1W90A

Cbm29-2 mutant d114a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
151
Chain Sequence
VRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIAFQDAPGNGDRIWIKNLVHSTGSADDFVDPINLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
molecule keywords NON-CATALYTIC PROTEIN 1
total genus 32
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w90A00
4LK6A 3ZYHA 4A6SA 4CPBD 4YW6A 4BQ5A 1WCUA 3UT0A 4YW7A 1HN0A 1W8ZA 1W9FA 1GWLA 4LKFA 4CP9A 2K46A 4BQ2A 4LK7A 1W8TA 2JWPA 4AL9A 4CPBA 1W8UA 3ZYFA 2WYFA 1W8WA 1V0AA 1WMXA 4LKDA 4LJHA 2KR2A 4LKEA 2LRPA 4BQ3A 3ZYBA 4YWAA 4CP9B 1WZXA 1UOJA 4BQ4A 5D21A 1GWMA 2LROA 1W90A 3F95A 1OH3A 2VXJA 1GWKA 3ORJA 2O14A 2C24A 2Q1FA 1L7LA 1OKOA
chains in the Genus database with same CATH superfamily
3EB7A 1VMFA 4C91A 2VG9A 5DAQA 3GBGA 3PUAA 3P3NA 3DL3A 3FBMA 4XURA 1Q5OA 4ONUA 5FXWA 5A3PA 3CKHA 4I02A 4IERA 4GULA 5DAXA 2QQNA 4QX0A 4D6SA 1AR92 3PUIA 2R6QA 1B35B 2VNVA 5F1RA 3AL6A 4XDQA 1W28A 1N1SA 1VRH2 2QUOA 3GZTB 4QHBA 1H2NA 2C6SA 3I2IA 1UCXA 3MIFA 4MV2A 5I93A 2W87A 2WDBA 1MACA 1DP0A 5I0RA 1OC1A 4KH9A 3WX5A 1UXXX 4TLGA 1CR7A 2JIJA 2CHHA 3BUCA 1SFNA 2HWD2 2MHFA 4Q29A 3ZDSA 2A5ZA 3HN1A 4AYUA 1ND3A 2R043 4AFDA 1JYXA 2K2SA 4MGSA 1VBC2 1GZWB 2JECA 3PTYA 2VZPA 4MO3M 3WDYA 3ZN4A 2FDFA 3HNBM 3OGGA 1O7FA 4Q4V3 5GLWA 2GDFA 4V2WA 1WMEA 5LK7B 2Z79A 1N3OA 4QGMA 3IDAA 3E97A 4TYSA 5F39A 5A3WA 5EYXA 4CSWA 4UAPA 4PF1A 2J1VA 3ZX7A 1OQ1A 1XU2A 5C3OA 3J8F2 2B39A 3POGA 5HI0A 1NZCA 2YGMA 2CV6A 2HYKA 1KQRA 3VB9A 4OZXA 3VZNA 2Z4FA 1R091 4QKBA 3H8XA 1O3QA 5A6QA 1UU5A 2G9ZA 4FP2A 5ABJC 3KCCA 3LDBA 4Q4V2 1T2XA 1BEV3 3F95A 3C7OA 4XUQA 1B09A 2BWAA 1POQA 5A7WA 2RDNA 3BALA 2G1MA 5LK5A 2NN8A 3WP4A 2Z69A 4W50A 1VPHA 1LOFC 2UWCA 4C0BA 2F6BA 2I74A 4JDOA 2WA3A 1H30A 1QNWA 1NLQA 2DCKA 2AEZA 4GALA 1W9SA 2FBEA 3WZ1A 1AXYA 3M1HA 3ZYBA 3DKWA 1RUH2 3HEIA 5FZ8A 2XPJA 4HT1T 3FC0A 2EAAA 2HWF2 3ZFEB 5FP7A 3LEGA 1JYVA 1QXRA 4P5HA 1R093 1W9YA 5CFCC 5L7OB 1HB1A 3ORJA 2CTVA 3U1XA 2X10A 2IVJA 1RUG1 1OXCA 5C5TA 3WF4A 1AXZA 5J3UA 2XL7A 1XYPA 2X29A 5KXEA 4P14A 2W5FA 5SV8A 3HJRA 3H0OA 5TSWA 4I3GA 3WDXA 1FPN2 4Q8LA 1OT5A 2A75A 1C8M3 4RGAA 1BK0A 3N7KA 1UD1A 5E6HA 3LAGA 2VTFA 2VBDA 2GSYA 1YJLA 1HRI2 2J42A 2RS12 3IZOA 4OHVA 4OHZA 3VBOB 4AEJA 3A0NA 1LOBA 1XC6A 3LDKA 2VOTA 4RFRB 4OVEA 1O8SA 1ZRDA 2HLEA 5J09A 2A6ZA 2YHJA 1UN1A 2G19A 3Q8EA 4FPEA 4XIKA 5FUIA 1WCQA 1GKBA 4NVPA 5FBJA 3RMYA 4AHZA 5FYHA 5FXVA 5AC93 5C8CB 1IOAA 4EN0A 1QJU2 5FPBA 2AYHA 3I2HA 5L9BA 1EUTA 4H55A 3LSEA 3B9CA 4B3NA 4MOAA 4Z2WA 2DUOA 2WN3A 4QKFA 1NXD1 3J7LA 2YXSA 1VB4A 2BGPA 4CVUA 3QACA 2ZAAA 2EXIA 3VDDA 1JYCA 3C3VA 4A7KA 3B7MA 1MEC2 2NPIA 3TOJA 1WZXA 3MW4A 3Q8FA 4OHXA 4JDNA 3FE5A 1SCSA 2IXKA 2WJSA 5F8PA 3BVCA 2G9FA 1H2KA 3WY6A 2OPKA 4S2DA 5A6XA 3HOBA 3DKQA 1GBGA 3I8TA 5FREA 4AEDC 3VDBA 1BZWA 2B9UA 1C28A 3PJQA 1HRV3 1HIXA 2E9QA 1ND2B 1UWWA 3AXDA 3EXUA 3OG2A 4XILA 1W2UA 3ACGA 5DDJ1 3N9QA 5E1RA 1OLRA 1LHWA 3P3PA 2MEV2 5EWSA 5CU1A 4EWDA 4OULA 1YQ2A 2D7FA 2BV4A 3T2TA 5FPVA 4A2UA 4OZOA 1OOPA 4D6QA 5JCTA 2XB6C 3B93A 1ZNPA 1ENQA 4K7JA 2AC1A 2JG9B 1I3HA 5F37A 4JZRA 3LDRA 1COV2 1GWMA 1CIYA 3A23A 2ZA9A 3ATGA 1UMZA 4QPGA 2EIEA 1H2LA 1AX1A 4K3UA 4WM7C 1JU3A 2WA4A 5C3PA 2PAMA 2V4VA 3A0KA 1G6NA 3ZN6A 2RJ2A 4CCDA 4LBMA 4DXTA 1PVC1 5AC91 4HSLA 4Q4X3 4LBQB 2JG9C 4QDSA 1NLSA 1LNSA 4A4AA 1A6CA 1H8VA 4PQQA 1GOHA 3AYDA 3RYRA 4W6XA 4GAZA 3WNKA 1JMUB 1KD7A 4ZS2A 4AFAA 4CE8A 1OPOA 5FKBA 1OLME 3BKZA 2J1EA 1RGSA 4AI2A 5KHGA 3LOBA 2X53S 1OD3A 3R0RA 1VR3A 3DN7A 2IXLA 4NHKA 3TN91 3UGHA 5DAWA 1W90A 2WUHA 2HWE1 1WWYA 5JIAA 1ODMA 5HXVA 2WNUA 4PBOA 4AQTA 4ZU7A 3M8LA 1O3SA 4PDWC 1VBC3 5FYCA 4OI4A 1E5HA 4N53C 4LO6B 3M3QA 1TZOA 4PCRA 4KWUA 2NYYA 1BYHA 3RYKA 3WW2A 4COZA 1VBA1 1AUYA 4OFGA 1J3QA 3BPZA 2YBKA 2GMPA 5FZEA 4Q26A 1HW5A 5FXXA 3SXWA 5JXHA 4KG0A 2Y38A 2RV9A 3IB3A 4M0NA 4N8MA 5FZHA 3OSDA 3PHMA 5FZCA 2LRPA 1RUI2 3ZIXA 3S6PA 2CNAA 2IUWA 4E8CA 1JHJA 1ONAA 2GNMA 1PO23 2XJPA 5E8AA 3WP3A 1QH7A 3BIWE 4FAHA 3I54A 3ZO0B 1VP6A 4I0BA 2D5FA 3B94A 1CJPA 2XONA 3I4IA 1I6XA 3SITA 4YVWB 5CFDA 5CBLA 3UESA 4EZ4A 3O1UA 4D94A 1QH6A 3AYEA 4Y26A 1VBB2 3E5QA 3A4UA 5J36A 1WMXA 2GNBA 2XOMA 4PI0A 2XJRA 3B01A 3NNLA 1COV1 5ACA1 4YSFA 1Q3EA 2HBTA 4XUPA 4LLOA 1X36A 3OBAA 1QJFA 1OPMA 4XTPA 3LB9A 5A6ZA 2K9ZA 3DF0A 3B69A 3O1VA 2HYXA 1YYNA 2GC2A 1YQ5A 4CRQA 4AK3A 4IV3B 1AF9A 4P5YA 1YFUA 2VNGA 3I59B 4Y4RA 3MIGA 1QJX3 3M70A 3NAPB 4K8RB 5K4LA 2RS53 4CEWA 2JIGA 1APNA 1W6NB 1UU6A 3HNMA 3H8OA 4OUEA 1PK6C 3THDA 1PM7A 5FZBA 1EYBA 2OQ6A 5FP9A 5FZDA 4AXOA 4QHZA 1ND2C 1X9TA 1AR61 1ST8A 1F4HA 1R1A2 1JN2P 1RUE3 2ZZQA 3DPRA 4XFHA 2YBSA 5A7WB 1O59A 4LBNA 5FYMA 2BFUS 5FZ6A 3ZXFA 1KS4A 2QBXA 3WVJA 1MS1A 2VVDA 2XWBB 1NY71 3U4SA 1QJU3 2W39A 3M3OA 5A1AA 3O12A 4I01A 1WW5A 1W6NA 5A7NA 3ZFGB 1D2QA 4YZ4A 2BBVA 1FPN3 5DG2A 4U2AA 5T5JA 2HWD1 1UX6A 1VIWB 2P6HA 3RI9A 4CPBA 2VC9A 2DYCA 2ZOEB 1QDOA 4Q4X2 1US3A 5KHIA 5C3RA 4BQ3A 3MHZA 3ZXJA 4ARYA 2RDSA 3BTZA 3U11A 4NHMA 1X33A 2XQRA 4Y1VA 4CDWC 4JAAA 1JUIA 3AMPA 1LCLA 2GZWA 1O6UA 1F8VA 4UF0B 3ZFEC 2DVGA 2VNRA 2R071 4ASLA 4COWA 1DGLA 1NCQC 5DMYA 5CYYA 1AYN2 2PHFA 5T3NA 2XHNA 1XE8A 2C9KA 1HJGA 4FCAA 3ZXLA 1JZ8A 1P8JA 1KFUL 1PIV3 3V0BA 3D0JA 4A3XA 3RRDA 4JKMA 4QX7A 3HWJA 5L7OA 1WW7A 1V70A 4LE4A 1KRIA 3GXUA 1O5LA 5IVEA 1HKDA 5LCWL 5IVCA 1KDKA 4R9DA 4MGZE 4AI0A 5JDBA 4AI1A 4QX2A 5FMOS 4LO5B 4X6RB 1DYKA 1OBNA 4XDOA 1NA1C 4ZZ8A 2Y6KA 2D97A 2V72A 2G4IA 1C8NA 3B9IA 4AVCA 4D69A 1BCXA 3CZUA 2P34A 1J3PA 1UPSA 3JD72 2A3XA 4FXKB 2WZPP 2HWC3 5HCBA 3KF3A 3WDWA 1YFXA 4M3CE 4AGVA 2P2KA 2WSUA 1C5HA 1QF3A 1QY4A 2E7QA 3KV9A 3ZMOA 5ANNA 1G9CA 2QQIA 4JGZC 1LB2A 4BQ2A 1JTZX 1U5ZA 2E31A 1NA1B 2A1XA 1VRH3 4BLIA 3LE0A 4Y3OA 4XQ4A 2R0FA 2JB4A 1SCRA 3VGIA 1GP6A 5HV0A 3Q8AA 4YWAA 5FQ0B 5AC92 1EPWA 2R49A 5C71A 1QJY1 4TXWA 1AL23 4E2QA 2Q4SA 2PLV1 4LMFA 4AI8A 1D0GA 4XETA 1QWRA 3ILRA 3KF5A 1PX3A 4G4FA 4UBGA 1QNYA 4CUAA 2XLAA 4KU7A 3TBDA 1T6BX 2Q5TA 4Q4W2 3SEEA 1U5YA 2VOVA 1IS5A 4NO4A 3K4ZA 3PMEA 2IXCA 1O91A 1W3XA 5EP9A 3ZR5A 2WNUC 1X9PA 5JZGA 1ASJ2 3RYPA 5CZKA 4NOTA 1C5IA 1FMD2 1WGPA 3IMMA 4CP1A 1RTVA 4M0HA 4Z2AA 4A44A 3GBFA 2PHXA 1G7YA 4ZS3A 2Y6GA 3LFMA 2PA7A 4HK9A 5DABA 1Y7BA 3BTXA 4FFGA 4Q0SA 3OUJA 3AXEA 1FNZA 3N9OA 3AP6A 1PZ8A 5GM0A 2XJTA 5T55A 1IGOA 5F5QA 1XJAA 1Z78A 3WG3A 2PLV3 2VUDA 2VZ1A 2ZS6B 1POV1 2WZR1 4N9IA 4LT5A 2I07B 1F15A 4K21A 4RGGA 5FWJA 2D3RA 2OS2A 4K1YA 5FYBA 3N35A 1MS8A 1X50A 1JZ2A 3ZFFB 2EALA 3WW1A 1GU3A 3X29B 5EIYB 2ZHNA 4XFFA 4NRPA 2WQ8A 3MV11 4BK4A 2WWJA 4RQPB 4W6YA 1ULDA 4C1XA 3WHUA 3TEWA 5FBZA 2VCMA 1FT9A 3RSJA 1UMHA 4DZGA 2CU5A 2VR4A 1UYZA 3VHRA 4E8DA 3UETA 2ZHLA 2CY6A 4CU9A 2VZ3A 3VL9A 5A3NA 2PYTA 3OF1A 3HN3A 2VULA 1ULOA 5DPNA 3WCRA 3AP7A 4BMBA 4BQ1A 4H7MA 2VPVA 2P5BA 4CEWB 2Y33A 3C7GA 3J7HA 3ZYPA 2HEVF 3ZN5A 1HQWA 1DQ5A 4XBNA 3V65A 1ZRIA 4YM2A 2DVFA 2AGSA 3BPSA 5LATA 4HL0A 2VUAA 3MBWA 1CIWA 3DXUA 5A33A 1QHDA 2D6KA 1IQDC 4DFSA 4QB1A 1Q8QA 4C0HA 4NIIA 1LENA 3LPGA 4XJ9A 2BPA2 4CDUC 3IDCB 5FYIA 1U5XA 4JGYB 4JHZA 4RHV2 3CHXA 4DS0A 3KLSA 3MLJA 3ME2A 4XHBA 4ZONA 2EXHA 2VZVA 5C9AB 4WM8C 3WSOA 2MEV3 3ES4A 3NRUA 3POFA 1H8TA 2HEYF 5BUVA 2BU9A 1RITA 3D8CA 4AGGA 4B4RA 3O1RA 1Q8PA 2VUCA 2GP3A 4FOYA 1ASJ3 2D6NA 3MFAA 4P9IA 1WLDA 3AP9A 4IGPA 3UV9A 1W39A 4QKDA 2PELA 3VD9A 3BYWA 4BB3A 2VM9A 1GWKA 3RWKX 4JGYC 1BVP1 4U36A 3I2DA 1WMDA 1XRUA 4A6OA 5C70A 4CCCA 2HWC1 1W9WA 3SLIA 5EYYA 4CDQB 5GZEA 1NZIA 4ZXEA 4NN0A 4TZDA 1W8ZA 2RJKA 3ZXKA 4YVWC 4UW6A 4N43A 4EWAA 3U0ZA 3ZSMA 2EICA 3U78A 3KT1A 4YGEA 3MPPG 3TN92 4QQHA 4AEDB 4G3YC 3ROUA 2RR11 1JUHA 5IVFA 1UF2C 3ZXAC 2NLRA 1LJ7A 2XGXA 5FO8B 4D0QA 1AR62 2BOJA 4FPKA 5I0DA 2TUNA 3Q8BA 2JDAA 2VZTA 4W6WA 3N3HA 5A3TA 2K0GA 2ZPXA 3LGRA 1A3KA 4JGZB 4M3CB 1OA4A 1PHMA 1PNGA 4MHRA 4Q4Y3 3IMNA 3AX4A 1AR72 1IQAA 3KSCA 1LKNA 1IG3A 4BDVB 1B35C 4COYA 1IPSA 2R041 3SC7X 1OUXA 1QU0A 4XQWA 3SCFA 1GOFA 2DTWA 3WXPA 1WBLA 1C8M1 1N47A 3CU7A 3NNJA 5H9PA 4HKOA 1W6OA 3WNXA 3VDCA 3GALA 4CP9A 4OCTA 2WO3A 4LO8A 5AFEA 5JMCA 3PVBB 4YGCA 2JE7A 1W3VA 1F35A 2JD4A 1YIPA 3D3AA 1O4TA 5EJZB 1BBT3 4WV8A 4UXAA 3S57A 2PMWB 1ZZ9A 4PJYA 1W99A 4E4HA 5FY9A 1OOPC 2QKDA 1DLCA 3POSA 4XDPA 5GKAC 1XQNA 2ZTNA 1EPZA 5FJKA 1H4HA 4M3CF 5FFOC 2DVBA 5CG8A 4K1ZA 3NV4A 1R092 4AEKA 1QJX1 1DGWA 4I0WB 4IE6A 3WQ0A 3FFZA 3H7YA 2EIDA 2ZHKA 2VAUA 4Z07A 2UWAA 2D44A 2WS93 2BNNA 5I8TA 1HQNA 5ACA2 3W5NA 3ZKYA 4YG0A 5FZIA 5ABJB 5J7MA 1QJY2 4DO0A 1RHI3 1QIQA 3AVRA 4UFLA 4DY5A 2CL2A 2JDKA 1CWPA 5IYYA 2XJQA 3QH6A 1GQPA 4BZ4A 5HCFA 3DV8A 5FDBA 5L19A 1MQTC 1C8M2 2DCYA 2QDRA 2WSVA 1GYKA 4GMP3 4DRRA 1S0CA 4BWOA 4YW5A 1YRZA 3ENRA 4RN5A 4BLJA 2BGCA 5DUVA 4YG3A 5BNOA 2AENA 1RUG3 4FOQA 4MVTA 5FUNA 2C1FA 2C5DA 1PO13 2JDUA 5A1LA 3I2FA 2VQUA 3FHIB 1CZTA 3TEYA 4JQRA 3O1SA 4XXAA 3FZ3A 3KGZA 4XJ8A 5DZGA 3HMYA 4JV4A 3SH3A 5IVVA 1PZ9A 5CFCB 2EIBA 5LA2A 3R05A 5T5PA 3FHQA 4LJHA 2C4XA 2XLGA 4XF4A 1EY2A 4PIZA 4SLIA 2DU1A 4GIQA 3M4FA 4JKKA 2A6XA 2GP5A 2KXLA 2ZGOA 4GMP1 3LFIA 4XEZA 2BERA 4R4XA 4CDUB 3NKTA 5IUQA 2Y26A 4KG8A 1MR5A 1X8MA 1QOOA 2ZX3A 3ASIA 4Y22B 2HEWF 2VQTA 3VKLA 1A8MA 4PQ9A 1OLQA 1AR83 4QWNA 4OUSA 2LW8A 3HT1A 3R4DB 3PJYA 4LHKA 1KEXA 4QT6A 4UW5A 3TRSB 2VOXA 2GNDA 2VCBA 2J1TA 2JKBA 2RS51 2BNMA 2HWE3 1UYYA 3ECQA 2F4PA 4ASMB 2R063 3K3OA 4LHLA 3HQRA 4R9CA 4XE9A 4Y4YA 2X5IC 3CMGA 4DQAA 5A6YA 2DUPA 1NCQA 1E5IA 2OW4A 1QMJA 2B45X 3BB6A 5FAXA 4LNVA 2UYBA 5FY4A 1E5RA 2P3YA 2RR12 4OUMA 3VBHB 4FTSA 5FLIA 5F7UA 4M4RA 4LBLA 5FLJA 4BQWA 2BJSA 5IAXA 4R9BA 4XF9A 5A80A 4MGTA 2YDEA 3I2OA 3H1YA 3GJBA 2JE9A 3PIJA 1JZ4A 3TEZA 1J59A 4MSVA 1LHOA 3RZMA 5I0UA 4P02B 1A78A 1SBEA 3H9AA 5KR7A 3IM0A 2QQOA 1QQP1 4DXSA 5JOZA 4KMQA 2QQUA 4W65A 4ZU5A 2OUJA 4YZ2A 2Q1FA 5IHRA 4IDZA 3O7OA 1REFA 1H1MA 5IWFA 1HXS2 2OZ6A 4E9KA 2O8OA 1VRBA 1WLCA 2ZCWA 3AMMA 1Z0HA 4K6BA 4RHV1 4BCUA 2E53A 2IWGB 3O1PA 3ZYJB 2R062 1PGL1 1CAVB 1W8WA 2JDHA 1X8EA 3AJZA 4KL1A 1IPKA 5F32A 3ZFFA 4NIHA 3FBYA 2A3YA 3AVSA 4Y33A 5E88A 3POIA 1MZ6A 4AW7A 5FZ0A 2DCZA 2ZGQA 3AKPA 4IW3A 4AE2A 5CKNA 1RUC1 1S0EA 1VBB1 1J3RA 1DQ0A 2ZHMA 2OKXA 4DINB 5CVRA 1REDA 1DBNA 3NJXA 4Q4W1 5T50A 1NCRB 4CZSA 4OMCA 3AMNA 5KC6A 2RS33 4ES9A 1MS4A 3D5OA 2JG8B 4J6GA 2JDYA 1KJLA 1S0FA 2UYAA 3A21A 3HQUA 4XZUG 2HWB1 2IFRA 5J48A 1SQ4A 4MXVA 5FP4A 2BYVE 2RMU1 4META 1NKGA 3BTAA 2VCCA 1RUG2 3KCXA 3WD5A 2HBUA 3ZSJA 2VMFA 4QPYA 2KR2A 4GJYA 2C9AA 2GC0A 3THPA 4BXFA 5SV5A 1K12A 1D4VB 1Z7S2 2W46A 4LULA 3FUQA 5C9AC 4YW2A 3T30A 1GICA 1QKQA 3LEIA 4IV3A 3AK0A 1XNKA 4RA0A 2AACA 5DG1A 1US2A 3VBSA 3WT3A 2R1BA 2VZUA 2QVSB 5FZ9A 5FY5A 4DY3A 1CZVA 1V6LA 4OYUA 2RS31 3QCWA 4RD7A 4P9XA 1AHSA 2P17A 1RB8G 3D82A 4LOSA 3VBOA 1WD3A 1S0DA 3POBA 3IDEA 5F5CA 4CCNA 5FY0A 1H9PA 4PHZA 3DPRB 3LCPA 3SISA 2RM22 3K51A 1LODA 3MIHA 4HPKA 4YM0A 1G9BA 4KWJA 5K0UA 1MZEA 1C1LA 3U4XA 3NSTA 4LKEA 4UBHA 1JYIA 1YQCA 4IEXA 5K8SA 3I3BA 3RZZA 3RZLA 1S0JA 3S7IA 3MEPA 3UNPA 1GP5A 1JU4A 1NQJA 5D21A 4HETA 2EAKA 2FCVA 1H9WA 2H0BA 4MZUA 2WT1A 3AZZA 3NV2A 3I3MA 4D7SA 1HXS1 5LWBA 3MF6A 1M4WA 4B1MA 1S2EA 1WLWA 4NHXA 4OQ8A 2WT2A 1GOGA 5T5LA 3PURA 3VDDC 2JENA 3WW4A 4Y22A 3VHNA 1ULFA 3WNLA 3O5SA 3D4KA 1ZBA1 3ZN6B 1MS0A 1YQ8A 2B7YA 5HBAA 1PMJX 3RJRA 1CD3G 1EAH3 4AFBA 2RS32 4CDQA 4P9LA 2QQWA 2PLV2 2VZOA 4Z92B 2A6WA 2BP6A 2JXAA 2L9LA 4KU8A 3PVEA 1UOGA 3LOIA 1AVBA 1OOPB 2RS11 3L2HA 3RG0A 1R083 1C1FA 3WLUA 3HD8B 3POEA 1JI6A 4J1XA 1GFF2 2HJIA 4QB2A 4A45A 4LLFA 2GC3A 5LA9A 2TBVA 2A6YA 5DDJ3 5LBCA 2K46A 2W0XA 3MLLA 4XCAA 5B4NA 4I09A 3OY8B 3PUHA 5BNNC 3U07A 4Y5Z0 2QQLA 1YEWA 2DCJA 1BKZA 4AG4A 1O5UA 2BNOA 2MEV1 4LBKA 5CISA 4D6RA 5LB6A 1MEC1 5KHKA 4D8MA 1K5MC 4LPLA 3PTRB 4J25A 4YVSC 2YROA 4XOGA 3VLBB 4LA2A 4BMEA 5JSRA 4WM8B 4YFWA 4UWDA 5FZKA 3N7JA 4IE0A 4FTEA 4XFBA 2TNFA 3I2JA 5EFUA 2XH6A 2GMEA 4AR2A 1VBD3 3CJXA 3MUY1 1NQDA 3CLPA 3K3NA 4N53B 2GN7A 4P00B 5A7PA 3T08A 5IFPA 2E32A 5BNPB 1QXPA 1UYXA 2ES3A 4M4PA 4QM9A 4WVVA 5JOXA 4GH4A 5D2AA 3PVNA 2WYSA 1IKPA 2DVDA 4LKDA 1Y9GA 1AL0G 1BEV2 3N9PA 3M3IA 4WVMB 3DYMA 5APAA 1YHFA 4QPWA 4LIVA 3WP6A 1UPIA 2KD7A 2OXBA 4Q1PA 1S0BA 4JCKA 4URAA 5GZDA 3VBUB 2GU9A 2WS92 5CKMA 5EPAA 1AR82 1DGRA 1IHMA 2XHKA 2RVAA 4PIXA 5FKCA 1AR73 1ZZ6A 4P9WA 1YFYA 1HB3A 4L11A 5LA1A 4QDQA 4LK6A 1K42A 3AFGA 3KT7A 4YPJA 2V09A 4QPGB 1AYN3 4H3WA 4LITA 1JODA 1D2SA 1H8TB 1D0HA 2QQVA 2XVKA 1CQ9A 3HVDA 4CTEA 4M01A 3MIDA 3NJVA 1OA2A 4WVWA 3H1MA 2XVLA 2JG8A 1UZVA 2W95A 1HB4A 2OA2A 4XBLA 4YVWA 2CGOA 3N9LA 1H0BA 1AR93 1QQP2 4D3WA 4QKNA 2QJVA 3NNGA 4XFAA 4JC1A 1SLAA 2ARAA 1PK6A 4XF0A 2JB8A 3VKFC 3RMXA 1NG0A 3KV4A 1V9U3 3NV3A 3T0AA 3RZGA 4UW4A 1IPJA 1HXS3 3LSDA 5FZGA 5LA0A 1LULA 2BQPA 5F3IA 1DYOA 2XUEA 4UI9L 3F2ZA 3MIEA 1QJEA 3VHPA 5F2SA 3FX3A 4AVBA 4GH4C 2J1SA 4R4ZA 1EV13 5KWRA 1BVVA 4R52A 4AVSA 2VOKA 4HVQA 5IK8A 4HFSA 5FYVA 4JGZA 2DF7A 3J7NA 3JD71 1RC6A 1V9U2 4O65A 4LUKA 4LE3A 3W58A 2OUHA 4PBPA 1Q56A 1C4RA 2PXJA 3R4UA 3OOXA 2VXJA 5F9TA 4KWLA 5C9AA 3MDPA 3CJIA 3OTFA 1FYUA 4DEVA 3WQ1A 3C2UA 3WW3A 5A3UA 5L9VA 3OBTA 1ENSA 1VBC1 3KGLA 4AQ6A 4Q5OA 3GF6A 5FIXA 2ARXA 1YO8A 2B9VA 3IPVA 4KWKA 4RR3B 4V1PA 3ACFA 5D1IA 3T2QA 3NQHA 5A32A 1ZBA2 1HV0A 4CU8A 4IEOA 4Q4Y2 3CBNA 4XHXA 1ND3B 4BE3A 5J96B 2VCAA 4L99A 4FAGA 2D6PA 1VRH1 4QM8A 1WCKA 1OQEA 1G9FA 5FMOL 2ZAHA 4DNYA 4ASKA 1GZ9A 4IE4A 5F6KA 3JB4C 3RFRA 3VD5A 1ZX5A 4ISRA 4RR3C 3RGBA 2ZEZA 4RYDA 1VAMA 2AEYA 1UIJA 1OKOA 5A1FA 5FTTC 1STMA 4QD2A 3USUB 3BTYA 3UT0A 2VZSA 2FDJA 4L92A 3UJQA 2ZX0A 1AYM1 4IV1B 2KM2A 4QQPA 4FPHA 2XL9A 2WNOA 5LEKA 1WW6A 1O4ZA 2CAVA 2VY0A 3KQ4B 3VBHA 1D4M2 4NIGA 1SPPA 1OQDA 1W06A 3CEWA 2AUYA 1UY2A 2PQSA 3PIGA 2XVGA 2ORXA 3C7EA 1XNDA 5FLHA 4B29A 3SKJE 3UKTA 4F7ZA 3WF3A 4NUBA 3MZHA 1PIV2 4LR4A 3V0AB 1W6OB 1ZBE2 2WL1A 3CJIC 2VMGA 3ETPA 4FXGB 1CESA 4YM1A 5IVYA 4AF9A 4BIOA 2PN5A 1RMU1 4ITCA 2V5YA 4ZXKA 3WG2A 5BY5A 1UXZA 2O8QA 1NYWA 4ET7A 1WBFA 2D3SA 1RINA 4OMDA 5FK7A 1PNFA 2JG9A 4HVOA 1HJFA 1FI2A 3N9NA 4SBVA 1MS3A 3A22A 5FPAA 2GMMA 1NUKA 1N1YA 3ZLIA 1AYM3 2D98A 3OBRA 4XUNA 4NWVA 3WDVA 1LECA 1W8TA 2VQ0A 1TNRA 2KA3A 2YPDA 1QXJA 3EJKA 3CJIB 2ZEYA 4UT5A 4AAPA 4Y1YA 1VBE1 3KS7A 5H9QA 2FDGA 5FPLA 5CEHA 4LA3A 5IW0A 5BNPA 2J1RA 1Y9QA 3GZUC 4C8DA 2XMLA 4Q0PA 5FPXA 3VBRB 1V9U1 2MPFA 1CAVA 3BOPA 2UU8A 2R16A 2H0VA 1DZRA 2VMIA 1W05A 4F83A 2DFCA 2NZ9A 3ZR6A 4NHYA 1V6JA 1Z7S3 2X09A 5FMCA 4L2NA 3AMHA 1RUI3 2WNEA 3KV5A 1I5ZA 4FQZA 3THCA 4A7YA 5BYNA 1D4M3 1LHUA 4QX8A 3RVHA 3VBFC 2VVFA 4RHV3 4Q8KA 3O1MA 4IUGA 3E5UA 3W20A 2P4EA 1PO21 2JDZA 1VBD1 3D0SA 5JXGA 5FY1A 3T0BA 4OI0A 4EN7B 4QU1A 3WINE 3NAPC 5ANQA 3AP5A 2PHWA 3DEMA 3VV1A 4A3ZA 3JB8A 4IGOA 4RQPA 3OEBA 5C8CA 3GJAA 1GNHA 4WM7B 2E7TA 2WAOA 1U5IA 3ETQA 1SBFA 1AJKA 1TMF2 2ZGNA 1ZYBA 2WO7A 4QQLA 4YW7A 1R1A1 1GMMA 4P9GA 1CX4A 1U12A 1ZZ8A 1W9FA 4I0AA 1OLMA 2PTMA 3TWIA 3ZFFC 3G6JB 4A41A 2RMU3 1F5JA 3GDBA 3POYA 2Q0AA 5CKQA 5GJ6A 4AFMA 3DXTA 3I2KA 3HT2A 3FLTA 2GN3A 5FYZA 4RR3A 1LOCA 5HCHA 4OQ9A 5EZWA 1BLZA 1VLNA 1DG6A 2WFF1 4PDWB 2Q8EA 4CEYA 3RZKA 3JBG2 4IV1A 5BXXA 3S0MA 4TWTA 4OI2A 4MX3A 1UZYA 3C7HA 5LW9A 4YFZA 4XJWA 3IKWA 4QX3A 5G04L 5FR3A 2V4AA 3AKRA 4XF1A 4Q4Y1 1KITA 4JTOA 1DHKB 1LESA 1UZZA 3H3UA 3NJYA 3ZXGA 1JZ7A 2VE1A 3OUIA 3H3ZA 1NCQB 2Y6JA 2WNVA 2ETEA 2DFBA 1DU3D 1UZ0A 1RXGA 1XPWA 3APBA 3B00A 1CAXB 2DWRA 1UY4A 2QZ3A 1PMIA 3MPBA 4IE5A 4LKSA 4MGYE 4PIYA 4RS5B 4Y20A 2AR6A 5IK5A 1YI7A 4PLMA 3T2PA 1EV11 2ZACA 3POWA 2Y6FA 1NXMA 2VZQA 2NM1A 4QHOA 1OSGA 1UNBA 2YV8A 2WIIB 4IL7A 2ZGRA 4AAXA 3UK9A 1L7LA 4CDXC 3URFA 1OVPA 1UKRA 4PF5A 1GQHA 3E1F1 3K77A 4NHLA 4YZ3A 2R072 2RE9A 5FMDA 3VKMA 1YC61 1QEXA 5T5OA 1O3TA 2QQKA 1PO12 5DN2A 1Q8SA 5BNOC 1UX7A 3EO6A 2D6OX 3PL0A 3LQCA 4YGBA 5DQ0A 1LHNA 4Y5SA 4BQYA 2PHUA 3USUA 4DIQA 2A73B 4LBQD 2R7EB 3BN6A 3ALQA 2QNKA 2WNVC 1FAYA 4NRQA 4F8AA 2FZ1A 2Y64A 2Z5WA 1K45A 3NVCA 3ZSEA 4GWMA 1MVQA 2R061 4CCMA 1BXHA 4L0PA 1ULCA 2IXJA 1IKQA 1ODNA 1SMVA 1W03A 1PVXA 1W8FA 2C24A 3SEPA 2RS13 3NWKA 3AP4A 1BK1A 2BTVC 3HPNA 3AKSA 1R081 3OYWB 4KGGA 4MLOA 4YLZA 4CCLA 2ZMNA 1PGW2 2ZGUA 4CXXA 4IE7A 1LRHA 3NW4A 1RUC2 2RM23 3PVOA 4XBQA 4ARXA 1GANA 2WZ8A 3DCQA 4QMAA 3U10A 1WA4A 1DYPA 4Q0QA 4IEQA 4X6QB 2DDUA 3T1LA 2LS6A 4Q2FA 5KXDA 2NMOA 5FYYA 1JOBA 1DQ2A 1KS5A 2JKXA 4X8NA 4FT8A 3TEXA 2VMDA 4I2OA 3ZKUA 3I97A 2PAEA 4Y5TA 1GSLA 1VJ2A 4UOJA 3TN93 5LRSA 4TSVA 3WP5A 5BNNB 2CWMA 1JYTA 4Y1ZA 1X82A 3KCYA 1LGBA 1OF4A 1TMF1 4FVVA 1S2BA 4OHWA 1MQTA 2W3JA 2BGOA 4LHNA 4LEJA 3T0DA 1UZWA 1PGW1 3U75A 4RS5A 3ACLA 3O1TA 1K5MB 4K8FA 4WZCA 1RMU3 3WUCA 3AB0A 4EYUA 1WA6X 1FPN1 1W8NA 4FPYA 4EN9B 2ZXQA 4O9GA 3HQXA 4RQPC 1CAUB 4NJ4A 2XR4A 2N7GA 3JD73 1FOD3 5FV3A 5F3EA 2VO5A 5JZGB 1Y4WA 4LBJA 4LO4B 3FUOA 5AVAA 2W08A 3WF2A 5C3SA 2Y8KA 1OF3A 2OT7A 3J4UH 4EE2A 3AZXA 2ZGKA 4MXWB 1XYOA 4AEDA 3U37A 4GZ9A 3OPTA 4A7ZA 3QD6A 2B8MA 2ARBA 3EYPA 3H1WA 1ZREA 1S1AA 1AR71 1W8OA 4AEMA 5J37A 3N4MA 4N43C 4AVVA 5K0UB 1N3QA 3J8F3 1ZZ7A 3OCPA 3S7EA 3L9JT 2CAUA 5A7OA 1S0GA 1OH4A 3B02A 5FOBB 1AYN1 5JIUA 1TME3 2HWB3 5A7SA 2ZGLA 3FFQA 2JWPA 1ZBE1 1RHI1 2WBKA 3I3DA 4FPFA 4N7UA 5KBFA 2OZJA 1RVF3 1V6NA 5B2GB 3FMGA 2OYZA 1MZ5A 5FMBA 1YJKA 5DZEA 1EV12 1WD4A 4BHPA 5GZCA 2DURA 2YFUA 3L2YA 3IIIA 4QPGC 5FZ7A 4R9AA 1FMD3 5LZ6A 3B5LB 1ZA7A 3VKNA 3NMBA 1B35A 1GNZA 5C5UA 3LWCA 3HNYM 1UY1A 2XBO2 3AZVA 4HLTA 1ENRA 1I1EA 3I2GA 5A7QA 2LUWA 5FQ0A 4IEWA 2CDPA 3Q8CA 5H9RA 3BU0A 4CU7A 1W2NA 4COVA 3IAPA 1FV2A 3CF6E 3M2MA 5EHDA 3VD4A 1QJZA 5DUUA 4HZFA 4QXKA 2WC2A 3RPQA 3WCSA 2YU2A 1TME1 5G05L 1MEC3 3V0AA 1E5SA 4Z1VA 3GHNA 3QOPA 4BH9A 3T09A 1FX5A 2WN2A 5F2WA 4AHXA 1LAJA 1JOPA 2MNGA 2QQMA 4UF0A 1DFQA 4XABA 4JTNA 3SH4A 4UFMA 2YBPA 2FDHA 1UOJA 5HV4A 5C4WB 1GZCA 5GZFA 4C1WA 4KI5M 4JX0A 4BXSV 5DAVA 3LIHA 1VAVA 1Q8VA 1PO22 1N1VA 1HRV1 5AFBA 3N7MA 2H6CA 2PHRA 2YU1A 1QOTA 1HQLA 3G7DA 1WCUA 4FO9A 1UOBA 3INAA 4NPMA 1TEIA 5FYUA 4TTGA 4Q4W3 1J83A 2FDIA 1DIWA 5ISLA 1CX1A 1XE7A 4XMIA 4FI9A 1V00A 3JQWA 4HONA 4PI2A 2X05A 2BBAA 1RUE2 1N1TA 3MGUA 3TAYA 3ZYFA 3VBFB 4PLNA 1RUD2 2G9GA 3KHBA 2W91A 5JVVA 4QQ2A 3WDUA 1RJ8A 1ZBA3 4QPIA 4ZHNA 1SLIA 3FLRA 5JOWA 5F5AA 3VBSC 4AGRA 4EWEA 2DTYA 3KQRA 4HXCA 4L8QA 1YLLA 1SBDA 1DLLA 3BI3A 1JOJA 1UKGA 2YGLA 4GJZA 2ZZJA 1W04A 2YFZA 3VDDB 3J26N 1SLCA 4Q4V1 3ZVXA 5LEJA 4FPGA 4GMP0 1XU1A 2XG3A 2R073 4WVMA 2D40A 3UJOA 3HBZA 4AOCA 4CPBD 4LTAA 3ILFA 3RDIA 2D93A 4WM7A 1W0OA 3WUDA 1UMIA 1FNYA 1SLLA 3VBUA 4INDA 3CO2A 4YRDA 4GWNA 2F17A 2PHLA 2IXIA 4H7LA 4CP0A 1K3IA 3MF9A 3WG4A 2PFWA 1RMU2 3PLQA 4LXLA 4E4ZA 3OGJA 1V6MA 2R1DA 3KWVA 4CEWC 1XSRA 3OD4A 3RI8A 3KV6A 4YVSA 3OGVA 4DXRA 2R0HA 4IV1C 4BQ4A 4AI3A 2HWE2 3IBMA 4QXHA 4FOWA 2FD8A 2CWSA 4BYYA 2LALA 4ATFA 4L9BA 4CCOA 1DGWX 5F3GA 4E4DX 1QJU1 1XNAA 2BFUL 2E26A 4E27A 2IZWA 1KGYA 1NCRC 2IFWA 2ZABA 4LQRA 3WEZA 4AHWA 4LIUA 3LA3A 3WF1A 3MI8A 1AR81 2WRAA 1AL22 2ID4A 2WZEA 4XJAA 3H8RA 4L97A 5JXIA 3PNAA 3GZEA 4HOOA 1DZQA 1LGCA 4LO7A 4YYOA 2WO1A 4O61A 2X8KA 5A3OA 3ZOIA 1TVGA 3IAQA 1RUH3 4E2GA 4N43B 5K0UC 1H1IA 4HVRA 2PHTA 3H50A 4NROA 1HN1A 5D8AA 2IC1A 3EBRA 2GALA 3UKVA 5IAVA 5LRRA 1JZ6A 1XNBA 1DF0A 1BBT2 1JZ3A 2BWCA 3USSA 4B4QA 1RYYA 3NKGA 2WS91 2O0OA 4CUBA 4YW4A 1TMF3 1VBD2 1QJX2 1ACCA 3D6EA 1UW8A 5GLTA 4LK7A 2WR9A 2Q8DA 5JAXA 3MV01 3VZLA 5D8AB 4KBZA 4BU2A 2DU0A 1PMHX 2C26A 3A7QA 4HN0A 4B7EA 5BNOB 4F3JA 1CJDA 4CEYC 1UY0A 1ENXA 1RUH1 3PU3A 1MPXA 3OB8A 3SMHA 5FPZA 1TQ5A 2QZ2A 5FZ4A 1RUJ2 4URTA 3LF7A 4JQTA 4ORFA 4QXBA 5EXOA 2JDPA 2BRTA 4YZ1A 2WAAA 1LEMA 2JDNA 2VW0A 3O0VA 5D8AC 1S2KA 2YG0A 5IJRA 4AHYA 1XBFA 1XB9A 4D7TA 3MW3A 1JZ5A 3I49A 4N7IA 4O9EA 4PDWA 5DDJ2 2R32A 5LBEA 4CEYB 4BQ5A 1UOFA 2YC2A 5B4XA 3WOGA 1J84A 3JXSA 4DEQA 2A3WA 5BPXA 2JD9A 3WR0A 1U0AA 3IN9A 4MADA 2OQ7A 2A6VA 3P6BA 3ABZA 4JDMA 1K5JA 4IEPA 1W6PB 2VZRA 1F5FA 5L9RA 5BV6A 4LUMA 3AKQA 4UFJA 1W2TA 5L73A 3KB5A 1YI9A 5FYSA 4ISQA 1DGRN 1RUJ1 4CUCA 1JH5A 1LTEA 2A70A 3AZWA 3NNFA 1VMHA 4WZFA 2Z42A 4Z82A 4MUVA 5EQUA 4DUVA 3OBZA 3ZPOA 5GALA 3KZ4C 4BQXA 1NY72 2EXKA 1J1TA 2VJXA 1GR3A 3SNMA 4CDWA 3ACHA 5JXJA 2ERFA 3MLKA 3VZJA 5GLUA 3ZSKA 2YZ4A 3FN9A 4BPZA 2NP0A 5C3QA 3MO4A 1RXFA 4XVHA 2OPWA 4HBNA 2Q8OA 3H3LA 1Y9MA 2Y6LA 4XFGA 4Y1XA 2ZMLA 4RFT0 4ZZ5A 1HB2A 1EAH1 3VD3A 2GNTA 3ZXDA 5FXZA 4CCKA 1BMV2 4MH0E 3NO8A 2B5HA 3KHCA 1MQTB 3OYWA 4JKLA 1F31A 1G86A 1ULGA 3MUZ1 3CIHA 3DYPA 1NLRA 2VOWA 1ASJ1 2WKKA 3PUQA 2W1QA 3R6SA 4NMIA 3EQEA 2W2IA 3UYJA 5EJ1B 1TME2 4KGQA 4YVSB 3OUHA 2UY9A 1SHWB 1S0IA 3H8UA 4PLOA 5DUWA 3CNAA 3RQ0A 3S5QA 1ND3C 1QGLA 4NAMA 4UFKA 3AKTA 5GLZA 4NRMA 4AQ2A 3VZMA 2ILMA 1LR5A 2XXZA 3OEAA 3K4AA 2XBO1 1H4GA 3E6BA 3NNMA 4IXLA 4QX1A 3U14A 4GB32 1V0AA 5BNPC 3K46A 4CCEA 2ZX1A 4JRLA 5F6LB 3NL1A 3SKVA 4Y1UA 4FFFA 1SLBA 1SFPA 3JBG3 2OIIA 2HWF1 5J1XA 3GHMA 2W68A 2A71A 3TNPB 4YW1A 1CGPA 4AWDA 3BIEA 4XFCA 3QBQA 2V5DA 4TLFA 4KNCA 2XJVA 2LM3A 4FBFA 4LBQA 4ZY9A 3VD7A 4IEYA 5FO9B 1W6PA 1MZFA 1Y3TA 4XQDA 4P9JA 1NE6A 5C8CC 2WNVB 2XQXA 1XYNA 2ADEA 5GZGA 1J58A 1Q43A 1OFSA 1RUD1 3N36A 2LTNA 4IETA 5AVPA 3ES1A 3KT4A 4MGKE 3T3YA 4DB5A 3JQXA 2ADDA 5CAZA 2P37A 5M0TA 2IXHA 4QX5A 2P3KA 1NOVA 4ZU4A 3WF0A 1ZZCA 1YUDA 3ST7A 1EP0A 2PAKA 3DPRC 3LPFA 3MW2A 3PUSA 1ND2A 1V6OA 1AZDA 3QH7A 1YQ6A 2VTXA 1LOGA 3KVAA 4NE9A 4XCBA 2VTXJ 1VBA2 2Y60A 2HWB2 2Y34A 1LHVA 1KDMA 2WABA 2VUJA 4DUXA 3LKJA 3OPWA 4IEUA 3AM2A 3WQBA 2Z2SB 1KXGA 5C4WC 2P3JA 4BM8A 4EJRA 4LBOA 4MYEA 3M3EA 1QOSA 4IV3C 2DV9A 2QTWB 5A32B 5CNAA 4ES8A 5CFCA 2WFPA 2BVVA 2WFF2 2ZEWA 3GYDA 2EIGA 3VZOA 4COUA 1Y43B 5E89A 2ZJCA 1JW6A 3PDQA 1OVSA 5IK4A 5IATA 2ZGSA 1EAH2 1JXNA 1FOD2 2ET1A 1UO9A 1LU1A 3HR9A 5F5IA 4CU6A 1FOD1 1SZBA 4JGYA 1POV3 2WZR3 3TYJA 2EF6A 3R4SA 2J7MA 1LEDA 4FQ4A 5C33A 2AZ5A 4OHYA 2DVAA 5HPOA 2E51A 1LOEA 3CQOA 3EMRA 1I9RA 1DZTA 1SEFA 5JZGC 1NA1A 2YB7A 4LORA 3UKNA 4HKWA 1VAKA 2QQJA 5ABJA 1BEV1 1VALA 3HIFA 3I7DA 1WLTA 2B42B 2QFEA 4Y20B 2WWSA 2E7AA 1W8HA 1YWKA 2EA7A 2YUEA 1SACA 4H2AA 2GC1A 5CG9A 3GM8A 3T4HB 5L7OC 3FHAA 2BZDA 5JMOA 2QQPA 1VBA3 2B46X 3I3QA 3TB0A 2ZX2A 3BCWA 3ZDVA 3OPZA 3ZMNA 4EZHA 4CXWA 3GBWA 2JICA 4XIOA 1FXZA 4B1LA 2Y0OA 4S2HA 1VBE3 3CDZB 1O8PA 4J1WA 5IVJA 3IT8A 4B7KA 1RUC3 1W0NA 1EUUA 4JVAA 3WG1A 4P08A 1RHI2 2XLFA 1IZ3A 2RDQA 1A34A 4H14A 1MVEA 2XKOA 4Q0UA 5H9SA 1XOYA 5LBBA 4AVTA 4XF3A 3ZPYA 5FOJB 5KC5A 3GCWA 1V6KA 4QPIC 2ZEXA 3BGAA 2P1BA 1DQ1A 1WCDJ 3GGLA 4DOUA 2C0ZA 5I91A 1BQPA 2ARCA 1D7PM 4HSJA 2BUKA 3T4VA 1VBE2 4GWIA 5LASA 4GXLA 5FK8A 5FZAA 2Q1ZB 1KJRA 3E5XA 4XAAA 3C7FA 2D6LX 3FJSA 4Q0VA 5IVBA 3W59A 4QPIB 4XUOA 3CL1A 3P5BA 2VVEA 3GCXA 4ATEA 3VBUC 1ZA4A 3AZYA 4XFIA 3ZIWA 4FPJA 3AYCA 4IQPA 2BDRA 4RSUA 3HAGA 3OD0A 1PIV1 5CADA 3AMQA 2FHRA 5CIRA 3GNEA 4B4PA 2XJUA 2BEOA 3O14A 1HRI3 4BK5A 4A42A 4M00A 3FWEA 1R1A3 5FO7B 1H8TC 4K9SA 3ZYRA 2W47A 1OFNA 4OLLA 4QDRA 3JZVA 1XE0A 2VXRA 4CP2A 5A3MA 2FCTA 5HCAA 1H6XA 1AYM2 2W52A 3J9SA 1H2MA 2FQPA 2GAUA 3WNMA 2VMHA 3J8F1 5A3LA 2WWUA 1RUOA 3VBRC 3VKOA 3JCIA 2WYFA 1AX2A 2H6BA 4XTMA 3K75B 4CXYA 3WHTA 1ZBE3 1OA3A 2VW1A 4XACA 1RVF1 1WCSA 5JR2A 2RM21 4CCJA 3HBKA 1R082 2YMZA 3H42B 1Q8OA 2W9XA 1PK6B 1PX4A 2J1UA 3J7MA 3S30A 4AL9A 4BISA 4P9YA 1ULEA 4C90A 1QJY3 2UY8A 4QGLA 4MGQA 2VQAA 2XKPA 4Z8BA 2IVIB 2UURA 3JUUA 4NWWA 1SLTA 4I3PA 2OVUA 2QDNA 3SQOA 4K40A 1XXNA 1PGSA 4GQ7A 2VU9A 3VZKA 1GV9A 1GLHA 1PVC2 4HG6B 4N53A 2PHDA 4GD4A 4EQVA 5FZLA 3WNPA 2SBAA 2HWF3 3VN4A 3ON7A 5DAPA 2VMCA 1ZRRA 1Z7S1 2E63A 2EXJA 4UFIA 4UW3A 1V6IA 2DBNA 4YW6A 3VBFA 2WO2A 1CAXA 3UL2A 3GZAA 4HMZA 5DUXA 4RL7A 4AVAA 4XC9A 2VNOA 5JPNB 5EV7A 1C3HA 3K4DA 2ZMKA 4M3CA 5ACA3 3SH5A 2QCSB 1OURA 4QXCA 1VB2A 2X5IA 3AFKA 4CDWB 3I59A 1PZ7A 1S4CA 2RS52 4IEZA 3DECA 1LGNA 4YNIA 1CPMA 1DQ4A 1GQGA 4JHTA 4AFCA 1F2NA 1RVF2 3RJ2X 5K7PA 4BOWA 2WINB 4FFHA 3ILNA 4Q27A 5FZOA 4EN6B 5C7GA 3UGFA 5T52A 4DPNA 3RS6A 5JI9A 5DZFA 2D6MA 5JLVA 5JOYA 4S2GA 5LBFA 2WT0A 3T2OA 1N3PA 1QDCA 5DXDA 4XJZA 4GKYA 1NT0A 5C4WA 1HN0A 4FOVA 3SCHA 1CONA 1NCRA 5FJHA 1PM4A 1WKYA 2VD7A 4LHSA 3VHOA 3W9AA 1ZZBA 4B8EA 4PT6A 3AC0A 1E57A 3DUIA 4NAOA 4BJ0A 1RUNA 1GNYA 3ELNA 2XJSA 4QB6A 1AJOA 5JR7B 1R64A 2RDRA 3IPVB 4WVZA 1T6GC 4E2SA 5CFDB 1MS5A 4CA9A 2VH9A 1AL21 4CDQC 2DUQA 2HH9A 4FSJA 5FPUA 1GUIA 1BMV1 4X8PA 1PGL2 3VDAA 3ZYHA 2A7AA 3IIAA 2DBIA 4CDXB 3ZM8A 4NPLA 1GWLA 2Q30A 1HRI1 2VGDA 4FP3A 4OI1A 3WV6A 3O0XA 3N9MA 1PVC3 3TNQA 1J1LA 4QAWA 2Q8CA 2BOIA 1JHNA 2WQZC 4MG2A 1JBCA 1X7NA 1W2OA 2BVBA 2NQYA 2J22A 2VMEA 2D43A 3AJYA 2W1WA 2W92A 1CAWB 1UYPA 3OGRA 2XDVA 2NMNA 4E4SA 1DQ6A 2RJLA 3KD4A 4YZ5A 1G9AA 1RUF3 2CDOA 2VBPA 4CDXA 4FTBA 5EJ3A 5FP3A 4KBBA 2JEMA 3O1OA 1XNCA 2X5IB 1TNFA 1UL9A 1HX6A 3AYAA 3POJA 1CZSA 4WBBA 5FY7A 5FZ1A 2AREA 2YY1A 4EROA 3B3QE 1CAUA 3AL5A 1G8WA 4GH4B 2ZKNA 3LIGA 4FPCA 2ZGMA 5FRAA 3ZFEA 1H1AA 4YM3A 1ALYA 2Q1MA 5LY1A 3VBHC 3S5AA 1CAWA 5I0TA 3WDTA 1FV3A 1OKQA 3WQ7A 1IS6A 2CGPA 2WZR2 5ERLA 1HV1A 1OI6A 1PO11 3KVBA 4XYXA 2CGNA 1IG0A 5K9YA 3ACIA 1IS4A 2XUMA 2ORZA 1RUF2 5JI7A 3LA2A 4QQOA 2D5HA 3MYXA 4NPRA 2VW2A 1O3RA 5FUPA 1O4YA 1RUE1 4Y24A 2WLQA 2XWJB 2O14A 1FMD1 1VMJA 4HK8A 5FZ3A 2PQQA 1FATA 2P3IA 2R30A 2CSGA 4NIAA 2VL4A 1KFXL 1SPPB 3JU9A 4FPOB 2EVXA 3V56A 3LA7A 3BU7A 4XW3A 3VBSB 3LEMA 3LZZA 1DCSA 1L7RA 4W4ZA 5FWEA 1HLCA 2FMYA 1BBT1 1YCIA 3C8XA 2FDKA 4IGQA 4CUGA 1YIFA 3IWZA 3WNOA 1RIRA 1LOFA 4CDUA 5KHJA 2FMDA 3VUOA 1URXA 5A33B 1L3JA 1NE4A 4DXZA 1YXWA 5LY2A 1ULPA 5JSOA 3CZJA 1VBB3 1TG7A 2OX0A 4K20A 2AH2A 3JBG1 1L7QA 1OD5A 1RUI1 1VE0A 4AZZA 2BW8A 2YYOA 1D4M1 5KHHA 4YG6A 4G9SB 4N9HA 5HXMA 3WNNA 2D3PA 2FCUA 3OJBA 2TEPA 3LEKA 1POV0 1LOAA 2O1QA 1AX0A 1SDDB 2JE8A 4IESA 1JYNA 3VBRA 1BJQA 5FZOB 2ZGTA 1C57A 4LKFA 2RHPA 4MXWA 4YARA 2JG8C 4YW3A 1JYWA 2P6CA 3EHKA 5CB7A 5IT6A 2E6VA 3THTA 1BHGA 1XNTA 2RR13 1RL3A 1AR91 3MICA 3ZFGA 1TE1B 2JJ6A 1W6MB 3M7AA 3M3CA 3OY8A 2Y0IA 1W9TA 3DYOA 4FFIA 4LOTA 4XUTA 2JDMA 2J1AA 3MFCA 3NV1A 2RMU2 3PMSA 4FPLA 1MS9A 1SFYA 4DUWA 1ZRCA 3NJZA 2W94A 1NX9A 3SHRA 5JUVA 4AQSA 1YNAA 3DGTA 4NR1A 1QQP3 4HPKB 5IFTA 3UGGA 5BNNA 4HKLA 4HN1A 4MHUA 5CA6A 3PU8A 1HDKA 4WM8A 3E6CC 3W5MA 1W2AX 4I30A 1G9DA 1REEA 4AI9A 5KXBA 1WUVA 5C8WA 2WNUB 1LU2A 1H6YA 2R042 2JX9A 1W6QA 4TN7A 3SCGA 3NAPA 1RUF1 3ZYGA 3V0BB 3O0WA 3RWNA 3N7LA 4KQ7A 2ATFA 1YFWA 4EV0A 4XAEA 4R8HA 3P1IA 2ENRA 3K2OA 4GWJA 3KMHA 2YPJA 4UFHA 4A6SA 3RZHA 1IS3A 2XBO3 1GZTA 4YGDA 4RGKA 4ZPIA 4O7XA 1UIKA 2F4LA 1OMIA 3E6DA 1WMFA 4HANA 2QE3A 2YC4A 1HRV2 2ZGPA 4V2VA 2DCTA 1ZRFA 2I2SA 1OUSA 1RJ7A 2WQ4A 2YC0A 1ZVFA 1CVNA 4QGNA 4XMAA 5J98B 1CPNA 1XSQA 1ZM1A 5I8SA 3VL8A 2UWBA 1JS9A 1RUJ3 2ET7A 4IEVA 5E16A 5A70A 3ZXEA 3RZJA 1RUD3 3H7JA 3LD8A 4EN8B 3V64A 5JSPA 2W1SA 1AXKA 4ZKTB 1W6MA 1UY3A 1GP4A 4Q1RA 5F3CA 2VBBA 4QU2A 3ZSLA 5FZFA 3Q9OA 5FCCA 1DDLA 5FY8A 3K48A 2V73A 5GLVA 4CYDA 1F4AA 1A8DA 1WW4A 1UAIA 4GA9A 2HWC2 4DMIA 4JRAA 1GZWA 5KXCA 1M06G 2Y6HA 2SLIA 1R1ZA 1OHFA 3OGSA 4BA6A 2ZX4A 4CP9B 4N90A 2HKXA 4XPVA 3QLQA 3ZFGC 1AR63 2GH2A 2ZBJA 4GB33 3FLPA 2E33A 2LROA 2GH8A 2FZ2A 2WFF3 2B4KA 4NIDA 1OH3A 1W0PA 5L36A 4UYBA 3VBOC 4DRVA 4XJUA 2HWD3 1CN1A 1NAEA 1SG3A 1UQXA 2RG4A 2VECA 3FL7A 1F9KA 1W6QB 3KM5A 1UU4A 3T1MA 2CYFA 5T54A 5JPMB 4D7YA 4RS5C 1W8UA 4XXPA 3I3EA 5IK7A 3ZYIB 5JWPA 5FYTA 1K5MA 1SDWA 2W1UA 3RNSA 5I0SA 3BODA 3BOWA 2ZKLA 3ITQA 4GB31 5I8YA 4S2FA 4MGIE 5C6CA 4W8JA 1COV3 2I45A 3IDBB 2WLPA 3W21A 4BIFA 4Q4X1 4GKXA 4XZPA 5FZMA 5BNQA 5CFDC 1I5PA 3MIBA 5FP8A 1S55A
chains in the Genus database with same CATH topology
4LK6A 3ZYHA 4A6SA 4CPBD 4YW6A 4BQ5A 1WCUA 3UT0A 4YW7A 1HN0A 1W8ZA 1W9FA 1GWLA 4LKFA 4CP9A 2K46A 4BQ2A 4LK7A 1W8TA 2JWPA 4AL9A 4CPBA 1W8UA 3ZYFA 2WYFA 1W8WA 1V0AA 1WMXA 4LKDA 4LJHA 2KR2A 4LKEA 2LRPA 4BQ3A 3ZYBA 4YWAA 4CP9B 1WZXA 1UOJA 4BQ4A 5D21A 1GWMA 2LROA 1W90A 3F95A 1OH3A 2VXJA 1GWKA 3ORJA 2O14A 2C24A 2Q1FA 1L7LA 1OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK6 A;  3ZYH A;  4A6S A;  4CPB D;  4YW6 A;  4BQ5 A;  1WCU A;  3UT0 A;  4YW7 A;  1HN0 A;  1W8Z A;  1W9F A;  1GWL A;  4LKF A;  4CP9 A;  2K46 A;  4BQ2 A;  4LK7 A;  1W8T A;  2JWP A;  4AL9 A;  4CPB A;  1W8U A;  3ZYF A;  2WYF A;  1W8W A;  1V0A A;  1WMX A;  4LKD A;  4LJH A;  2KR2 A;  4LKE A;  2LRP A;  4BQ3 A;  3ZYB A;  4YWA A;  4CP9 B;  1WZX A;  1UOJ A;  4BQ4 A;  5D21 A;  1GWM A;  2LRO A;  1W90 A;  3F95 A;  1OH3 A;  2VXJ A;  1GWK A;  3ORJ A;  2O14 A;  2C24 A;  2Q1F A;  1L7L A;  1OKO A; 
#chains in the Genus database with same CATH topology
 3EB7 A;  1VMF A;  4C91 A;  2VG9 A;  5DAQ A;  3GBG A;  3PUA A;  3P3N A;  3DL3 A;  3FBM A;  4XUR A;  1Q5O A;  4ONU A;  5FXW A;  5A3P A;  3CKH A;  4I02 A;  4IER A;  4GUL A;  5DAX A;  2QQN A;  4QX0 A;  4D6S A;  1AR9 2;  3PUI A;  2R6Q A;  1B35 B;  2VNV A;  5F1R A;  3AL6 A;  4XDQ A;  1W28 A;  1N1S A;  1VRH 2;  2QUO A;  3GZT B;  4QHB A;  1H2N A;  2C6S A;  3I2I A;  1UCX A;  3MIF A;  4MV2 A;  5I93 A;  2W87 A;  2WDB A;  1MAC A;  1DP0 A;  5I0R A;  1OC1 A;  4KH9 A;  3WX5 A;  1UXX X;  4TLG A;  1CR7 A;  2JIJ A;  2CHH A;  3BUC A;  1SFN A;  2HWD 2;  2MHF A;  4Q29 A;  3ZDS A;  2A5Z A;  3HN1 A;  4AYU A;  1ND3 A;  2R04 3;  4AFD A;  1JYX A;  2K2S A;  4MGS A;  1VBC 2;  1GZW B;  2JEC A;  3PTY A;  2VZP A;  4MO3 M;  3WDY A;  3ZN4 A;  2FDF A;  3HNB M;  3OGG A;  1O7F A;  4Q4V 3;  5GLW A;  2GDF A;  4V2W A;  1WME A;  5LK7 B;  2Z79 A;  1N3O A;  4QGM A;  3IDA A;  3E97 A;  4TYS A;  5F39 A;  5A3W A;  5EYX A;  4CSW A;  4UAP A;  4PF1 A;  2J1V A;  3ZX7 A;  1OQ1 A;  1XU2 A;  5C3O A;  3J8F 2;  2B39 A;  3POG A;  5HI0 A;  1NZC A;  2YGM A;  2CV6 A;  2HYK A;  1KQR A;  3VB9 A;  4OZX A;  3VZN A;  2Z4F A;  1R09 1;  4QKB A;  3H8X A;  1O3Q A;  5A6Q A;  1UU5 A;  2G9Z A;  4FP2 A;  5ABJ C;  3KCC A;  3LDB A;  4Q4V 2;  1T2X A;  1BEV 3;  3F95 A;  3C7O A;  4XUQ A;  1B09 A;  2BWA A;  1POQ A;  5A7W A;  2RDN A;  3BAL A;  2G1M A;  5LK5 A;  2NN8 A;  3WP4 A;  2Z69 A;  4W50 A;  1VPH A;  1LOF C;  2UWC A;  4C0B A;  2F6B A;  2I74 A;  4JDO A;  2WA3 A;  1H30 A;  1QNW A;  1NLQ A;  2DCK A;  2AEZ A;  4GAL A;  1W9S A;  2FBE A;  3WZ1 A;  1AXY A;  3M1H A;  3ZYB A;  3DKW A;  1RUH 2;  3HEI A;  5FZ8 A;  2XPJ A;  4HT1 T;  3FC0 A;  2EAA A;  2HWF 2;  3ZFE B;  5FP7 A;  3LEG A;  1JYV A;  1QXR A;  4P5H A;  1R09 3;  1W9Y A;  5CFC C;  5L7O B;  1HB1 A;  3ORJ A;  2CTV A;  3U1X A;  2X10 A;  2IVJ A;  1RUG 1;  1OXC A;  5C5T A;  3WF4 A;  1AXZ A;  5J3U A;  2XL7 A;  1XYP A;  2X29 A;  5KXE A;  4P14 A;  2W5F A;  5SV8 A;  3HJR A;  3H0O A;  5TSW A;  4I3G A;  3WDX A;  1FPN 2;  4Q8L A;  1OT5 A;  2A75 A;  1C8M 3;  4RGA A;  1BK0 A;  3N7K A;  1UD1 A;  5E6H A;  3LAG A;  2VTF A;  2VBD A;  2GSY A;  1YJL A;  1HRI 2;  2J42 A;  2RS1 2;  3IZO A;  4OHV A;  4OHZ A;  3VBO B;  4AEJ A;  3A0N A;  1LOB A;  1XC6 A;  3LDK A;  2VOT A;  4RFR B;  4OVE A;  1O8S A;  1ZRD A;  2HLE A;  5J09 A;  2A6Z A;  2YHJ A;  1UN1 A;  2G19 A;  3Q8E A;  4FPE A;  4XIK A;  5FUI A;  1WCQ A;  1GKB A;  4NVP A;  5FBJ A;  3RMY A;  4AHZ A;  5FYH A;  5FXV A;  5AC9 3;  5C8C B;  1IOA A;  4EN0 A;  1QJU 2;  5FPB A;  2AYH A;  3I2H A;  5L9B A;  1EUT A;  4H55 A;  3LSE A;  3B9C A;  4B3N A;  4MOA A;  4Z2W A;  2DUO A;  2WN3 A;  4QKF A;  1NXD 1;  3J7L A;  2YXS A;  1VB4 A;  2BGP A;  4CVU A;  3QAC A;  2ZAA A;  2EXI A;  3VDD A;  1JYC A;  3C3V A;  4A7K A;  3B7M A;  1MEC 2;  2NPI A;  3TOJ A;  1WZX A;  3MW4 A;  3Q8F A;  4OHX A;  4JDN A;  3FE5 A;  1SCS A;  2IXK A;  2WJS A;  5F8P A;  3BVC A;  2G9F A;  1H2K A;  3WY6 A;  2OPK A;  4S2D A;  5A6X A;  3HOB A;  3DKQ A;  1GBG A;  3I8T A;  5FRE A;  4AED C;  3VDB A;  1BZW A;  2B9U A;  1C28 A;  3PJQ A;  1HRV 3;  1HIX A;  2E9Q A;  1ND2 B;  1UWW A;  3AXD A;  3EXU A;  3OG2 A;  4XIL A;  1W2U A;  3ACG A;  5DDJ 1;  3N9Q A;  5E1R A;  1OLR A;  1LHW A;  3P3P A;  2MEV 2;  5EWS A;  5CU1 A;  4EWD A;  4OUL A;  1YQ2 A;  2D7F A;  2BV4 A;  3T2T A;  5FPV A;  4A2U A;  4OZO A;  1OOP A;  4D6Q A;  5JCT A;  2XB6 C;  3B93 A;  1ZNP A;  1ENQ A;  4K7J A;  2AC1 A;  2JG9 B;  1I3H A;  5F37 A;  4JZR A;  3LDR A;  1COV 2;  1GWM A;  1CIY A;  3A23 A;  2ZA9 A;  3ATG A;  1UMZ A;  4QPG A;  2EIE A;  1H2L A;  1AX1 A;  4K3U A;  4WM7 C;  1JU3 A;  2WA4 A;  5C3P A;  2PAM A;  2V4V A;  3A0K A;  1G6N A;  3ZN6 A;  2RJ2 A;  4CCD A;  4LBM A;  4DXT A;  1PVC 1;  5AC9 1;  4HSL A;  4Q4X 3;  4LBQ B;  2JG9 C;  4QDS A;  1NLS A;  1LNS A;  4A4A A;  1A6C A;  1H8V A;  4PQQ A;  1GOH A;  3AYD A;  3RYR A;  4W6X A;  4GAZ A;  3WNK A;  1JMU B;  1KD7 A;  4ZS2 A;  4AFA A;  4CE8 A;  1OPO A;  5FKB A;  1OLM E;  3BKZ A;  2J1E A;  1RGS A;  4AI2 A;  5KHG A;  3LOB A;  2X53 S;  1OD3 A;  3R0R A;  1VR3 A;  3DN7 A;  2IXL A;  4NHK A;  3TN9 1;  3UGH A;  5DAW A;  1W90 A;  2WUH A;  2HWE 1;  1WWY A;  5JIA A;  1ODM A;  5HXV A;  2WNU A;  4PBO A;  4AQT A;  4ZU7 A;  3M8L A;  1O3S A;  4PDW C;  1VBC 3;  5FYC A;  4OI4 A;  1E5H A;  4N53 C;  4LO6 B;  3M3Q A;  1TZO A;  4PCR A;  4KWU A;  2NYY A;  1BYH A;  3RYK A;  3WW2 A;  4COZ A;  1VBA 1;  1AUY A;  4OFG A;  1J3Q A;  3BPZ A;  2YBK A;  2GMP A;  5FZE A;  4Q26 A;  1HW5 A;  5FXX A;  3SXW A;  5JXH A;  4KG0 A;  2Y38 A;  2RV9 A;  3IB3 A;  4M0N A;  4N8M A;  5FZH A;  3OSD A;  3PHM A;  5FZC A;  2LRP A;  1RUI 2;  3ZIX A;  3S6P A;  2CNA A;  2IUW A;  4E8C A;  1JHJ A;  1ONA A;  2GNM A;  1PO2 3;  2XJP A;  5E8A A;  3WP3 A;  1QH7 A;  3BIW E;  4FAH A;  3I54 A;  3ZO0 B;  1VP6 A;  4I0B A;  2D5F A;  3B94 A;  1CJP A;  2XON A;  3I4I A;  1I6X A;  3SIT A;  4YVW B;  5CFD A;  5CBL A;  3UES A;  4EZ4 A;  3O1U A;  4D94 A;  1QH6 A;  3AYE A;  4Y26 A;  1VBB 2;  3E5Q A;  3A4U A;  5J36 A;  1WMX A;  2GNB A;  2XOM A;  4PI0 A;  2XJR A;  3B01 A;  3NNL A;  1COV 1;  5ACA 1;  4YSF A;  1Q3E A;  2HBT A;  4XUP A;  4LLO A;  1X36 A;  3OBA A;  1QJF A;  1OPM A;  4XTP A;  3LB9 A;  5A6Z A;  2K9Z A;  3DF0 A;  3B69 A;  3O1V A;  2HYX A;  1YYN A;  2GC2 A;  1YQ5 A;  4CRQ A;  4AK3 A;  4IV3 B;  1AF9 A;  4P5Y A;  1YFU A;  2VNG A;  3I59 B;  4Y4R A;  3MIG A;  1QJX 3;  3M70 A;  3NAP B;  4K8R B;  5K4L A;  2RS5 3;  4CEW A;  2JIG A;  1APN A;  1W6N B;  1UU6 A;  3HNM A;  3H8O A;  4OUE A;  1PK6 C;  3THD A;  1PM7 A;  5FZB A;  1EYB A;  2OQ6 A;  5FP9 A;  5FZD A;  4AXO A;  4QHZ A;  1ND2 C;  1X9T A;  1AR6 1;  1ST8 A;  1F4H A;  1R1A 2;  1JN2 P;  1RUE 3;  2ZZQ A;  3DPR A;  4XFH A;  2YBS A;  5A7W B;  1O59 A;  4LBN A;  5FYM A;  2BFU S;  5FZ6 A;  3ZXF A;  1KS4 A;  2QBX A;  3WVJ A;  1MS1 A;  2VVD A;  2XWB B;  1NY7 1;  3U4S A;  1QJU 3;  2W39 A;  3M3O A;  5A1A A;  3O12 A;  4I01 A;  1WW5 A;  1W6N A;  5A7N A;  3ZFG B;  1D2Q A;  4YZ4 A;  2BBV A;  1FPN 3;  5DG2 A;  4U2A A;  5T5J A;  2HWD 1;  1UX6 A;  1VIW B;  2P6H A;  3RI9 A;  4CPB A;  2VC9 A;  2DYC A;  2ZOE B;  1QDO A;  4Q4X 2;  1US3 A;  5KHI A;  5C3R A;  4BQ3 A;  3MHZ A;  3ZXJ A;  4ARY A;  2RDS A;  3BTZ A;  3U11 A;  4NHM A;  1X33 A;  2XQR A;  4Y1V A;  4CDW C;  4JAA A;  1JUI A;  3AMP A;  1LCL A;  2GZW A;  1O6U A;  1F8V A;  4UF0 B;  3ZFE C;  2DVG A;  2VNR A;  2R07 1;  4ASL A;  4COW A;  1DGL A;  1NCQ C;  5DMY A;  5CYY A;  1AYN 2;  2PHF A;  5T3N A;  2XHN A;  1XE8 A;  2C9K A;  1HJG A;  4FCA A;  3ZXL A;  1JZ8 A;  1P8J A;  1KFU L;  1PIV 3;  3V0B A;  3D0J A;  4A3X A;  3RRD A;  4JKM A;  4QX7 A;  3HWJ A;  5L7O A;  1WW7 A;  1V70 A;  4LE4 A;  1KRI A;  3GXU A;  1O5L A;  5IVE A;  1HKD A;  5LCW L;  5IVC A;  1KDK A;  4R9D A;  4MGZ E;  4AI0 A;  5JDB A;  4AI1 A;  4QX2 A;  5FMO S;  4LO5 B;  4X6R B;  1DYK A;  1OBN A;  4XDO A;  1NA1 C;  4ZZ8 A;  2Y6K A;  2D97 A;  2V72 A;  2G4I A;  1C8N A;  3B9I A;  4AVC A;  4D69 A;  1BCX A;  3CZU A;  2P34 A;  1J3P A;  1UPS A;  3JD7 2;  2A3X A;  4FXK B;  2WZP P;  2HWC 3;  5HCB A;  3KF3 A;  3WDW A;  1YFX A;  4M3C E;  4AGV A;  2P2K A;  2WSU A;  1C5H A;  1QF3 A;  1QY4 A;  2E7Q A;  3KV9 A;  3ZMO A;  5ANN A;  1G9C A;  2QQI A;  4JGZ C;  1LB2 A;  4BQ2 A;  1JTZ X;  1U5Z A;  2E31 A;  1NA1 B;  2A1X A;  1VRH 3;  4BLI A;  3LE0 A;  4Y3O A;  4XQ4 A;  2R0F A;  2JB4 A;  1SCR A;  3VGI A;  1GP6 A;  5HV0 A;  3Q8A A;  4YWA A;  5FQ0 B;  5AC9 2;  1EPW A;  2R49 A;  5C71 A;  1QJY 1;  4TXW A;  1AL2 3;  4E2Q A;  2Q4S A;  2PLV 1;  4LMF A;  4AI8 A;  1D0G A;  4XET A;  1QWR A;  3ILR A;  3KF5 A;  1PX3 A;  4G4F A;  4UBG A;  1QNY A;  4CUA A;  2XLA A;  4KU7 A;  3TBD A;  1T6B X;  2Q5T A;  4Q4W 2;  3SEE A;  1U5Y A;  2VOV A;  1IS5 A;  4NO4 A;  3K4Z A;  3PME A;  2IXC A;  1O91 A;  1W3X A;  5EP9 A;  3ZR5 A;  2WNU C;  1X9P A;  5JZG A;  1ASJ 2;  3RYP A;  5CZK A;  4NOT A;  1C5I A;  1FMD 2;  1WGP A;  3IMM A;  4CP1 A;  1RTV A;  4M0H A;  4Z2A A;  4A44 A;  3GBF A;  2PHX A;  1G7Y A;  4ZS3 A;  2Y6G A;  3LFM A;  2PA7 A;  4HK9 A;  5DAB A;  1Y7B A;  3BTX A;  4FFG A;  4Q0S A;  3OUJ A;  3AXE A;  1FNZ A;  3N9O A;  3AP6 A;  1PZ8 A;  5GM0 A;  2XJT A;  5T55 A;  1IGO A;  5F5Q A;  1XJA A;  1Z78 A;  3WG3 A;  2PLV 3;  2VUD A;  2VZ1 A;  2ZS6 B;  1POV 1;  2WZR 1;  4N9I A;  4LT5 A;  2I07 B;  1F15 A;  4K21 A;  4RGG A;  5FWJ A;  2D3R A;  2OS2 A;  4K1Y A;  5FYB A;  3N35 A;  1MS8 A;  1X50 A;  1JZ2 A;  3ZFF B;  2EAL A;  3WW1 A;  1GU3 A;  3X29 B;  5EIY B;  2ZHN A;  4XFF A;  4NRP A;  2WQ8 A;  3MV1 1;  4BK4 A;  2WWJ A;  4RQP B;  4W6Y A;  1ULD A;  4C1X A;  3WHU A;  3TEW A;  5FBZ A;  2VCM A;  1FT9 A;  3RSJ A;  1UMH A;  4DZG A;  2CU5 A;  2VR4 A;  1UYZ A;  3VHR A;  4E8D A;  3UET A;  2ZHL A;  2CY6 A;  4CU9 A;  2VZ3 A;  3VL9 A;  5A3N A;  2PYT A;  3OF1 A;  3HN3 A;  2VUL A;  1ULO A;  5DPN A;  3WCR A;  3AP7 A;  4BMB A;  4BQ1 A;  4H7M A;  2VPV A;  2P5B A;  4CEW B;  2Y33 A;  3C7G A;  3J7H A;  3ZYP A;  2HEV F;  3ZN5 A;  1HQW A;  1DQ5 A;  4XBN A;  3V65 A;  1ZRI A;  4YM2 A;  2DVF A;  2AGS A;  3BPS A;  5LAT A;  4HL0 A;  2VUA A;  3MBW A;  1CIW A;  3DXU A;  5A33 A;  1QHD A;  2D6K A;  1IQD C;  4DFS A;  4QB1 A;  1Q8Q A;  4C0H A;  4NII A;  1LEN A;  3LPG A;  4XJ9 A;  2BPA 2;  4CDU C;  3IDC B;  5FYI A;  1U5X A;  4JGY B;  4JHZ A;  4RHV 2;  3CHX A;  4DS0 A;  3KLS A;  3MLJ A;  3ME2 A;  4XHB A;  4ZON A;  2EXH A;  2VZV A;  5C9A B;  4WM8 C;  3WSO A;  2MEV 3;  3ES4 A;  3NRU A;  3POF A;  1H8T A;  2HEY F;  5BUV A;  2BU9 A;  1RIT A;  3D8C A;  4AGG A;  4B4R A;  3O1R A;  1Q8P A;  2VUC A;  2GP3 A;  4FOY A;  1ASJ 3;  2D6N A;  3MFA A;  4P9I A;  1WLD A;  3AP9 A;  4IGP A;  3UV9 A;  1W39 A;  4QKD A;  2PEL A;  3VD9 A;  3BYW A;  4BB3 A;  2VM9 A;  1GWK A;  3RWK X;  4JGY C;  1BVP 1;  4U36 A;  3I2D A;  1WMD A;  1XRU A;  4A6O A;  5C70 A;  4CCC A;  2HWC 1;  1W9W A;  3SLI A;  5EYY A;  4CDQ B;  5GZE A;  1NZI A;  4ZXE A;  4NN0 A;  4TZD A;  1W8Z A;  2RJK A;  3ZXK A;  4YVW C;  4UW6 A;  4N43 A;  4EWA A;  3U0Z A;  3ZSM A;  2EIC A;  3U78 A;  3KT1 A;  4YGE A;  3MPP G;  3TN9 2;  4QQH A;  4AED B;  4G3Y C;  3ROU A;  2RR1 1;  1JUH A;  5IVF A;  1UF2 C;  3ZXA C;  2NLR A;  1LJ7 A;  2XGX A;  5FO8 B;  4D0Q A;  1AR6 2;  2BOJ A;  4FPK A;  5I0D A;  2TUN A;  3Q8B A;  2JDA A;  2VZT A;  4W6W A;  3N3H A;  5A3T A;  2K0G A;  2ZPX A;  3LGR A;  1A3K A;  4JGZ B;  4M3C B;  1OA4 A;  1PHM A;  1PNG A;  4MHR A;  4Q4Y 3;  3IMN A;  3AX4 A;  1AR7 2;  1IQA A;  3KSC A;  1LKN A;  1IG3 A;  4BDV B;  1B35 C;  4COY A;  1IPS A;  2R04 1;  3SC7 X;  1OUX A;  1QU0 A;  4XQW A;  3SCF A;  1GOF A;  2DTW A;  3WXP A;  1WBL A;  1C8M 1;  1N47 A;  3CU7 A;  3NNJ A;  5H9P A;  4HKO A;  1W6O A;  3WNX A;  3VDC A;  3GAL A;  4CP9 A;  4OCT A;  2WO3 A;  4LO8 A;  5AFE A;  5JMC A;  3PVB B;  4YGC A;  2JE7 A;  1W3V A;  1F35 A;  2JD4 A;  1YIP A;  3D3A A;  1O4T A;  5EJZ B;  1BBT 3;  4WV8 A;  4UXA A;  3S57 A;  2PMW B;  1ZZ9 A;  4PJY A;  1W99 A;  4E4H A;  5FY9 A;  1OOP C;  2QKD A;  1DLC A;  3POS A;  4XDP A;  5GKA C;  1XQN A;  2ZTN A;  1EPZ A;  5FJK A;  1H4H A;  4M3C F;  5FFO C;  2DVB A;  5CG8 A;  4K1Z A;  3NV4 A;  1R09 2;  4AEK A;  1QJX 1;  1DGW A;  4I0W B;  4IE6 A;  3WQ0 A;  3FFZ A;  3H7Y A;  2EID A;  2ZHK A;  2VAU A;  4Z07 A;  2UWA A;  2D44 A;  2WS9 3;  2BNN A;  5I8T A;  1HQN A;  5ACA 2;  3W5N A;  3ZKY A;  4YG0 A;  5FZI A;  5ABJ B;  5J7M A;  1QJY 2;  4DO0 A;  1RHI 3;  1QIQ A;  3AVR A;  4UFL A;  4DY5 A;  2CL2 A;  2JDK A;  1CWP A;  5IYY A;  2XJQ A;  3QH6 A;  1GQP A;  4BZ4 A;  5HCF A;  3DV8 A;  5FDB A;  5L19 A;  1MQT C;  1C8M 2;  2DCY A;  2QDR A;  2WSV A;  1GYK A;  4GMP 3;  4DRR A;  1S0C A;  4BWO A;  4YW5 A;  1YRZ A;  3ENR A;  4RN5 A;  4BLJ A;  2BGC A;  5DUV A;  4YG3 A;  5BNO A;  2AEN A;  1RUG 3;  4FOQ A;  4MVT A;  5FUN A;  2C1F A;  2C5D A;  1PO1 3;  2JDU A;  5A1L A;  3I2F A;  2VQU A;  3FHI B;  1CZT A;  3TEY A;  4JQR A;  3O1S A;  4XXA A;  3FZ3 A;  3KGZ A;  4XJ8 A;  5DZG A;  3HMY A;  4JV4 A;  3SH3 A;  5IVV A;  1PZ9 A;  5CFC B;  2EIB A;  5LA2 A;  3R05 A;  5T5P A;  3FHQ A;  4LJH A;  2C4X A;  2XLG A;  4XF4 A;  1EY2 A;  4PIZ A;  4SLI A;  2DU1 A;  4GIQ A;  3M4F A;  4JKK A;  2A6X A;  2GP5 A;  2KXL A;  2ZGO A;  4GMP 1;  3LFI A;  4XEZ A;  2BER A;  4R4X A;  4CDU B;  3NKT A;  5IUQ A;  2Y26 A;  4KG8 A;  1MR5 A;  1X8M A;  1QOO A;  2ZX3 A;  3ASI A;  4Y22 B;  2HEW F;  2VQT A;  3VKL A;  1A8M A;  4PQ9 A;  1OLQ A;  1AR8 3;  4QWN A;  4OUS A;  2LW8 A;  3HT1 A;  3R4D B;  3PJY A;  4LHK A;  1KEX A;  4QT6 A;  4UW5 A;  3TRS B;  2VOX A;  2GND A;  2VCB A;  2J1T A;  2JKB A;  2RS5 1;  2BNM A;  2HWE 3;  1UYY A;  3ECQ A;  2F4P A;  4ASM B;  2R06 3;  3K3O A;  4LHL A;  3HQR A;  4R9C A;  4XE9 A;  4Y4Y A;  2X5I C;  3CMG A;  4DQA A;  5A6Y A;  2DUP A;  1NCQ A;  1E5I A;  2OW4 A;  1QMJ A;  2B45 X;  3BB6 A;  5FAX A;  4LNV A;  2UYB A;  5FY4 A;  1E5R A;  2P3Y A;  2RR1 2;  4OUM A;  3VBH B;  4FTS A;  5FLI A;  5F7U A;  4M4R A;  4LBL A;  5FLJ A;  4BQW A;  2BJS A;  5IAX A;  4R9B A;  4XF9 A;  5A80 A;  4MGT A;  2YDE A;  3I2O A;  3H1Y A;  3GJB A;  2JE9 A;  3PIJ A;  1JZ4 A;  3TEZ A;  1J59 A;  4MSV A;  1LHO A;  3RZM A;  5I0U A;  4P02 B;  1A78 A;  1SBE A;  3H9A A;  5KR7 A;  3IM0 A;  2QQO A;  1QQP 1;  4DXS A;  5JOZ A;  4KMQ A;  2QQU A;  4W65 A;  4ZU5 A;  2OUJ A;  4YZ2 A;  2Q1F A;  5IHR A;  4IDZ A;  3O7O A;  1REF A;  1H1M A;  5IWF A;  1HXS 2;  2OZ6 A;  4E9K A;  2O8O A;  1VRB A;  1WLC A;  2ZCW A;  3AMM A;  1Z0H A;  4K6B A;  4RHV 1;  4BCU A;  2E53 A;  2IWG B;  3O1P A;  3ZYJ B;  2R06 2;  1PGL 1;  1CAV B;  1W8W A;  2JDH A;  1X8E A;  3AJZ A;  4KL1 A;  1IPK A;  5F32 A;  3ZFF A;  4NIH A;  3FBY A;  2A3Y A;  3AVS A;  4Y33 A;  5E88 A;  3POI A;  1MZ6 A;  4AW7 A;  5FZ0 A;  2DCZ A;  2ZGQ A;  3AKP A;  4IW3 A;  4AE2 A;  5CKN A;  1RUC 1;  1S0E A;  1VBB 1;  1J3R A;  1DQ0 A;  2ZHM A;  2OKX A;  4DIN B;  5CVR A;  1RED A;  1DBN A;  3NJX A;  4Q4W 1;  5T50 A;  1NCR B;  4CZS A;  4OMC A;  3AMN A;  5KC6 A;  2RS3 3;  4ES9 A;  1MS4 A;  3D5O A;  2JG8 B;  4J6G A;  2JDY A;  1KJL A;  1S0F A;  2UYA A;  3A21 A;  3HQU A;  4XZU G;  2HWB 1;  2IFR A;  5J48 A;  1SQ4 A;  4MXV A;  5FP4 A;  2BYV E;  2RMU 1;  4MET A;  1NKG A;  3BTA A;  2VCC A;  1RUG 2;  3KCX A;  3WD5 A;  2HBU A;  3ZSJ A;  2VMF A;  4QPY A;  2KR2 A;  4GJY A;  2C9A A;  2GC0 A;  3THP A;  4BXF A;  5SV5 A;  1K12 A;  1D4V B;  1Z7S 2;  2W46 A;  4LUL A;  3FUQ A;  5C9A C;  4YW2 A;  3T30 A;  1GIC A;  1QKQ A;  3LEI A;  4IV3 A;  3AK0 A;  1XNK A;  4RA0 A;  2AAC A;  5DG1 A;  1US2 A;  3VBS A;  3WT3 A;  2R1B A;  2VZU A;  2QVS B;  5FZ9 A;  5FY5 A;  4DY3 A;  1CZV A;  1V6L A;  4OYU A;  2RS3 1;  3QCW A;  4RD7 A;  4P9X A;  1AHS A;  2P17 A;  1RB8 G;  3D82 A;  4LOS A;  3VBO A;  1WD3 A;  1S0D A;  3POB A;  3IDE A;  5F5C A;  4CCN A;  5FY0 A;  1H9P A;  4PHZ A;  3DPR B;  3LCP A;  3SIS A;  2RM2 2;  3K51 A;  1LOD A;  3MIH A;  4HPK A;  4YM0 A;  1G9B A;  4KWJ A;  5K0U A;  1MZE A;  1C1L A;  3U4X A;  3NST A;  4LKE A;  4UBH A;  1JYI A;  1YQC A;  4IEX A;  5K8S A;  3I3B A;  3RZZ A;  3RZL A;  1S0J A;  3S7I A;  3MEP A;  3UNP A;  1GP5 A;  1JU4 A;  1NQJ A;  5D21 A;  4HET A;  2EAK A;  2FCV A;  1H9W A;  2H0B A;  4MZU A;  2WT1 A;  3AZZ A;  3NV2 A;  3I3M A;  4D7S A;  1HXS 1;  5LWB A;  3MF6 A;  1M4W A;  4B1M A;  1S2E A;  1WLW A;  4NHX A;  4OQ8 A;  2WT2 A;  1GOG A;  5T5L A;  3PUR A;  3VDD C;  2JEN A;  3WW4 A;  4Y22 A;  3VHN A;  1ULF A;  3WNL A;  3O5S A;  3D4K A;  1ZBA 1;  3ZN6 B;  1MS0 A;  1YQ8 A;  2B7Y A;  5HBA A;  1PMJ X;  3RJR A;  1CD3 G;  1EAH 3;  4AFB A;  2RS3 2;  4CDQ A;  4P9L A;  2QQW A;  2PLV 2;  2VZO A;  4Z92 B;  2A6W A;  2BP6 A;  2JXA A;  2L9L A;  4KU8 A;  3PVE A;  1UOG A;  3LOI A;  1AVB A;  1OOP B;  2RS1 1;  3L2H A;  3RG0 A;  1R08 3;  1C1F A;  3WLU A;  3HD8 B;  3POE A;  1JI6 A;  4J1X A;  1GFF 2;  2HJI A;  4QB2 A;  4A45 A;  4LLF A;  2GC3 A;  5LA9 A;  2TBV A;  2A6Y A;  5DDJ 3;  5LBC A;  2K46 A;  2W0X A;  3MLL A;  4XCA A;  5B4N A;  4I09 A;  3OY8 B;  3PUH A;  5BNN C;  3U07 A;  4Y5Z 0;  2QQL A;  1YEW A;  2DCJ A;  1BKZ A;  4AG4 A;  1O5U A;  2BNO A;  2MEV 1;  4LBK A;  5CIS A;  4D6R A;  5LB6 A;  1MEC 1;  5KHK A;  4D8M A;  1K5M C;  4LPL A;  3PTR B;  4J25 A;  4YVS C;  2YRO A;  4XOG A;  3VLB B;  4LA2 A;  4BME A;  5JSR A;  4WM8 B;  4YFW A;  4UWD A;  5FZK A;  3N7J A;  4IE0 A;  4FTE A;  4XFB A;  2TNF A;  3I2J A;  5EFU A;  2XH6 A;  2GME A;  4AR2 A;  1VBD 3;  3CJX A;  3MUY 1;  1NQD A;  3CLP A;  3K3N A;  4N53 B;  2GN7 A;  4P00 B;  5A7P A;  3T08 A;  5IFP A;  2E32 A;  5BNP B;  1QXP A;  1UYX A;  2ES3 A;  4M4P A;  4QM9 A;  4WVV A;  5JOX A;  4GH4 A;  5D2A A;  3PVN A;  2WYS A;  1IKP A;  2DVD A;  4LKD A;  1Y9G A;  1AL0 G;  1BEV 2;  3N9P A;  3M3I A;  4WVM B;  3DYM A;  5APA A;  1YHF A;  4QPW A;  4LIV A;  3WP6 A;  1UPI A;  2KD7 A;  2OXB A;  4Q1P A;  1S0B A;  4JCK A;  4URA A;  5GZD A;  3VBU B;  2GU9 A;  2WS9 2;  5CKM A;  5EPA A;  1AR8 2;  1DGR A;  1IHM A;  2XHK A;  2RVA A;  4PIX A;  5FKC A;  1AR7 3;  1ZZ6 A;  4P9W A;  1YFY A;  1HB3 A;  4L11 A;  5LA1 A;  4QDQ A;  4LK6 A;  1K42 A;  3AFG A;  3KT7 A;  4YPJ A;  2V09 A;  4QPG B;  1AYN 3;  4H3W A;  4LIT A;  1JOD A;  1D2S A;  1H8T B;  1D0H A;  2QQV A;  2XVK A;  1CQ9 A;  3HVD A;  4CTE A;  4M01 A;  3MID A;  3NJV A;  1OA2 A;  4WVW A;  3H1M A;  2XVL A;  2JG8 A;  1UZV A;  2W95 A;  1HB4 A;  2OA2 A;  4XBL A;  4YVW A;  2CGO A;  3N9L A;  1H0B A;  1AR9 3;  1QQP 2;  4D3W A;  4QKN A;  2QJV A;  3NNG A;  4XFA A;  4JC1 A;  1SLA A;  2ARA A;  1PK6 A;  4XF0 A;  2JB8 A;  3VKF C;  3RMX A;  1NG0 A;  3KV4 A;  1V9U 3;  3NV3 A;  3T0A A;  3RZG A;  4UW4 A;  1IPJ A;  1HXS 3;  3LSD A;  5FZG A;  5LA0 A;  1LUL A;  2BQP A;  5F3I A;  1DYO A;  2XUE A;  4UI9 L;  3F2Z A;  3MIE A;  1QJE A;  3VHP A;  5F2S A;  3FX3 A;  4AVB A;  4GH4 C;  2J1S A;  4R4Z A;  1EV1 3;  5KWR A;  1BVV A;  4R52 A;  4AVS A;  2VOK A;  4HVQ A;  5IK8 A;  4HFS A;  5FYV A;  4JGZ A;  2DF7 A;  3J7N A;  3JD7 1;  1RC6 A;  1V9U 2;  4O65 A;  4LUK A;  4LE3 A;  3W58 A;  2OUH A;  4PBP A;  1Q56 A;  1C4R A;  2PXJ A;  3R4U A;  3OOX A;  2VXJ A;  5F9T A;  4KWL A;  5C9A A;  3MDP A;  3CJI A;  3OTF A;  1FYU A;  4DEV A;  3WQ1 A;  3C2U A;  3WW3 A;  5A3U A;  5L9V A;  3OBT A;  1ENS A;  1VBC 1;  3KGL A;  4AQ6 A;  4Q5O A;  3GF6 A;  5FIX A;  2ARX A;  1YO8 A;  2B9V A;  3IPV A;  4KWK A;  4RR3 B;  4V1P A;  3ACF A;  5D1I A;  3T2Q A;  3NQH A;  5A32 A;  1ZBA 2;  1HV0 A;  4CU8 A;  4IEO A;  4Q4Y 2;  3CBN A;  4XHX A;  1ND3 B;  4BE3 A;  5J96 B;  2VCA A;  4L99 A;  4FAG A;  2D6P A;  1VRH 1;  4QM8 A;  1WCK A;  1OQE A;  1G9F A;  5FMO L;  2ZAH A;  4DNY A;  4ASK A;  1GZ9 A;  4IE4 A;  5F6K A;  3JB4 C;  3RFR A;  3VD5 A;  1ZX5 A;  4ISR A;  4RR3 C;  3RGB A;  2ZEZ A;  4RYD A;  1VAM A;  2AEY A;  1UIJ A;  1OKO A;  5A1F A;  5FTT C;  1STM A;  4QD2 A;  3USU B;  3BTY A;  3UT0 A;  2VZS A;  2FDJ A;  4L92 A;  3UJQ A;  2ZX0 A;  1AYM 1;  4IV1 B;  2KM2 A;  4QQP A;  4FPH A;  2XL9 A;  2WNO A;  5LEK A;  1WW6 A;  1O4Z A;  2CAV A;  2VY0 A;  3KQ4 B;  3VBH A;  1D4M 2;  4NIG A;  1SPP A;  1OQD A;  1W06 A;  3CEW A;  2AUY A;  1UY2 A;  2PQS A;  3PIG A;  2XVG A;  2ORX A;  3C7E A;  1XND A;  5FLH A;  4B29 A;  3SKJ E;  3UKT A;  4F7Z A;  3WF3 A;  4NUB A;  3MZH A;  1PIV 2;  4LR4 A;  3V0A B;  1W6O B;  1ZBE 2;  2WL1 A;  3CJI C;  2VMG A;  3ETP A;  4FXG B;  1CES A;  4YM1 A;  5IVY A;  4AF9 A;  4BIO A;  2PN5 A;  1RMU 1;  4ITC A;  2V5Y A;  4ZXK A;  3WG2 A;  5BY5 A;  1UXZ A;  2O8Q A;  1NYW A;  4ET7 A;  1WBF A;  2D3S A;  1RIN A;  4OMD A;  5FK7 A;  1PNF A;  2JG9 A;  4HVO A;  1HJF A;  1FI2 A;  3N9N A;  4SBV A;  1MS3 A;  3A22 A;  5FPA A;  2GMM A;  1NUK A;  1N1Y A;  3ZLI A;  1AYM 3;  2D98 A;  3OBR A;  4XUN A;  4NWV A;  3WDV A;  1LEC A;  1W8T A;  2VQ0 A;  1TNR A;  2KA3 A;  2YPD A;  1QXJ A;  3EJK A;  3CJI B;  2ZEY A;  4UT5 A;  4AAP A;  4Y1Y A;  1VBE 1;  3KS7 A;  5H9Q A;  2FDG A;  5FPL A;  5CEH A;  4LA3 A;  5IW0 A;  5BNP A;  2J1R A;  1Y9Q A;  3GZU C;  4C8D A;  2XML A;  4Q0P A;  5FPX A;  3VBR B;  1V9U 1;  2MPF A;  1CAV A;  3BOP A;  2UU8 A;  2R16 A;  2H0V A;  1DZR A;  2VMI A;  1W05 A;  4F83 A;  2DFC A;  2NZ9 A;  3ZR6 A;  4NHY A;  1V6J A;  1Z7S 3;  2X09 A;  5FMC A;  4L2N A;  3AMH A;  1RUI 3;  2WNE A;  3KV5 A;  1I5Z A;  4FQZ A;  3THC A;  4A7Y A;  5BYN A;  1D4M 3;  1LHU A;  4QX8 A;  3RVH A;  3VBF C;  2VVF A;  4RHV 3;  4Q8K A;  3O1M A;  4IUG A;  3E5U A;  3W20 A;  2P4E A;  1PO2 1;  2JDZ A;  1VBD 1;  3D0S A;  5JXG A;  5FY1 A;  3T0B A;  4OI0 A;  4EN7 B;  4QU1 A;  3WIN E;  3NAP C;  5ANQ A;  3AP5 A;  2PHW A;  3DEM A;  3VV1 A;  4A3Z A;  3JB8 A;  4IGO A;  4RQP A;  3OEB A;  5C8C A;  3GJA A;  1GNH A;  4WM7 B;  2E7T A;  2WAO A;  1U5I A;  3ETQ A;  1SBF A;  1AJK A;  1TMF 2;  2ZGN A;  1ZYB A;  2WO7 A;  4QQL A;  4YW7 A;  1R1A 1;  1GMM A;  4P9G A;  1CX4 A;  1U12 A;  1ZZ8 A;  1W9F A;  4I0A A;  1OLM A;  2PTM A;  3TWI A;  3ZFF C;  3G6J B;  4A41 A;  2RMU 3;  1F5J A;  3GDB A;  3POY A;  2Q0A A;  5CKQ A;  5GJ6 A;  4AFM A;  3DXT A;  3I2K A;  3HT2 A;  3FLT A;  2GN3 A;  5FYZ A;  4RR3 A;  1LOC A;  5HCH A;  4OQ9 A;  5EZW A;  1BLZ A;  1VLN A;  1DG6 A;  2WFF 1;  4PDW B;  2Q8E A;  4CEY A;  3RZK A;  3JBG 2;  4IV1 A;  5BXX A;  3S0M A;  4TWT A;  4OI2 A;  4MX3 A;  1UZY A;  3C7H A;  5LW9 A;  4YFZ A;  4XJW A;  3IKW A;  4QX3 A;  5G04 L;  5FR3 A;  2V4A A;  3AKR A;  4XF1 A;  4Q4Y 1;  1KIT A;  4JTO A;  1DHK B;  1LES A;  1UZZ A;  3H3U A;  3NJY A;  3ZXG A;  1JZ7 A;  2VE1 A;  3OUI A;  3H3Z A;  1NCQ B;  2Y6J A;  2WNV A;  2ETE A;  2DFB A;  1DU3 D;  1UZ0 A;  1RXG A;  1XPW A;  3APB A;  3B00 A;  1CAX B;  2DWR A;  1UY4 A;  2QZ3 A;  1PMI A;  3MPB A;  4IE5 A;  4LKS A;  4MGY E;  4PIY A;  4RS5 B;  4Y20 A;  2AR6 A;  5IK5 A;  1YI7 A;  4PLM A;  3T2P A;  1EV1 1;  2ZAC A;  3POW A;  2Y6F A;  1NXM A;  2VZQ A;  2NM1 A;  4QHO A;  1OSG A;  1UNB A;  2YV8 A;  2WII B;  4IL7 A;  2ZGR A;  4AAX A;  3UK9 A;  1L7L A;  4CDX C;  3URF A;  1OVP A;  1UKR A;  4PF5 A;  1GQH A;  3E1F 1;  3K77 A;  4NHL A;  4YZ3 A;  2R07 2;  2RE9 A;  5FMD A;  3VKM A;  1YC6 1;  1QEX A;  5T5O A;  1O3T A;  2QQK A;  1PO1 2;  5DN2 A;  1Q8S A;  5BNO C;  1UX7 A;  3EO6 A;  2D6O X;  3PL0 A;  3LQC A;  4YGB A;  5DQ0 A;  1LHN A;  4Y5S A;  4BQY A;  2PHU A;  3USU A;  4DIQ A;  2A73 B;  4LBQ D;  2R7E B;  3BN6 A;  3ALQ A;  2QNK A;  2WNV C;  1FAY A;  4NRQ A;  4F8A A;  2FZ1 A;  2Y64 A;  2Z5W A;  1K45 A;  3NVC A;  3ZSE A;  4GWM A;  1MVQ A;  2R06 1;  4CCM A;  1BXH A;  4L0P A;  1ULC A;  2IXJ A;  1IKQ A;  1ODN A;  1SMV A;  1W03 A;  1PVX A;  1W8F A;  2C24 A;  3SEP A;  2RS1 3;  3NWK A;  3AP4 A;  1BK1 A;  2BTV C;  3HPN A;  3AKS A;  1R08 1;  3OYW B;  4KGG A;  4MLO A;  4YLZ A;  4CCL A;  2ZMN A;  1PGW 2;  2ZGU A;  4CXX A;  4IE7 A;  1LRH A;  3NW4 A;  1RUC 2;  2RM2 3;  3PVO A;  4XBQ A;  4ARX A;  1GAN A;  2WZ8 A;  3DCQ A;  4QMA A;  3U10 A;  1WA4 A;  1DYP A;  4Q0Q A;  4IEQ A;  4X6Q B;  2DDU A;  3T1L A;  2LS6 A;  4Q2F A;  5KXD A;  2NMO A;  5FYY A;  1JOB A;  1DQ2 A;  1KS5 A;  2JKX A;  4X8N A;  4FT8 A;  3TEX A;  2VMD A;  4I2O A;  3ZKU A;  3I97 A;  2PAE A;  4Y5T A;  1GSL A;  1VJ2 A;  4UOJ A;  3TN9 3;  5LRS A;  4TSV A;  3WP5 A;  5BNN B;  2CWM A;  1JYT A;  4Y1Z A;  1X82 A;  3KCY A;  1LGB A;  1OF4 A;  1TMF 1;  4FVV A;  1S2B A;  4OHW A;  1MQT A;  2W3J A;  2BGO A;  4LHN A;  4LEJ A;  3T0D A;  1UZW A;  1PGW 1;  3U75 A;  4RS5 A;  3ACL A;  3O1T A;  1K5M B;  4K8F A;  4WZC A;  1RMU 3;  3WUC A;  3AB0 A;  4EYU A;  1WA6 X;  1FPN 1;  1W8N A;  4FPY A;  4EN9 B;  2ZXQ A;  4O9G A;  3HQX A;  4RQP C;  1CAU B;  4NJ4 A;  2XR4 A;  2N7G A;  3JD7 3;  1FOD 3;  5FV3 A;  5F3E A;  2VO5 A;  5JZG B;  1Y4W A;  4LBJ A;  4LO4 B;  3FUO A;  5AVA A;  2W08 A;  3WF2 A;  5C3S A;  2Y8K A;  1OF3 A;  2OT7 A;  3J4U H;  4EE2 A;  3AZX A;  2ZGK A;  4MXW B;  1XYO A;  4AED A;  3U37 A;  4GZ9 A;  3OPT A;  4A7Z A;  3QD6 A;  2B8M A;  2ARB A;  3EYP A;  3H1W A;  1ZRE A;  1S1A A;  1AR7 1;  1W8O A;  4AEM A;  5J37 A;  3N4M A;  4N43 C;  4AVV A;  5K0U B;  1N3Q A;  3J8F 3;  1ZZ7 A;  3OCP A;  3S7E A;  3L9J T;  2CAU A;  5A7O A;  1S0G A;  1OH4 A;  3B02 A;  5FOB B;  1AYN 1;  5JIU A;  1TME 3;  2HWB 3;  5A7S A;  2ZGL A;  3FFQ A;  2JWP A;  1ZBE 1;  1RHI 1;  2WBK A;  3I3D A;  4FPF A;  4N7U A;  5KBF A;  2OZJ A;  1RVF 3;  1V6N A;  5B2G B;  3FMG A;  2OYZ A;  1MZ5 A;  5FMB A;  1YJK A;  5DZE A;  1EV1 2;  1WD4 A;  4BHP A;  5GZC A;  2DUR A;  2YFU A;  3L2Y A;  3III A;  4QPG C;  5FZ7 A;  4R9A A;  1FMD 3;  5LZ6 A;  3B5L B;  1ZA7 A;  3VKN A;  3NMB A;  1B35 A;  1GNZ A;  5C5U A;  3LWC A;  3HNY M;  1UY1 A;  2XBO 2;  3AZV A;  4HLT A;  1ENR A;  1I1E A;  3I2G A;  5A7Q A;  2LUW A;  5FQ0 A;  4IEW A;  2CDP A;  3Q8C A;  5H9R A;  3BU0 A;  4CU7 A;  1W2N A;  4COV A;  3IAP A;  1FV2 A;  3CF6 E;  3M2M A;  5EHD A;  3VD4 A;  1QJZ A;  5DUU A;  4HZF A;  4QXK A;  2WC2 A;  3RPQ A;  3WCS A;  2YU2 A;  1TME 1;  5G05 L;  1MEC 3;  3V0A A;  1E5S A;  4Z1V A;  3GHN A;  3QOP A;  4BH9 A;  3T09 A;  1FX5 A;  2WN2 A;  5F2W A;  4AHX A;  1LAJ A;  1JOP A;  2MNG A;  2QQM A;  4UF0 A;  1DFQ A;  4XAB A;  4JTN A;  3SH4 A;  4UFM A;  2YBP A;  2FDH A;  1UOJ A;  5HV4 A;  5C4W B;  1GZC A;  5GZF A;  4C1W A;  4KI5 M;  4JX0 A;  4BXS V;  5DAV A;  3LIH A;  1VAV A;  1Q8V A;  1PO2 2;  1N1V A;  1HRV 1;  5AFB A;  3N7M A;  2H6C A;  2PHR A;  2YU1 A;  1QOT A;  1HQL A;  3G7D A;  1WCU A;  4FO9 A;  1UOB A;  3INA A;  4NPM A;  1TEI A;  5FYU A;  4TTG A;  4Q4W 3;  1J83 A;  2FDI A;  1DIW A;  5ISL A;  1CX1 A;  1XE7 A;  4XMI A;  4FI9 A;  1V00 A;  3JQW A;  4HON A;  4PI2 A;  2X05 A;  2BBA A;  1RUE 2;  1N1T A;  3MGU A;  3TAY A;  3ZYF A;  3VBF B;  4PLN A;  1RUD 2;  2G9G A;  3KHB A;  2W91 A;  5JVV A;  4QQ2 A;  3WDU A;  1RJ8 A;  1ZBA 3;  4QPI A;  4ZHN A;  1SLI A;  3FLR A;  5JOW A;  5F5A A;  3VBS C;  4AGR A;  4EWE A;  2DTY A;  3KQR A;  4HXC A;  4L8Q A;  1YLL A;  1SBD A;  1DLL A;  3BI3 A;  1JOJ A;  1UKG A;  2YGL A;  4GJZ A;  2ZZJ A;  1W04 A;  2YFZ A;  3VDD B;  3J26 N;  1SLC A;  4Q4V 1;  3ZVX A;  5LEJ A;  4FPG A;  4GMP 0;  1XU1 A;  2XG3 A;  2R07 3;  4WVM A;  2D40 A;  3UJO A;  3HBZ A;  4AOC A;  4CPB D;  4LTA A;  3ILF A;  3RDI A;  2D93 A;  4WM7 A;  1W0O A;  3WUD A;  1UMI A;  1FNY A;  1SLL A;  3VBU A;  4IND A;  3CO2 A;  4YRD A;  4GWN A;  2F17 A;  2PHL A;  2IXI A;  4H7L A;  4CP0 A;  1K3I A;  3MF9 A;  3WG4 A;  2PFW A;  1RMU 2;  3PLQ A;  4LXL A;  4E4Z A;  3OGJ A;  1V6M A;  2R1D A;  3KWV A;  4CEW C;  1XSR A;  3OD4 A;  3RI8 A;  3KV6 A;  4YVS A;  3OGV A;  4DXR A;  2R0H A;  4IV1 C;  4BQ4 A;  4AI3 A;  2HWE 2;  3IBM A;  4QXH A;  4FOW A;  2FD8 A;  2CWS A;  4BYY A;  2LAL A;  4ATF A;  4L9B A;  4CCO A;  1DGW X;  5F3G A;  4E4D X;  1QJU 1;  1XNA A;  2BFU L;  2E26 A;  4E27 A;  2IZW A;  1KGY A;  1NCR C;  2IFW A;  2ZAB A;  4LQR A;  3WEZ A;  4AHW A;  4LIU A;  3LA3 A;  3WF1 A;  3MI8 A;  1AR8 1;  2WRA A;  1AL2 2;  2ID4 A;  2WZE A;  4XJA A;  3H8R A;  4L97 A;  5JXI A;  3PNA A;  3GZE A;  4HOO A;  1DZQ A;  1LGC A;  4LO7 A;  4YYO A;  2WO1 A;  4O61 A;  2X8K A;  5A3O A;  3ZOI A;  1TVG A;  3IAQ A;  1RUH 3;  4E2G A;  4N43 B;  5K0U C;  1H1I A;  4HVR A;  2PHT A;  3H50 A;  4NRO A;  1HN1 A;  5D8A A;  2IC1 A;  3EBR A;  2GAL A;  3UKV A;  5IAV A;  5LRR A;  1JZ6 A;  1XNB A;  1DF0 A;  1BBT 2;  1JZ3 A;  2BWC A;  3USS A;  4B4Q A;  1RYY A;  3NKG A;  2WS9 1;  2O0O A;  4CUB A;  4YW4 A;  1TMF 3;  1VBD 2;  1QJX 2;  1ACC A;  3D6E A;  1UW8 A;  5GLT A;  4LK7 A;  2WR9 A;  2Q8D A;  5JAX A;  3MV0 1;  3VZL A;  5D8A B;  4KBZ A;  4BU2 A;  2DU0 A;  1PMH X;  2C26 A;  3A7Q A;  4HN0 A;  4B7E A;  5BNO B;  4F3J A;  1CJD A;  4CEY C;  1UY0 A;  1ENX A;  1RUH 1;  3PU3 A;  1MPX A;  3OB8 A;  3SMH A;  5FPZ A;  1TQ5 A;  2QZ2 A;  5FZ4 A;  1RUJ 2;  4URT A;  3LF7 A;  4JQT A;  4ORF A;  4QXB A;  5EXO A;  2JDP A;  2BRT A;  4YZ1 A;  2WAA A;  1LEM A;  2JDN A;  2VW0 A;  3O0V A;  5D8A C;  1S2K A;  2YG0 A;  5IJR A;  4AHY A;  1XBF A;  1XB9 A;  4D7T A;  3MW3 A;  1JZ5 A;  3I49 A;  4N7I A;  4O9E A;  4PDW A;  5DDJ 2;  2R32 A;  5LBE A;  4CEY B;  4BQ5 A;  1UOF A;  2YC2 A;  5B4X A;  3WOG A;  1J84 A;  3JXS A;  4DEQ A;  2A3W A;  5BPX A;  2JD9 A;  3WR0 A;  1U0A A;  3IN9 A;  4MAD A;  2OQ7 A;  2A6V A;  3P6B A;  3ABZ A;  4JDM A;  1K5J A;  4IEP A;  1W6P B;  2VZR A;  1F5F A;  5L9R A;  5BV6 A;  4LUM A;  3AKQ A;  4UFJ A;  1W2T A;  5L73 A;  3KB5 A;  1YI9 A;  5FYS A;  4ISQ A;  1DGR N;  1RUJ 1;  4CUC A;  1JH5 A;  1LTE A;  2A70 A;  3AZW A;  3NNF A;  1VMH A;  4WZF A;  2Z42 A;  4Z82 A;  4MUV A;  5EQU A;  4DUV A;  3OBZ A;  3ZPO A;  5GAL A;  3KZ4 C;  4BQX A;  1NY7 2;  2EXK A;  1J1T A;  2VJX A;  1GR3 A;  3SNM A;  4CDW A;  3ACH A;  5JXJ A;  2ERF A;  3MLK A;  3VZJ A;  5GLU A;  3ZSK A;  2YZ4 A;  3FN9 A;  4BPZ A;  2NP0 A;  5C3Q A;  3MO4 A;  1RXF A;  4XVH A;  2OPW A;  4HBN A;  2Q8O A;  3H3L A;  1Y9M A;  2Y6L A;  4XFG A;  4Y1X A;  2ZML A;  4RFT 0;  4ZZ5 A;  1HB2 A;  1EAH 1;  3VD3 A;  2GNT A;  3ZXD A;  5FXZ A;  4CCK A;  1BMV 2;  4MH0 E;  3NO8 A;  2B5H A;  3KHC A;  1MQT B;  3OYW A;  4JKL A;  1F31 A;  1G86 A;  1ULG A;  3MUZ 1;  3CIH A;  3DYP A;  1NLR A;  2VOW A;  1ASJ 1;  2WKK A;  3PUQ A;  2W1Q A;  3R6S A;  4NMI A;  3EQE A;  2W2I A;  3UYJ A;  5EJ1 B;  1TME 2;  4KGQ A;  4YVS B;  3OUH A;  2UY9 A;  1SHW B;  1S0I A;  3H8U A;  4PLO A;  5DUW A;  3CNA A;  3RQ0 A;  3S5Q A;  1ND3 C;  1QGL A;  4NAM A;  4UFK A;  3AKT A;  5GLZ A;  4NRM A;  4AQ2 A;  3VZM A;  2ILM A;  1LR5 A;  2XXZ A;  3OEA A;  3K4A A;  2XBO 1;  1H4G A;  3E6B A;  3NNM A;  4IXL A;  4QX1 A;  3U14 A;  4GB3 2;  1V0A A;  5BNP C;  3K46 A;  4CCE A;  2ZX1 A;  4JRL A;  5F6L B;  3NL1 A;  3SKV A;  4Y1U A;  4FFF A;  1SLB A;  1SFP A;  3JBG 3;  2OII A;  2HWF 1;  5J1X A;  3GHM A;  2W68 A;  2A71 A;  3TNP B;  4YW1 A;  1CGP A;  4AWD A;  3BIE A;  4XFC A;  3QBQ A;  2V5D A;  4TLF A;  4KNC A;  2XJV A;  2LM3 A;  4FBF A;  4LBQ A;  4ZY9 A;  3VD7 A;  4IEY A;  5FO9 B;  1W6P A;  1MZF A;  1Y3T A;  4XQD A;  4P9J A;  1NE6 A;  5C8C C;  2WNV B;  2XQX A;  1XYN A;  2ADE A;  5GZG A;  1J58 A;  1Q43 A;  1OFS A;  1RUD 1;  3N36 A;  2LTN A;  4IET A;  5AVP A;  3ES1 A;  3KT4 A;  4MGK E;  3T3Y A;  4DB5 A;  3JQX A;  2ADD A;  5CAZ A;  2P37 A;  5M0T A;  2IXH A;  4QX5 A;  2P3K A;  1NOV A;  4ZU4 A;  3WF0 A;  1ZZC A;  1YUD A;  3ST7 A;  1EP0 A;  2PAK A;  3DPR C;  3LPF A;  3MW2 A;  3PUS A;  1ND2 A;  1V6O A;  1AZD A;  3QH7 A;  1YQ6 A;  2VTX A;  1LOG A;  3KVA A;  4NE9 A;  4XCB A;  2VTX J;  1VBA 2;  2Y60 A;  2HWB 2;  2Y34 A;  1LHV A;  1KDM A;  2WAB A;  2VUJ A;  4DUX A;  3LKJ A;  3OPW A;  4IEU A;  3AM2 A;  3WQB A;  2Z2S B;  1KXG A;  5C4W C;  2P3J A;  4BM8 A;  4EJR A;  4LBO A;  4MYE A;  3M3E A;  1QOS A;  4IV3 C;  2DV9 A;  2QTW B;  5A32 B;  5CNA A;  4ES8 A;  5CFC A;  2WFP A;  2BVV A;  2WFF 2;  2ZEW A;  3GYD A;  2EIG A;  3VZO A;  4COU A;  1Y43 B;  5E89 A;  2ZJC A;  1JW6 A;  3PDQ A;  1OVS A;  5IK4 A;  5IAT A;  2ZGS A;  1EAH 2;  1JXN A;  1FOD 2;  2ET1 A;  1UO9 A;  1LU1 A;  3HR9 A;  5F5I A;  4CU6 A;  1FOD 1;  1SZB A;  4JGY A;  1POV 3;  2WZR 3;  3TYJ A;  2EF6 A;  3R4S A;  2J7M A;  1LED A;  4FQ4 A;  5C33 A;  2AZ5 A;  4OHY A;  2DVA A;  5HPO A;  2E51 A;  1LOE A;  3CQO A;  3EMR A;  1I9R A;  1DZT A;  1SEF A;  5JZG C;  1NA1 A;  2YB7 A;  4LOR A;  3UKN A;  4HKW A;  1VAK A;  2QQJ A;  5ABJ A;  1BEV 1;  1VAL A;  3HIF A;  3I7D A;  1WLT A;  2B42 B;  2QFE A;  4Y20 B;  2WWS A;  2E7A A;  1W8H A;  1YWK A;  2EA7 A;  2YUE A;  1SAC A;  4H2A A;  2GC1 A;  5CG9 A;  3GM8 A;  3T4H B;  5L7O C;  3FHA A;  2BZD A;  5JMO A;  2QQP A;  1VBA 3;  2B46 X;  3I3Q A;  3TB0 A;  2ZX2 A;  3BCW A;  3ZDV A;  3OPZ A;  3ZMN A;  4EZH A;  4CXW A;  3GBW A;  2JIC A;  4XIO A;  1FXZ A;  4B1L A;  2Y0O A;  4S2H A;  1VBE 3;  3CDZ B;  1O8P A;  4J1W A;  5IVJ A;  3IT8 A;  4B7K A;  1RUC 3;  1W0N A;  1EUU A;  4JVA A;  3WG1 A;  4P08 A;  1RHI 2;  2XLF A;  1IZ3 A;  2RDQ A;  1A34 A;  4H14 A;  1MVE A;  2XKO A;  4Q0U A;  5H9S A;  1XOY A;  5LBB A;  4AVT A;  4XF3 A;  3ZPY A;  5FOJ B;  5KC5 A;  3GCW A;  1V6K A;  4QPI C;  2ZEX A;  3BGA A;  2P1B A;  1DQ1 A;  1WCD J;  3GGL A;  4DOU A;  2C0Z A;  5I91 A;  1BQP A;  2ARC A;  1D7P M;  4HSJ A;  2BUK A;  3T4V A;  1VBE 2;  4GWI A;  5LAS A;  4GXL A;  5FK8 A;  5FZA A;  2Q1Z B;  1KJR A;  3E5X A;  4XAA A;  3C7F A;  2D6L X;  3FJS A;  4Q0V A;  5IVB A;  3W59 A;  4QPI B;  4XUO A;  3CL1 A;  3P5B A;  2VVE A;  3GCX A;  4ATE A;  3VBU C;  1ZA4 A;  3AZY A;  4XFI A;  3ZIW A;  4FPJ A;  3AYC A;  4IQP A;  2BDR A;  4RSU A;  3HAG A;  3OD0 A;  1PIV 1;  5CAD A;  3AMQ A;  2FHR A;  5CIR A;  3GNE A;  4B4P A;  2XJU A;  2BEO A;  3O14 A;  1HRI 3;  4BK5 A;  4A42 A;  4M00 A;  3FWE A;  1R1A 3;  5FO7 B;  1H8T C;  4K9S A;  3ZYR A;  2W47 A;  1OFN A;  4OLL A;  4QDR A;  3JZV A;  1XE0 A;  2VXR A;  4CP2 A;  5A3M A;  2FCT A;  5HCA A;  1H6X A;  1AYM 2;  2W52 A;  3J9S A;  1H2M A;  2FQP A;  2GAU A;  3WNM A;  2VMH A;  3J8F 1;  5A3L A;  2WWU A;  1RUO A;  3VBR C;  3VKO A;  3JCI A;  2WYF A;  1AX2 A;  2H6B A;  4XTM A;  3K75 B;  4CXY A;  3WHT A;  1ZBE 3;  1OA3 A;  2VW1 A;  4XAC A;  1RVF 1;  1WCS A;  5JR2 A;  2RM2 1;  4CCJ A;  3HBK A;  1R08 2;  2YMZ A;  3H42 B;  1Q8O A;  2W9X A;  1PK6 B;  1PX4 A;  2J1U A;  3J7M A;  3S30 A;  4AL9 A;  4BIS A;  4P9Y A;  1ULE A;  4C90 A;  1QJY 3;  2UY8 A;  4QGL A;  4MGQ A;  2VQA A;  2XKP A;  4Z8B A;  2IVI B;  2UUR A;  3JUU A;  4NWW A;  1SLT A;  4I3P A;  2OVU A;  2QDN A;  3SQO A;  4K40 A;  1XXN A;  1PGS A;  4GQ7 A;  2VU9 A;  3VZK A;  1GV9 A;  1GLH A;  1PVC 2;  4HG6 B;  4N53 A;  2PHD A;  4GD4 A;  4EQV A;  5FZL A;  3WNP A;  2SBA A;  2HWF 3;  3VN4 A;  3ON7 A;  5DAP A;  2VMC A;  1ZRR A;  1Z7S 1;  2E63 A;  2EXJ A;  4UFI A;  4UW3 A;  1V6I A;  2DBN A;  4YW6 A;  3VBF A;  2WO2 A;  1CAX A;  3UL2 A;  3GZA A;  4HMZ A;  5DUX A;  4RL7 A;  4AVA A;  4XC9 A;  2VNO A;  5JPN B;  5EV7 A;  1C3H A;  3K4D A;  2ZMK A;  4M3C A;  5ACA 3;  3SH5 A;  2QCS B;  1OUR A;  4QXC A;  1VB2 A;  2X5I A;  3AFK A;  4CDW B;  3I59 A;  1PZ7 A;  1S4C A;  2RS5 2;  4IEZ A;  3DEC A;  1LGN A;  4YNI A;  1CPM A;  1DQ4 A;  1GQG A;  4JHT A;  4AFC A;  1F2N A;  1RVF 2;  3RJ2 X;  5K7P A;  4BOW A;  2WIN B;  4FFH A;  3ILN A;  4Q27 A;  5FZO A;  4EN6 B;  5C7G A;  3UGF A;  5T52 A;  4DPN A;  3RS6 A;  5JI9 A;  5DZF A;  2D6M A;  5JLV A;  5JOY A;  4S2G A;  5LBF A;  2WT0 A;  3T2O A;  1N3P A;  1QDC A;  5DXD A;  4XJZ A;  4GKY A;  1NT0 A;  5C4W A;  1HN0 A;  4FOV A;  3SCH A;  1CON A;  1NCR A;  5FJH A;  1PM4 A;  1WKY A;  2VD7 A;  4LHS A;  3VHO A;  3W9A A;  1ZZB A;  4B8E A;  4PT6 A;  3AC0 A;  1E57 A;  3DUI A;  4NAO A;  4BJ0 A;  1RUN A;  1GNY A;  3ELN A;  2XJS A;  4QB6 A;  1AJO A;  5JR7 B;  1R64 A;  2RDR A;  3IPV B;  4WVZ A;  1T6G C;  4E2S A;  5CFD B;  1MS5 A;  4CA9 A;  2VH9 A;  1AL2 1;  4CDQ C;  2DUQ A;  2HH9 A;  4FSJ A;  5FPU A;  1GUI A;  1BMV 1;  4X8P A;  1PGL 2;  3VDA A;  3ZYH A;  2A7A A;  3IIA A;  2DBI A;  4CDX B;  3ZM8 A;  4NPL A;  1GWL A;  2Q30 A;  1HRI 1;  2VGD A;  4FP3 A;  4OI1 A;  3WV6 A;  3O0X A;  3N9M A;  1PVC 3;  3TNQ A;  1J1L A;  4QAW A;  2Q8C A;  2BOI A;  1JHN A;  2WQZ C;  4MG2 A;  1JBC A;  1X7N A;  1W2O A;  2BVB A;  2NQY A;  2J22 A;  2VME A;  2D43 A;  3AJY A;  2W1W A;  2W92 A;  1CAW B;  1UYP A;  3OGR A;  2XDV A;  2NMN A;  4E4S A;  1DQ6 A;  2RJL A;  3KD4 A;  4YZ5 A;  1G9A A;  1RUF 3;  2CDO A;  2VBP A;  4CDX A;  4FTB A;  5EJ3 A;  5FP3 A;  4KBB A;  2JEM A;  3O1O A;  1XNC A;  2X5I B;  1TNF A;  1UL9 A;  1HX6 A;  3AYA A;  3POJ A;  1CZS A;  4WBB A;  5FY7 A;  5FZ1 A;  2ARE A;  2YY1 A;  4ERO A;  3B3Q E;  1CAU A;  3AL5 A;  1G8W A;  4GH4 B;  2ZKN A;  3LIG A;  4FPC A;  2ZGM A;  5FRA A;  3ZFE A;  1H1A A;  4YM3 A;  1ALY A;  2Q1M A;  5LY1 A;  3VBH C;  3S5A A;  1CAW A;  5I0T A;  3WDT A;  1FV3 A;  1OKQ A;  3WQ7 A;  1IS6 A;  2CGP A;  2WZR 2;  5ERL A;  1HV1 A;  1OI6 A;  1PO1 1;  3KVB A;  4XYX A;  2CGN A;  1IG0 A;  5K9Y A;  3ACI A;  1IS4 A;  2XUM A;  2ORZ A;  1RUF 2;  5JI7 A;  3LA2 A;  4QQO A;  2D5H A;  3MYX A;  4NPR A;  2VW2 A;  1O3R A;  5FUP A;  1O4Y A;  1RUE 1;  4Y24 A;  2WLQ A;  2XWJ B;  2O14 A;  1FMD 1;  1VMJ A;  4HK8 A;  5FZ3 A;  2PQQ A;  1FAT A;  2P3I A;  2R30 A;  2CSG A;  4NIA A;  2VL4 A;  1KFX L;  1SPP B;  3JU9 A;  4FPO B;  2EVX A;  3V56 A;  3LA7 A;  3BU7 A;  4XW3 A;  3VBS B;  3LEM A;  3LZZ A;  1DCS A;  1L7R A;  4W4Z A;  5FWE A;  1HLC A;  2FMY A;  1BBT 1;  1YCI A;  3C8X A;  2FDK A;  4IGQ A;  4CUG A;  1YIF A;  3IWZ A;  3WNO A;  1RIR A;  1LOF A;  4CDU A;  5KHJ A;  2FMD A;  3VUO A;  1URX A;  5A33 B;  1L3J A;  1NE4 A;  4DXZ A;  1YXW A;  5LY2 A;  1ULP A;  5JSO A;  3CZJ A;  1VBB 3;  1TG7 A;  2OX0 A;  4K20 A;  2AH2 A;  3JBG 1;  1L7Q A;  1OD5 A;  1RUI 1;  1VE0 A;  4AZZ A;  2BW8 A;  2YYO A;  1D4M 1;  5KHH A;  4YG6 A;  4G9S B;  4N9H A;  5HXM A;  3WNN A;  2D3P A;  2FCU A;  3OJB A;  2TEP A;  3LEK A;  1POV 0;  1LOA A;  2O1Q A;  1AX0 A;  1SDD B;  2JE8 A;  4IES A;  1JYN A;  3VBR A;  1BJQ A;  5FZO B;  2ZGT A;  1C57 A;  4LKF A;  2RHP A;  4MXW A;  4YAR A;  2JG8 C;  4YW3 A;  1JYW A;  2P6C A;  3EHK A;  5CB7 A;  5IT6 A;  2E6V A;  3THT A;  1BHG A;  1XNT A;  2RR1 3;  1RL3 A;  1AR9 1;  3MIC A;  3ZFG A;  1TE1 B;  2JJ6 A;  1W6M B;  3M7A A;  3M3C A;  3OY8 A;  2Y0I A;  1W9T A;  3DYO A;  4FFI A;  4LOT A;  4XUT A;  2JDM A;  2J1A A;  3MFC A;  3NV1 A;  2RMU 2;  3PMS A;  4FPL A;  1MS9 A;  1SFY A;  4DUW A;  1ZRC A;  3NJZ A;  2W94 A;  1NX9 A;  3SHR A;  5JUV A;  4AQS A;  1YNA A;  3DGT A;  4NR1 A;  1QQP 3;  4HPK B;  5IFT A;  3UGG A;  5BNN A;  4HKL A;  4HN1 A;  4MHU A;  5CA6 A;  3PU8 A;  1HDK A;  4WM8 A;  3E6C C;  3W5M A;  1W2A X;  4I30 A;  1G9D A;  1REE A;  4AI9 A;  5KXB A;  1WUV A;  5C8W A;  2WNU B;  1LU2 A;  1H6Y A;  2R04 2;  2JX9 A;  1W6Q A;  4TN7 A;  3SCG A;  3NAP A;  1RUF 1;  3ZYG A;  3V0B B;  3O0W A;  3RWN A;  3N7L A;  4KQ7 A;  2ATF A;  1YFW A;  4EV0 A;  4XAE A;  4R8H A;  3P1I A;  2ENR A;  3K2O A;  4GWJ A;  3KMH A;  2YPJ A;  4UFH A;  4A6S A;  3RZH A;  1IS3 A;  2XBO 3;  1GZT A;  4YGD A;  4RGK A;  4ZPI A;  4O7X A;  1UIK A;  2F4L A;  1OMI A;  3E6D A;  1WMF A;  4HAN A;  2QE3 A;  2YC4 A;  1HRV 2;  2ZGP A;  4V2V A;  2DCT A;  1ZRF A;  2I2S A;  1OUS A;  1RJ7 A;  2WQ4 A;  2YC0 A;  1ZVF A;  1CVN A;  4QGN A;  4XMA A;  5J98 B;  1CPN A;  1XSQ A;  1ZM1 A;  5I8S A;  3VL8 A;  2UWB A;  1JS9 A;  1RUJ 3;  2ET7 A;  4IEV A;  5E16 A;  5A70 A;  3ZXE A;  3RZJ A;  1RUD 3;  3H7J A;  3LD8 A;  4EN8 B;  3V64 A;  5JSP A;  2W1S A;  1AXK A;  4ZKT B;  1W6M A;  1UY3 A;  1GP4 A;  4Q1R A;  5F3C A;  2VBB A;  4QU2 A;  3ZSL A;  5FZF A;  3Q9O A;  5FCC A;  1DDL A;  5FY8 A;  3K48 A;  2V73 A;  5GLV A;  4CYD A;  1F4A A;  1A8D A;  1WW4 A;  1UAI A;  4GA9 A;  2HWC 2;  4DMI A;  4JRA A;  1GZW A;  5KXC A;  1M06 G;  2Y6H A;  2SLI A;  1R1Z A;  1OHF A;  3OGS A;  4BA6 A;  2ZX4 A;  4CP9 B;  4N90 A;  2HKX A;  4XPV A;  3QLQ A;  3ZFG C;  1AR6 3;  2GH2 A;  2ZBJ A;  4GB3 3;  3FLP A;  2E33 A;  2LRO A;  2GH8 A;  2FZ2 A;  2WFF 3;  2B4K A;  4NID A;  1OH3 A;  1W0P A;  5L36 A;  4UYB A;  3VBO C;  4DRV A;  4XJU A;  2HWD 3;  1CN1 A;  1NAE A;  1SG3 A;  1UQX A;  2RG4 A;  2VEC A;  3FL7 A;  1F9K A;  1W6Q B;  3KM5 A;  1UU4 A;  3T1M A;  2CYF A;  5T54 A;  5JPM B;  4D7Y A;  4RS5 C;  1W8U A;  4XXP A;  3I3E A;  5IK7 A;  3ZYI B;  5JWP A;  5FYT A;  1K5M A;  1SDW A;  2W1U A;  3RNS A;  5I0S A;  3BOD A;  3BOW A;  2ZKL A;  3ITQ A;  4GB3 1;  5I8Y A;  4S2F A;  4MGI E;  5C6C A;  4W8J A;  1COV 3;  2I45 A;  3IDB B;  2WLP A;  3W21 A;  4BIF A;  4Q4X 1;  4GKX A;  4XZP A;  5FZM A;  5BNQ A;  5CFD C;  1I5P A;  3MIB A;  5FP8 A;  1S55 A; 
#chains in the Genus database with same CATH homology
 4LK6 A;  3ZYH A;  4A6S A;  4CPB D;  4YW6 A;  4BQ5 A;  1WCU A;  3UT0 A;  4YW7 A;  1HN0 A;  1W8Z A;  1W9F A;  1GWL A;  4LKF A;  4CP9 A;  2K46 A;  4BQ2 A;  4LK7 A;  1W8T A;  2JWP A;  4AL9 A;  4CPB A;  1W8U A;  3ZYF A;  2WYF A;  1W8W A;  1V0A A;  1WMX A;  4LKD A;  4LJH A;  2KR2 A;  4LKE A;  2LRP A;  4BQ3 A;  3ZYB A;  4YWA A;  4CP9 B;  1WZX A;  1UOJ A;  4BQ4 A;  5D21 A;  1GWM A;  2LRO A;  1W90 A;  3F95 A;  1OH3 A;  2VXJ A;  1GWK A;  3ORJ A;  2O14 A;  2C24 A;  2Q1F A;  1L7L A;  1OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...