1W8WA

Cbm29-2 mutant y46a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKAGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPINLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
total genus 32
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w8wA00
3UT0A 1L7LA 1V0AA 4BQ3A 4YWAA 2O14A 4CP9B 4LK6A 2K46A 3F95A 3ORJA 2LRPA 4A6SA 1GWMA 4AL9A 3ZYHA 2Q1FA 4YW7A 1WZXA 2WYFA 1GWLA 2C24A 4LK7A 4CP9A 1WMXA 4LKFA 1W8TA 1UOJA 1W8WA 1W8ZA 1W9FA 2LROA 2JWPA 1OKOA 2VXJA 3ZYBA 1GWKA 1OH3A 1W8UA 4LJHA 5D21A 4BQ2A 4LKEA 1WCUA 2KR2A 3ZYFA 4CPBD 1W90A 4BQ4A 4YW6A 1HN0A 4CPBA 4BQ5A 4LKDA
chains in the Genus database with same CATH superfamily
4XC9A 4TYSA 5A3OA 1S2EA 2VW2A 2OT7A 3BOPA 5SV5A 3S7IA 5ERLA 1V6NA 1STMA 4CCEA 4JVAA 5FZGA 1I6XA 1POV3 3M8LA 1RXGA 4PQ9A 1RHI1 1NT0A 3E1F1 1GNYA 2IVJA 3NVCA 1VAMA 4OZXA 1LHWA 2OXBA 2YGMA 5DN2A 5K0UB 4NWVA 5C5TA 2QZ3A 4UF0A 4Q4X2 1ZREA 2G19A 5FPLA 2CL2A 1AVBA 4HSJA 2K0GA 4OI1A 1RL3A 2A73B 4E2GA 5DMYA 3C7HA 2EIBA 1HV1A 2QQIA 3AKQA 1VMHA 2WWJA 1GKBA 1QJY3 2DCJA 4Z82A 3LE0A 2JDZA 4A42A 3PVNA 4MZUA 3KT4A 2CSGA 1SDDB 3AZYA 5HXMA 3FX3A 2PQQA 1E57A 2FMYA 3WUCA 3ZPYA 3ELNA 2TBVA 2A71A 2QQNA 1QJU1 2XB6C 3UJOA 1TZOA 3JU9A 3ZFFB 4JGYB 3ZXAC 2FCVA 5FK8A 3N9LA 2J22A 4M4PA 4LBQA 1PZ9A 2FDHA 4CEYA 4Q0QA 1UKRA 4BQYA 3I4IA 2WIIB 3W20A 4IEUA 4CDWB 1H4HA 1EPZA 2VNVA 4L92A 5FYSA 2R062 3OD0A 2VVDA 4E4HA 5J3UA 4QWNA 1CJDA 1VBA1 1NQJA 1L3JA 1VAKA 2NYYA 4TSVA 2QKDA 1H8VA 5LA1A 1OBNA 2G1MA 1YUDA 5EJ1B 2I74A 4CEYC 3AP4A 4CU8A 1J58A 2WT0A 1X8MA 2CV6A 2YFUA 1C8M1 4PBPA 3B3QE 2VO5A 1REDA 1HN1A 1WKYA 2A3WA 4AEMA 4EYUA 4O65A 2EXHA 3MI8A 1AXKA 2H6BA 2BNOA 2UYAA 1UO9A 4RYDA 1GQPA 4FVVA 3HNYM 1D2SA 1CQ9A 2E31A 2QBXA 2E7QA 1YQ8A 3C7EA 4EZHA 3H9AA 1CAVB 4XDPA 5FOBB 4FBFA 4ZONA 2RJ2A 4DOUA 4RD7A 1NE4A 3JQWA 5FZ3A 2ET1A 2J1UA 4TLFA 1QY4A 3FUQA 5E88A 3I3MA 1S0EA 2JECA 1RMU1 2ZEWA 3B01A 2Y6LA 3CU7A 2ZS6B 4L8QA 4A3XA 1GNHA 3WQ0A 4E2QA 2WSUA 2UWCA 1OUXA 2SLIA 3LAGA 1UX7A 4YGDA 2GU9A 5ANNA 4QKDA 3M3CA 4GWJA 4LKFA 1MACA 4Q4W2 5ACA3 3WD5A 4W65A 4DRRA 1JXNA 2IXJA 1W8NA 1FPN2 4OFGA 3ZO0B 2ORZA 3Q8AA 3VBOB 4XE9A 1RUG3 3ZXFA 1V70A 1G86A 3GBGA 3LPFA 4MVTA 2XJRA 4YPJA 4C0HA 3HWJA 3NNJA 3WP6A 4BQXA 2WZ8A 2WFF1 1QOSA 3NL1A 3MIBA 4R4ZA 2Q8CA 1YI9A 4CDXC 5HCHA 5APAA 2VC9A 5F3CA 4NAOA 4ES9A 5A6XA 5JOYA 1JYTA 3LOBA 1K42A 4IEQA 1HXS2 5KHKA 3T1LA 2WFPA 4PLNA 1EUTA 2ZZQA 5C8CB 1CX1A 3IIIA 4XUNA 2A70A 4URAA 1RUJ1 1ULCA 3HBZA 3OGVA 4FOWA 1RC6A 5T55A 1H8TA 4BE3A 2RS32 3Q9OA 5FP7A 4GWIA 3T0DA 1DYPA 2BQPA 2WNEA 4QQPA 1PK6B 1J3QA 3VZNA 2I2SA 5FYIA 5KXCA 4B29A 4LHSA 2ZHNA 1V6IA 3ATGA 3A21A 5JZGA 3WG4A 2XKPA 1IPKA 1UNBA 1WW5A 5A80A 5F9TA 1ZA4A 1ZYBA 2VOVA 1XNDA 3U07A 3IIAA 1RJ8A 1JN2P 2DBNA 2V5DA 1YFXA 3WNKA 5JLVA 3ACGA 1MQTB 2RS13 2VULA 5CAZA 3OBAA 3NKTA 3NV3A 1H8TC 1OHFA 4JTOA 3U10A 2VPVA 4RR3B 4OI0A 1UYPA 5FYTA 3MLKA 5FZ6A 1HRI2 4RGKA 2RM22 4GD4A 4XF1A 4M00A 4OHYA 2UURA 4AHXA 4OULA 4MO3M 1UIJA 2OPKA 4CP2A 2P3JA 4JQRA 5ABJA 4BLJA 1CR7A 4K20A 4H14A 4CA9A 2FDKA 3SNMA 3DV8A 3RS6A 1CJPA 2Q4SA 2BW8A 3ZFGB 1QEXA 4B7KA 4BQ3A 2HWC1 4WZCA 3VZOA 4NHLA 2D98A 4K3UA 2Y38A 3ILFA 5C33A 1JZ2A 1POV1 1LOCA 3FLRA 4FOYA 5L36A 4XFFA 2DUPA 1PIV3 2IC1A 1KFXL 4FCAA 1K45A 1WZXA 1K5MB 1X50A 2E9QA 4IESA 1BYHA 4P08A 5DDJ2 1BBT3 3HR9A 3ZFFA 2XJSA 1QDCA 2WNUA 4QU2A 4XQ4A 2XJVA 1KS5A 4MXWB 1W99A 2DURA 5LBEA 3ZXGA 3QBQA 1I5ZA 1QXJA 2UY9A 5FZ0A 4BISA 1VRH1 3PUSA 4QXHA 2CAUA 1PHMA 3H8UA 1QJY1 3S57A 3J9SA 1T6BX 4DY5A 5LRSA 4CDWA 4Q26A 4C1WA 1D7PM 4XDQA 1GSLA 4YG3A 4Z92B 5G04L 2D6OX 2WQ8A 1W2UA 3LKJA 1XSQA 2PN5A 4LBMA 1NE6A 2WZR2 4P9GA 3OGJA 5GKAC 1XNAA 3ZFFC 2WNUC 2DUQA 4Q27A 1LEMA 2VBBA 2VQAA 1CZVA 2ZHLA 3DXUA 4AFCA 2NM1A 1RUF1 1ENXA 5LA2A 5L73A 4JHZA 2WLPA 2Z5WA 4R9BA 3KF3A 5EYYA 4LBKA 4CDWC 4QKBA 4LE3A 3MZHA 1DGRN 4P9IA 3B00A 3MBWA 2E51A 1U5YA 3MGUA 1FMD3 2AREA 1GMMA 1UY0A 1VBC2 3POWA 4NHXA 1QNWA 3T09A 3Q8FA 4EWEA 1S55A 4GH4B 3POJA 4GA9A 5GJ6A 5JIUA 2DBIA 3AYAA 2DVDA 3D8CA 4ZU5A 1NYWA 2QQKA 1HIXA 1IKQA 2QQLA 2XXZA 1QDOA 3K3OA 1IQDC 4DIQA 4C91A 2A3YA 1W05A 3CKHA 2Q1FA 2ENRA 1WLDA 2CDOA 3K4AA 4DPNA 1XE0A 2H0VA 2VMHA 1W9TA 2WA3A 1O5UA 1XB9A 3POEA 4OI4A 4P00B 3ZIWA 4DY3A 4UFMA 4UOJA 4DZGA 4GULA 5JWPA 3JXSA 2XQXA 1NXD1 4XFHA 3KCYA 3WNOA 3AK0A 2VCBA 5FMOS 1UQXA 5KXDA 4RQPA 4LHLA 4K6BA 1EV11 1Q5OA 5GZEA 2GMPA 4QDRA 4AGVA 1IPSA 2XLGA 3M3EA 3VBOA 3WX5A 4CU6A 1OI6A 4META 5JR7B 1VBE2 2MHFA 4OI2A 4AVAA 2VL4A 3MHZA 3BALA 1UU6A 4KBBA 3E5UA 1ASJ2 3NMBA 2C9AA 2Q8DA 4ZU7A 1YFUA 4QB2A 2RDRA 2ZEZA 1COV3 1ZBA3 4MH0E 4LIVA 4XJ9A 4RQPC 2XWJB 3WCSA 1YQ2A 3ON7A 1RUG1 5JXHA 4AI9A 1PO21 4AI8A 1REFA 3A0NA 1G9FA 4XVHA 2FZ1A 4H3WA 1SMVA 1OF4A 3VBOC 4BB3A 1YNAA 3ASIA 3J7NA 3QCWA 4ARYA 5C8CA 1JZ5A 1TME3 4LHKA 2IFWA 1ALYA 4JKLA 1G6NA 2P4EA 2D43A 4OHWA 1OVSA 5IVJA 2P3KA 1IS5A 1Y9MA 4ARXA 3ZSMA 3ZPOA 3CJIB 3LSEA 5FK7A 5IAVA 1MVEA 4UYBA 1O6UA 5DPNA 4MSVA 3T1MA 5C8CC 4XACA 2E6VA 5FYUA 3WQ1A 1W6OB 1MQTA 4AQSA 1IOAA 1VMFA 3GNEA 1RHI2 5DAVA 4AI2A 3I49A 3KZ4C 4ZS3A 5J96B 1QJFA 1WD4A 2YC4A 4MYEA 4RR3A 1RITA 4ZXEA 2P6CA 1CZSA 3ZN6A 1W3XA 2VZUA 3NNFA 1WMDA 5J37A 4QDQA 4V2WA 2OX0A 3KT7A 4EN8B 5J48A 3RZMA 3M3QA 4V1PA 3KD4A 2EIEA 1PVC3 3LA7A 4CU7A 3HQXA 4CDUB 2BJSA 3MW3A 1QXRA 1NY72 2W68A 1WW4A 3BTZA 1MQTC 4A44A 3LIHA 2EICA 4LXLA 4ONUA 4XYXA 3ZFGA 4CVUA 1KITA 2HWD1 1XNKA 3IPVB 2ZGUA 4RR3C 3VDBA 5JMOA 1QJU2 5FBZA 2W3JA 4RGAA 5JXJA 1AYN3 4FOQA 1N1YA 1QJEA 2CYFA 2VXJA 5BXXA 1HJFA 1RUH2 2IXCA 3LEIA 1MS5A 4LJHA 1JODA 2YFZA 4WBBA 3WUDA 1DYOA 1K5MA 1QH6A 2UY8A 3Q8BA 4HL0A 3ZXKA 4BYYA 4E8DA 3AKSA 1OF3A 1H1AA 1UXXX 2W2IA 4IE6A 4A7ZA 4Y1XA 5IAXA 4HVRA 3U4SA 4GWMA 1QWRA 3ZFGC 1ENQA 1LODA 3OOXA 3SITA 4MXWA 2JDKA 5DXDA 3BN6A 2R1BA 5LBFA 5FLJA 4IE5A 3VD9A 1JYIA 1SEFA 2VZ1A 3AYEA 2XR4A 4RN5A 1QQP1 4AR2A 2W95A 4CDQB 3W58A 1BBT1 4L0PA 1GWLA 4Q2FA 3ZN4A 4C8DA 1M06G 2GC1A 1S4CA 1K5MC 1JZ7A 4PT6A 1PM7A 1GOFA 2WT2A 3K4ZA 4YM2A 5T5OA 4ITCA 1QXPA 4XBQA 2Q1ZB 4MHRA 4LKEA 4DRVA 4Y5Z0 3IB3A 5DAWA 2BZDA 4K21A 5GLUA 4CRQA 2XVKA 1BK0A 5C3PA 4QX0A 3GXUA 3ACLA 4QX2A 2W52A 1D0HA 1LOFA 2QQUA 3JBG2 4MGTA 2H6CA 5DG2A 4HBNA 1JUHA 5KC6A 4CCKA 2FDFA 4M01A 1YWKA 3S6PA 2BNMA 4CTEA 5C3RA 4R9AA 1B35B 3IAQA 2W08A 4GJZA 2JEMA 1OUSA 4HT1T 4PIYA 1ZRCA 2ARXA 4GAZA 2ZCWA 3B5LB 1TVGA 1APNA 4O7XA 1HLCA 3PDQA 1DBNA 1LGNA 1W3VA 1ZZBA 1DQ0A 1XBFA 2VZOA 2Z79A 3M4FA 4U2AA 1HJGA 1VE0A 2WJSA 3OJBA 1Q8QA 1LOFC 5BNPB 5JIAA 2B46X 2PMWB 2WAOA 1UY2A 5IJRA 2YV8A 4LBJA 3ZYPA 1ULFA 3W5MA 4Q0VA 1QKQA 4FP3A 1AYM3 4P02B 2VZTA 2ZXQA 2HWF3 4QKFA 1ULPA 2D6LX 4PF5A 1FXZA 1VPHA 2Q0AA 5I0TA 4GH4C 3J8F2 4LO4B 5EQUA 1QMJA 3NJXA 3WW4A 3ZFEA 5HBAA 2D6MA 2WFF2 4IW3A 3B94A 5FY7A 4AL9A 1C8NA 2OZ6A 4ZZ5A 3TN91 1SLLA 3VBRB 1R093 2Q8OA 3IMNA 3OF1A 3FWEA 4XETA 2D6PA 3NSTA 1R1ZA 4GMP3 3VBFB 3UGFA 1ZZCA 2P5BA 4IV3B 3V64A 1OA3A 1QGLA 3AKTA 2WUHA 5FPZA 3UGGA 3ZFEC 1VBE3 3HEIA 4I3PA 4XZUG 5HPOA 4PQQA 1SLBA 3CMGA 2XHKA 3H8RA 4GJYA 2VOXA 5FZAA 5LCWL 1HB1A 2PHTA 1F2NA 5GZCA 2D3SA 2YBKA 2DCTA 2X09A 4Y20A 1N1VA 1ZBA1 5DAXA 1F5FA 1JW6A 1OLMA 3TRSB 4QPWA 1DGWX 4W6XA 3WNXA 3RI8A 3LSDA 2VU9A 1VP6A 5FREA 2ZX0A 3TB0A 2WN3A 1V6JA 3B02A 1H9WA 3K51A 3CJIA 1F5JA 1OKQA 3CIHA 5FO8B 3OG2A 2P17A 3HD8B 4BA6A 3MYXA 1RYYA 5HCAA 4LKDA 2VCMA 3UT0A 4B3NA 4B8EA 5FZFA 1HV0A 3E5QA 1E5RA 3D4KA 3RWKX 1PGL1 4A2UA 3VBSB 3MIGA 5JUVA 3CQOA 2YUEA 2D3RA 3URFA 1ZRIA 3FL7A 1DP0A 2AACA 3RYPA 2HWC2 1O8PA 3GZUC 5BNQA 1RTVA 2RS53 4KMQA 3UL2A 2C26A 3E6BA 4X8PA 3CJIC 1W6MA 2YXSA 2C24A 1D4M2 1DZRA 3POFA 4WVWA 1C4RA 3AZZA 4CP0A 2RJLA 4OLLA 1AR93 1AX0A 2BOIA 5F5AA 3U37A 1AL21 4DXZA 5A7OA 4PDWB 4W6WA 3KT1A 5DUVA 4TN7A 4JRAA 3KS7A 2YGLA 3T30A 4Q4Y3 5HV0A 1C5HA 3THDA 1PVC1 5CEHA 4ET7A 2RMU1 1HN0A 3EJKA 3USUA 1ZZ7A 3NKGA 2P2KA 4YWAA 5KC5A 3QD6A 1VRH2 1JH5A 4GB31 1FI2A 2JDNA 3FMGA 3A7QA 4IL7A 4LBQB 4I30A 4CEYB 4D7SA 1AR83 3PUHA 5IVBA 1POQA 2VBPA 4XIOA 4XFIA 3TEXA 3WQ7A 4CCNA 3IDAA 1KXGA 4QX5A 4YM0A 5C70A 1G9DA 3THTA 4B1MA 1E5IA 5A6QA 2VD7A 1LESA 3M7AA 1W8WA 1UY3A 5FXWA 1GLHA 1HB2A 3O1TA 3DL3A 4QQ2A 4WZFA 2J1RA 3AVSA 2C1FA 3ECQA 4Q4V3 4FPKA 4WV8A 1RUF2 2JX9A 3H7YA 3OBZA 5BY5A 1WUVA 1UL9A 1BMV1 3N4MA 3OPZA 3D82A 3THCA 2XONA 5FYVA 1Y9GA 3CEWA 1LHVA 2W91A 5FIXA 1XNBA 5I8SA 2O8OA 3WG1A 2EF6A 5JSRA 2CAVA 1PNFA 4CE8A 2YHJA 1NZIA 1O4YA 2XMLA 4RFRB 1HKDA 2QQMA 4LEJA 4LUKA 3NV1A 5FO9B 5HCBA 2ZHKA 1O3TA 2JE7A 4AHYA 3U0ZA 4PJYA 1B35A 4XDOA 1S0IA 1RUI2 1RVF3 4NMIA 4OCTA 4QQOA 5F2SA 5FJHA 3HN1A 3LGRA 4Q0UA 1SLAA 1VBD2 5CVRA 5IFTA 3BPSA 1ONAA 3AMHA 5CB7A 1KDKA 4X6QB 1CAUA 2Z2SB 1ST8A 4NO4A 5GZDA 5FLIA 2JENA 4EN6B 1FNZA 1DLLA 1XU1A 2YB7A 3BGAA 3P5BA 1EUUA 5C5UA 1R1A3 4Q29A 1EV12 1XJAA 1H2KA 5LRRA 3VBUA 3WW3A 4EZ4A 2WNOA 2PAEA 3J7HA 1MR5A 3NJVA 1B35C 4QPYA 4NIGA 4JKMA 4KGQA 1DIWA 4BDVB 2IFRA 5FJKA 3GZTB 4EWDA 4TZDA 1NA1B 1ZBE3 5J1XA 1W9WA 2PHXA 1JOBA 5K8SA 3O1OA 2QQVA 2YU2A 3SKJE 1Y4WA 3VKFC 3WT3A 1VBB3 1R083 2DYCA 1W9SA 5EPAA 1GYKA 4LO6B 1E5HA 1JHJA 2JXAA 2J1AA 5B4NA 2EXJA 3JZVA 1PO22 4AEDA 3J8F3 4D6SA 2WC2A 3DPRB 2B5HA 3JD71 3VBFA 1VR3A 4AOCA 4I01A 1E5SA 4FFHA 4IV3A 1O3SA 2JDMA 2LRPA 4J1WA 2X29A 1V9U3 2P6HA 1R091 5A7PA 4W4ZA 3ZXEA 2MPFA 1DF0A 2A5ZA 5J98B 3O5SA 2IXLA 4H7LA 2W46A 4QXCA 2A1XA 4Y3OA 1KJLA 1SQ4A 4J25A 3D6EA 5LA9A 4BXSV 5I93A 4IE0A 3BIEA 2WS91 3RZGA 2GZWA 4LNVA 5JZGB 2VCCA 1S0GA 2JG8A 2DTYA 1GZ9A 1ZZ8A 4LPLA 1W0OA 4S2GA 5LBCA 3WHUA 1HQLA 1S1AA 5FY1A 4AEDC 2R041 2PFWA 1CAWB 1GUIA 4ZXKA 3VBFC 1ZA7A 1QJX2 3AMMA 4FXKB 1O3QA 3VB9A 2PAMA 4IV3C 4JHTA 1OQEA 5JCTA 1RUNA 5JOXA 2HBTA 3WG2A 3AVRA 3H1YA 4MG2A 4AVVA 3OUHA 4YW4A 3TWIA 1LEDA 2E26A 2JDAA 3GBWA 1MEC2 4Q1RA 5FP8A 1ZRFA 5E8AA 2VVFA 2JG8C 1FNYA 2B4KA 5GM0A 4D7TA 2IXHA 3FE5A 4QPIA 5ABJB 5IVVA 4HPKB 1YYNA 3O1PA 4IEXA 3BCWA 3KVBA 1OFSA 3U1XA 2P1BA 3VBSA 2NZ9A 3DN7A 1RUE1 3VD3A 3KMHA 1Y7BA 1GZWA 5T3NA 3E6DA 2HWD2 1DGWA 4QX8A 2XJTA 4AQTA 3QH7A 4UBGA 2WQ4A 5T50A 4IE4A 2W1SA 1WMFA 1GU3A 2HYKA 1Q56A 4P5YA 4QXKA 5FY8A 4PDWA 3NW4A 4D0QA 2PLV1 1PM4A 4IXLA 4K40A 3WDTA 1DQ4A 2VM9A 4NWWA 4HXCA 2NMOA 3VBSC 1LRHA 5K7PA 3K75B 2D44A 2WNUB 1UKGA 1XQNA 4AI0A 5F8PA 1WW6A 1HB3A 1NQDA 5FQ0A 2GMEA 3MO4A 2B9VA 3PTYA 1AX2A 3GHNA 3W9AA 4WM8B 2NMNA 3N9MA 1HRV3 4ZHNA 1QQP2 1GQGA 3NAPB 4XF4A 5CKMA 2WBKA 2W92A 2XBO2 3OSDA 4PDWC 4Y4RA 2WYSA 1OURA 1WCUA 3AZWA 5H9RA 5JPNB 4XJAA 1O4ZA 4LKSA 1AR61 4N7UA 1UAIA 3ENRA 3ZR5A 4NRPA 3H50A 1SBDA 4BJ0A 3M3OA 2BU9A 3WDVA 4XUPA 2YROA 2O14A 1UZZA 2GNBA 2ARCA 2FDJA 1PGW1 1W39A 5HXVA 4RFT0 5IATA 1BEV1 1W0NA 3ILRA 5FP3A 1MZ6A 1FAYA 5C7GA 4CP9A 5IT6A 4Q4V1 4BWOA 4DEQA 2X05A 3WLUA 4ZY9A 2YC2A 4DQAA 4NPLA 4HVOA 5KHIA 2AUYA 2HEWF 4JDMA 2XKOA 3AP6A 2BBAA 4B7EA 4XOGA 4EROA 3VKNA 2QUOA 4QM8A 2F4PA 2J1TA 5GZFA 4RHV2 4AGGA 2G4IA 5A3WA 4INDA 1MZFA 2OQ7A 3G7DA 4N53A 1FOD2 1GP6A 2DVAA 1RUD1 2HWB1 1WBFA 2Y6KA 2VH9A 3FJSA 3I2GA 3S30A 5J7MA 4AXOA 4PI2A 1J3RA 1GQHA 3S5QA 2A7AA 2EAKA 2VMEA 4AVCA 1JZ8A 4UFIA 4OUSA 2P3YA 1G9BA 1PO13 4NE9A 3FFQA 4RQPB 1RVF1 1UZ0A 1H0BA 1UZYA 2JWPA 2VUAA 4MXVA 1WLTA 2AC1A 3TN92 2R0FA 5CADA 1OH3A 1ODNA 4QXBA 2Y60A 4ASMB 2W87A 2D5FA 5A6YA 4N53C 4P14A 1TMF1 1NA1A 2MEV3 2ZGTA 4MGSA 3WHTA 5JI9A 2RR13 3GZEA 3OPTA 1R1A1 5EP9A 3CJXA 1UX6A 1GOHA 4DB5A 1WBLA 2GAUA 2AENA 3F95A 1DU3D 3Q8CA 5IFPA 3ORJA 2FMDA 1KJRA 5A32B 1WD3A 2CHHA 1AR71 3NV4A 3IDCB 1JS9A 3KM5A 1K12A 5F3EA 4HK8A 3DPRA 4XBLA 1A34A 1NUKA 2Y6GA 4M3CE 5CFDA 3UNPA 5E6HA 1VRBA 1N47A 4M3CA 1NA1C 4KI5M 2QFEA 3OUJA 1OD5A 3RJ2X 1UW8A 1FATA 3V65A 1W9YA 1H1IA 1UY1A 5C3QA 1HDKA 1N3PA 5A7SA 2Q8EA 3PUQA 1Z7S1 5BYNA 4Q0SA 2B45X 4COVA 4D6RA 4HVQA 3ETQA 2JKBA 3A0KA 2D93A 3POSA 3I3QA 4QD2A 5D8AB 4OHVA 1LTEA 2JIJA 1V9U1 3DPRC 1CAWA 1LOGA 1OPMA 1QOTA 3KWVA 4R52A 2W1UA 4Y1VA 5A7WA 5I8YA 5F5QA 2QNKA 1YC61 2Y64A 1PGL2 2ZMNA 3P3NA 1JYNA 1POV0 3ZN6B 1JOJA 1EAH2 2W47A 1IPJA 2CWMA 5F32A 5H9PA 2R073 1O5LA 3HQRA 3FZ3A 3VHOA 3CHXA 4XMAA 5JZGC 2BGPA 1I1EA 3AL5A 3PLQA 3WF3A 4UWDA 4HANA 3I3DA 4HPKA 1RB8G 3ZYFA 4K1ZA 1AL22 4YW6A 3NJZA 4I0WB 3LPGA 4JKKA 3ZDSA 4I02A 3MUY1 4MLOA 2D6KA 4V2VA 1Q8VA 3ST7A 5LY2A 2RMU2 1DQ2A 3R0RA 3EB7A 3T08A 3F2ZA 5L9BA 4YFWA 3HN3A 4NIHA 4MGZE 4BLIA 3FFZA 4GB32 1I5PA 4FPHA 4WM7A 5FP9A 4AAXA 3VD4A 4UT5A 2PHLA 5CBLA 5ABJC 2FDIA 2VMFA 3HQUA 4E4DX 4Q4X3 2ZKLA 1V6OA 3DECA 3BVCA 4G9SB 5IHRA 3MIFA 3HPNA 3VKMA 1NCQB 4O61A 4LOSA 3ZLIA 1IS4A 1CWPA 4YVSB 1ZZ9A 4WM8A 5E16A 5EJZB 3BTAA 3W21A 1UN1A 3NAPA 4YSFA 1BMV2 5C3OA 4YW5A 4NIAA 2OYZA 4LO8A 4OVEA 1H6YA 4QGNA 2YY1A 1SPPA 2R16A 2DVBA 4FAHA 4CXWA 1DG6A 3LA2A 2ZMKA 3N7KA 5FPAA 2ZOEB 4KU8A 1W6QB 2BP6A 1OC1A 1RUC2 4WM8C 2R063 1K5JA 4XW3A 1EYBA 1Y43B 4M0NA 5EJ3A 3NAPC 5HI0A 2WRAA 4DUXA 1LHNA 1UXZA 4XFCA 4QAWA 2JICA 4XJ8A 3TAYA 4DUWA 4G3YC 1NX9A 5FZ7A 3UESA 4ZZ8A 3EHKA 2HWE2 2W1QA 4DINB 4CU9A 1JZ6A 1N1SA 2E32A 4LE4A 3MV01 5I0SA 2JE9A 3A23A 2Y6FA 4AFDA 3WP5A 3IKWA 4DUVA 1ULEA 1G9CA 1MS3A 1O4TA 4JGZB 3WDWA 1XNCA 4B4PA 4URTA 1IS3A 5L9VA 2LROA 2CGOA 4YARA 4D8MA 2ZGRA 3H0OA 3PIJA 5C4WA 5FZDA 4IDZA 3OGGA 1CPNA 4P9WA 4FFGA 2Y0IA 3ZFEB 1H4GA 1L7LA 3ZYRA 5FAXA 3INAA 2ZGQA 3SEEA 2BGOA 2BFUL 2XVLA 2EA7A 2TUNA 3TOJA 1SLIA 4LK6A 5FR3A 3GDBA 3I2FA 4FQZA 3V0BB 1QF3A 4KG0A 2ERFA 4UFLA 2EAAA 5FPVA 3WF4A 3JD72 3O0XA 4Q4W3 3DF0A 1PO11 5AC92 5CA6A 5ACA1 3PVOA 5C4WC 1FPN3 4C90A 2QTWB 1CGPA 2V09A 1ZNPA 3J7MA 1K3IA 3AKRA 3N3HA 1LR5A 4Y4YA 5IUQA 3G6JB 5A32A 4ATEA 2XLFA 4QGLA 3ZSLA 5BNNA 4I0AA 3J4UH 3O1MA 2WS92 4EN7B 2F4LA 1W90A 2RR11 1W06A 1OQ1A 2KA3A 4Y20B 2EALA 2R042 2VW1A 4IUGA 5FMCA 1F4HA 1YO8A 5FDBA 2WABA 2OPWA 5CKNA 1J1LA 1HXS3 2HLEA 2UYBA 1CZTA 4NROA 4WVMA 1HB4A 4P5HA 5LEJA 1OD3A 2HEYF 2ES3A 2ZGLA 3GJBA 1H9PA 2GH8A 3PMEA 2RJKA 3FBMA 4YW7A 2RS33 3DKQA 3TYJA 4BOWA 1RINA 5D8AA 4YM3A 2ZEYA 2QQPA 3WDYA 2VCAA 5JOWA 2R7EB 2C0ZA 3FHQA 1A3KA 4YLZA 3JCIA 2BDRA 4HK9A 2R49A 4UAPA 5F5CA 5FOJB 5FUIA 2A6XA 1RUE2 4FXGB 4TLGA 3AYCA 4FPOB 2ZGOA 1O59A 3D0JA 3P1IA 4SBVA 4XCAA 3RYKA 3MFAA 1H2NA 5HCFA 2E7AA 1W6MB 2JB8A 1SBFA 1KDMA 1JMUB 2RS11 5FZLA 5D8AC 4MGIE 5A6ZA 4WVVA 4I3GA 1EAH3 1HRI3 1NLSA 1ULGA 4FPCA 2RM23 1LAJA 1OVPA 2PLV2 1JTZX 3WDXA 2PA7A 4K8FA 2R071 4LK7A 3WNMA 3W5NA 4ES8A 2GC0A 4OZOA 4BIFA 1VJ2A 4GWNA 4ZU4A 3USUB 4UBHA 2EXKA 1SCRA 3H3ZA 3AZXA 3HIFA 4NUBA 4OQ9A 1C5IA 2G9GA 2WWUA 1WLWA 2XQRA 1JHNA 2C9KA 4I2OA 2X5IA 4N90A 3C2UA 5A3TA 4OMCA 3KV6A 5FMBA 1OLRA 1RXFA 3ACFA 3HBKA 2JDHA 5A33A 1NCQA 5CIRA 3ZXJA 4BPZA 2VXRA 1U0AA 3R4SA 5EFUA 1EY2A 1PIV1 2PHWA 4YVSA 3BKZA 1VBA2 4Q1PA 1SZBA 3ZVXA 5DDJ3 3WQBA 3RGBA 4Q4X1 3K2OA 1ZZ6A 4S2DA 3IM0A 1BEV2 2FQPA 2CTVA 1C8M2 1NG0A 1C3HA 1US3A 2Q1MA 3CL1A 4Y5SA 2RDNA 1WMEA 3RYRA 3U14A 4AFMA 1S0JA 3MIHA 4XAEA 4MOAA 4JQTA 3SISA 1NCQC 5CG9A 4TXWA 1W6QA 4YRDA 4NVPA 3RQ0A 1UOGA 4YVSC 1JI6A 4YG0A 1V0AA 4JZRA 2UWBA 2QCSB 2PTMA 4L97A 3KV5A 2RHPA 2WZR3 2VQTA 3MEPA 5DAPA 2ARBA 1GZTA 4A45A 5C9AA 4Y22A 2RE9A 2VZPA 4IEYA 2DCKA 5IVYA 4H7MA 1IKPA 4Z2AA 1ULOA 1U5ZA 3GHMA 3I2DA 4FO9A 1RMU2 2BVVA 2GP5A 2HWB2 4CCLA 4HKWA 2OIIA 4YW2A 5K4LA 1YEWA 4EQVA 3CZUA 3PL0A 1CAUB 4CUGA 5KHHA 4Z1VA 3EYPA 1JYWA 1CVNA 1GWKA 2VMDA 3B9IA 4AE2A 5IK5A 5KHJA 4JGZA 1VBC3 3VDAA 1PVXA 1UD1A 1FMD1 3NRUA 4S2FA 3VBUB 2XUMA 5C9AC 2ZA9A 2WZPP 5CZKA 1Q8PA 4W6YA 3LWCA 4FFIA 1WCQA 1Q8OA 1UMHA 1TMF2 2VQUA 1ND2B 1AUYA 1CIWA 3O12A 4YW1A 1S0CA 2R0HA 3M2MA 4UI9L 4YW3A 4AAPA 4Z8BA 1LGCA 5C8WA 2BPA2 1N1TA 4D94A 4JGZC 1WMXA 3LCPA 4XIKA 4CCJA 4YZ2A 2OW4A 2OZJA 5A3MA 4E27A 5FLHA 1AR72 3V0BA 4AEDB 3ABZA 3O0VA 2DF7A 2WT1A 4A4AA 2D97A 3MV11 4AG4A 4JX0A 4XQWA 4KG8A 3ZKYA 2KR2A 3N9OA 1RUJ2 4HN0A 5IWFA 1MS1A 1L7RA 5SV8A 1IG0A 4XUTA 3IBMA 4ZS2A 3SQOA 1YXWA 4QHZA 3ZOIA 1Z7S2 3I2IA 5JXGA 3N9NA 4UW6A 1W6NA 1DFQA 2VR4A 4L2NA 1ASJ3 2WA4A 5F39A 2JG8B 1KGYA 1FPN1 4LTAA 3ZYHA 2A6VA 2PHRA 2V4VA 3AFGA 4YNIA 2VNGA 1COV1 3WF0A 2JDPA 1BQPA 3B7MA 1MS4A 2OS2A 1W8ZA 1UYXA 1VLNA 5DUXA 2ADEA 5F3IA 3ZYGA 4OQ8A 5A70A 3VD5A 4JDNA 1YIPA 1EP0A 2RV9A 2BRTA 1TME1 1CN1A 1ZM1A 2WO2A 4KWLA 5EWSA 3EQEA 4BH9A 1G9AA 3SH4A 3J7LA 3KCCA 3PHMA 3P3PA 4O9GA 4QPIB 1HXS1 2JDUA 3L2HA 1UMIA 3DGTA 3N35A 2BUKA 4HMZA 4CP1A 4QT6A 4IEVA 4BK5A 4QX3A 5B4XA 4JDOA 2VGDA 3BB6A 3WG3A 1GZWB 3KHBA 1F35A 1S0DA 1XXNA 5AFBA 3KF5A 2WL1A 1U5IA 4I0BA 2KXLA 1RHI3 4LQRA 4LOTA 4F7ZA 4NRQA 2V5YA 2ZACA 3UKTA 2WO7A 4D69A 3RFRA 2PHUA 4N43B 4COYA 4FAGA 3I3EA 3LZZA 3OGSA 4GKYA 1CAXB 5L9RA 2E53A 5FPBA 3T0AA 2XH6A 3EMRA 3VHPA 2FDGA 3VKOA 2WAAA 2EXIA 5GLZA 5ANQA 4AHWA 1NAEA 4ATFA 2DDUA 1T2XA 4F3JA 3K3NA 3FHIB 2GMMA 4AVTA 5IYYA 1AJOA 4ZPIA 4R9CA 5FQ0B 3BODA 3OGRA 4IE7A 3WNNA 2BTVC 3SKVA 3T4HB 1QJY2 3E97A 3POGA 2D3PA 4AK3A 3ZIXA 4S2HA 5DABA 3FBYA 1QJU3 2VY0A 3VLBB 4BU2A 2WDBA 4L9BA 2E63A 1AYN1 4U36A 1RUH3 3USSA 2RDSA 3HAGA 3ZXLA 3PVEA 1LCLA 4DMIA 4XUQA 2ID4A 2JE8A 3Q8EA 3BYWA 2VOWA 1AX1A 1IGOA 4P9LA 1Q43A 5FZKA 1RIRA 3OY8B 4NJ4A 4XURA 5AFEA 4CYDA 5T54A 1VBA3 3A22A 3WW1A 2FBEA 3UV9A 2BWCA 3JUUA 4CP9B 2DVFA 2WN2A 3NNGA 3E5XA 5I0RA 1ZRRA 5IK7A 3MF9A 2VZSA 2DFBA 3HJRA 3RMYA 5DG1A 2PHDA 5JMCA 5TSWA 1Y9QA 1PX3A 2J1SA 1Y3TA 3GZAA 3IZOA 3LOIA 4XZPA 2AEZA 4GALA 1W9FA 3LEGA 4XFGA 2R6QA 2GALA 4Q0PA 5EYXA 4BIOA 1WW7A 4FSJA 1CIYA 1GP4A 1S2KA 3ILNA 1UF2C 4ORFA 3K77A 5A7QA 4R8HA 4YZ3A 2VNRA 4N53B 4E4ZA 3JBG3 1BKZA 4CPBD 1KQRA 2VBDA 4JAAA 4QMAA 4BQ4A 1PMJX 2CDPA 2BFUS 3AXEA 1XYPA 4FPYA 2WZR1 2FHRA 4Z07A 2O8QA 3RZZA 1GFF2 2DV9A 3AZVA 3DYMA 4QQLA 4E9KA 4IV1A 2V72A 3C7OA 3BPZA 3R4DB 2ZZJA 4QPGB 1J1TA 2UWAA 1O91A 1MS0A 1NZCA 3I54A 1A6CA 1G7YA 1LJ7A 5LWBA 3WEZA 4UW3A 4QB6A 4FTEA 1X36A 5FZ8A 5LK7B 1ND2A 2ZPXA 4W50A 1Q3EA 4Y26A 4A41A 3V0AA 1ZRDA 4GMP0 4HFSA 4AFAA 1YQCA 4NPRA 3HVDA 2K2SA 4KU7A 2D40A 1KFUL 3AXDA 1AYM1 2KM2A 3TEZA 2HWF1 1A8MA 3ZN5A 4LA3A 1RUG2 4PBOA 4BQ5A 1TG7A 1UPIA 1VB2A 3VBUC 4CXXA 1XNTA 2XJUA 2PAKA 3ZXDA 5JR2A 2WFF3 5CFDB 1YHFA 3KSCA 3FUOA 4M3CB 1ND2C 3TEWA 3KLSA 4QDSA 4RA0A 5KXEA 3VL8A 1B09A 2LTNA 2YDEA 3UGHA 2ZGNA 1OSGA 1W8TA 4OUEA 4GMP1 3BIWE 4LHNA 5JSOA 4HN1A 4AGRA 1XSRA 3RSJA 4XMIA 1JOPA 2VUCA 2HBUA 2VZRA 1MS9A 4EN0A 3L2YA 4A7YA 4Y5TA 5JI7A 3BOWA 1GICA 3MF6A 3MFCA 1PZ8A 1VBE1 5A7WB 3POBA 4HSLA 1ENRA 3UK9A 5BPXA 3VZJA 2QQJA 5H9SA 3THPA 1ASJ1 3ZYJB 1OH4A 2P3IA 3TNQA 2ZX1A 3KQRA 2ZMLA 5F3GA 4Y1ZA 1XOYA 3O14A 1UU5A 3OD4A 2C6SA 2OUHA 3N7MA 3ZSJA 3TBDA 5FFOC 1JUIA 1BZWA 2RS12 1DQ5A 4KWKA 4IQPA 1OOPA 1W8HA 1V6LA 5FXVA 1AHSA 4MX3A 1YCIA 4OHXA 4AVBA 2RVAA 4QX1A 1CD3G 3CDZB 1FV2A 2F6BA 3HNBM 3RMXA 2PQSA 3CBNA 4CEWB 1GNZA 1BXHA 1WA6X 2GNMA 2FD8A 2GN3A 5A1LA 3FLTA 4YVWA 3U11A 1I3HA 4AEJA 4CPBA 4OHZA 5FZHA 4F8AA 1D4VB 3AMQA 4WM7B 3OB8A 3I59A 4N43A 3ME2A 3U78A 1UIKA 2YU1A 4QPIC 3AP5A 2HWC3 2WQZC 2YC0A 1CAXA 4KQ7A 5FWEA 3RWNA 1OOPC 2Y0OA 5FPXA 2DFCA 1FX5A 2G9ZA 3HOBA 4XJZA 4YZ1A 5C3SA 3O7OA 1JZ4A 1D4M3 2RS51 3ZM8A 1XYNA 3WSOA 2LS6A 3KV4A 4QX7A 2XL9A 1AR91 3VV1A 2NQYA 3MW4A 2CWSA 5FXZA 1PIV2 2Y26A 3K46A 4YVWC 4CSWA 1OKOA 4XTMA 1SLCA 2VG9A 3GCWA 4Q4Y1 2XL7A 1BBT2 3B69A 2WWSA 3LFMA 4N43C 3SLIA 3RZJA 4COUA 5JOZA 3SH5A 1J59A 1XE7A 1NY71 1FT9A 1VRH3 3DEMA 1SPPB 1C1LA 3UJQA 4FPEA 2ZHMA 2RG4A 1OXCA 3KCXA 4XF3A 1W2AX 3S0MA 1AR81 1O8SA 3I97A 3RZHA 2BGCA 3LDKA 2D6NA 1N3OA 5IVCA 3QLQA 2VOTA 4GXLA 2RDQA 3OY8A 2CGNA 1TNRA 3O0WA 2ZEXA 1RUH1 4LITA 5EZWA 4YZ5A 4FTBA 4XFAA 1W04A 4JV4A 1WGPA 3JQXA 1MPXA 4UFKA 4OMDA 1RUF3 2CU5A 2ZX3A 4HONA 1ENSA 4QHBA 2AR6A 5F5IA 4JTNA 4LIUA 3KHCA 2JKXA 3RRDA 5F37A 5DZEA 1M4WA 4PHZA 3EBRA 2NP0A 1O7FA 5FZOA 3MPBA 3OBRA 4XJUA 1ULDA 4XABA 3PTRB 1FMD2 1SBEA 3GALA 2VZ3A 2GC2A 3QH6A 1GANA 4KWJA 5E1RA 3VZKA 2WO3A 1WWYA 4SLIA 4CUBA 1QJZA 3ETPA 4EN9B 3I8TA 5GZGA 4FFFA 4AFBA 3VZLA 1GWMA 1OA2A 4E2SA 3H1WA 5AVAA 4GIQA 2ZJCA 1WCKA 5C4WB 4D6QA 4XUOA 3PU3A 2GC3A 1RUI3 4PIZA 3H8XA 2VJXA 2NN8A 4UFJA 3JBG1 1VBD3 4QU1A 4QPGA 2F17A 5T5JA 1UWWA 4HKLA 2Z4FA 2VMGA 4LBOA 3C3VA 2JG9B 2R1DA 1OQDA 5F7UA 1OLQA 2SBAA 3S5AA 3K48A 2JIGA 1LOBA 1ND3B 3RNSA 3ZMNA 4MADA 5CNAA 1W0PA 4BMEA 5I0DA 1EV13 4MUVA 1PNGA 1Z78A 2O1QA 4XTPA 3AP7A 5FZ4A 1CX4A 4AF9A 2BBVA 3JB4C 4YZ4A 5CFCB 5BNNB 4CDXA 2A6WA 2XUEA 1ZBE1 4QPGC 4FPFA 2ZAAA 3GJAA 4NPMA 1PMIA 4OYUA 1VBB1 1GV9A 1R081 3N9QA 4QQHA 5FYYA 2VECA 5T5LA 2XJQA 1WCSA 2Z42A 1J83A 5LASA 1COV2 1ZBA2 3H8OA 4X8NA 4XFBA 4A7KA 4NRMA 1PO23 1RGSA 2P34A 2A3XA 2VOKA 1OFNA 1HX6A 3J8F1 3MLJA 4HETA 4WVMB 5F2WA 2NLRA 2LW8A 3LD8A 5FZ9A 1KEXA 2DTWA 3RJRA 1TME2 2JB4A 2VMIA 5F1RA 5EXOA 5CG8A 3J26N 5CFDC 3PIGA 4P9YA 1US2A 1YFWA 2IWGB 2Y34A 3OEAA 2Q30A 3PUIA 5L7OA 4I09A 5A3PA 1F9KA 2QZ2A 2Z69A 2FZ2A 4E8CA 5E89A 3ROUA 2VAUA 3GCXA 3T4VA 3MPPG 4P9XA 1QJX3 1DQ1A 4C0BA 1V00A 1LULA 1VMJA 4BXFA 5IVFA 3UETA 5LA0A 1MZ5A 2UU8A 1JU3A 1ZX5A 2VVEA 3P6BA 3O1UA 2A6YA 2XVGA 1YJKA 4K1YA 2QVSB 4XHXA 4AQ2A 1MEC3 3SCGA 5L7OC 1AXYA 1YQ6A 1UMZA 3GM8A 4CEWA 1PMHX 4MGYE 1VIWB 4D3WA 4NN0A 1PVC2 1YQ5A 3LIGA 3AL6A 3MDPA 2B9UA 4DFSA 2AH2A 4JRLA 2ADDA 2QDNA 4DS0A 3S7EA 3LA3A 2YPJA 3CO2A 1ODMA 2HWD3 2X5IB 1IQAA 4LO5B 3NNLA 3H42B 1D2QA 1WLCA 4FT8A 3VGIA 1IG3A 5D21A 1AYN2 3AMPA 1HW5A 5A33B 4CEWC 4FPLA 2XWBB 5FBJA 2PXJA 5FY9A 5LBBA 4GZ9A 5DZFA 4XBNA 5K0UA 2R32A 3R4UA 3X29B 1XC6A 1SG3A 1UOFA 1D4M1 4WM7C 2K46A 4Y33A 4BQ1A 3AC0A 4LORA 4LLOA 5B2GB 4LLFA 1SFNA 2BVBA 3LFIA 3ZSEA 5EV7A 4LT5A 5DAQA 1QQP3 1REEA 1U12A 2I07B 3I2HA 1HRV1 2XBO3 3ZR6A 3JB8A 3BTYA 2BNNA 3DYOA 5FKBA 3RPQA 4FPGA 2D5HA 2X53S 4JCKA 1GR3A 3K4DA 4JGYA 5K0UC 4AZZA 2V73A 2X10A 1AJKA 5FZ1A 1X7NA 2BEOA 1D0GA 5FMDA 5A3LA 5C9AB 4Y22B 4YFZA 3OTFA 2E33A 2GN7A 1W28A 1RUOA 5JVVA 1FV3A 1W2TA 2WO1A 5FZEA 4EJRA 1LB2A 5D2AA 4BM8A 5H9QA 1ACCA 3SXWA 1UZVA 1SDWA 2W1WA 4IEZA 2OQ6A 3V56A 1SCSA 4NOTA 4XXPA 4HZFA 3SHRA 3VHNA 3T3YA 3DYPA 3MIDA 3N36A 4JGYC 3GYDA 3ZDVA 3VHRA 2LUWA 3WVJA 1X9TA 2WZEA 4IGOA 1DGLA 2B7YA 4FTSA 5FYBA 3N7JA 4MGKE 3IT8A 3VDDB 3WR0A 4HOOA 1SACA 3H1MA 1HQNA 5T5PA 2LALA 2XJPA 3A4UA 4CUCA 1W8UA 3HMYA 4FP2A 5A1FA 1NOVA 4RHV3 1KD7A 1NXMA 2AGSA 4UW5A 2Y6HA 3SEPA 2VQ0A 1FOD3 4K9SA 1I9RA 2HEVF 5L19A 1QNYA 2H0BA 4DXRA 1CAVA 1AYM2 1F8VA 5J09A 2HWF2 2JG9A 2GNDA 2YYOA 4RSUA 3PJYA 4FQ4A 2J42A 5IW0A 2A6ZA 1ND3A 4LA2A 4KNCA 1RUI1 1XYOA 3RZKA 2ZGKA 3PMSA 4FI9A 5FYZA 1VBD1 3GBFA 4YGBA 3IDEA 3APBA 5LB6A 3TN93 5BUVA 1T6GC 1MZEA 2QJVA 1R092 4ASLA 5I91A 1W8OA 1YIFA 3PUAA 1LKNA 5LATA 4CZSA 5D1IA 5CFCA 1W6NB 2MEV1 3WINE 1V6KA 3PURA 4HLTA 4QM9A 1SFYA 2JG9C 4EV0A 4XILA 4R9DA 1NLQA 2XHNA 1X33A 1ND3C 3AB0A 5I0UA 4KWUA 5KR7A 1S2BA 5J36A 2D7FA 1GZCA 4COZA 4K8RB 5LK5A 3OYWB 4BK4A 5FY4A 2WYFA 5CFCC 5EIYB 5LW9A 1W6PB 1AL0G 2FCTA 2YG0A 5FUPA 3WZ1A 4B4RA 3R6SA 2GNTA 3CF6E 4AI3A 5K9YA 2JDYA 2ZAHA 5FYMA 1BCXA 5M0TA 4J6GA 4PIXA 3BU7A 4FOVA 2FCUA 5A3NA 4CXYA 1O3RA 4M4RA 3DCQA 2WSVA 2XGXA 3WV6A 4YG6A 3ES1A 4LO7A 4DXTA 3WNPA 2WNVB 1PK6A 2PHFA 2MNGA 2TNFA 2ZBJA 3TEYA 1QHDA 1W8FA 4AEKA 2JD9A 4R4XA 4HG6B 3IAPA 4KBZA 2P37A 2KD7A 3NV2A 5FZBA 3RI9A 4QHOA 1QJX1 2DCYA 2ZTNA 3FLPA 2DCZA 3WCRA 1H2MA 2RS52 1U5XA 4NHMA 1X9PA 1XE8A 1AL23 3UKNA 1S0FA 4B1LA 2ZX2A 1AR92 2J1EA 4IERA 2DU0A 1PK6C 2IUWA 1MS8A 2C4XA 3GF6A 2VTXJ 5BNOB 1MEC1 1LGBA 2NPIA 1KRIA 2I45A 1H30A 1YJLA 2ETEA 4P9JA 4RGGA 3RVHA 4D7YA 4E4SA 4Q4Y2 5EHDA 3VZMA 2RMU3 4DXSA 1SLTA 3QACA 2EVXA 1UPSA 2CY6A 2DU1A 1JYVA 2J1VA 4GB33 1AR62 1X8EA 1VB4A 4PF1A 3C7GA 3SCHA 4A6SA 2B8MA 1DDLA 1WCDJ 1AR82 3D3AA 5FXXA 1OMIA 3PVBB 2WR9A 3NO8A 3SC7X 3MIEA 5IK8A 4HKOA 3WNLA 1PGW2 3LB9A 4A3ZA 1ZVFA 1BJQA 2Y8KA 2JJ6A 2X5IC 2YPDA 3I7DA 3LQCA 2DUOA 4NR1A 4XF0A 3VUOA 3KVAA 3LDBA 1XRUA 4M3CF 3AKPA 5C6CA 2ET7A 4H55A 4Q4V2 3WP4A 3IN9A 3DKWA 3FN9A 1W2OA 4X6RB 5FCCA 4TTGA 3O1VA 1DQ6A 4ASKA 2V4AA 1DCSA 2Q5TA 3H7JA 3RDIA 3PJQA 2IZWA 2VZVA 5C71A 4AWDA 1AZDA 1VAVA 3RZLA 2J7MA 5CKQA 5FZMA 4N9IA 4F83A 5FZCA 2OUJA 2XBO1 2N7GA 1RUC3 5CISA 5T52A 1LU1A 1CPMA 1UYZA 3ES4A 1BHGA 1RUD2 3ZSKA 2R061 4UFHA 2BOJA 3NWKA 1GOGA 3C7FA 5IVEA 4OUMA 2YZ4A 1W03A 4BQ2A 4GQ7A 2ILMA 2HWE3 2XOMA 1VALA 1AF9A 4IV1B 5KWRA 1BK1A 1NCRB 1RVF2 1J84A 4IGPA 5GLWA 3VDDA 5GLVA 5BNNC 4BMBA 3OUIA 3WXPA 3C8XA 3CZJA 4QB1A 4YGCA 3IMMA 4KL1A 1BLZA 4C1XA 1NLRA 4Q8LA 4JC1A 4AQ6A 2PELA 4LULA 3POYA 3FHAA 2ZKNA 3V0AB 1R1A2 4YYOA 4GH4A 4KGGA 3AMNA 2Y6JA 2IVIB 1QIQA 3WP3A 5CU1A 4H2AA 4QKNA 3O1SA 4RHV1 3VDDC 1ZBE2 4RS5B 1OPOA 1JU4A 1TQ5A 4A6OA 1IZ3A 1FOD1 3KV9A 1VBB2 1R082 4NIIA 3U75A 1CESA 2EIGA 2DVGA 2O0OA 2QQOA 2WKKA 4NAMA 2BYVE 4AVSA 4J1XA 4BQWA 3LDRA 3JD73 4EE2A 5AC93 2ATFA 3SCFA 3HNMA 4Q4W1 2IXKA 3EO6A 5ISLA 3T2PA 2TEPA 5GALA 4CCCA 2HH9A 4IETA 4ZKTB 2GH2A 3VBHB 1V9U2 5FV3A 5FRAA 3HT2A 4PLOA 4PLMA 1DLCA 2WS93 5KXBA 3H3LA 1JYCA 3T0BA 3MLLA 4MHUA 4XEZA 5JDBA 3OYWA 1JBCA 2R043 3T2OA 5I8TA 1HQWA 3WDUA 3AFKA 3VD7A 1BVP1 1W6PA 1XPWA 2AYHA 4AI1A 4NIDA 2VZQA 1S0BA 5FY5A 4B4QA 2ZGSA 4LMFA 1OOPB 1H1MA 4COWA 2EIDA 4M0HA 1LU2A 2VTXA 5F6KA 3WW2A 2C5DA 4LUMA 1OLME 3AM2A 3MUZ1 3AP9A 2RS31 1LOEA 1PZ7A 1GBGA 4XHBA 2WNVA 5A3UA 1JYXA 4K7JA 3LF7A 5IK4A 4MV2A 4YVWB 3L9JT 3IWZA 3U4XA 2CGPA 3PU8A 1RUE3 4CCOA 3I59B 2GDFA 4N8MA 4ISQA 3POIA 1W2NA 2QQWA 1UU4A 2PYTA 1V6MA 1LENA 1TNFA 4XQDA 1W6OA 2YBPA 1LHOA 1SFPA 2QDRA 4IEOA 4XCBA 5FY0A 3WY6A 1LNSA 2BWAA 3ALQA 4Y1UA 2WNVC 5JSPA 1EAH1 1HRI1 3OCPA 5FZIA 2PLV3 2RM21 4WVZA 5BNOA 1YFYA 2W9XA 1LOAA 3CLPA 4NHYA 4UF0B 1Z0HA 4XAAA 5FYCA 3WF2A 4BZ4A 2XPJA 4UXAA 2E7TA 1N3QA 3TNPB 4CDUA 1NKGA 4O9EA 5KHGA 2R30A 3DUIA 3ITQA 2G9FA 2XG3A 3I2JA 3MW2A 4IGQA 4N9HA 4XF9A 4DEVA 5HV4A 5DUWA 4CUAA 1UZWA 2A75A 5AVPA 3AJZA 5FUNA 5KBFA 4N7IA 1X82A 3QOPA 3CNAA 1C57A 1HRV2 3FC0A 2JD4A 3IPVA 3VDCA 3B93A 1IHMA 5BV6A 1F15A 4Z2WA 5BNOC 1H6XA 2ZGMA 1AR63 1WA4A 2VW0A 2W5FA 3I2KA 3M3IA 5FPUA 3NQHA 1KS4A 1TEIA 1XU2A 3OBTA 4KH9A 3AJYA 2GSYA 4LBLA 2ORXA 4YM1A 1UOBA 2VUJA 4CDUC 5FTTC 3LEKA 2BERA 4ISRA 1A8DA 5DDJ1 5DQ0A 1L7QA 3M70A 1LHUA 3DXTA 1H2LA 1BEV3 4FPJA 2K9ZA 1C8M3 2AZ5A 5JPMB 3BI3A 3BUCA 5F6LB 2WLQA 2YMZA 2YBSA 3SMHA 5G05L 1QOOA 5CYYA 1A78A 3KGZA 5FZOB 4CCDA 2GP3A 1R64A 1CONA 4DNYA 3VL9A 3VN4A 4CDQA 5LZ6A 4G4FA 1G8WA 1OT5A 5FP4A 3WF1A 1SHWB 3R05A 1PGSA 1YLLA 2OA2A 5DUUA 1QU0A 1J3PA 3ZKUA 5DZGA 3D0SA 4IEPA 2VMCA 2W94A 4XXAA 2HJIA 3RG0A 3VKLA 3ZYIB 4XPVA 3PNAA 3NNMA 3B9CA 1FYUA 2ZGPA 1QH7A 2DWRA 4W8JA 2IXIA 3ZX7A 1RMU3 4TWTA 1NCRA 1RUC1 2HWB3 1RUD3 4MGQA 4L11A 5JXIA 2Y33A 2B42B 1GP5A 1LECA 4CDQC 3T2TA 4QGMA 4L99A 2CNAA 1YRZA 4CCMA 2HKXA 1MVQA 2L9LA 3E6CC 2HWE1 5JAXA 3ZYBA 3KGLA 3N9PA 5GLTA 1PO12 1VBC1 4YGEA 5ACA2 5A7NA 2VNOA 4EWAA 2XDVA 3I2OA 4PI0A 5LY1A 4IV1C 1AXZA 3I3BA 1DGRA 3D5OA 1F4AA 3H3UA 3HT1A 3OPWA 1TMF3 1NCRC 4CDXB 4Y1YA 5BNPA 4RL7A 3KB5A 4RS5A 2MEV2 4LBNA 3UYJA 4Q8KA 4BCUA 1YI7A 2RR12 3UKVA 4Q5OA 3ZMOA 3T2QA 4PCRA 4LBQD 4XJWA 3GGLA 3LEMA 2OVUA 1AR73 2W0XA 2AEYA 2VTFA 2W39A 5FWJA 4GKXA 1UOJA 4AW7A 4Y24A 2VE1A 1RUJ3 3KQ4B 5A1AA 5BNPC 1DHKB 4UW4A 3VBRA 1DYKA 4RS5C 1C1FA 4AHZA 1URXA 5FMOL 2QE3A 2VUDA 3VBHA 3WOGA 4AYUA 1Z7S3 4IEWA 1RJ7A 1DZQA 3EXUA 5L7OB 1P8JA 1JZ3A 5AC91 3AYDA 3N7LA 2BV4A 2X8KA 2ARAA 3OEBA 1H8TB 5FKCA 2LM3A 3AX4A 2ZABA 2HYXA 5FO7B 2ZX4A 3BU0A 2B39A 4DO0A 1TE1B 2XLAA 3O1RA 3W59A 3VBRC 1IS6A 1OA4A 1UYYA 3NJYA 1UY4A 1F31A 3VBHC 3ACHA 1C28A 4BHPA 3IDBB 3SH3A 1DZTA 1EPWA 1Q8SA 3M1HA 4NHKA 5FYHA 3MICA 1BVVA 4LR4A 2OKXA 2R072 3BTXA 1UCXA 5LEKA 2WINB 1PX4A 3ACIA
chains in the Genus database with same CATH topology
3UT0A 1L7LA 1V0AA 4BQ3A 4YWAA 2O14A 4CP9B 4LK6A 2K46A 3F95A 3ORJA 2LRPA 4A6SA 1GWMA 4AL9A 3ZYHA 2Q1FA 4YW7A 1WZXA 2WYFA 1GWLA 2C24A 4LK7A 4CP9A 1WMXA 4LKFA 1W8TA 1UOJA 1W8WA 1W8ZA 1W9FA 2LROA 2JWPA 1OKOA 2VXJA 3ZYBA 1GWKA 1OH3A 1W8UA 4LJHA 5D21A 4BQ2A 4LKEA 1WCUA 2KR2A 3ZYFA 4CPBD 1W90A 4BQ4A 4YW6A 1HN0A 4CPBA 4BQ5A 4LKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT0 A;  1L7L A;  1V0A A;  4BQ3 A;  4YWA A;  2O14 A;  4CP9 B;  4LK6 A;  2K46 A;  3F95 A;  3ORJ A;  2LRP A;  4A6S A;  1GWM A;  4AL9 A;  3ZYH A;  2Q1F A;  4YW7 A;  1WZX A;  2WYF A;  1GWL A;  2C24 A;  4LK7 A;  4CP9 A;  1WMX A;  4LKF A;  1W8T A;  1UOJ A;  1W8W A;  1W8Z A;  1W9F A;  2LRO A;  2JWP A;  1OKO A;  2VXJ A;  3ZYB A;  1GWK A;  1OH3 A;  1W8U A;  4LJH A;  5D21 A;  4BQ2 A;  4LKE A;  1WCU A;  2KR2 A;  3ZYF A;  4CPB D;  1W90 A;  4BQ4 A;  4YW6 A;  1HN0 A;  4CPB A;  4BQ5 A;  4LKD A; 
#chains in the Genus database with same CATH topology
 4XC9 A;  4TYS A;  5A3O A;  1S2E A;  2VW2 A;  2OT7 A;  3BOP A;  5SV5 A;  3S7I A;  5ERL A;  1V6N A;  1STM A;  4CCE A;  4JVA A;  5FZG A;  1I6X A;  1POV 3;  3M8L A;  1RXG A;  4PQ9 A;  1RHI 1;  1NT0 A;  3E1F 1;  1GNY A;  2IVJ A;  3NVC A;  1VAM A;  4OZX A;  1LHW A;  2OXB A;  2YGM A;  5DN2 A;  5K0U B;  4NWV A;  5C5T A;  2QZ3 A;  4UF0 A;  4Q4X 2;  1ZRE A;  2G19 A;  5FPL A;  2CL2 A;  1AVB A;  4HSJ A;  2K0G A;  4OI1 A;  1RL3 A;  2A73 B;  4E2G A;  5DMY A;  3C7H A;  2EIB A;  1HV1 A;  2QQI A;  3AKQ A;  1VMH A;  2WWJ A;  1GKB A;  1QJY 3;  2DCJ A;  4Z82 A;  3LE0 A;  2JDZ A;  4A42 A;  3PVN A;  4MZU A;  3KT4 A;  2CSG A;  1SDD B;  3AZY A;  5HXM A;  3FX3 A;  2PQQ A;  1E57 A;  2FMY A;  3WUC A;  3ZPY A;  3ELN A;  2TBV A;  2A71 A;  2QQN A;  1QJU 1;  2XB6 C;  3UJO A;  1TZO A;  3JU9 A;  3ZFF B;  4JGY B;  3ZXA C;  2FCV A;  5FK8 A;  3N9L A;  2J22 A;  4M4P A;  4LBQ A;  1PZ9 A;  2FDH A;  4CEY A;  4Q0Q A;  1UKR A;  4BQY A;  3I4I A;  2WII B;  3W20 A;  4IEU A;  4CDW B;  1H4H A;  1EPZ A;  2VNV A;  4L92 A;  5FYS A;  2R06 2;  3OD0 A;  2VVD A;  4E4H A;  5J3U A;  4QWN A;  1CJD A;  1VBA 1;  1NQJ A;  1L3J A;  1VAK A;  2NYY A;  4TSV A;  2QKD A;  1H8V A;  5LA1 A;  1OBN A;  2G1M A;  1YUD A;  5EJ1 B;  2I74 A;  4CEY C;  3AP4 A;  4CU8 A;  1J58 A;  2WT0 A;  1X8M A;  2CV6 A;  2YFU A;  1C8M 1;  4PBP A;  3B3Q E;  2VO5 A;  1RED A;  1HN1 A;  1WKY A;  2A3W A;  4AEM A;  4EYU A;  4O65 A;  2EXH A;  3MI8 A;  1AXK A;  2H6B A;  2BNO A;  2UYA A;  1UO9 A;  4RYD A;  1GQP A;  4FVV A;  3HNY M;  1D2S A;  1CQ9 A;  2E31 A;  2QBX A;  2E7Q A;  1YQ8 A;  3C7E A;  4EZH A;  3H9A A;  1CAV B;  4XDP A;  5FOB B;  4FBF A;  4ZON A;  2RJ2 A;  4DOU A;  4RD7 A;  1NE4 A;  3JQW A;  5FZ3 A;  2ET1 A;  2J1U A;  4TLF A;  1QY4 A;  3FUQ A;  5E88 A;  3I3M A;  1S0E A;  2JEC A;  1RMU 1;  2ZEW A;  3B01 A;  2Y6L A;  3CU7 A;  2ZS6 B;  4L8Q A;  4A3X A;  1GNH A;  3WQ0 A;  4E2Q A;  2WSU A;  2UWC A;  1OUX A;  2SLI A;  3LAG A;  1UX7 A;  4YGD A;  2GU9 A;  5ANN A;  4QKD A;  3M3C A;  4GWJ A;  4LKF A;  1MAC A;  4Q4W 2;  5ACA 3;  3WD5 A;  4W65 A;  4DRR A;  1JXN A;  2IXJ A;  1W8N A;  1FPN 2;  4OFG A;  3ZO0 B;  2ORZ A;  3Q8A A;  3VBO B;  4XE9 A;  1RUG 3;  3ZXF A;  1V70 A;  1G86 A;  3GBG A;  3LPF A;  4MVT A;  2XJR A;  4YPJ A;  4C0H A;  3HWJ A;  3NNJ A;  3WP6 A;  4BQX A;  2WZ8 A;  2WFF 1;  1QOS A;  3NL1 A;  3MIB A;  4R4Z A;  2Q8C A;  1YI9 A;  4CDX C;  5HCH A;  5APA A;  2VC9 A;  5F3C A;  4NAO A;  4ES9 A;  5A6X A;  5JOY A;  1JYT A;  3LOB A;  1K42 A;  4IEQ A;  1HXS 2;  5KHK A;  3T1L A;  2WFP A;  4PLN A;  1EUT A;  2ZZQ A;  5C8C B;  1CX1 A;  3III A;  4XUN A;  2A70 A;  4URA A;  1RUJ 1;  1ULC A;  3HBZ A;  3OGV A;  4FOW A;  1RC6 A;  5T55 A;  1H8T A;  4BE3 A;  2RS3 2;  3Q9O A;  5FP7 A;  4GWI A;  3T0D A;  1DYP A;  2BQP A;  2WNE A;  4QQP A;  1PK6 B;  1J3Q A;  3VZN A;  2I2S A;  5FYI A;  5KXC A;  4B29 A;  4LHS A;  2ZHN A;  1V6I A;  3ATG A;  3A21 A;  5JZG A;  3WG4 A;  2XKP A;  1IPK A;  1UNB A;  1WW5 A;  5A80 A;  5F9T A;  1ZA4 A;  1ZYB A;  2VOV A;  1XND A;  3U07 A;  3IIA A;  1RJ8 A;  1JN2 P;  2DBN A;  2V5D A;  1YFX A;  3WNK A;  5JLV A;  3ACG A;  1MQT B;  2RS1 3;  2VUL A;  5CAZ A;  3OBA A;  3NKT A;  3NV3 A;  1H8T C;  1OHF A;  4JTO A;  3U10 A;  2VPV A;  4RR3 B;  4OI0 A;  1UYP A;  5FYT A;  3MLK A;  5FZ6 A;  1HRI 2;  4RGK A;  2RM2 2;  4GD4 A;  4XF1 A;  4M00 A;  4OHY A;  2UUR A;  4AHX A;  4OUL A;  4MO3 M;  1UIJ A;  2OPK A;  4CP2 A;  2P3J A;  4JQR A;  5ABJ A;  4BLJ A;  1CR7 A;  4K20 A;  4H14 A;  4CA9 A;  2FDK A;  3SNM A;  3DV8 A;  3RS6 A;  1CJP A;  2Q4S A;  2BW8 A;  3ZFG B;  1QEX A;  4B7K A;  4BQ3 A;  2HWC 1;  4WZC A;  3VZO A;  4NHL A;  2D98 A;  4K3U A;  2Y38 A;  3ILF A;  5C33 A;  1JZ2 A;  1POV 1;  1LOC A;  3FLR A;  4FOY A;  5L36 A;  4XFF A;  2DUP A;  1PIV 3;  2IC1 A;  1KFX L;  4FCA A;  1K45 A;  1WZX A;  1K5M B;  1X50 A;  2E9Q A;  4IES A;  1BYH A;  4P08 A;  5DDJ 2;  1BBT 3;  3HR9 A;  3ZFF A;  2XJS A;  1QDC A;  2WNU A;  4QU2 A;  4XQ4 A;  2XJV A;  1KS5 A;  4MXW B;  1W99 A;  2DUR A;  5LBE A;  3ZXG A;  3QBQ A;  1I5Z A;  1QXJ A;  2UY9 A;  5FZ0 A;  4BIS A;  1VRH 1;  3PUS A;  4QXH A;  2CAU A;  1PHM A;  3H8U A;  1QJY 1;  3S57 A;  3J9S A;  1T6B X;  4DY5 A;  5LRS A;  4CDW A;  4Q26 A;  4C1W A;  1D7P M;  4XDQ A;  1GSL A;  4YG3 A;  4Z92 B;  5G04 L;  2D6O X;  2WQ8 A;  1W2U A;  3LKJ A;  1XSQ A;  2PN5 A;  4LBM A;  1NE6 A;  2WZR 2;  4P9G A;  3OGJ A;  5GKA C;  1XNA A;  3ZFF C;  2WNU C;  2DUQ A;  4Q27 A;  1LEM A;  2VBB A;  2VQA A;  1CZV A;  2ZHL A;  3DXU A;  4AFC A;  2NM1 A;  1RUF 1;  1ENX A;  5LA2 A;  5L73 A;  4JHZ A;  2WLP A;  2Z5W A;  4R9B A;  3KF3 A;  5EYY A;  4LBK A;  4CDW C;  4QKB A;  4LE3 A;  3MZH A;  1DGR N;  4P9I A;  3B00 A;  3MBW A;  2E51 A;  1U5Y A;  3MGU A;  1FMD 3;  2ARE A;  1GMM A;  1UY0 A;  1VBC 2;  3POW A;  4NHX A;  1QNW A;  3T09 A;  3Q8F A;  4EWE A;  1S55 A;  4GH4 B;  3POJ A;  4GA9 A;  5GJ6 A;  5JIU A;  2DBI A;  3AYA A;  2DVD A;  3D8C A;  4ZU5 A;  1NYW A;  2QQK A;  1HIX A;  1IKQ A;  2QQL A;  2XXZ A;  1QDO A;  3K3O A;  1IQD C;  4DIQ A;  4C91 A;  2A3Y A;  1W05 A;  3CKH A;  2Q1F A;  2ENR A;  1WLD A;  2CDO A;  3K4A A;  4DPN A;  1XE0 A;  2H0V A;  2VMH A;  1W9T A;  2WA3 A;  1O5U A;  1XB9 A;  3POE A;  4OI4 A;  4P00 B;  3ZIW A;  4DY3 A;  4UFM A;  4UOJ A;  4DZG A;  4GUL A;  5JWP A;  3JXS A;  2XQX A;  1NXD 1;  4XFH A;  3KCY A;  3WNO A;  3AK0 A;  2VCB A;  5FMO S;  1UQX A;  5KXD A;  4RQP A;  4LHL A;  4K6B A;  1EV1 1;  1Q5O A;  5GZE A;  2GMP A;  4QDR A;  4AGV A;  1IPS A;  2XLG A;  3M3E A;  3VBO A;  3WX5 A;  4CU6 A;  1OI6 A;  4MET A;  5JR7 B;  1VBE 2;  2MHF A;  4OI2 A;  4AVA A;  2VL4 A;  3MHZ A;  3BAL A;  1UU6 A;  4KBB A;  3E5U A;  1ASJ 2;  3NMB A;  2C9A A;  2Q8D A;  4ZU7 A;  1YFU A;  4QB2 A;  2RDR A;  2ZEZ A;  1COV 3;  1ZBA 3;  4MH0 E;  4LIV A;  4XJ9 A;  4RQP C;  2XWJ B;  3WCS A;  1YQ2 A;  3ON7 A;  1RUG 1;  5JXH A;  4AI9 A;  1PO2 1;  4AI8 A;  1REF A;  3A0N A;  1G9F A;  4XVH A;  2FZ1 A;  4H3W A;  1SMV A;  1OF4 A;  3VBO C;  4BB3 A;  1YNA A;  3ASI A;  3J7N A;  3QCW A;  4ARY A;  5C8C A;  1JZ5 A;  1TME 3;  4LHK A;  2IFW A;  1ALY A;  4JKL A;  1G6N A;  2P4E A;  2D43 A;  4OHW A;  1OVS A;  5IVJ A;  2P3K A;  1IS5 A;  1Y9M A;  4ARX A;  3ZSM A;  3ZPO A;  3CJI B;  3LSE A;  5FK7 A;  5IAV A;  1MVE A;  4UYB A;  1O6U A;  5DPN A;  4MSV A;  3T1M A;  5C8C C;  4XAC A;  2E6V A;  5FYU A;  3WQ1 A;  1W6O B;  1MQT A;  4AQS A;  1IOA A;  1VMF A;  3GNE A;  1RHI 2;  5DAV A;  4AI2 A;  3I49 A;  3KZ4 C;  4ZS3 A;  5J96 B;  1QJF A;  1WD4 A;  2YC4 A;  4MYE A;  4RR3 A;  1RIT A;  4ZXE A;  2P6C A;  1CZS A;  3ZN6 A;  1W3X A;  2VZU A;  3NNF A;  1WMD A;  5J37 A;  4QDQ A;  4V2W A;  2OX0 A;  3KT7 A;  4EN8 B;  5J48 A;  3RZM A;  3M3Q A;  4V1P A;  3KD4 A;  2EIE A;  1PVC 3;  3LA7 A;  4CU7 A;  3HQX A;  4CDU B;  2BJS A;  3MW3 A;  1QXR A;  1NY7 2;  2W68 A;  1WW4 A;  3BTZ A;  1MQT C;  4A44 A;  3LIH A;  2EIC A;  4LXL A;  4ONU A;  4XYX A;  3ZFG A;  4CVU A;  1KIT A;  2HWD 1;  1XNK A;  3IPV B;  2ZGU A;  4RR3 C;  3VDB A;  5JMO A;  1QJU 2;  5FBZ A;  2W3J A;  4RGA A;  5JXJ A;  1AYN 3;  4FOQ A;  1N1Y A;  1QJE A;  2CYF A;  2VXJ A;  5BXX A;  1HJF A;  1RUH 2;  2IXC A;  3LEI A;  1MS5 A;  4LJH A;  1JOD A;  2YFZ A;  4WBB A;  3WUD A;  1DYO A;  1K5M A;  1QH6 A;  2UY8 A;  3Q8B A;  4HL0 A;  3ZXK A;  4BYY A;  4E8D A;  3AKS A;  1OF3 A;  1H1A A;  1UXX X;  2W2I A;  4IE6 A;  4A7Z A;  4Y1X A;  5IAX A;  4HVR A;  3U4S A;  4GWM A;  1QWR A;  3ZFG C;  1ENQ A;  1LOD A;  3OOX A;  3SIT A;  4MXW A;  2JDK A;  5DXD A;  3BN6 A;  2R1B A;  5LBF A;  5FLJ A;  4IE5 A;  3VD9 A;  1JYI A;  1SEF A;  2VZ1 A;  3AYE A;  2XR4 A;  4RN5 A;  1QQP 1;  4AR2 A;  2W95 A;  4CDQ B;  3W58 A;  1BBT 1;  4L0P A;  1GWL A;  4Q2F A;  3ZN4 A;  4C8D A;  1M06 G;  2GC1 A;  1S4C A;  1K5M C;  1JZ7 A;  4PT6 A;  1PM7 A;  1GOF A;  2WT2 A;  3K4Z A;  4YM2 A;  5T5O A;  4ITC A;  1QXP A;  4XBQ A;  2Q1Z B;  4MHR A;  4LKE A;  4DRV A;  4Y5Z 0;  3IB3 A;  5DAW A;  2BZD A;  4K21 A;  5GLU A;  4CRQ A;  2XVK A;  1BK0 A;  5C3P A;  4QX0 A;  3GXU A;  3ACL A;  4QX2 A;  2W52 A;  1D0H A;  1LOF A;  2QQU A;  3JBG 2;  4MGT A;  2H6C A;  5DG2 A;  4HBN A;  1JUH A;  5KC6 A;  4CCK A;  2FDF A;  4M01 A;  1YWK A;  3S6P A;  2BNM A;  4CTE A;  5C3R A;  4R9A A;  1B35 B;  3IAQ A;  2W08 A;  4GJZ A;  2JEM A;  1OUS A;  4HT1 T;  4PIY A;  1ZRC A;  2ARX A;  4GAZ A;  2ZCW A;  3B5L B;  1TVG A;  1APN A;  4O7X A;  1HLC A;  3PDQ A;  1DBN A;  1LGN A;  1W3V A;  1ZZB A;  1DQ0 A;  1XBF A;  2VZO A;  2Z79 A;  3M4F A;  4U2A A;  1HJG A;  1VE0 A;  2WJS A;  3OJB A;  1Q8Q A;  1LOF C;  5BNP B;  5JIA A;  2B46 X;  2PMW B;  2WAO A;  1UY2 A;  5IJR A;  2YV8 A;  4LBJ A;  3ZYP A;  1ULF A;  3W5M A;  4Q0V A;  1QKQ A;  4FP3 A;  1AYM 3;  4P02 B;  2VZT A;  2ZXQ A;  2HWF 3;  4QKF A;  1ULP A;  2D6L X;  4PF5 A;  1FXZ A;  1VPH A;  2Q0A A;  5I0T A;  4GH4 C;  3J8F 2;  4LO4 B;  5EQU A;  1QMJ A;  3NJX A;  3WW4 A;  3ZFE A;  5HBA A;  2D6M A;  2WFF 2;  4IW3 A;  3B94 A;  5FY7 A;  4AL9 A;  1C8N A;  2OZ6 A;  4ZZ5 A;  3TN9 1;  1SLL A;  3VBR B;  1R09 3;  2Q8O A;  3IMN A;  3OF1 A;  3FWE A;  4XET A;  2D6P A;  3NST A;  1R1Z A;  4GMP 3;  3VBF B;  3UGF A;  1ZZC A;  2P5B A;  4IV3 B;  3V64 A;  1OA3 A;  1QGL A;  3AKT A;  2WUH A;  5FPZ A;  3UGG A;  3ZFE C;  1VBE 3;  3HEI A;  4I3P A;  4XZU G;  5HPO A;  4PQQ A;  1SLB A;  3CMG A;  2XHK A;  3H8R A;  4GJY A;  2VOX A;  5FZA A;  5LCW L;  1HB1 A;  2PHT A;  1F2N A;  5GZC A;  2D3S A;  2YBK A;  2DCT A;  2X09 A;  4Y20 A;  1N1V A;  1ZBA 1;  5DAX A;  1F5F A;  1JW6 A;  1OLM A;  3TRS B;  4QPW A;  1DGW X;  4W6X A;  3WNX A;  3RI8 A;  3LSD A;  2VU9 A;  1VP6 A;  5FRE A;  2ZX0 A;  3TB0 A;  2WN3 A;  1V6J A;  3B02 A;  1H9W A;  3K51 A;  3CJI A;  1F5J A;  1OKQ A;  3CIH A;  5FO8 B;  3OG2 A;  2P17 A;  3HD8 B;  4BA6 A;  3MYX A;  1RYY A;  5HCA A;  4LKD A;  2VCM A;  3UT0 A;  4B3N A;  4B8E A;  5FZF A;  1HV0 A;  3E5Q A;  1E5R A;  3D4K A;  3RWK X;  1PGL 1;  4A2U A;  3VBS B;  3MIG A;  5JUV A;  3CQO A;  2YUE A;  2D3R A;  3URF A;  1ZRI A;  3FL7 A;  1DP0 A;  2AAC A;  3RYP A;  2HWC 2;  1O8P A;  3GZU C;  5BNQ A;  1RTV A;  2RS5 3;  4KMQ A;  3UL2 A;  2C26 A;  3E6B A;  4X8P A;  3CJI C;  1W6M A;  2YXS A;  2C24 A;  1D4M 2;  1DZR A;  3POF A;  4WVW A;  1C4R A;  3AZZ A;  4CP0 A;  2RJL A;  4OLL A;  1AR9 3;  1AX0 A;  2BOI A;  5F5A A;  3U37 A;  1AL2 1;  4DXZ A;  5A7O A;  4PDW B;  4W6W A;  3KT1 A;  5DUV A;  4TN7 A;  4JRA A;  3KS7 A;  2YGL A;  3T30 A;  4Q4Y 3;  5HV0 A;  1C5H A;  3THD A;  1PVC 1;  5CEH A;  4ET7 A;  2RMU 1;  1HN0 A;  3EJK A;  3USU A;  1ZZ7 A;  3NKG A;  2P2K A;  4YWA A;  5KC5 A;  3QD6 A;  1VRH 2;  1JH5 A;  4GB3 1;  1FI2 A;  2JDN A;  3FMG A;  3A7Q A;  4IL7 A;  4LBQ B;  4I30 A;  4CEY B;  4D7S A;  1AR8 3;  3PUH A;  5IVB A;  1POQ A;  2VBP A;  4XIO A;  4XFI A;  3TEX A;  3WQ7 A;  4CCN A;  3IDA A;  1KXG A;  4QX5 A;  4YM0 A;  5C70 A;  1G9D A;  3THT A;  4B1M A;  1E5I A;  5A6Q A;  2VD7 A;  1LES A;  3M7A A;  1W8W A;  1UY3 A;  5FXW A;  1GLH A;  1HB2 A;  3O1T A;  3DL3 A;  4QQ2 A;  4WZF A;  2J1R A;  3AVS A;  2C1F A;  3ECQ A;  4Q4V 3;  4FPK A;  4WV8 A;  1RUF 2;  2JX9 A;  3H7Y A;  3OBZ A;  5BY5 A;  1WUV A;  1UL9 A;  1BMV 1;  3N4M A;  3OPZ A;  3D82 A;  3THC A;  2XON A;  5FYV A;  1Y9G A;  3CEW A;  1LHV A;  2W91 A;  5FIX A;  1XNB A;  5I8S A;  2O8O A;  3WG1 A;  2EF6 A;  5JSR A;  2CAV A;  1PNF A;  4CE8 A;  2YHJ A;  1NZI A;  1O4Y A;  2XML A;  4RFR B;  1HKD A;  2QQM A;  4LEJ A;  4LUK A;  3NV1 A;  5FO9 B;  5HCB A;  2ZHK A;  1O3T A;  2JE7 A;  4AHY A;  3U0Z A;  4PJY A;  1B35 A;  4XDO A;  1S0I A;  1RUI 2;  1RVF 3;  4NMI A;  4OCT A;  4QQO A;  5F2S A;  5FJH A;  3HN1 A;  3LGR A;  4Q0U A;  1SLA A;  1VBD 2;  5CVR A;  5IFT A;  3BPS A;  1ONA A;  3AMH A;  5CB7 A;  1KDK A;  4X6Q B;  1CAU A;  2Z2S B;  1ST8 A;  4NO4 A;  5GZD A;  5FLI A;  2JEN A;  4EN6 B;  1FNZ A;  1DLL A;  1XU1 A;  2YB7 A;  3BGA A;  3P5B A;  1EUU A;  5C5U A;  1R1A 3;  4Q29 A;  1EV1 2;  1XJA A;  1H2K A;  5LRR A;  3VBU A;  3WW3 A;  4EZ4 A;  2WNO A;  2PAE A;  3J7H A;  1MR5 A;  3NJV A;  1B35 C;  4QPY A;  4NIG A;  4JKM A;  4KGQ A;  1DIW A;  4BDV B;  2IFR A;  5FJK A;  3GZT B;  4EWD A;  4TZD A;  1NA1 B;  1ZBE 3;  5J1X A;  1W9W A;  2PHX A;  1JOB A;  5K8S A;  3O1O A;  2QQV A;  2YU2 A;  3SKJ E;  1Y4W A;  3VKF C;  3WT3 A;  1VBB 3;  1R08 3;  2DYC A;  1W9S A;  5EPA A;  1GYK A;  4LO6 B;  1E5H A;  1JHJ A;  2JXA A;  2J1A A;  5B4N A;  2EXJ A;  3JZV A;  1PO2 2;  4AED A;  3J8F 3;  4D6S A;  2WC2 A;  3DPR B;  2B5H A;  3JD7 1;  3VBF A;  1VR3 A;  4AOC A;  4I01 A;  1E5S A;  4FFH A;  4IV3 A;  1O3S A;  2JDM A;  2LRP A;  4J1W A;  2X29 A;  1V9U 3;  2P6H A;  1R09 1;  5A7P A;  4W4Z A;  3ZXE A;  2MPF A;  1DF0 A;  2A5Z A;  5J98 B;  3O5S A;  2IXL A;  4H7L A;  2W46 A;  4QXC A;  2A1X A;  4Y3O A;  1KJL A;  1SQ4 A;  4J25 A;  3D6E A;  5LA9 A;  4BXS V;  5I93 A;  4IE0 A;  3BIE A;  2WS9 1;  3RZG A;  2GZW A;  4LNV A;  5JZG B;  2VCC A;  1S0G A;  2JG8 A;  2DTY A;  1GZ9 A;  1ZZ8 A;  4LPL A;  1W0O A;  4S2G A;  5LBC A;  3WHU A;  1HQL A;  1S1A A;  5FY1 A;  4AED C;  2R04 1;  2PFW A;  1CAW B;  1GUI A;  4ZXK A;  3VBF C;  1ZA7 A;  1QJX 2;  3AMM A;  4FXK B;  1O3Q A;  3VB9 A;  2PAM A;  4IV3 C;  4JHT A;  1OQE A;  5JCT A;  1RUN A;  5JOX A;  2HBT A;  3WG2 A;  3AVR A;  3H1Y A;  4MG2 A;  4AVV A;  3OUH A;  4YW4 A;  3TWI A;  1LED A;  2E26 A;  2JDA A;  3GBW A;  1MEC 2;  4Q1R A;  5FP8 A;  1ZRF A;  5E8A A;  2VVF A;  2JG8 C;  1FNY A;  2B4K A;  5GM0 A;  4D7T A;  2IXH A;  3FE5 A;  4QPI A;  5ABJ B;  5IVV A;  4HPK B;  1YYN A;  3O1P A;  4IEX A;  3BCW A;  3KVB A;  1OFS A;  3U1X A;  2P1B A;  3VBS A;  2NZ9 A;  3DN7 A;  1RUE 1;  3VD3 A;  3KMH A;  1Y7B A;  1GZW A;  5T3N A;  3E6D A;  2HWD 2;  1DGW A;  4QX8 A;  2XJT A;  4AQT A;  3QH7 A;  4UBG A;  2WQ4 A;  5T50 A;  4IE4 A;  2W1S A;  1WMF A;  1GU3 A;  2HYK A;  1Q56 A;  4P5Y A;  4QXK A;  5FY8 A;  4PDW A;  3NW4 A;  4D0Q A;  2PLV 1;  1PM4 A;  4IXL A;  4K40 A;  3WDT A;  1DQ4 A;  2VM9 A;  4NWW A;  4HXC A;  2NMO A;  3VBS C;  1LRH A;  5K7P A;  3K75 B;  2D44 A;  2WNU B;  1UKG A;  1XQN A;  4AI0 A;  5F8P A;  1WW6 A;  1HB3 A;  1NQD A;  5FQ0 A;  2GME A;  3MO4 A;  2B9V A;  3PTY A;  1AX2 A;  3GHN A;  3W9A A;  4WM8 B;  2NMN A;  3N9M A;  1HRV 3;  4ZHN A;  1QQP 2;  1GQG A;  3NAP B;  4XF4 A;  5CKM A;  2WBK A;  2W92 A;  2XBO 2;  3OSD A;  4PDW C;  4Y4R A;  2WYS A;  1OUR A;  1WCU A;  3AZW A;  5H9R A;  5JPN B;  4XJA A;  1O4Z A;  4LKS A;  1AR6 1;  4N7U A;  1UAI A;  3ENR A;  3ZR5 A;  4NRP A;  3H50 A;  1SBD A;  4BJ0 A;  3M3O A;  2BU9 A;  3WDV A;  4XUP A;  2YRO A;  2O14 A;  1UZZ A;  2GNB A;  2ARC A;  2FDJ A;  1PGW 1;  1W39 A;  5HXV A;  4RFT 0;  5IAT A;  1BEV 1;  1W0N A;  3ILR A;  5FP3 A;  1MZ6 A;  1FAY A;  5C7G A;  4CP9 A;  5IT6 A;  4Q4V 1;  4BWO A;  4DEQ A;  2X05 A;  3WLU A;  4ZY9 A;  2YC2 A;  4DQA A;  4NPL A;  4HVO A;  5KHI A;  2AUY A;  2HEW F;  4JDM A;  2XKO A;  3AP6 A;  2BBA A;  4B7E A;  4XOG A;  4ERO A;  3VKN A;  2QUO A;  4QM8 A;  2F4P A;  2J1T A;  5GZF A;  4RHV 2;  4AGG A;  2G4I A;  5A3W A;  4IND A;  1MZF A;  2OQ7 A;  3G7D A;  4N53 A;  1FOD 2;  1GP6 A;  2DVA A;  1RUD 1;  2HWB 1;  1WBF A;  2Y6K A;  2VH9 A;  3FJS A;  3I2G A;  3S30 A;  5J7M A;  4AXO A;  4PI2 A;  1J3R A;  1GQH A;  3S5Q A;  2A7A A;  2EAK A;  2VME A;  4AVC A;  1JZ8 A;  4UFI A;  4OUS A;  2P3Y A;  1G9B A;  1PO1 3;  4NE9 A;  3FFQ A;  4RQP B;  1RVF 1;  1UZ0 A;  1H0B A;  1UZY A;  2JWP A;  2VUA A;  4MXV A;  1WLT A;  2AC1 A;  3TN9 2;  2R0F A;  5CAD A;  1OH3 A;  1ODN A;  4QXB A;  2Y60 A;  4ASM B;  2W87 A;  2D5F A;  5A6Y A;  4N53 C;  4P14 A;  1TMF 1;  1NA1 A;  2MEV 3;  2ZGT A;  4MGS A;  3WHT A;  5JI9 A;  2RR1 3;  3GZE A;  3OPT A;  1R1A 1;  5EP9 A;  3CJX A;  1UX6 A;  1GOH A;  4DB5 A;  1WBL A;  2GAU A;  2AEN A;  3F95 A;  1DU3 D;  3Q8C A;  5IFP A;  3ORJ A;  2FMD A;  1KJR A;  5A32 B;  1WD3 A;  2CHH A;  1AR7 1;  3NV4 A;  3IDC B;  1JS9 A;  3KM5 A;  1K12 A;  5F3E A;  4HK8 A;  3DPR A;  4XBL A;  1A34 A;  1NUK A;  2Y6G A;  4M3C E;  5CFD A;  3UNP A;  5E6H A;  1VRB A;  1N47 A;  4M3C A;  1NA1 C;  4KI5 M;  2QFE A;  3OUJ A;  1OD5 A;  3RJ2 X;  1UW8 A;  1FAT A;  3V65 A;  1W9Y A;  1H1I A;  1UY1 A;  5C3Q A;  1HDK A;  1N3P A;  5A7S A;  2Q8E A;  3PUQ A;  1Z7S 1;  5BYN A;  4Q0S A;  2B45 X;  4COV A;  4D6R A;  4HVQ A;  3ETQ A;  2JKB A;  3A0K A;  2D93 A;  3POS A;  3I3Q A;  4QD2 A;  5D8A B;  4OHV A;  1LTE A;  2JIJ A;  1V9U 1;  3DPR C;  1CAW A;  1LOG A;  1OPM A;  1QOT A;  3KWV A;  4R52 A;  2W1U A;  4Y1V A;  5A7W A;  5I8Y A;  5F5Q A;  2QNK A;  1YC6 1;  2Y64 A;  1PGL 2;  2ZMN A;  3P3N A;  1JYN A;  1POV 0;  3ZN6 B;  1JOJ A;  1EAH 2;  2W47 A;  1IPJ A;  2CWM A;  5F32 A;  5H9P A;  2R07 3;  1O5L A;  3HQR A;  3FZ3 A;  3VHO A;  3CHX A;  4XMA A;  5JZG C;  2BGP A;  1I1E A;  3AL5 A;  3PLQ A;  3WF3 A;  4UWD A;  4HAN A;  3I3D A;  4HPK A;  1RB8 G;  3ZYF A;  4K1Z A;  1AL2 2;  4YW6 A;  3NJZ A;  4I0W B;  3LPG A;  4JKK A;  3ZDS A;  4I02 A;  3MUY 1;  4MLO A;  2D6K A;  4V2V A;  1Q8V A;  3ST7 A;  5LY2 A;  2RMU 2;  1DQ2 A;  3R0R A;  3EB7 A;  3T08 A;  3F2Z A;  5L9B A;  4YFW A;  3HN3 A;  4NIH A;  4MGZ E;  4BLI A;  3FFZ A;  4GB3 2;  1I5P A;  4FPH A;  4WM7 A;  5FP9 A;  4AAX A;  3VD4 A;  4UT5 A;  2PHL A;  5CBL A;  5ABJ C;  2FDI A;  2VMF A;  3HQU A;  4E4D X;  4Q4X 3;  2ZKL A;  1V6O A;  3DEC A;  3BVC A;  4G9S B;  5IHR A;  3MIF A;  3HPN A;  3VKM A;  1NCQ B;  4O61 A;  4LOS A;  3ZLI A;  1IS4 A;  1CWP A;  4YVS B;  1ZZ9 A;  4WM8 A;  5E16 A;  5EJZ B;  3BTA A;  3W21 A;  1UN1 A;  3NAP A;  4YSF A;  1BMV 2;  5C3O A;  4YW5 A;  4NIA A;  2OYZ A;  4LO8 A;  4OVE A;  1H6Y A;  4QGN A;  2YY1 A;  1SPP A;  2R16 A;  2DVB A;  4FAH A;  4CXW A;  1DG6 A;  3LA2 A;  2ZMK A;  3N7K A;  5FPA A;  2ZOE B;  4KU8 A;  1W6Q B;  2BP6 A;  1OC1 A;  1RUC 2;  4WM8 C;  2R06 3;  1K5J A;  4XW3 A;  1EYB A;  1Y43 B;  4M0N A;  5EJ3 A;  3NAP C;  5HI0 A;  2WRA A;  4DUX A;  1LHN A;  1UXZ A;  4XFC A;  4QAW A;  2JIC A;  4XJ8 A;  3TAY A;  4DUW A;  4G3Y C;  1NX9 A;  5FZ7 A;  3UES A;  4ZZ8 A;  3EHK A;  2HWE 2;  2W1Q A;  4DIN B;  4CU9 A;  1JZ6 A;  1N1S A;  2E32 A;  4LE4 A;  3MV0 1;  5I0S A;  2JE9 A;  3A23 A;  2Y6F A;  4AFD A;  3WP5 A;  3IKW A;  4DUV A;  1ULE A;  1G9C A;  1MS3 A;  1O4T A;  4JGZ B;  3WDW A;  1XNC A;  4B4P A;  4URT A;  1IS3 A;  5L9V A;  2LRO A;  2CGO A;  4YAR A;  4D8M A;  2ZGR A;  3H0O A;  3PIJ A;  5C4W A;  5FZD A;  4IDZ A;  3OGG A;  1CPN A;  4P9W A;  4FFG A;  2Y0I A;  3ZFE B;  1H4G A;  1L7L A;  3ZYR A;  5FAX A;  3INA A;  2ZGQ A;  3SEE A;  2BGO A;  2BFU L;  2XVL A;  2EA7 A;  2TUN A;  3TOJ A;  1SLI A;  4LK6 A;  5FR3 A;  3GDB A;  3I2F A;  4FQZ A;  3V0B B;  1QF3 A;  4KG0 A;  2ERF A;  4UFL A;  2EAA A;  5FPV A;  3WF4 A;  3JD7 2;  3O0X A;  4Q4W 3;  3DF0 A;  1PO1 1;  5AC9 2;  5CA6 A;  5ACA 1;  3PVO A;  5C4W C;  1FPN 3;  4C90 A;  2QTW B;  1CGP A;  2V09 A;  1ZNP A;  3J7M A;  1K3I A;  3AKR A;  3N3H A;  1LR5 A;  4Y4Y A;  5IUQ A;  3G6J B;  5A32 A;  4ATE A;  2XLF A;  4QGL A;  3ZSL A;  5BNN A;  4I0A A;  3J4U H;  3O1M A;  2WS9 2;  4EN7 B;  2F4L A;  1W90 A;  2RR1 1;  1W06 A;  1OQ1 A;  2KA3 A;  4Y20 B;  2EAL A;  2R04 2;  2VW1 A;  4IUG A;  5FMC A;  1F4H A;  1YO8 A;  5FDB A;  2WAB A;  2OPW A;  5CKN A;  1J1L A;  1HXS 3;  2HLE A;  2UYB A;  1CZT A;  4NRO A;  4WVM A;  1HB4 A;  4P5H A;  5LEJ A;  1OD3 A;  2HEY F;  2ES3 A;  2ZGL A;  3GJB A;  1H9P A;  2GH8 A;  3PME A;  2RJK A;  3FBM A;  4YW7 A;  2RS3 3;  3DKQ A;  3TYJ A;  4BOW A;  1RIN A;  5D8A A;  4YM3 A;  2ZEY A;  2QQP A;  3WDY A;  2VCA A;  5JOW A;  2R7E B;  2C0Z A;  3FHQ A;  1A3K A;  4YLZ A;  3JCI A;  2BDR A;  4HK9 A;  2R49 A;  4UAP A;  5F5C A;  5FOJ B;  5FUI A;  2A6X A;  1RUE 2;  4FXG B;  4TLG A;  3AYC A;  4FPO B;  2ZGO A;  1O59 A;  3D0J A;  3P1I A;  4SBV A;  4XCA A;  3RYK A;  3MFA A;  1H2N A;  5HCF A;  2E7A A;  1W6M B;  2JB8 A;  1SBF A;  1KDM A;  1JMU B;  2RS1 1;  5FZL A;  5D8A C;  4MGI E;  5A6Z A;  4WVV A;  4I3G A;  1EAH 3;  1HRI 3;  1NLS A;  1ULG A;  4FPC A;  2RM2 3;  1LAJ A;  1OVP A;  2PLV 2;  1JTZ X;  3WDX A;  2PA7 A;  4K8F A;  2R07 1;  4LK7 A;  3WNM A;  3W5N A;  4ES8 A;  2GC0 A;  4OZO A;  4BIF A;  1VJ2 A;  4GWN A;  4ZU4 A;  3USU B;  4UBH A;  2EXK A;  1SCR A;  3H3Z A;  3AZX A;  3HIF A;  4NUB A;  4OQ9 A;  1C5I A;  2G9G A;  2WWU A;  1WLW A;  2XQR A;  1JHN A;  2C9K A;  4I2O A;  2X5I A;  4N90 A;  3C2U A;  5A3T A;  4OMC A;  3KV6 A;  5FMB A;  1OLR A;  1RXF A;  3ACF A;  3HBK A;  2JDH A;  5A33 A;  1NCQ A;  5CIR A;  3ZXJ A;  4BPZ A;  2VXR A;  1U0A A;  3R4S A;  5EFU A;  1EY2 A;  1PIV 1;  2PHW A;  4YVS A;  3BKZ A;  1VBA 2;  4Q1P A;  1SZB A;  3ZVX A;  5DDJ 3;  3WQB A;  3RGB A;  4Q4X 1;  3K2O A;  1ZZ6 A;  4S2D A;  3IM0 A;  1BEV 2;  2FQP A;  2CTV A;  1C8M 2;  1NG0 A;  1C3H A;  1US3 A;  2Q1M A;  3CL1 A;  4Y5S A;  2RDN A;  1WME A;  3RYR A;  3U14 A;  4AFM A;  1S0J A;  3MIH A;  4XAE A;  4MOA A;  4JQT A;  3SIS A;  1NCQ C;  5CG9 A;  4TXW A;  1W6Q A;  4YRD A;  4NVP A;  3RQ0 A;  1UOG A;  4YVS C;  1JI6 A;  4YG0 A;  1V0A A;  4JZR A;  2UWB A;  2QCS B;  2PTM A;  4L97 A;  3KV5 A;  2RHP A;  2WZR 3;  2VQT A;  3MEP A;  5DAP A;  2ARB A;  1GZT A;  4A45 A;  5C9A A;  4Y22 A;  2RE9 A;  2VZP A;  4IEY A;  2DCK A;  5IVY A;  4H7M A;  1IKP A;  4Z2A A;  1ULO A;  1U5Z A;  3GHM A;  3I2D A;  4FO9 A;  1RMU 2;  2BVV A;  2GP5 A;  2HWB 2;  4CCL A;  4HKW A;  2OII A;  4YW2 A;  5K4L A;  1YEW A;  4EQV A;  3CZU A;  3PL0 A;  1CAU B;  4CUG A;  5KHH A;  4Z1V A;  3EYP A;  1JYW A;  1CVN A;  1GWK A;  2VMD A;  3B9I A;  4AE2 A;  5IK5 A;  5KHJ A;  4JGZ A;  1VBC 3;  3VDA A;  1PVX A;  1UD1 A;  1FMD 1;  3NRU A;  4S2F A;  3VBU B;  2XUM A;  5C9A C;  2ZA9 A;  2WZP P;  5CZK A;  1Q8P A;  4W6Y A;  3LWC A;  4FFI A;  1WCQ A;  1Q8O A;  1UMH A;  1TMF 2;  2VQU A;  1ND2 B;  1AUY A;  1CIW A;  3O12 A;  4YW1 A;  1S0C A;  2R0H A;  3M2M A;  4UI9 L;  4YW3 A;  4AAP A;  4Z8B A;  1LGC A;  5C8W A;  2BPA 2;  1N1T A;  4D94 A;  4JGZ C;  1WMX A;  3LCP A;  4XIK A;  4CCJ A;  4YZ2 A;  2OW4 A;  2OZJ A;  5A3M A;  4E27 A;  5FLH A;  1AR7 2;  3V0B A;  4AED B;  3ABZ A;  3O0V A;  2DF7 A;  2WT1 A;  4A4A A;  2D97 A;  3MV1 1;  4AG4 A;  4JX0 A;  4XQW A;  4KG8 A;  3ZKY A;  2KR2 A;  3N9O A;  1RUJ 2;  4HN0 A;  5IWF A;  1MS1 A;  1L7R A;  5SV8 A;  1IG0 A;  4XUT A;  3IBM A;  4ZS2 A;  3SQO A;  1YXW A;  4QHZ A;  3ZOI A;  1Z7S 2;  3I2I A;  5JXG A;  3N9N A;  4UW6 A;  1W6N A;  1DFQ A;  2VR4 A;  4L2N A;  1ASJ 3;  2WA4 A;  5F39 A;  2JG8 B;  1KGY A;  1FPN 1;  4LTA A;  3ZYH A;  2A6V A;  2PHR A;  2V4V A;  3AFG A;  4YNI A;  2VNG A;  1COV 1;  3WF0 A;  2JDP A;  1BQP A;  3B7M A;  1MS4 A;  2OS2 A;  1W8Z A;  1UYX A;  1VLN A;  5DUX A;  2ADE A;  5F3I A;  3ZYG A;  4OQ8 A;  5A70 A;  3VD5 A;  4JDN A;  1YIP A;  1EP0 A;  2RV9 A;  2BRT A;  1TME 1;  1CN1 A;  1ZM1 A;  2WO2 A;  4KWL A;  5EWS A;  3EQE A;  4BH9 A;  1G9A A;  3SH4 A;  3J7L A;  3KCC A;  3PHM A;  3P3P A;  4O9G A;  4QPI B;  1HXS 1;  2JDU A;  3L2H A;  1UMI A;  3DGT A;  3N35 A;  2BUK A;  4HMZ A;  4CP1 A;  4QT6 A;  4IEV A;  4BK5 A;  4QX3 A;  5B4X A;  4JDO A;  2VGD A;  3BB6 A;  3WG3 A;  1GZW B;  3KHB A;  1F35 A;  1S0D A;  1XXN A;  5AFB A;  3KF5 A;  2WL1 A;  1U5I A;  4I0B A;  2KXL A;  1RHI 3;  4LQR A;  4LOT A;  4F7Z A;  4NRQ A;  2V5Y A;  2ZAC A;  3UKT A;  2WO7 A;  4D69 A;  3RFR A;  2PHU A;  4N43 B;  4COY A;  4FAG A;  3I3E A;  3LZZ A;  3OGS A;  4GKY A;  1CAX B;  5L9R A;  2E53 A;  5FPB A;  3T0A A;  2XH6 A;  3EMR A;  3VHP A;  2FDG A;  3VKO A;  2WAA A;  2EXI A;  5GLZ A;  5ANQ A;  4AHW A;  1NAE A;  4ATF A;  2DDU A;  1T2X A;  4F3J A;  3K3N A;  3FHI B;  2GMM A;  4AVT A;  5IYY A;  1AJO A;  4ZPI A;  4R9C A;  5FQ0 B;  3BOD A;  3OGR A;  4IE7 A;  3WNN A;  2BTV C;  3SKV A;  3T4H B;  1QJY 2;  3E97 A;  3POG A;  2D3P A;  4AK3 A;  3ZIX A;  4S2H A;  5DAB A;  3FBY A;  1QJU 3;  2VY0 A;  3VLB B;  4BU2 A;  2WDB A;  4L9B A;  2E63 A;  1AYN 1;  4U36 A;  1RUH 3;  3USS A;  2RDS A;  3HAG A;  3ZXL A;  3PVE A;  1LCL A;  4DMI A;  4XUQ A;  2ID4 A;  2JE8 A;  3Q8E A;  3BYW A;  2VOW A;  1AX1 A;  1IGO A;  4P9L A;  1Q43 A;  5FZK A;  1RIR A;  3OY8 B;  4NJ4 A;  4XUR A;  5AFE A;  4CYD A;  5T54 A;  1VBA 3;  3A22 A;  3WW1 A;  2FBE A;  3UV9 A;  2BWC A;  3JUU A;  4CP9 B;  2DVF A;  2WN2 A;  3NNG A;  3E5X A;  5I0R A;  1ZRR A;  5IK7 A;  3MF9 A;  2VZS A;  2DFB A;  3HJR A;  3RMY A;  5DG1 A;  2PHD A;  5JMC A;  5TSW A;  1Y9Q A;  1PX3 A;  2J1S A;  1Y3T A;  3GZA A;  3IZO A;  3LOI A;  4XZP A;  2AEZ A;  4GAL A;  1W9F A;  3LEG A;  4XFG A;  2R6Q A;  2GAL A;  4Q0P A;  5EYX A;  4BIO A;  1WW7 A;  4FSJ A;  1CIY A;  1GP4 A;  1S2K A;  3ILN A;  1UF2 C;  4ORF A;  3K77 A;  5A7Q A;  4R8H A;  4YZ3 A;  2VNR A;  4N53 B;  4E4Z A;  3JBG 3;  1BKZ A;  4CPB D;  1KQR A;  2VBD A;  4JAA A;  4QMA A;  4BQ4 A;  1PMJ X;  2CDP A;  2BFU S;  3AXE A;  1XYP A;  4FPY A;  2WZR 1;  2FHR A;  4Z07 A;  2O8Q A;  3RZZ A;  1GFF 2;  2DV9 A;  3AZV A;  3DYM A;  4QQL A;  4E9K A;  4IV1 A;  2V72 A;  3C7O A;  3BPZ A;  3R4D B;  2ZZJ A;  4QPG B;  1J1T A;  2UWA A;  1O91 A;  1MS0 A;  1NZC A;  3I54 A;  1A6C A;  1G7Y A;  1LJ7 A;  5LWB A;  3WEZ A;  4UW3 A;  4QB6 A;  4FTE A;  1X36 A;  5FZ8 A;  5LK7 B;  1ND2 A;  2ZPX A;  4W50 A;  1Q3E A;  4Y26 A;  4A41 A;  3V0A A;  1ZRD A;  4GMP 0;  4HFS A;  4AFA A;  1YQC A;  4NPR A;  3HVD A;  2K2S A;  4KU7 A;  2D40 A;  1KFU L;  3AXD A;  1AYM 1;  2KM2 A;  3TEZ A;  2HWF 1;  1A8M A;  3ZN5 A;  4LA3 A;  1RUG 2;  4PBO A;  4BQ5 A;  1TG7 A;  1UPI A;  1VB2 A;  3VBU C;  4CXX A;  1XNT A;  2XJU A;  2PAK A;  3ZXD A;  5JR2 A;  2WFF 3;  5CFD B;  1YHF A;  3KSC A;  3FUO A;  4M3C B;  1ND2 C;  3TEW A;  3KLS A;  4QDS A;  4RA0 A;  5KXE A;  3VL8 A;  1B09 A;  2LTN A;  2YDE A;  3UGH A;  2ZGN A;  1OSG A;  1W8T A;  4OUE A;  4GMP 1;  3BIW E;  4LHN A;  5JSO A;  4HN1 A;  4AGR A;  1XSR A;  3RSJ A;  4XMI A;  1JOP A;  2VUC A;  2HBU A;  2VZR A;  1MS9 A;  4EN0 A;  3L2Y A;  4A7Y A;  4Y5T A;  5JI7 A;  3BOW A;  1GIC A;  3MF6 A;  3MFC A;  1PZ8 A;  1VBE 1;  5A7W B;  3POB A;  4HSL A;  1ENR A;  3UK9 A;  5BPX A;  3VZJ A;  2QQJ A;  5H9S A;  3THP A;  1ASJ 1;  3ZYJ B;  1OH4 A;  2P3I A;  3TNQ A;  2ZX1 A;  3KQR A;  2ZML A;  5F3G A;  4Y1Z A;  1XOY A;  3O14 A;  1UU5 A;  3OD4 A;  2C6S A;  2OUH A;  3N7M A;  3ZSJ A;  3TBD A;  5FFO C;  1JUI A;  1BZW A;  2RS1 2;  1DQ5 A;  4KWK A;  4IQP A;  1OOP A;  1W8H A;  1V6L A;  5FXV A;  1AHS A;  4MX3 A;  1YCI A;  4OHX A;  4AVB A;  2RVA A;  4QX1 A;  1CD3 G;  3CDZ B;  1FV2 A;  2F6B A;  3HNB M;  3RMX A;  2PQS A;  3CBN A;  4CEW B;  1GNZ A;  1BXH A;  1WA6 X;  2GNM A;  2FD8 A;  2GN3 A;  5A1L A;  3FLT A;  4YVW A;  3U11 A;  1I3H A;  4AEJ A;  4CPB A;  4OHZ A;  5FZH A;  4F8A A;  1D4V B;  3AMQ A;  4WM7 B;  3OB8 A;  3I59 A;  4N43 A;  3ME2 A;  3U78 A;  1UIK A;  2YU1 A;  4QPI C;  3AP5 A;  2HWC 3;  2WQZ C;  2YC0 A;  1CAX A;  4KQ7 A;  5FWE A;  3RWN A;  1OOP C;  2Y0O A;  5FPX A;  2DFC A;  1FX5 A;  2G9Z A;  3HOB A;  4XJZ A;  4YZ1 A;  5C3S A;  3O7O A;  1JZ4 A;  1D4M 3;  2RS5 1;  3ZM8 A;  1XYN A;  3WSO A;  2LS6 A;  3KV4 A;  4QX7 A;  2XL9 A;  1AR9 1;  3VV1 A;  2NQY A;  3MW4 A;  2CWS A;  5FXZ A;  1PIV 2;  2Y26 A;  3K46 A;  4YVW C;  4CSW A;  1OKO A;  4XTM A;  1SLC A;  2VG9 A;  3GCW A;  4Q4Y 1;  2XL7 A;  1BBT 2;  3B69 A;  2WWS A;  3LFM A;  4N43 C;  3SLI A;  3RZJ A;  4COU A;  5JOZ A;  3SH5 A;  1J59 A;  1XE7 A;  1NY7 1;  1FT9 A;  1VRH 3;  3DEM A;  1SPP B;  1C1L A;  3UJQ A;  4FPE A;  2ZHM A;  2RG4 A;  1OXC A;  3KCX A;  4XF3 A;  1W2A X;  3S0M A;  1AR8 1;  1O8S A;  3I97 A;  3RZH A;  2BGC A;  3LDK A;  2D6N A;  1N3O A;  5IVC A;  3QLQ A;  2VOT A;  4GXL A;  2RDQ A;  3OY8 A;  2CGN A;  1TNR A;  3O0W A;  2ZEX A;  1RUH 1;  4LIT A;  5EZW A;  4YZ5 A;  4FTB A;  4XFA A;  1W04 A;  4JV4 A;  1WGP A;  3JQX A;  1MPX A;  4UFK A;  4OMD A;  1RUF 3;  2CU5 A;  2ZX3 A;  4HON A;  1ENS A;  4QHB A;  2AR6 A;  5F5I A;  4JTN A;  4LIU A;  3KHC A;  2JKX A;  3RRD A;  5F37 A;  5DZE A;  1M4W A;  4PHZ A;  3EBR A;  2NP0 A;  1O7F A;  5FZO A;  3MPB A;  3OBR A;  4XJU A;  1ULD A;  4XAB A;  3PTR B;  1FMD 2;  1SBE A;  3GAL A;  2VZ3 A;  2GC2 A;  3QH6 A;  1GAN A;  4KWJ A;  5E1R A;  3VZK A;  2WO3 A;  1WWY A;  4SLI A;  4CUB A;  1QJZ A;  3ETP A;  4EN9 B;  3I8T A;  5GZG A;  4FFF A;  4AFB A;  3VZL A;  1GWM A;  1OA2 A;  4E2S A;  3H1W A;  5AVA A;  4GIQ A;  2ZJC A;  1WCK A;  5C4W B;  4D6Q A;  4XUO A;  3PU3 A;  2GC3 A;  1RUI 3;  4PIZ A;  3H8X A;  2VJX A;  2NN8 A;  4UFJ A;  3JBG 1;  1VBD 3;  4QU1 A;  4QPG A;  2F17 A;  5T5J A;  1UWW A;  4HKL A;  2Z4F A;  2VMG A;  4LBO A;  3C3V A;  2JG9 B;  2R1D A;  1OQD A;  5F7U A;  1OLQ A;  2SBA A;  3S5A A;  3K48 A;  2JIG A;  1LOB A;  1ND3 B;  3RNS A;  3ZMN A;  4MAD A;  5CNA A;  1W0P A;  4BME A;  5I0D A;  1EV1 3;  4MUV A;  1PNG A;  1Z78 A;  2O1Q A;  4XTP A;  3AP7 A;  5FZ4 A;  1CX4 A;  4AF9 A;  2BBV A;  3JB4 C;  4YZ4 A;  5CFC B;  5BNN B;  4CDX A;  2A6W A;  2XUE A;  1ZBE 1;  4QPG C;  4FPF A;  2ZAA A;  3GJA A;  4NPM A;  1PMI A;  4OYU A;  1VBB 1;  1GV9 A;  1R08 1;  3N9Q A;  4QQH A;  5FYY A;  2VEC A;  5T5L A;  2XJQ A;  1WCS A;  2Z42 A;  1J83 A;  5LAS A;  1COV 2;  1ZBA 2;  3H8O A;  4X8N A;  4XFB A;  4A7K A;  4NRM A;  1PO2 3;  1RGS A;  2P34 A;  2A3X A;  2VOK A;  1OFN A;  1HX6 A;  3J8F 1;  3MLJ A;  4HET A;  4WVM B;  5F2W A;  2NLR A;  2LW8 A;  3LD8 A;  5FZ9 A;  1KEX A;  2DTW A;  3RJR A;  1TME 2;  2JB4 A;  2VMI A;  5F1R A;  5EXO A;  5CG8 A;  3J26 N;  5CFD C;  3PIG A;  4P9Y A;  1US2 A;  1YFW A;  2IWG B;  2Y34 A;  3OEA A;  2Q30 A;  3PUI A;  5L7O A;  4I09 A;  5A3P A;  1F9K A;  2QZ2 A;  2Z69 A;  2FZ2 A;  4E8C A;  5E89 A;  3ROU A;  2VAU A;  3GCX A;  3T4V A;  3MPP G;  4P9X A;  1QJX 3;  1DQ1 A;  4C0B A;  1V00 A;  1LUL A;  1VMJ A;  4BXF A;  5IVF A;  3UET A;  5LA0 A;  1MZ5 A;  2UU8 A;  1JU3 A;  1ZX5 A;  2VVE A;  3P6B A;  3O1U A;  2A6Y A;  2XVG A;  1YJK A;  4K1Y A;  2QVS B;  4XHX A;  4AQ2 A;  1MEC 3;  3SCG A;  5L7O C;  1AXY A;  1YQ6 A;  1UMZ A;  3GM8 A;  4CEW A;  1PMH X;  4MGY E;  1VIW B;  4D3W A;  4NN0 A;  1PVC 2;  1YQ5 A;  3LIG A;  3AL6 A;  3MDP A;  2B9U A;  4DFS A;  2AH2 A;  4JRL A;  2ADD A;  2QDN A;  4DS0 A;  3S7E A;  3LA3 A;  2YPJ A;  3CO2 A;  1ODM A;  2HWD 3;  2X5I B;  1IQA A;  4LO5 B;  3NNL A;  3H42 B;  1D2Q A;  1WLC A;  4FT8 A;  3VGI A;  1IG3 A;  5D21 A;  1AYN 2;  3AMP A;  1HW5 A;  5A33 B;  4CEW C;  4FPL A;  2XWB B;  5FBJ A;  2PXJ A;  5FY9 A;  5LBB A;  4GZ9 A;  5DZF A;  4XBN A;  5K0U A;  2R32 A;  3R4U A;  3X29 B;  1XC6 A;  1SG3 A;  1UOF A;  1D4M 1;  4WM7 C;  2K46 A;  4Y33 A;  4BQ1 A;  3AC0 A;  4LOR A;  4LLO A;  5B2G B;  4LLF A;  1SFN A;  2BVB A;  3LFI A;  3ZSE A;  5EV7 A;  4LT5 A;  5DAQ A;  1QQP 3;  1REE A;  1U12 A;  2I07 B;  3I2H A;  1HRV 1;  2XBO 3;  3ZR6 A;  3JB8 A;  3BTY A;  2BNN A;  3DYO A;  5FKB A;  3RPQ A;  4FPG A;  2D5H A;  2X53 S;  4JCK A;  1GR3 A;  3K4D A;  4JGY A;  5K0U C;  4AZZ A;  2V73 A;  2X10 A;  1AJK A;  5FZ1 A;  1X7N A;  2BEO A;  1D0G A;  5FMD A;  5A3L A;  5C9A B;  4Y22 B;  4YFZ A;  3OTF A;  2E33 A;  2GN7 A;  1W28 A;  1RUO A;  5JVV A;  1FV3 A;  1W2T A;  2WO1 A;  5FZE A;  4EJR A;  1LB2 A;  5D2A A;  4BM8 A;  5H9Q A;  1ACC A;  3SXW A;  1UZV A;  1SDW A;  2W1W A;  4IEZ A;  2OQ6 A;  3V56 A;  1SCS A;  4NOT A;  4XXP A;  4HZF A;  3SHR A;  3VHN A;  3T3Y A;  3DYP A;  3MID A;  3N36 A;  4JGY C;  3GYD A;  3ZDV A;  3VHR A;  2LUW A;  3WVJ A;  1X9T A;  2WZE A;  4IGO A;  1DGL A;  2B7Y A;  4FTS A;  5FYB A;  3N7J A;  4MGK E;  3IT8 A;  3VDD B;  3WR0 A;  4HOO A;  1SAC A;  3H1M A;  1HQN A;  5T5P A;  2LAL A;  2XJP A;  3A4U A;  4CUC A;  1W8U A;  3HMY A;  4FP2 A;  5A1F A;  1NOV A;  4RHV 3;  1KD7 A;  1NXM A;  2AGS A;  4UW5 A;  2Y6H A;  3SEP A;  2VQ0 A;  1FOD 3;  4K9S A;  1I9R A;  2HEV F;  5L19 A;  1QNY A;  2H0B A;  4DXR A;  1CAV A;  1AYM 2;  1F8V A;  5J09 A;  2HWF 2;  2JG9 A;  2GND A;  2YYO A;  4RSU A;  3PJY A;  4FQ4 A;  2J42 A;  5IW0 A;  2A6Z A;  1ND3 A;  4LA2 A;  4KNC A;  1RUI 1;  1XYO A;  3RZK A;  2ZGK A;  3PMS A;  4FI9 A;  5FYZ A;  1VBD 1;  3GBF A;  4YGB A;  3IDE A;  3APB A;  5LB6 A;  3TN9 3;  5BUV A;  1T6G C;  1MZE A;  2QJV A;  1R09 2;  4ASL A;  5I91 A;  1W8O A;  1YIF A;  3PUA A;  1LKN A;  5LAT A;  4CZS A;  5D1I A;  5CFC A;  1W6N B;  2MEV 1;  3WIN E;  1V6K A;  3PUR A;  4HLT A;  4QM9 A;  1SFY A;  2JG9 C;  4EV0 A;  4XIL A;  4R9D A;  1NLQ A;  2XHN A;  1X33 A;  1ND3 C;  3AB0 A;  5I0U A;  4KWU A;  5KR7 A;  1S2B A;  5J36 A;  2D7F A;  1GZC A;  4COZ A;  4K8R B;  5LK5 A;  3OYW B;  4BK4 A;  5FY4 A;  2WYF A;  5CFC C;  5EIY B;  5LW9 A;  1W6P B;  1AL0 G;  2FCT A;  2YG0 A;  5FUP A;  3WZ1 A;  4B4R A;  3R6S A;  2GNT A;  3CF6 E;  4AI3 A;  5K9Y A;  2JDY A;  2ZAH A;  5FYM A;  1BCX A;  5M0T A;  4J6G A;  4PIX A;  3BU7 A;  4FOV A;  2FCU A;  5A3N A;  4CXY A;  1O3R A;  4M4R A;  3DCQ A;  2WSV A;  2XGX A;  3WV6 A;  4YG6 A;  3ES1 A;  4LO7 A;  4DXT A;  3WNP A;  2WNV B;  1PK6 A;  2PHF A;  2MNG A;  2TNF A;  2ZBJ A;  3TEY A;  1QHD A;  1W8F A;  4AEK A;  2JD9 A;  4R4X A;  4HG6 B;  3IAP A;  4KBZ A;  2P37 A;  2KD7 A;  3NV2 A;  5FZB A;  3RI9 A;  4QHO A;  1QJX 1;  2DCY A;  2ZTN A;  3FLP A;  2DCZ A;  3WCR A;  1H2M A;  2RS5 2;  1U5X A;  4NHM A;  1X9P A;  1XE8 A;  1AL2 3;  3UKN A;  1S0F A;  4B1L A;  2ZX2 A;  1AR9 2;  2J1E A;  4IER A;  2DU0 A;  1PK6 C;  2IUW A;  1MS8 A;  2C4X A;  3GF6 A;  2VTX J;  5BNO B;  1MEC 1;  1LGB A;  2NPI A;  1KRI A;  2I45 A;  1H30 A;  1YJL A;  2ETE A;  4P9J A;  4RGG A;  3RVH A;  4D7Y A;  4E4S A;  4Q4Y 2;  5EHD A;  3VZM A;  2RMU 3;  4DXS A;  1SLT A;  3QAC A;  2EVX A;  1UPS A;  2CY6 A;  2DU1 A;  1JYV A;  2J1V A;  4GB3 3;  1AR6 2;  1X8E A;  1VB4 A;  4PF1 A;  3C7G A;  3SCH A;  4A6S A;  2B8M A;  1DDL A;  1WCD J;  1AR8 2;  3D3A A;  5FXX A;  1OMI A;  3PVB B;  2WR9 A;  3NO8 A;  3SC7 X;  3MIE A;  5IK8 A;  4HKO A;  3WNL A;  1PGW 2;  3LB9 A;  4A3Z A;  1ZVF A;  1BJQ A;  2Y8K A;  2JJ6 A;  2X5I C;  2YPD A;  3I7D A;  3LQC A;  2DUO A;  4NR1 A;  4XF0 A;  3VUO A;  3KVA A;  3LDB A;  1XRU A;  4M3C F;  3AKP A;  5C6C A;  2ET7 A;  4H55 A;  4Q4V 2;  3WP4 A;  3IN9 A;  3DKW A;  3FN9 A;  1W2O A;  4X6R B;  5FCC A;  4TTG A;  3O1V A;  1DQ6 A;  4ASK A;  2V4A A;  1DCS A;  2Q5T A;  3H7J A;  3RDI A;  3PJQ A;  2IZW A;  2VZV A;  5C71 A;  4AWD A;  1AZD A;  1VAV A;  3RZL A;  2J7M A;  5CKQ A;  5FZM A;  4N9I A;  4F83 A;  5FZC A;  2OUJ A;  2XBO 1;  2N7G A;  1RUC 3;  5CIS A;  5T52 A;  1LU1 A;  1CPM A;  1UYZ A;  3ES4 A;  1BHG A;  1RUD 2;  3ZSK A;  2R06 1;  4UFH A;  2BOJ A;  3NWK A;  1GOG A;  3C7F A;  5IVE A;  4OUM A;  2YZ4 A;  1W03 A;  4BQ2 A;  4GQ7 A;  2ILM A;  2HWE 3;  2XOM A;  1VAL A;  1AF9 A;  4IV1 B;  5KWR A;  1BK1 A;  1NCR B;  1RVF 2;  1J84 A;  4IGP A;  5GLW A;  3VDD A;  5GLV A;  5BNN C;  4BMB A;  3OUI A;  3WXP A;  3C8X A;  3CZJ A;  4QB1 A;  4YGC A;  3IMM A;  4KL1 A;  1BLZ A;  4C1X A;  1NLR A;  4Q8L A;  4JC1 A;  4AQ6 A;  2PEL A;  4LUL A;  3POY A;  3FHA A;  2ZKN A;  3V0A B;  1R1A 2;  4YYO A;  4GH4 A;  4KGG A;  3AMN A;  2Y6J A;  2IVI B;  1QIQ A;  3WP3 A;  5CU1 A;  4H2A A;  4QKN A;  3O1S A;  4RHV 1;  3VDD C;  1ZBE 2;  4RS5 B;  1OPO A;  1JU4 A;  1TQ5 A;  4A6O A;  1IZ3 A;  1FOD 1;  3KV9 A;  1VBB 2;  1R08 2;  4NII A;  3U75 A;  1CES A;  2EIG A;  2DVG A;  2O0O A;  2QQO A;  2WKK A;  4NAM A;  2BYV E;  4AVS A;  4J1X A;  4BQW A;  3LDR A;  3JD7 3;  4EE2 A;  5AC9 3;  2ATF A;  3SCF A;  3HNM A;  4Q4W 1;  2IXK A;  3EO6 A;  5ISL A;  3T2P A;  2TEP A;  5GAL A;  4CCC A;  2HH9 A;  4IET A;  4ZKT B;  2GH2 A;  3VBH B;  1V9U 2;  5FV3 A;  5FRA A;  3HT2 A;  4PLO A;  4PLM A;  1DLC A;  2WS9 3;  5KXB A;  3H3L A;  1JYC A;  3T0B A;  3MLL A;  4MHU A;  4XEZ A;  5JDB A;  3OYW A;  1JBC A;  2R04 3;  3T2O A;  5I8T A;  1HQW A;  3WDU A;  3AFK A;  3VD7 A;  1BVP 1;  1W6P A;  1XPW A;  2AYH A;  4AI1 A;  4NID A;  2VZQ A;  1S0B A;  5FY5 A;  4B4Q A;  2ZGS A;  4LMF A;  1OOP B;  1H1M A;  4COW A;  2EID A;  4M0H A;  1LU2 A;  2VTX A;  5F6K A;  3WW2 A;  2C5D A;  4LUM A;  1OLM E;  3AM2 A;  3MUZ 1;  3AP9 A;  2RS3 1;  1LOE A;  1PZ7 A;  1GBG A;  4XHB A;  2WNV A;  5A3U A;  1JYX A;  4K7J A;  3LF7 A;  5IK4 A;  4MV2 A;  4YVW B;  3L9J T;  3IWZ A;  3U4X A;  2CGP A;  3PU8 A;  1RUE 3;  4CCO A;  3I59 B;  2GDF A;  4N8M A;  4ISQ A;  3POI A;  1W2N A;  2QQW A;  1UU4 A;  2PYT A;  1V6M A;  1LEN A;  1TNF A;  4XQD A;  1W6O A;  2YBP A;  1LHO A;  1SFP A;  2QDR A;  4IEO A;  4XCB A;  5FY0 A;  3WY6 A;  1LNS A;  2BWA A;  3ALQ A;  4Y1U A;  2WNV C;  5JSP A;  1EAH 1;  1HRI 1;  3OCP A;  5FZI A;  2PLV 3;  2RM2 1;  4WVZ A;  5BNO A;  1YFY A;  2W9X A;  1LOA A;  3CLP A;  4NHY A;  4UF0 B;  1Z0H A;  4XAA A;  5FYC A;  3WF2 A;  4BZ4 A;  2XPJ A;  4UXA A;  2E7T A;  1N3Q A;  3TNP B;  4CDU A;  1NKG A;  4O9E A;  5KHG A;  2R30 A;  3DUI A;  3ITQ A;  2G9F A;  2XG3 A;  3I2J A;  3MW2 A;  4IGQ A;  4N9H A;  4XF9 A;  4DEV A;  5HV4 A;  5DUW A;  4CUA A;  1UZW A;  2A75 A;  5AVP A;  3AJZ A;  5FUN A;  5KBF A;  4N7I A;  1X82 A;  3QOP A;  3CNA A;  1C57 A;  1HRV 2;  3FC0 A;  2JD4 A;  3IPV A;  3VDC A;  3B93 A;  1IHM A;  5BV6 A;  1F15 A;  4Z2W A;  5BNO C;  1H6X A;  2ZGM A;  1AR6 3;  1WA4 A;  2VW0 A;  2W5F A;  3I2K A;  3M3I A;  5FPU A;  3NQH A;  1KS4 A;  1TEI A;  1XU2 A;  3OBT A;  4KH9 A;  3AJY A;  2GSY A;  4LBL A;  2ORX A;  4YM1 A;  1UOB A;  2VUJ A;  4CDU C;  5FTT C;  3LEK A;  2BER A;  4ISR A;  1A8D A;  5DDJ 1;  5DQ0 A;  1L7Q A;  3M70 A;  1LHU A;  3DXT A;  1H2L A;  1BEV 3;  4FPJ A;  2K9Z A;  1C8M 3;  2AZ5 A;  5JPM B;  3BI3 A;  3BUC A;  5F6L B;  2WLQ A;  2YMZ A;  2YBS A;  3SMH A;  5G05 L;  1QOO A;  5CYY A;  1A78 A;  3KGZ A;  5FZO B;  4CCD A;  2GP3 A;  1R64 A;  1CON A;  4DNY A;  3VL9 A;  3VN4 A;  4CDQ A;  5LZ6 A;  4G4F A;  1G8W A;  1OT5 A;  5FP4 A;  3WF1 A;  1SHW B;  3R05 A;  1PGS A;  1YLL A;  2OA2 A;  5DUU A;  1QU0 A;  1J3P A;  3ZKU A;  5DZG A;  3D0S A;  4IEP A;  2VMC A;  2W94 A;  4XXA A;  2HJI A;  3RG0 A;  3VKL A;  3ZYI B;  4XPV A;  3PNA A;  3NNM A;  3B9C A;  1FYU A;  2ZGP A;  1QH7 A;  2DWR A;  4W8J A;  2IXI A;  3ZX7 A;  1RMU 3;  4TWT A;  1NCR A;  1RUC 1;  2HWB 3;  1RUD 3;  4MGQ A;  4L11 A;  5JXI A;  2Y33 A;  2B42 B;  1GP5 A;  1LEC A;  4CDQ C;  3T2T A;  4QGM A;  4L99 A;  2CNA A;  1YRZ A;  4CCM A;  2HKX A;  1MVQ A;  2L9L A;  3E6C C;  2HWE 1;  5JAX A;  3ZYB A;  3KGL A;  3N9P A;  5GLT A;  1PO1 2;  1VBC 1;  4YGE A;  5ACA 2;  5A7N A;  2VNO A;  4EWA A;  2XDV A;  3I2O A;  4PI0 A;  5LY1 A;  4IV1 C;  1AXZ A;  3I3B A;  1DGR A;  3D5O A;  1F4A A;  3H3U A;  3HT1 A;  3OPW A;  1TMF 3;  1NCR C;  4CDX B;  4Y1Y A;  5BNP A;  4RL7 A;  3KB5 A;  4RS5 A;  2MEV 2;  4LBN A;  3UYJ A;  4Q8K A;  4BCU A;  1YI7 A;  2RR1 2;  3UKV A;  4Q5O A;  3ZMO A;  3T2Q A;  4PCR A;  4LBQ D;  4XJW A;  3GGL A;  3LEM A;  2OVU A;  1AR7 3;  2W0X A;  2AEY A;  2VTF A;  2W39 A;  5FWJ A;  4GKX A;  1UOJ A;  4AW7 A;  4Y24 A;  2VE1 A;  1RUJ 3;  3KQ4 B;  5A1A A;  5BNP C;  1DHK B;  4UW4 A;  3VBR A;  1DYK A;  4RS5 C;  1C1F A;  4AHZ A;  1URX A;  5FMO L;  2QE3 A;  2VUD A;  3VBH A;  3WOG A;  4AYU A;  1Z7S 3;  4IEW A;  1RJ7 A;  1DZQ A;  3EXU A;  5L7O B;  1P8J A;  1JZ3 A;  5AC9 1;  3AYD A;  3N7L A;  2BV4 A;  2X8K A;  2ARA A;  3OEB A;  1H8T B;  5FKC A;  2LM3 A;  3AX4 A;  2ZAB A;  2HYX A;  5FO7 B;  2ZX4 A;  3BU0 A;  2B39 A;  4DO0 A;  1TE1 B;  2XLA A;  3O1R A;  3W59 A;  3VBR C;  1IS6 A;  1OA4 A;  1UYY A;  3NJY A;  1UY4 A;  1F31 A;  3VBH C;  3ACH A;  1C28 A;  4BHP A;  3IDB B;  3SH3 A;  1DZT A;  1EPW A;  1Q8S A;  3M1H A;  4NHK A;  5FYH A;  3MIC A;  1BVV A;  4LR4 A;  2OKX A;  2R07 2;  3BTX A;  1UCX A;  5LEK A;  2WIN B;  1PX4 A;  3ACI A; 
#chains in the Genus database with same CATH homology
 3UT0 A;  1L7L A;  1V0A A;  4BQ3 A;  4YWA A;  2O14 A;  4CP9 B;  4LK6 A;  2K46 A;  3F95 A;  3ORJ A;  2LRP A;  4A6S A;  1GWM A;  4AL9 A;  3ZYH A;  2Q1F A;  4YW7 A;  1WZX A;  2WYF A;  1GWL A;  2C24 A;  4LK7 A;  4CP9 A;  1WMX A;  4LKF A;  1W8T A;  1UOJ A;  1W8W A;  1W8Z A;  1W9F A;  2LRO A;  2JWP A;  1OKO A;  2VXJ A;  3ZYB A;  1GWK A;  1OH3 A;  1W8U A;  4LJH A;  5D21 A;  4BQ2 A;  4LKE A;  1WCU A;  2KR2 A;  3ZYF A;  4CPB D;  1W90 A;  4BQ4 A;  4YW6 A;  1HN0 A;  4CPB A;  4BQ5 A;  4LKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...