 2DBJA 2ZUQC 3V6FB 1A4BA 4I0PB 4IOIB 1BFVH 4ODTL 3ZTDC 3MLRH 1F45A 1FSKB 4UTBL 4PWEA 2A74A 2CK0H 2X89D 3ME0A 5FHAH 4AGLA 3IJEA 4P4RB 1UTDA 5DUBB 5IQMA 3C5SA 3FQTA 5B22A 4BELD 1GVIA 1XB6A 4R5XA 1NGPH 5D55A 2JQMA 3D3VE 1JF1A 1KBBA 3GINA 1O9ZA 5DEZA 2PETA 4YUEH 5D1XD 5L9DL 2Q7NA 5EIIG 5BOJA 2YUZA 3PAZA 4KO9A 4NB7A 1CYGA 4XP4H 4G3YH 1C5CL 4LCWD 1JWUB 3UXFA 1YEGH 2OJZH 4JO1H 1U2CA 2YEVB 3LD8B 1MW0A 3GRBA 2AXHA 1YA5A 2XRAL 2HLEB 1QR4A 3K6SB 1HU8A 2FJGA 4E9LA 4FA7B 4HW6A 1E30A 4GS7B 1MFUA 3WIIH 3AT8A 4F2ME 1G9HA 2VAJA 4N2AA 2YAPA 2EEDA 3WIHA 3IU4H 4N2GA 1RMFL 3G04B 4POZC 3G6DL 2WZPD 2BY3A 4JHBA 3EADA 4Z3HA 4NUJB 2E8ZA 4E9YA 3PXHA 1NA8A 5C0CE 2DQHL 3C5ZB 1INDL 1BBJB 4MRBA 3IB4A 3MV7A 4GIOA 4UTAH 5L0QB 4NGHH 1L5GA 3AREB 2VZ3A 1B4JL 3GSWA 1RV6X 1VPOH 2BDNL 1CL7H 4GG6F 2NR6C 4WUUD 1ZY9A 5TTRA 1J10A 4DP9X 2J1YA 2QBWA 1COBA 3RGVB 2G2NA 4OZHB 1ZSDA 3L9RA 4AIZA 5KSVB 4L1SA 3VI4F 3RZCC 1G7MA 1WDAA 2A77H 2ZCKL 1F3JB 3L54A 1AGFB 5FB8A 5E9NA 1XL6A 3FCTA 4X4KA 4KTEH 2IOMA 4N0UB 4Y1AB 1DQLL 2ZYRA 1OQXA 1D5IH 1BMZA 3F12A 2OSLA 3A6OA 4XP6L 2ATAA 1TMQA 1FVEB 3KLAB 4YXKH 5DUBA 1U6AH 4MJIB 3MRFB 1FNSL 3V95A 3CUPB 1WAAE 4F2MA 4MCZA 3TN0B 5AD0B 1E43A 4K3HA 1L9OA 6FABL 4KX7A 1PAMA 4NQVB 1UUSA 4WV1A 3C12A 2FD6L 4GBXA 1UH3A 2FIRT 2H0JA 2Y7LA 3KMDA 3ZGIA 2IGTA 2AVGA 5E6ID 5E5MB 15C8H 2PYEB 1IGYA 4U3HA 2JKNA 3V7AG 4I9XA 3H42L 4ZW3A 2G4GA 2NLJB 1NICA 2VLKB 3BKCL 2F58L 2AV7A 2ICWJ 2HZHA 2Q7YB 3D3VA 3GMMA 4EN3A 2CGYA 3Q1SH 3OKLB 3SSGA 1JPTH 5CM1A 3F6JA 5F3BB 3LQAC 2KHAA 1MAJA 2F5AH 2R56L 3FU0A 4X0NA 3UYPB 2MOGA 3GLDA 2ZWZA 3FO0L 3MUGA 1A8ZA 2H0PA 5FF6A 3IJHA 2VW7A 4KKCD 2KH2B 3W37A 1G9MH 4WWPA 1RUPH 3CMOL 5IHZB 4WY7H 2FQGA 4BSVB 4FQQB 1A6TB 3MV9D 4FE9A 4YLCA 5AENA 2QELA 3VWKA 1N8ZB 1EJFA 3CVHB 3E2HB 1C08A 1NCUA 4P05A 4KJPC 4JUTA 4ZYKB 5IEKB 1WUZA 4MAUH 1Q1JH 1IGIL 1YEEH 5KSUA 3IJSB 4ICXA 4OGAC 1Q9WB 1WGOA 3QXAB 4KMQA 3L9YA 4L4VD 4RMVA 5KYUB 1R5VB 5CILH 3SD2A 5G4OA 2O26U 3H2WA 1SF5A 4NO0D 3OC8A 2AVFA 4NN7C 2BOCA 2K4AA 2VJ0A 4UCFA 1N0XH 2ENJA 2NZ9D 3E1ZA 3QDHA 4BYHA 4RGNB 5ICZB 2FBOJ 3I6KB 3GBNL 1RK0A 3FUDA 4NWUL 4PJ5A 2NZIA 5L6YH 2YAOA 2ZONA 2VMCA 4XGZA 5DJ8B 3S3BB 3CZJA 3FO1B 3FSWA 2WJ5A 4E9RA 1XZ0B 3T04D 1O0VA 3LDBB 4IRSD 3HUJE 1X3DA 4AYDC 2X4OA 2B9BA 1CS6A 1FO0B 2DQGL 5HYJA 1EDQA 2ZUSA 4YDIL 3CV5A 4N28A 2R69H 4XCCL 3CZNA 3V6BR 1VFAA 3EOAA 3QS2A 4N9OB 3LJ3A 3OX8B 1RQ5A 4F80A 4X4YB 3CSGA 5EEZA 1HVXA 1MCWW 4G7YH 2G5RA 3NSFA 3O6ML 3AY4C 1S9YA 5GSVB 4ODSL 2F54E 1MREH 2D7MA 5CCHE 2B4CH 2IDQA 4NWTH 4M3KB 2GJRA 4QY8A 3BT2L 1M6OA 2ZYSA 3WIAA 2ZYHA 4DUWA 4LP8A 5M94B 2MRYA 1OPOA 1HFUA 5GZNC 1UC6A 1PIFA 4PJ9D 3ARDA 2XQBL 3GXDA 4X7DC 3VXSA 1K5NB 4AK2A 4MD0A 4X6EB 5FYLE 1AZZC 1DQJA 4WW2C 5AVVB 2YD5A 3BUYB 3LKQB 5DJZA 5E4OA 3IBOA 3SDDC 5I9QC 3QA3A 1C08B 1I9RH 3ULVF 4G8GA 1OP9A 5IWLA 1OLLA 3AAZA 5JORB 2OCJA 3HPJA 4XPFH 4KU1A 3MJ7B 2EYTB 3L3GB 1RP8A 4AE0A 5GS0D 4PFEA 4P57B 5KWYC 3TWCL 4NPYA 4HSAC 2J4WL 3B2XA 3RWHA 4IOSD 1XSOA 3EW3B 4LEOA 4PSPA 2XPGA 1AXSB 1HEHC 4S2SA 1KCVH 4YJZL 3QEUA 1CYXA 4NZTL 4L3EB 3DC0A 4Y2DD 3AY2A 1RK0B 4PJ5B 2DIEA 1MWAL 2DIBA 1G7JB 3NK3A 1NC2B 3T4YB 1Z9PA 1JFHA 1PG7H 4OZGA 2OI9B 4Y19D 1J5IA 2D4DA 2WP3T 4NEHB 4Y4FD 4KRPD 5EORL 5D2NB 2Q8BH 3D0LA 1ZLEA 3Q1EA 5FCSH 1MUJA 3TCLA 4TQHA 3VFMB 5BS0B 4PUBH 3OAUH 4AM0Q 2IH8A 4Q9QH 1RVFH 1E8WA 2D03L 1CF8H 2IH3A 3ARUA 3E80A 3HJEA 2HPOA 2LU7A 4HFUL 4XOEA 3UGXA 4OGXH 2HPTA 5ID0A 1XGUA 3T2OA 2EUVA 5KTEL 1RLBA 1JXFA 2QADC 4XN9A 1HHJB 3EYVA 4TSAL