1W97L

Cyto-epsl: the cytoplasmic domain of epsl, an inner membrane component of the type ii secretion system of vibrio cholerae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
238
structure length
229
Chain Sequence
SEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVLLAASDLILTSVEQLENMLPYLLEDAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLSLLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTGSFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE II SECRETION SYSTEM PROTEIN L
publication title The Structure of the Cytoplasmic Domain of Epsl, an Inner Membrane Component of the Type II Secretion System of Vibrio Cholerae: An Unusual Member of the Actin-Like ATPase Superfamily
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 48
structure length 229
sequence length 238
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1w97L02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1w97L01
4PHTX 1W97L 2BH1A 5TKWA 1YF5L
chains in the Genus database with same CATH superfamily
2RF2A 2Q0UA 4DV4K 3RR8A 5HBMA 1RTIA 3DLHA 2UUCK 5AQXA 5M1FA 1ESVA 3QIOA 1JKHA 1H1VA 2YJEA 1JLFA 4QS8A 3QEIA 2HNYA 5CHIA 1VQLN 3ULDA 3SPZA 5T7BA 3BY5A 2A3ZA 3D45A 2ZM6K 4RWTA 4BC4A 3MEDA 5KTQA 3WXMB 4KHNA 4HTUA 4ZTFA 4FJ9A 3A5MC 3VQPA 1VSHA 4DFJA 4WFAL 3WNFA 3ZEUA 2YHXA 4RW9A 4FO0A 1HKCA 1ITGA 3EYZA 1TK5A 4NB4A 2XY5A 1LW2A 4B1ZA 5KQDA 4FJHA 5AZJB 5DMRA 1BA1A 3DWLA 3FLCO 3LP1A 3LL3A 4A5BA 4WFBL 2A1RA 4FWLA 2O8DA 2XY6A 3SAHA 4N5SA 4RW6A 4DTSA 5AQTA 5FLXO 1S1UA 1UAXA 3E9LA 2KTQA 1MDUB 4CD1A 4BR5A 1JLGA 5HOOA 1TKDA 4Z4FA 2OPRA 3NH1A 4O0JA 5LL6Z 3QETA 3OA9A 1TKZA 3DXKA 5C42A 1YIJN 3SUPA 2EHGA 3MXMA 3ALYA 2Q3SA 4RW7A 3I55N 4NXMK 1J54A 3WEEA 1SL2A 3WNEA 3C6UA 1VSMA 4FLXA 2X6SA 1EO1A 3RMAA 4YOVA 3V4IA 2QEXN 4XEIA 5AQIA 3EL2A 5KQ8A 1NJXA 3D2FB 1RT4A 4C1NK 1S1VA 4OO1J 2Q31A 5EOYA 1JXBA 3IMXA 3QIPA 1Q9YA 1TL1A 4FZZA 3KVGA 5AQQA 1WBDA 3C6HA 4DR3K 4I7FA 3TSUA 1SKRA 1JLQA 2QWNA 3O6WA 3ASMA 3WNGA 5A2QO 1GLCG 4OLAA 4BGBA 3BDPA 1Z26A 5FDLA 3H6EA 2E6LA 4N47A 2X6NA 2YCHA 4NXNK 3BF1A 3LAKA 5BREA 3IG1A 3DLEA 5J2MA 4AHCA 1ATSA 3ZSQA 3WXJA 1NK9A 3SV3A 2EX3A 1YT3A 2OTJN 4WE1A 1X9MA 4DR5K 4A59A 2RKIA 1KD1O 4DSLA 3SQ2A 3DRRA 2ZQBA 4ELUA 2FBTA 2VG7A 3WEEB 1RDBA 1BIUA 3EY1A 3RSEA 4B9LA 1BISA 2G8UA 3LDSA 3THXA 4JYAK 4GV6A 3RVCA 3CYMA 2Y1IA 3BP8A 1D9DA 1FKPA 5AQPA 4E7LA 4V19S 4N41A 5I3UA 4DB3A 4EZ6A 1ASVA 2VCPA 3GL1A 3QINA 4DQSA 3FFIA 1W0HA 2W6LA 4MO5A 1L3SA 2BGGA 2ZGZA 3OS2A 3HPOA 3OYDA 2FLOA 3ATUA 3HTVA 5GAHP 1S5JA 1E3MA 1RDAA 4JI1K 1L3VA 2OCEA 3CJBA 1SS6A 1NK5A 4E7IA 5ADXA 3O1WA 1TUUA 3A5LC 3SAFA 1T6DA 2PY5A 1YAGA 3CC2N 1KLMA 2GX9A 3VF6A 4BDYA 1XUPO 4DR1K 4KHWA 1D5AA 2P9SB 4MDBA 1Y97A 2AA4A 4Z4HA 1HNWK 4KH6A 4KH4A 1YI2N 3EO3A 4JKHA 2VG6A 2D0BA 2ATQA 4CW7B 1RBVA 1F21A 2ZE2A 3Q7BA 2O8BB 3AVLA 3OYFA 3ZSYA 2RE2A 1OVYA 2Q97A 1X9WA 1KSPA 4JK7A 5AQFA 5AJ3K 1D9FA 2A5XA 4CESA 4CJ7A 4H4MA 1BI4B 2F9TA 5AFUA 1HYSA 4OGCA 1GOAA 3PX4A 3O3FA 4ELTA 2Q36A 2WFBA 3MX2A 3CI5A 3AVBA 1TAQA 1Q18A 4IOAL 4AQYK 4DHYA 2KW4A 1VQ4N 1DT9A 2H3GX 4OJRA 3L2RA 2WONA 4FVUA 4F3OA 3R1XA 3KLFA 4B9UA 2CGKA 4BR0A 1L3TA 4H0PA 3RR7A 3PX0A 2D0PA 3OYAA 4IFYA 1VQ8N 1EWQA 5E84A 3ZSZA 2OZSA 2QXFA 1RNHA 3ISNC 2P51A 3KD1E 1NK0A 1TAUA 3R3LA 2NRTA 4BE1A 1T8EA 4JKDA 1S9GA 3V1OA 4DV0K 4CBXA 5ADXH 4CF9A 2J4RA 1B92A 1OH5A 1D8YA 2G8KA 4C8KA 4GKKK 3SBTA 1NG9A 3M5RA 2HB5A 1LWCA 4JI4K 5M1NA 1IV0A 4BRQA 1YJ9N 4FLVA 5FRNA 1RFQA 2YHYA 2HOEA 3K58A 1Q86O 2ITGA 2HHQA 1IKXA 3CJAA 1RBTA 4M3YA 4CZHA 1NJIO 3VEOA 1YJWN 3U8XA 4CBWA 3AO1A 4CZIA 2V52B 1LW0A 3AA5X 4FWSA 1RT3A 4M3ZA 1KRPA 3AA3A 3HXMA 4PUOA 4UY8O 5GADP 1RBUA 2NRRA 4FW2A 3S3OA 4YORA 5FROA 2IVPA 2HNZA 3BZKA 3O9RA 4FZXC 5CZ2A 2W6KA 5AFUH 2HHXA 2NRHA 2FXUA 2DPNA 4M63C 5KRTA 2NRZA 3CMAN 3OHRA 3OVNA 1ZYQA 4Y1CA 3CFRA 3HOTA 5TKWA 5TKYA 1YVNA 4CIEA 2KQ2A 1NGIA 3KIOA 2OPSA 1KVAA 4YOYA 2YHAA 3CCUN 1RT1A 3VQEA 3SUQA 4RG8A 3VQ5A 4CJEA 1NOYA 4K41A 4NYNA 1RTDA 4J2BA 4CF1A 3JSMA 4CEZA 4FWMA 1MA9B 3DRPA 3RMDA 2X74A 4IO9L 4X62K 4G1QA 2QW9A 2F4VK 3CJ7A 3NF8A 4DLEA 4WQ5A 3THWA 4DFKA 3LDQA 1A5VA 3ZX3A 4F8RA 4B8CA 3NVKA 3MX5A 2WOMA 3VQ6A 4DR4K 3L3VA 1ASWA 2HVHA 3O9TA 1S1XA 1NJZA 2FBXA 1NGGA 3H1QA 3K59A 2ZJRL 1IG9A 2V7ZA 5AQSA 2GEMA 1HNZK 3OYNA 5AQLA 3PLAA 4DSJA 2QI2A 1WNSA 4JHDA 1I39A 4DLGA 2YX6A 4KTQA 5HLFA 1RCHA 3VF2A 1KFSA 5FPNA 3NDKA 3O80A 4HCCA 2IDOA 3FZLA 3EN9A 1E4GT 3O9SA 1D4XA 4NLBA 4BC5A 3O9QA 3WQUA 5AQOA 3MXJA 1W97L 4JEPA 3SYZA 3OYJA 1GLAG 4CEBA 2B5JA 2E88A 2W40A 4W5TA 1NNEA 4CBUA 1FXXA 2BH1A 4DTMA 4EP4A 1Q8IA 3KWIA 1U48A 5AQKA 3BUZB 3K9KA 4KH5A 2VGMA 5AQZA 2ZGYA 2HHWA 4BQZA 3O3GA 3DXMB 5GIOA 1UA0A 3ZETA 2BDPA 4DF8A 3D0PA 1NWKA 3CF5L 3G71N 4IBNA 1BQMA 4J2DA 4B1XB 4JKGA 1HR0K 1J5OA 1VHXA 3I8DA 4JKEA 3EKUA 2KZMA 2WTUA 4F4KA 1HQEA 4BRHA 4IDKA 1TL3A 3MWTA 1S3XA 2WC9A 4AH9A 1DTTA 3KWGA 4JHDB 4CCHA 2E6MA 4LH5A 1HRHA 2P9IA 3VTIA 5HRRA 3S41A 4CJLA 4BREA 4B1VA 5FPDA 1UOCA 5DM7L 3NAEA 5F2RA 2VGNA 5EXWA 4CEAA 1BG3A 1Y64A 3PSIA 4PKHA 5HP1A 1CZ9A 4O4GA 5JMVA 3QB0A 4IOCL 1WSIA 1Z05A 3P83D 2Z1GA 4BRFA 4DTXA 3NF7A 1HLUA 2IAJA 1V4TA 3WNHA 4CJFA 3PY8A 4GV9A 2A6AA 4DR6K 1T03A 4IXCA 3MEEA 1NMNA 2HNDA 3O8MA 3ULEB 3ZT3A 2UUAK 4H0XB 1NGDA 1GLDG 3I8BA 5BPMA 3MWPA 1SKSA 4AM7A 1S22A 5BPLA 4CZLA 1JLCA 4YDUC 2YNGA 3P1GA 3THYA 2GTDA 5AQHA 4KI4A 3QEPA 1N33K 1RDDA 3O5BA 1ATRA 1VSJA 4DU1A 3QEVA 3U6FA 4M3WA 1ZBIA 3E9OA 3GOIA 3CCLN 1X1PA 3HVRA 3TI0A 3VGLA 2FBVA 5GINA 3BGRA 4FJXA 2P9IB 2XO7A 3V1QA 2QWQA 3W0LA 3ZT0A 2IVOA 2V7YA 1HPMA 4RW4A 4PL7A 2B4JA 5AQVA 1SL1A 2P5GA 4Z4EA 5AZJA 4FWNA 1DLOA 4CGDA 1C0FA 2O8FB 1NLVA 2HHHK 1QQNA 3CCSN 3RTVA 3ZSWA 2HBKA 4AF1A 4CGGA 3C95A 1RTJA 3L0QA 1XC9A 4BRGA 1RT2A 4I9LA 5H1SQ 5KRSA 2F8SA 1FKOA 3KHYA 2G8IA 2GBZA 1HJRA 4OPJA 2GWKA 1N8RO 1WSHA 2BANA 3VTHA 1S6PA 3FE1A 4DQQA 4FVMA 1NKBA 4DS4A 3NH0A 3THYB 3KTQA 3LANA 4JNEA 2FSNA 1SKWA 2Q1NA 3KLGA 1WBBA 4LF4K 3CXCM 4KBOA 2NZTA 4FWPA 2NRVA 1QSSA 1NBWA 1WN7A 1IH7A 4DTRA 4HUGA 3D2FA 2E4LA 2D1KA 4MQ3A 3SBGA 4JK8A 3ZLJA 1HX1A 4CEOA 1OKJA 3SQ4A 3R6MA 3VA0A 4ILGB 3OYIA 1ZBHA 3AGRA 3F73A 3SI6A 3T1AA 1DEJA 3FR0A 4N76A 4KHPK 4QOZB 4ISGA 1QSLA 4GW6A 2I7NA 3VPZA 3SQ0A 4ID5A 1VSKA 1LV5A 2WBNA 5IT9O 2P9LB 4AHTA 3QDKA 2QK9A 3I0SA 3VF4A 4JD2B 2ZWHA 3ZSXA 1L5UA 2A40A 4FWRA 3FGUA 5FRMA 4M7XA 3B8AX 4NCGA 1VQMN 3L2WA 3SUOA 3HO1A 2VWBA 3K5MA 2PYLA 3CCJN 4A5AA 3VEZA 1X3MA 4JN4A 4OKKA 3O1BA 3ZT2A 5C12A 3I56N 5J2NA 4H0TB 3J80O 3VGMA 3G25A 4BRNA 4JS4A 3G4SN 4UQGA 2B6AA 4ILHA 1JLAA 3F2KA 1BU6O 2DFHA 3VOVA 4QAGA 4CF8A 1T6CA 4NCAA 3C6TA 4FLUA 4HTLA 4K43A 1QQOA 2LSNA 4KHSA 3SAGA 5M1KA 3SK3A 3G10A 1HQUA 1W9HA 1WSEA 4GV3A 2ZJQL 1M90O 3KKSA 3DI6A 5FPMA 3MMVA 2G8WA 5BRHA 1Z25A 3A0IX 3L2UA 2DFFA 3NCIA 4DSKA 4WFNL 3M3ZA 1NGEA 1BCMA 3HRGA 1BO5O 1TVRA 1K9MO 2P9SA 1RILA 1VAZA 4DR2K 5BR9A 3WXLA 4CJSA 4IG3A 2ASPA 4H5TA 1VQ9N 4DQPA 2OYQA 3WXIA 1HMVA 4DU4A 4B9NA 2O8BA 4O5FA 1KQSM 1VQ6N 4R79A 1S6QA 4HHTA 3VEYA 3AVGA 3ZSOA 5GAEP 1REVA 4E0DA 1NGFA 4FJLA 3C6AA 4WQ4C 1NGJA 4FLTA 1T3VA 3MN9A 3H3NO 4CK1A 2FBYA 1HNVA 4BDZA 2V51B 3I33A 3VEVA 4PA1A 1BI4A 3M6GA 2Q0RA 3TTCA 4CZGA 2XRIA 3CCMN 4H5VA 3OJSA 4O8UA 2HVIA 5M1OA 3VESA 5AZIB 1YHQN 4RTFD 4EHTA 1JJ2M 2F7TA 4B1UB 4YOTA 4JI6K 2ASOA 1WOQA 4B1WB 5C2FA 3MN7A 3KLHA 3MXIA 1I94K 1VSFA 1P90A 3TAPA 1ZC6A 3HM9A 3TAGA 5BR8K 3LDNA 4KB1A 1NGBA 2OPPA 1SUQA 2IIRA 4CF2A 3GBTA 1EP4A 3V9ZA 2ETJA 1BDGA 5CYQA 3MAQA 3F9MA 3SQ1A 3MDQA 1IKVA 1EKEA 3TTFA 1N36K 2NUBA 4CHZA 3NFAA 1K73O 4GKJK 2AJQA 3C65A 3H08A 4BG9A 2OANA 4O0IA 1BUPA 4H5RA 2P9NB 5AR0A 3O4WA 2DTUA 1XWLA 1K8KA 5C24A 3M8PA 3S3MA 3P4IA 4A61A 4M3TA 3VQ4A 3AAQA 3PSFA 4CZFA 3IUCA 5EX5A 3HOSA 1KLNA 5CE3A 3L2VA 2HHSA 3AVKA 1QS4A 4DTNA 3ZCMA 3CJCA 3LM2A 3FZFA 2QWOA 3CC7N 3FZKA 2XY8A 3ENBA 3N4PA 3F5TA 4CJPA 3RMCA 4LSNA 4ICLA 3CCEN 4E19A 5EY4A 2QTDA 4ISFA 1XMOK 4CJ5A 3KD5E 4YFUA 5M1QA 4CHNA 1J9AA 3OY9A 4GMJB 1J6ZA 3AVAA 1ZBLA 1YITN 5IWAK 4AHUA 3B6OA 4KHYA 4OPAA 3CJ9A 5LJWA 2P1JA 1IKWA 3Q7CA 3ZT4A 1XQSC 3NH2A 3KK7A 4DQRA 4M42A 2HMIA 2OZMA 1A5WA 1EQYA 3C94A 4LFAK 3H3OB 1XNRK 1RBSA 4CJRA 1QZ6A 1XNQK 1BWFO 1HNXK 2KFNA 5C2DA 3HP9A 1K8KB 3TPQA 3BF3A 1KAXA 2UUBK 4IOXA 2FC0A 3O4NA 2JGUA 5DM6L 4CZJA 5BN8A 4Z94A 4KTWA 4BR2A 3PO4A 2RPIA 4CEFA 2E2QA 1LAVA 3MEGA 5E41A 1L3UA 4U7BA 4MLHA 3MECA 3JS6A 1OH6A 4AHVA 4NYFA 3GE1A 1LOTB 3LDPA 3EE9A 4DWIA 4FJMA 4BRIA 3K5NA 3VQ8A 4Q5VA 3AVMA 2QWRA 4BE2A 4EZ9A 1N34K 4FWQA 3QBWA 2GUPA 3TAEA 2YNFA 4DUYK 4E1JA 3JXUA 2UXDK 3TTDA 3M8QA 3PO5A 4E7KA 2W42A 5LMUK 2ZF5O 3AVNA 3TSPA 5DK5A 4Z4IA 2CH6A 3GDQA 1XHZA 4BACA 1KXPA 5GIPA 1RT7A 3OYCA 4CJVA 2P9UB 2FSKA 3VQBA 5BN9A 2QA4N 3WT0A 2BE2A 3CQ8A 2GELA 4EHUA 1S72N 3HZ6A 1S1TA 4Z0UA 3OTOK 2HMPA 3OYEA 3CMEN 4YDUA 3NE6A 3J8AA 4I2PA 4JKFA 1X9JA 4B3OA 1KVBA 5HRNA 1IBKK 4A62A 4DQ8A 3DXMA 1DTQA 4CF0A 1HKGA 1WUAA 1ATNA 4F2RA 1J5EK 4B9QA 2HW3A 4YOXA 3T19A 3KK3A 3ZYYX 4IG0A 2PYJA 3HL8A 3HSCA 4DV5K 2NLXA 4BY9C 4EFHA 3SJJA 3DJCA 4HUEA 1U6ZA 1B9FA 4CFAA 2UXBK 4JS5A 1U2VB 3QESA 2D5RA 3CHWA 3O08A 3PX6A 3DM2A 4JI7K 1LAWA 4FK4A 3NF6A 1C1CA 1MWKA 3M8RA 2FSJA 5HRSA 3H45C 3E01A 4JKCA 4LF7K 4M3XA 3V1RA 3VQ7A 4M3RA 3AARA 2PFUA 4BVPA 4IO8A 4B1YB 2DY4A 4LD0A 4JI5K 1Q9XA 3AO2A 4FYDA 3BZCA 3QMLA 1QHAA 3ULEA 5J2PA 4KHUA 3DMJA 2KHOA 4HVJA 2VQFK 1BA0A 2G8HA 4FJGA 3T3FA 1RT5A 4C8LA 1EXQA 4HCBA 4BGAA 2P9PB 2F96A 3J81O 2R7YA 4CFBA 3CETA 4JRPA 4YHHK 5KGXA 4DTJA 3DOKA 4LC9B 3LPTA 5JLHA 4IJNA 2G8VA 1C1BA 3VEWA 1C0MA 3OYLA 3U9DA 4CECA 5AQUA 3V9WA 3E9PA 2VWKA 4PL8A 3MK6A 1HUXA 2VG5A 4QCLA 1SL0A 2YV0X 4E89A 2ZJPL 3PV8A 1JXEA 4GNIA 2E5LK 3LWLA 4K8XA 2IOCA 4Y1DA 1R59O 1RTHA 4NLCA 2EWSA 3AVCA 3HPHA 4CK3A 3CFPA 3AA4A 5JICA 3V9SA 4DTUA 1U47A 3L3UA 1JLBA 2O8FA 5C25A 2UU9K 4DSEA 4C1NI 4EIAA 2OA8A 3H46O 3I0RA 3OW2M 3NGZA 2JWKA 2JWLA 3UKUB 5B8HA 2PBDA 1RDUA 1GLFO 4JLHA 4CJ4A 2I5JA 1KFDA 1QHTA 1QTMA 4KB0A 2Z1HA 4FM2A 3LZJA 4L3QA 2A1SA 3L4QA 1VSIA 1FJGK 2WUSA 5SZTA 3PUFA 4DG1A 4E3SA 3O9UA 1MWMA 3C7NB 4FW1A 3LDLA 1TK0A 2O8EB 5KPRA 3PIPL 4DTOA 4CEQA 1DKGD 3V6DA 3QLHA 4H0OA 3TABA 1ASUA 3IAYA 4BC2A 3TANA 4W5OA 1HJOA 4C8OA 2CGJA 2UYTA 2VYPA 5D3GA 4JK9A 1CXQA 2IGIA 1S1WA 2F8TA 5FPEA 1RDCA 4BG8A 4FLZA 1VRUA 4CHQA 2D0AA 4FPAA 3VMFB 4DSIA 4RCHA 1C1AA 1B9DA 3KK1A 3NBPA 3QEWA 3CPEA 4CGIA 3KLEA 5JS1A 4F2SA 4G9ZA 3EZWA 1JCFA 4ZTJA 1OH7A 3C0BA 4FJJA 3FZMA 3THVA 2P9LA 3A8YA 4X64K 1NK8A 1GLJO 1Z6RA 3TR8A 4JD2A 5KPZA 4B3SK 5AQMA 1FK9A 4LFBK 2OPQA 1CLQA 4DU3A 4M45A 4O5BA 1N6QA 4O55A 3T69A 1WLJA 3LM9A 4AHRA 3CG7A 4K42A 1J53A 2HBMA 3QFUA 1QVGM 1VQNN 5CYMA 4I6MB 4LF5K 4B9SA 4F3TA 4FOEA 4JI3K 4KFBA 1EETA 1KVCA 5CZ1A 3IDHA 3PIOL 3O4QA 4BRDA 5CY4A 4C8MA 3L6QA 1G99A 4WQ4A 2I7PA 1TKTA 5AQGA 3K5LA 3DLLL 3CFOA 4IZ9A 4I9QA 4CGHA 1T7PA 1VQ7N 4J2AA 3VN5A 4CHYA 4LF9K 2O8CB 2F9WA 3KK2A 1LCUA 3HSTB 2HHUA 3S9HA 2YNHA 1Q7YO 1NJWA 1SV5A 2E20A 1TUYA 4B9MA 3G0ZA 4DFMA 1U4BA 3AAPA 4MFBA 1IG8A 4O8KA 4BDPA 2XY7A 1C6VA 2GV9A 4BRKA 1QE1A 2O4GA 4LF8K 3D2EB 4H03B 1WSJA 4KO0A 4FJIA 5I9EB 1YTAA 4FK2A 4K0KK 3OJUA 1N5YA 2KKZA 3HYFA 4BR4A 5M1PA 2VWJA 3MCAB 2P9KB 1HYZA 3AVJA 4B8AB 4OPHA 4KKOA 4BRLA 2Z1IA 4PY5A 3LALA 3N4QA 4JKBA 4DMNA 4E1MA 3NVMA 4RW8A 4FJKA 4LF6K 4ILJA 3VA3A 3T7ZA 4KTZA 3T1HK 2VQEK 4ID1A 3LPUA 4CEEA 1QVFM 4CJUA 3AO5A 5AQNA 5J2QA 1C0TA 3QERA 2QKBA 4JAXA 1S9EA 1YVUA 1KAYA 4JI8K 3SZ2A 2YKMA 4CJKA 5MLCQ 3G6EN 3ID6A 2KFZA 4XH5A 3IRXA 4A2AA 3QICA 4KRFA 4OKJA 4C8NA 5E26A 3AY9A 5J1EA 4YY3K 3B6PA 3QNOA 1Q82O 1VQKN 2DFEA 1FW6A 3CCRN 1HKBA 3ZEUB 3LAMA 3ITHA 4M3UA 4KAZA 3D6RA 3U9ZA 4A2BA 5AZIA 1YJNN 1HPZA 1R0AA 4CZMA 4H5NA 2BUPA 4DKWA 1JCEA 3IFRA 5CR4A 3DYAA 1VK0A 3DRSA 1IJJA 2O8DB 2IS3A 4XH4A 1NGCA 3WQTA 1IO2A 4Y0WA 4BRCA 5GAGP 4FPBA 3AVHA 1XMQK 1VRTA 4YOUA 3DOLA 3VQAA 4BRPA 5JS2A 3ENHA 5C15A 4FK0A 5HROA 3DXKB 4CK2A 2P9NA 5I42A 1GOBA 1VSEA 3UIQA 5BRDA 2IC3A 2KLAA 3M1FA 5C0YA 4GVMA 1V4SA 4E7HA 3T1YK 3KLIA 2E2NA 3TAMA 3MCPA 3P38A 3EZ5A 4B9VA 1WSFA 3ZT1A 4BROA 1SAZA 2E8AA 2HF3A 3ZX2A 4K8ZA 4IJAA 3HVTA 1BIZA 1K6YA 4AILC 4CJTA 4JI0K 1T44A 1QQCA 1BHLA 4Z4GA 1LWFA 5LJVA 1C0GA 5K14A 4QS9A 1QZ5A 1VQPN 3HM8A 4CFCA 3LWMA 4XH1A 3E1YA 3SCXA 1NK7A 3CQYA 3QBXA 2AP1A 3ZX0A 3OYGA 3AO4A 3CM5A 5AQJA 3VQCA 3LDOA 1M1KO 4DV3K 3U3YA 3A5NC 3VETA 3JYTA 4WYBA 3L4IA 2FF6A 4AHSA 3EEQA 2OTLN 3J7ZO 3S3NA 3BEXA 3JAMO 4CGJA 4E7JA 3RSEB 4OGEA 3OBYA 3VENA 4CJQA 1VSLA 4FWOA 3THXB 2QWPA 3A5OC 3VGKA 3DLKA 2KZZA 3IS9A 1WAJA 3HJFA 3LP3A 1P8ZA 3ID8A 2D0CA 3LP2A 2NNWA 3L8BA 2QXLA 1VQ5N 5JLFA 2ITMA 3F9KA 4IEIA 2P5OA 5KGWA 4OX9K 4X66K 5F0XA 1IBMK 2ZD1A 1SQKA 3TAFA 4DV1K 1NK4A 2JLEA 4ISEA 1CZAN 3D7EO 3VQ9A 1NK6A 3OBWA 5LMNK 1RGIA 1ZBUA 4B3TK 3CM6A 4W5RA 2IVNA 4MO4A 3CJ1A 4CZEA 3AVFA 2A41A 2HF4A 4DQIA 3U3GA 1ZXOA 3NMUA 4U67L 2P9UA 3CPWM 2QWLA 3HI0A 4BWMA 1X9SA 1K8AO 3QEXA 4FM0A 1NKEA 1BGXT 2D0OA 3AVIA 1C0UA 4GY2B 3WXKA 3OYBA 3K57A 4CJWA 3SV4A 1OH8A 3EE8A 2QKKA 4JKAA 4JI2K 2QWMA 4FSVA 3IKMA 3NHGA 1A5XA 1W7AA 4E1NA 3VQQA 4BRMA 3GG4A 5BRFA 4DUZK 4LSLA 3NGYA 4BR7A 4MLEA 4FOIA 4KPYA 1JL2A 5EVZA 3RMBA 2CGLA 1RDWX 4CHPA 3VERA 3SLCA 4BC3A 4IWVA 3K5OA 3CC4N 1GOCA 4PHTX 5EU7A 4L8RB 3AV9A 1GLBG 2YHBA 3QO9A 1U2VA 2YHWA 4H8KA 1YXQA 2YNIA 4FZYA 3OYHA 4EP5A 1IBLK 2YJFA 4CD3A 4OKEA 3V9UA 3FFKB 3AO3A 3MN6A 1WSGA 3OYMA 3SMSA 4FLYA 2A42A 3LP0A 3R9PA 4B08A 1XC3A 4CIGA 5KPTA 1U04A 1IKYA 1MU2A 1DGKN 3CCVN 2YKNA 3L2QA 4TSXA 2GUIA 1I3AA 4LY7A 2E2PA 2P9PA 4DFPA 3ENOA 5F1XA 5HL7L 2ASMA 2HBLA 5KI6A 2PZSA 3OS1A 1VQON 3ZSRA 1TGOA 1UA1A 3SMPA 1NM1A 4OVLA 2XHBA 4IFEA 3UKRA 1EWRA 4CEDA 3TARA 4CE9A 4DV6K 4PQUA 3TWHA 4O44A 4J2EA 2HBJA 1TV6A 4KV8A 1TYQA 3V81A 4CGFA 4FJ5A 2E2OA 4NCBA 1G15A 3UB5A 2CH5A 3P5JA 4K25A 4Q0BA 5ELZA 1NKCA 4YOWA 3K0SA 4YNQA 1N32K 1RBRA 4DF4A 4BVOA 1HYVA 1X3NA 3HPGA 3LZIA 1WB9A 1CZBA 3CD6N 3FZHA 4CIFA 3QNNA 4NO7A 3MN5A 3UKUA 1YUWA 4FLWA 4H4OA 3AGKA 1W2BM 3RRHA 1ILYA 4EAHD 1ZBFA 4PKGA 1NOZA 1YF5L 2Q2RA 4HUFA 4W5NA 3KKRA 3WUHA 2E1ZA 3ATVA 3EKSA 4XIUA 3HBTA 3OYKA 2RHKA 1T05A 4PWDA 3KJVA 4PKIA 1EX4A 4BRAA 3W3DA 4DR7K 1E4FT 1WAFA 3VQDA 3E66A 4F9OA 4M7YA 3NGIA 3C7NA 4CZKA 2G8FA 4DSFA 5AQYA 2O8EA 3UKRB 1BL3A 4Z4CA 4B3MK 4W5QA 4I2QA 2HHVA 1NGHA 3HP6A 1JL1A 1NU0A 5SWMA 3A2FA 3SNNA 4CFDA 1XI1A 1TYQB 3THWB 4DV7K 4BWJA 3SPYA 1QQMA 1KTQA 3R8EA 4DCHA 2O4IA 5BPNA 4FJ7A 2W41A 5HRPA 4DV2K 3TU5A 2NRWA 4N56A 3DLGA 4AM6A 1TKXA 4CVNE 1BQNA 5C10A 3TSQA 4JRQA 4FXDA 1BCOA 2GWJA 4ZHRA 1JCGA 1ZBSA 4IFVA 3SUNA 1SZ2A 3H1VX 2Y1JA 4OLBA 4LH4A 4CJ3A 1NMDA 3CERA 1RT6A 3UE5A 1BOTO 1GLLO 3CIPA 3M8SA 1NGAA 3DLRA 4KI6A 3O3HA 3KZBA 3K2PA 1KAZA 2HSTA 1JLEA 4JV5K 4IDHA 3K9JA 4WCEL 5AQWA 1U45A 2RN2A 2BTFA 4I6MA 2QM1A 4LFCK 2X78A 3U4LA 4HWIA 4R5PA 4FJ8A 3P31A 1LWEA 4WF9L 1QSYA 3ZSVA 3NF9A 4IKFA 1O1WA 4QS7A 3ZETB 1U49A 2Z1JA 3QFPA 4H5WA 3VEXA 3J7YP 1OVQA 4CHOA 4FWKA 5LY3A 4JKGB 4FJNA 1CXUA 3CQXA 2E1YA 2O8CA 4H0VB 1HNIA 4FL9A 1GLEG 3CCQN 1KCFA 4ELVA 4FM1A 3P39A 4WQ5C 4BQLA 3RRGA 1NJYA 2D4WA 4C23A 3TAQA 4BR9A 1O13A 4H0YB 4A57A 3HT3A 4X65K 4B3RK 4BE0A 4IEEA 1UWBA 3SJHA 4MDAA 2FF3B 4M41A 4FCYA 4KHQA 1YTUA 2YI1A 1XHXA 3HK2A 3D2EA 5AQRA 2HHTA 3V9XA 4J8FA 4B9TA 4DS5A 2PAVA 1KC8O 1Q81O 4OPKA 4GVEA 4CI6A 5JVHL 2P9KA 1VSDA 4DTPA 3RWUA 2NRXA 1TK8A 3AA2A 3DLBA 5JVGL 3OS0A 2UXCK 3J7AP 4KREA 4CERA 3DAWA
chains in the Genus database with same CATH topology
1QZ6A 4CBUA 1BWFO 2BH1A 3DXKB 5C2DA 1K8KB 3TPQA 2Q0UA 1KAXA 3BF3A 4IOXA 2P9NA 3KWIA 5AQKA 5AQXA 3BUZB 3K9KA 4KH5A 1ESVA 2VGMA 5AQZA 5M1FA 5DM6L 2ZGYA 4CZJA 5BN8A 4BQZA 4Z94A 5BRDA 1H1VA 3DXMB 2YJEA 4QS8A 4BR2A 2KLAA 3M1FA 5GIOA 5C0YA 1V4SA 5CHIA 2E2QA 1VQLN 3ZETA 2E2NA 4U7BA 3MCPA 3P38A 4MLHA 3JS6A 1NWKA 3CF5L 3G71N 2A3ZA 4B1XB 4RWTA 4JKGA 4BC4A 3GE1A 3WXMB 1LOTB 3LDPA 3EE9A 4BROA 4JKEA 1SAZA 4BRIA 2E8AA 3EKUA 2HF3A 3A5MC 2QWRA 3ZX2A 4FWQA 3QBWA 4IJAA 4BRHA 4WFAL 2GUPA 4E1JA 3MWTA 3ZEUA 1S3XA 2WC9A 2YHXA 4FO0A 1HKCA 3JXUA 3KWGA 4JHDB 3TTDA 1T44A 2P9IA 4NB4A 3VTIA 3S41A 4B1ZA 4BREA 5KQDA 4B1VA 5AZJB 5FPDA 5DM7L 5F2RA 1BA1A 2VGNA 5LJVA 1C0GA 2ZF5O 3DWLA 3FLCO 5EXWA 3LL3A 1BG3A 3TSPA 1Y64A 4QS9A 4PKHA 1QZ5A 4A5BA 4WFBL 4FWLA 1VQPN 3HM8A 3SAHA 4XH1A 2CH6A 3E1YA 3GDQA 5JMVA 3QB0A 4IOCL 1Z05A 4BRFA 5AQTA 4GV9A 1HLUA 1V4TA 1KXPA 5GIPA 3CQYA 3QBXA 2P9UB 2A6AA 2AP1A 2FSKA 3E9LA 3ZX0A 4IXCA 1MDUB 5BN9A 3WT0A 2QA4N 4CD1A 3O8MA 5AQJA 3ULEB 3LDOA 4BR5A 1M1KO 4H0XB 1NGDA 5HOOA 2GELA 3A5NC 3VETA 4EHUA 1S72N 3HZ6A 1GLDG 3OA9A 4WYBA 3DXKA 2HMPA 1YIJN 3I8BA 3CMEN 3L4IA 4YDUA 2FF6A 5BPMA 2OTLN 3J8AA 3MWPA 4JKFA 4AM7A 1S22A 1X9JA 5BPLA 3J7ZO 3BEXA 4CZLA 3I55N 3RSEB 4A62A 4DQ8A 4YDUC 3DXMA 3OBYA 3VENA 4FWOA 3WEEA 2QWPA 1HKGA 2GTDA 3A5OC 5AQHA 3VGKA 1WUAA 1ATNA 1EO1A 4B9QA 4YOXA 1P8ZA 3ID8A 3O5BA 1ATRA 2NNWA 3ZYYX 2QXLA 4YOVA 3HSCA 1VQ5N 5JLFA 2ITMA 2QEXN 2NLXA 4XEIA 5AQIA 3E9OA 3EL2A 4IEIA 5KQ8A 3GOIA 3CCLN 4BY9C 3D2FB 4C1NK 4OO1J 3VGLA 2Q31A 5EOYA 5F0XA 5GINA 4EFHA 2P9IB 3IMXA 2QWQA 3DJCA 3W0LA 2IVOA 1U6ZA 2V7YA 1HPMA 3KVGA 5AQQA 3C6HA 1U2VB 1SQKA 4PL7A 3TSUA 4ISEA 1CZAN 3CHWA 3D7EO 3O08A 2QWNA 5AQVA 3O6WA 3OBWA 1RGIA 5AZJA 4FWNA 1MWKA 2FSJA 1C0FA 1NLVA 1GLCG 1QQNA 3H45C 4BGBA 3CCSN 4JKCA 2HBKA 2IVNA 4MO4A 3CJ1A 3H6EA 4AF1A 4CZEA 3AARA 2PFUA 4BVPA 4IO8A 2A41A 2HF4A 2YCHA 3BF1A 4B1YB 5BREA 3L0QA 1ZXOA 3NMUA 4U67L 2P9UA 4BRGA 3CPWM 3QMLA 5H1SQ 1QHAA 3ULEA 1ATSA 2QWLA 3HI0A 3WXJA 3KHYA 1K8AO 2GWKA 2KHOA 1N8RO 2OTJN 3VTHA 1BA0A 4A59A 2D0OA 3FE1A 4GY2B 3WXKA 1KD1O 4BGAA 2P9PB 3EE8A 4JKAA 3CETA 3WEEB 2QWMA 4FSVA 3RSEA 4JNEA 3IKMA 4LC9B 5JLHA 4IJNA 2FSNA 4BRMA 3GG4A 2Q1NA 3VEWA 5BRFA 3U9DA 4GV6A 5AQUA 3RVCA 3E9PA 4BR7A 4MLEA 3CXCM 4FOIA 3BP8A 4KBOA 2NZTA 4FWPA 2NRVA 4PL8A 3MK6A 5EVZA 1HUXA 2CGLA 1RDWX 1NBWA 3VERA 3SLCA 4BC3A 4IWVA 5AQPA 2ZJPL 3CC4N 3D2FA 4GNIA 4PHTX 4DB3A 1R59O 4NLCA 2EWSA 1GLBG 2D1KA 2VCPA 3SBGA 4JK8A 1HX1A 3GL1A 1OKJA 1U2VA 2YHWA 3R6MA 4ILGB 4MO5A 2ZGZA 3AGRA 5JICA 1YXQA 1DEJA 3FR0A 4ISGA 2FLOA 2I7NA 3ATUA 3VPZA 3HTVA 5GAHP 2WBNA 2YJFA 4C1NI 4CD3A 4EIAA 3H46O 3OW2M 2P9LB 2JWKA 3QDKA 3CJBA 1SS6A 3FFKB 3VF4A 2JWLA 3UKUB 3MN6A 5B8HA 2PBDA 1RDUA 4JD2B 3O1WA 5ADXA 1TUUA 3A5LC 1GLFO 3SAFA 1T6DA 3SMSA 1YAGA 2ZWHA 3CC2N 2A40A 4FWRA 3FGUA 2A42A 3R9PA 1XC3A 3B8AX 4M7XA 2GX9A 3VF6A 1VQMN 1XUPO 5KPTA 2P9SB 4L3QA 3CCVN 1DGKN 3L4QA 4MDBA 2AA4A 2VWBA 2E2PA 2P9PA 2WUSA 3ENOA 3CCJN 4KH6A 4A5AA 4KH4A 5F1XA 1YI2N 3EO3A 3VEZA 3O9UA 4JKHA 1MWMA 1X3MA 3C7NB 4JN4A 2ASMA 5HL7L 2HBLA 3LDLA 3Q7BA 3O1BA 1VQON 5C12A 5KPRA 3PIPL 3I56N 3SMPA 1NM1A 1DKGD 4H0OA 4IFEA 4H0TB 3UKRA 2RE2A 1OVYA 2Q97A 3VGMA 3G25A 4BRNA 4BC2A 1HJOA 4JK7A 3G4SN 5AQFA 2A5XA 2CGJA 4CJ7A 2UYTA 2VYPA 2HBJA 4ILHA 2F9TA 5AFUA 1TYQA 4JK9A 3F2KA 1BU6O 2E2OA 3VOVA 2Q36A 2WFBA 3MX2A 3UB5A 5FPEA 3CI5A 2CH5A 4BG8A 4K25A 1T6CA 5ELZA 4YOWA 4FPAA 3VMFB 4RCHA 4HTLA 1Q18A 4IOAL 4K43A 1QQOA 4DHYA 1VQ4N 1DT9A 2H3GX 3SAGA 5M1KA 3SK3A 4BVOA 1X3NA 3CPEA 4FVUA 3CD6N 3R1XA 4G9ZA 3FZHA 4GV3A 3EZWA 1JCFA 2ZJQL 3C0BA 3FZMA 1M90O 2P9LA 4NO7A 2CGKA 3A8YA 3MN5A 4BR0A 4H0PA 3MMVA 5FPMA 1GLJO 1YUWA 1Z6RA 4JD2A 3UKUA 5KPZA 3AGKA 5AQMA 5BRHA 1W2BM 3A0IX 2D0PA 1ILYA 4EAHD 4PKGA 3T69A 1VQ8N 5E84A 3LM9A 1YF5L 2Q2RA 4WFNL 3M3ZA 1NGEA 4K42A 3WUHA 2E1ZA 2HBMA 3ATVA 3EKSA 3HBTA 3HRGA 2RHKA 3R3LA 3QFUA 1BO5O 1K9MO 1QVGM 1VQNN 2P9SA 2NRTA 4PKIA 4I6MB 1VAZA 4JKDA 4BRAA 5BR9A 3W3DA 4FOEA 3WXLA 2ASPA 1E4FT 4H5TA 3E66A 4F9OA 1VQ9N 4M7YA 3IDHA 3WXIA 3PIOL 3C7NA 4BRDA 4CBXA 4CZKA 5ADXH 5AQYA 3UKRB 3L6QA 1G99A 2J4RA 4O5FA 4WQ4A 1KQSM 2I7PA 4R79A 1VQ6N 1NGHA 5AQGA 3VEYA 3SBTA 5GAEP 3DLLL 3M5RA 4IZ9A 1NGFA 1VQ7N 3C6AA 5M1NA 4BRQA 1TYQB 1NGJA 4WQ4C 1YJ9N 1T3VA 1RFQA 2F9WA 2YHYA 2HOEA 1QQMA 3H3NO 1LCUA 3MN9A 3R8EA 4DCHA 1Q86O 5BPNA 2V51B 3I33A 2W41A 3VEVA 3CJAA 3TU5A 3M6GA 2NRWA 1Q7YO 4AM6A 4CZHA 5C10A 2E20A 1NJIO 3VEOA 1TUYA 2Q0RA 3TTCA 1YJWN 3U8XA 3TSQA 4CZGA 3CCMN 4CBWA 4CZIA 4H5VA 2V52B 2GWJA 4O8UA 1JCGA 3AAPA 5M1OA 5AZIB 1ZBSA 1IG8A 4O8KA 4FWSA 1SZ2A 3H1VX 3VESA 1YHQN 4RTFD 4EHTA 1JJ2M 4UY8O 5GADP 2F7TA 4B1UB 4YOTA 4BRKA 2ASOA 2NRRA 1WOQA 1NMDA 4B1WB 3MN7A 4YORA 5C2FA 3CERA 3D2EB 3UE5A 2IVPA 4H03B 1P90A 5I9EB 3O9RA 5AFUH 1BOTO 1GLLO 1ZC6A 3CIPA 1NGAA 2NRHA 2KKZA 2FXUA 3LDNA 2DPNA 1NGBA 4M63C 5M1PA 4BR4A 3MCAB 2P9KB 2IIRA 2NRZA 3CMAN 3KZBA 4OPHA 3OHRA 1KAZA 3GBTA 2HSTA 1BDGA 4IDHA 3F9MA 3MDQA 4BRLA 3K9JA 3TTFA 4WCEL 3N4QA 5AQWA 3HOTA 5TKWA 5TKYA 1YVNA 2BTFA 4JKBA 3NVMA 1K73O 1NGIA 3C65A 4ILJA 4I6MA 2QM1A 2OANA 4BG9A 4YOYA 1BUPA 4H5RA 3CCUN 2P9NB 3T7ZA 5AR0A 3O4WA 3U4LA 4HWIA 1K8KA 1QVFM 3P31A 5AQNA 4K41A 4WF9L 4JAXA 3P4IA 4QS7A 4A61A 3ZETB 1KAYA 3AAQA 3QFPA 4H5WA 3VEXA 4FWMA 3IUCA 4CZFA 1MA9B 5EX5A 4FWKA 4IO9L 5MLCQ 3HOSA 5CE3A 5LY3A 2QW9A 4JKGB 3CJ7A 3G6EN 3ID6A 4WQ5A 4XH5A 3CQXA 4A2AA 3QICA 2E1YA 5E26A 4H0VB 3AY9A 3CJCA 3LDQA 3FZFA 2QWOA 3LM2A 1GLEG 4FL9A 3ZX3A 3CCQN 3CC7N 3NVKA 1Q82O 3FZKA 3MX5A 1VQKN 3P39A 4WQ5C 4BQLA 3CCRN 3ENBA 3N4PA 3F5TA 3O9TA 1HKBA 3ZEUB 2D4WA 4C23A 4BR9A 1NGGA 3H1QA 3CCEN 2ZJRL 1O13A 4H0YB 4A57A 2V7ZA 5AQSA 5EY4A 2QTDA 3D6RA 4ISFA 3U9ZA 4A2BA 2GEMA 5AZIA 4IEEA 1YJNN 3SJHA 5AQLA 3PLAA 4CZMA 4H5NA 2BUPA 2QI2A 4MDAA 2FF3B 4JHDA 1JCEA 5M1QA 3IFRA 5CR4A 4DKWA 2YI1A 2YX6A 3D2EA 1J6ZA 5AQRA 3VF2A 1YITN 1IJJA 5FPNA 3O80A 4J8FA 3FZLA 3EN9A 1E4GT 4XH4A 2PAVA 4OPAA 3CJ9A 1NGCA 3WQTA 5LJWA 4Y0WA 3O9SA 1D4XA 1Q81O 1KC8O 4BRCA 5GAGP 4FPBA 3Q7CA 4GVEA 1XQSC 4NLBA 3KK7A 2P9KA 4CI6A 4YOUA 4BC5A 3O9QA 3WQUA 2NRXA 5JVHL 5AQOA 1W97L 4JEPA 5JVGL 1EQYA 4BRPA 1GLAG 3H3OB 3ENHA 5C15A 2E88A 2W40A 3DAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT X;  1W97 L;  2BH1 A;  5TKW A;  1YF5 L; 
#chains in the Genus database with same CATH topology
 2RF2 A;  2Q0U A;  4DV4 K;  3RR8 A;  5HBM A;  1RTI A;  3DLH A;  2UUC K;  5AQX A;  5M1F A;  1ESV A;  3QIO A;  1JKH A;  1H1V A;  2YJE A;  1JLF A;  4QS8 A;  3QEI A;  2HNY A;  5CHI A;  1VQL N;  3ULD A;  3SPZ A;  5T7B A;  3BY5 A;  2A3Z A;  3D45 A;  2ZM6 K;  4RWT A;  4BC4 A;  3MED A;  5KTQ A;  3WXM B;  4KHN A;  4HTU A;  4ZTF A;  4FJ9 A;  3A5M C;  3VQP A;  1VSH A;  4DFJ A;  4WFA L;  3WNF A;  3ZEU A;  2YHX A;  4RW9 A;  4FO0 A;  1HKC A;  1ITG A;  3EYZ A;  1TK5 A;  4NB4 A;  2XY5 A;  1LW2 A;  4B1Z A;  5KQD A;  4FJH A;  5AZJ B;  5DMR A;  1BA1 A;  3DWL A;  3FLC O;  3LP1 A;  3LL3 A;  4A5B A;  4WFB L;  2A1R A;  4FWL A;  2O8D A;  2XY6 A;  3SAH A;  4N5S A;  4RW6 A;  4DTS A;  5AQT A;  5FLX O;  1S1U A;  1UAX A;  3E9L A;  2KTQ A;  1MDU B;  4CD1 A;  4BR5 A;  1JLG A;  5HOO A;  1TKD A;  4Z4F A;  2OPR A;  3NH1 A;  4O0J A;  5LL6 Z;  3QET A;  3OA9 A;  1TKZ A;  3DXK A;  5C42 A;  1YIJ N;  3SUP A;  2EHG A;  3MXM A;  3ALY A;  2Q3S A;  4RW7 A;  3I55 N;  4NXM K;  1J54 A;  3WEE A;  1SL2 A;  3WNE A;  3C6U A;  1VSM A;  4FLX A;  2X6S A;  1EO1 A;  3RMA A;  4YOV A;  3V4I A;  2QEX N;  4XEI A;  5AQI A;  3EL2 A;  5KQ8 A;  1NJX A;  3D2F B;  1RT4 A;  4C1N K;  1S1V A;  4OO1 J;  2Q31 A;  5EOY A;  1JXB A;  3IMX A;  3QIP A;  1Q9Y A;  1TL1 A;  4FZZ A;  3KVG A;  5AQQ A;  1WBD A;  3C6H A;  4DR3 K;  4I7F A;  3TSU A;  1SKR A;  1JLQ A;  2QWN A;  3O6W A;  3ASM A;  3WNG A;  5A2Q O;  1GLC G;  4OLA A;  4BGB A;  3BDP A;  1Z26 A;  5FDL A;  3H6E A;  2E6L A;  4N47 A;  2X6N A;  2YCH A;  4NXN K;  3BF1 A;  3LAK A;  5BRE A;  3IG1 A;  3DLE A;  5J2M A;  4AHC A;  1ATS A;  3ZSQ A;  3WXJ A;  1NK9 A;  3SV3 A;  2EX3 A;  1YT3 A;  2OTJ N;  4WE1 A;  1X9M A;  4DR5 K;  4A59 A;  2RKI A;  1KD1 O;  4DSL A;  3SQ2 A;  3DRR A;  2ZQB A;  4ELU A;  2FBT A;  2VG7 A;  3WEE B;  1RDB A;  1BIU A;  3EY1 A;  3RSE A;  4B9L A;  1BIS A;  2G8U A;  3LDS A;  3THX A;  4JYA K;  4GV6 A;  3RVC A;  3CYM A;  2Y1I A;  3BP8 A;  1D9D A;  1FKP A;  5AQP A;  4E7L A;  4V19 S;  4N41 A;  5I3U A;  4DB3 A;  4EZ6 A;  1ASV A;  2VCP A;  3GL1 A;  3QIN A;  4DQS A;  3FFI A;  1W0H A;  2W6L A;  4MO5 A;  1L3S A;  2BGG A;  2ZGZ A;  3OS2 A;  3HPO A;  3OYD A;  2FLO A;  3ATU A;  3HTV A;  5GAH P;  1S5J A;  1E3M A;  1RDA A;  4JI1 K;  1L3V A;  2OCE A;  3CJB A;  1SS6 A;  1NK5 A;  4E7I A;  5ADX A;  3O1W A;  1TUU A;  3A5L C;  3SAF A;  1T6D A;  2PY5 A;  1YAG A;  3CC2 N;  1KLM A;  2GX9 A;  3VF6 A;  4BDY A;  1XUP O;  4DR1 K;  4KHW A;  1D5A A;  2P9S B;  4MDB A;  1Y97 A;  2AA4 A;  4Z4H A;  1HNW K;  4KH6 A;  4KH4 A;  1YI2 N;  3EO3 A;  4JKH A;  2VG6 A;  2D0B A;  2ATQ A;  4CW7 B;  1RBV A;  1F21 A;  2ZE2 A;  3Q7B A;  2O8B B;  3AVL A;  3OYF A;  3ZSY A;  2RE2 A;  1OVY A;  2Q97 A;  1X9W A;  1KSP A;  4JK7 A;  5AQF A;  5AJ3 K;  1D9F A;  2A5X A;  4CES A;  4CJ7 A;  4H4M A;  1BI4 B;  2F9T A;  5AFU A;  1HYS A;  4OGC A;  1GOA A;  3PX4 A;  3O3F A;  4ELT A;  2Q36 A;  2WFB A;  3MX2 A;  3CI5 A;  3AVB A;  1TAQ A;  1Q18 A;  4IOA L;  4AQY K;  4DHY A;  2KW4 A;  1VQ4 N;  1DT9 A;  2H3G X;  4OJR A;  3L2R A;  2WON A;  4FVU A;  4F3O A;  3R1X A;  3KLF A;  4B9U A;  2CGK A;  4BR0 A;  1L3T A;  4H0P A;  3RR7 A;  3PX0 A;  2D0P A;  3OYA A;  4IFY A;  1VQ8 N;  1EWQ A;  5E84 A;  3ZSZ A;  2OZS A;  2QXF A;  1RNH A;  3ISN C;  2P51 A;  3KD1 E;  1NK0 A;  1TAU A;  3R3L A;  2NRT A;  4BE1 A;  1T8E A;  4JKD A;  1S9G A;  3V1O A;  4DV0 K;  4CBX A;  5ADX H;  4CF9 A;  2J4R A;  1B92 A;  1OH5 A;  1D8Y A;  2G8K A;  4C8K A;  4GKK K;  3SBT A;  1NG9 A;  3M5R A;  2HB5 A;  1LWC A;  4JI4 K;  5M1N A;  1IV0 A;  4BRQ A;  1YJ9 N;  4FLV A;  5FRN A;  1RFQ A;  2YHY A;  2HOE A;  3K58 A;  1Q86 O;  2ITG A;  2HHQ A;  1IKX A;  3CJA A;  1RBT A;  4M3Y A;  4CZH A;  1NJI O;  3VEO A;  1YJW N;  3U8X A;  4CBW A;  3AO1 A;  4CZI A;  2V52 B;  1LW0 A;  3AA5 X;  4FWS A;  1RT3 A;  4M3Z A;  1KRP A;  3AA3 A;  3HXM A;  4PUO A;  4UY8 O;  5GAD P;  1RBU A;  2NRR A;  4FW2 A;  3S3O A;  4YOR A;  5FRO A;  2IVP A;  2HNZ A;  3BZK A;  3O9R A;  4FZX C;  5CZ2 A;  2W6K A;  5AFU H;  2HHX A;  2NRH A;  2FXU A;  2DPN A;  4M63 C;  5KRT A;  2NRZ A;  3CMA N;  3OHR A;  3OVN A;  1ZYQ A;  4Y1C A;  3CFR A;  3HOT A;  5TKW A;  5TKY A;  1YVN A;  4CIE A;  2KQ2 A;  1NGI A;  3KIO A;  2OPS A;  1KVA A;  4YOY A;  2YHA A;  3CCU N;  1RT1 A;  3VQE A;  3SUQ A;  4RG8 A;  3VQ5 A;  4CJE A;  1NOY A;  4K41 A;  4NYN A;  1RTD A;  4J2B A;  4CF1 A;  3JSM A;  4CEZ A;  4FWM A;  1MA9 B;  3DRP A;  3RMD A;  2X74 A;  4IO9 L;  4X62 K;  4G1Q A;  2QW9 A;  2F4V K;  3CJ7 A;  3NF8 A;  4DLE A;  4WQ5 A;  3THW A;  4DFK A;  3LDQ A;  1A5V A;  3ZX3 A;  4F8R A;  4B8C A;  3NVK A;  3MX5 A;  2WOM A;  3VQ6 A;  4DR4 K;  3L3V A;  1ASW A;  2HVH A;  3O9T A;  1S1X A;  1NJZ A;  2FBX A;  1NGG A;  3H1Q A;  3K59 A;  2ZJR L;  1IG9 A;  2V7Z A;  5AQS A;  2GEM A;  1HNZ K;  3OYN A;  5AQL A;  3PLA A;  4DSJ A;  2QI2 A;  1WNS A;  4JHD A;  1I39 A;  4DLG A;  2YX6 A;  4KTQ A;  5HLF A;  1RCH A;  3VF2 A;  1KFS A;  5FPN A;  3NDK A;  3O80 A;  4HCC A;  2IDO A;  3FZL A;  3EN9 A;  1E4G T;  3O9S A;  1D4X A;  4NLB A;  4BC5 A;  3O9Q A;  3WQU A;  5AQO A;  3MXJ A;  1W97 L;  4JEP A;  3SYZ A;  3OYJ A;  1GLA G;  4CEB A;  2B5J A;  2E88 A;  2W40 A;  4W5T A;  1NNE A;  4CBU A;  1FXX A;  2BH1 A;  4DTM A;  4EP4 A;  1Q8I A;  3KWI A;  1U48 A;  5AQK A;  3BUZ B;  3K9K A;  4KH5 A;  2VGM A;  5AQZ A;  2ZGY A;  2HHW A;  4BQZ A;  3O3G A;  3DXM B;  5GIO A;  1UA0 A;  3ZET A;  2BDP A;  4DF8 A;  3D0P A;  1NWK A;  3CF5 L;  3G71 N;  4IBN A;  1BQM A;  4J2D A;  4B1X B;  4JKG A;  1HR0 K;  1J5O A;  1VHX A;  3I8D A;  4JKE A;  3EKU A;  2KZM A;  2WTU A;  4F4K A;  1HQE A;  4BRH A;  4IDK A;  1TL3 A;  3MWT A;  1S3X A;  2WC9 A;  4AH9 A;  1DTT A;  3KWG A;  4JHD B;  4CCH A;  2E6M A;  4LH5 A;  1HRH A;  2P9I A;  3VTI A;  5HRR A;  3S41 A;  4CJL A;  4BRE A;  4B1V A;  5FPD A;  1UOC A;  5DM7 L;  3NAE A;  5F2R A;  2VGN A;  5EXW A;  4CEA A;  1BG3 A;  1Y64 A;  3PSI A;  4PKH A;  5HP1 A;  1CZ9 A;  4O4G A;  5JMV A;  3QB0 A;  4IOC L;  1WSI A;  1Z05 A;  3P83 D;  2Z1G A;  4BRF A;  4DTX A;  3NF7 A;  1HLU A;  2IAJ A;  1V4T A;  3WNH A;  4CJF A;  3PY8 A;  4GV9 A;  2A6A A;  4DR6 K;  1T03 A;  4IXC A;  3MEE A;  1NMN A;  2HND A;  3O8M A;  3ULE B;  3ZT3 A;  2UUA K;  4H0X B;  1NGD A;  1GLD G;  3I8B A;  5BPM A;  3MWP A;  1SKS A;  4AM7 A;  1S22 A;  5BPL A;  4CZL A;  1JLC A;  4YDU C;  2YNG A;  3P1G A;  3THY A;  2GTD A;  5AQH A;  4KI4 A;  3QEP A;  1N33 K;  1RDD A;  3O5B A;  1ATR A;  1VSJ A;  4DU1 A;  3QEV A;  3U6F A;  4M3W A;  1ZBI A;  3E9O A;  3GOI A;  3CCL N;  1X1P A;  3HVR A;  3TI0 A;  3VGL A;  2FBV A;  5GIN A;  3BGR A;  4FJX A;  2P9I B;  2XO7 A;  3V1Q A;  2QWQ A;  3W0L A;  3ZT0 A;  2IVO A;  2V7Y A;  1HPM A;  4RW4 A;  4PL7 A;  2B4J A;  5AQV A;  1SL1 A;  2P5G A;  4Z4E A;  5AZJ A;  4FWN A;  1DLO A;  4CGD A;  1C0F A;  2O8F B;  1NLV A;  2HHH K;  1QQN A;  3CCS N;  3RTV A;  3ZSW A;  2HBK A;  4AF1 A;  4CGG A;  3C95 A;  1RTJ A;  3L0Q A;  1XC9 A;  4BRG A;  1RT2 A;  4I9L A;  5H1S Q;  5KRS A;  2F8S A;  1FKO A;  3KHY A;  2G8I A;  2GBZ A;  1HJR A;  4OPJ A;  2GWK A;  1N8R O;  1WSH A;  2BAN A;  3VTH A;  1S6P A;  3FE1 A;  4DQQ A;  4FVM A;  1NKB A;  4DS4 A;  3NH0 A;  3THY B;  3KTQ A;  3LAN A;  4JNE A;  2FSN A;  1SKW A;  2Q1N A;  3KLG A;  1WBB A;  4LF4 K;  3CXC M;  4KBO A;  2NZT A;  4FWP A;  2NRV A;  1QSS A;  1NBW A;  1WN7 A;  1IH7 A;  4DTR A;  4HUG A;  3D2F A;  2E4L A;  2D1K A;  4MQ3 A;  3SBG A;  4JK8 A;  3ZLJ A;  1HX1 A;  4CEO A;  1OKJ A;  3SQ4 A;  3R6M A;  3VA0 A;  4ILG B;  3OYI A;  1ZBH A;  3AGR A;  3F73 A;  3SI6 A;  3T1A A;  1DEJ A;  3FR0 A;  4N76 A;  4KHP K;  4QOZ B;  4ISG A;  1QSL A;  4GW6 A;  2I7N A;  3VPZ A;  3SQ0 A;  4ID5 A;  1VSK A;  1LV5 A;  2WBN A;  5IT9 O;  2P9L B;  4AHT A;  3QDK A;  2QK9 A;  3I0S A;  3VF4 A;  4JD2 B;  2ZWH A;  3ZSX A;  1L5U A;  2A40 A;  4FWR A;  3FGU A;  5FRM A;  4M7X A;  3B8A X;  4NCG A;  1VQM N;  3L2W A;  3SUO A;  3HO1 A;  2VWB A;  3K5M A;  2PYL A;  3CCJ N;  4A5A A;  3VEZ A;  1X3M A;  4JN4 A;  4OKK A;  3O1B A;  3ZT2 A;  5C12 A;  3I56 N;  5J2N A;  4H0T B;  3J80 O;  3VGM A;  3G25 A;  4BRN A;  4JS4 A;  3G4S N;  4UQG A;  2B6A A;  4ILH A;  1JLA A;  3F2K A;  1BU6 O;  2DFH A;  3VOV A;  4QAG A;  4CF8 A;  1T6C A;  4NCA A;  3C6T A;  4FLU A;  4HTL A;  4K43 A;  1QQO A;  2LSN A;  4KHS A;  3SAG A;  5M1K A;  3SK3 A;  3G10 A;  1HQU A;  1W9H A;  1WSE A;  4GV3 A;  2ZJQ L;  1M90 O;  3KKS A;  3DI6 A;  5FPM A;  3MMV A;  2G8W A;  5BRH A;  1Z25 A;  3A0I X;  3L2U A;  2DFF A;  3NCI A;  4DSK A;  4WFN L;  3M3Z A;  1NGE A;  1BCM A;  3HRG A;  1BO5 O;  1TVR A;  1K9M O;  2P9S A;  1RIL A;  1VAZ A;  4DR2 K;  5BR9 A;  3WXL A;  4CJS A;  4IG3 A;  2ASP A;  4H5T A;  1VQ9 N;  4DQP A;  2OYQ A;  3WXI A;  1HMV A;  4DU4 A;  4B9N A;  2O8B A;  4O5F A;  1KQS M;  1VQ6 N;  4R79 A;  1S6Q A;  4HHT A;  3VEY A;  3AVG A;  3ZSO A;  5GAE P;  1REV A;  4E0D A;  1NGF A;  4FJL A;  3C6A A;  4WQ4 C;  1NGJ A;  4FLT A;  1T3V A;  3MN9 A;  3H3N O;  4CK1 A;  2FBY A;  1HNV A;  4BDZ A;  2V51 B;  3I33 A;  3VEV A;  4PA1 A;  1BI4 A;  3M6G A;  2Q0R A;  3TTC A;  4CZG A;  2XRI A;  3CCM N;  4H5V A;  3OJS A;  4O8U A;  2HVI A;  5M1O A;  3VES A;  5AZI B;  1YHQ N;  4RTF D;  4EHT A;  1JJ2 M;  2F7T A;  4B1U B;  4YOT A;  4JI6 K;  2ASO A;  1WOQ A;  4B1W B;  5C2F A;  3MN7 A;  3KLH A;  3MXI A;  1I94 K;  1VSF A;  1P90 A;  3TAP A;  1ZC6 A;  3HM9 A;  3TAG A;  5BR8 K;  3LDN A;  4KB1 A;  1NGB A;  2OPP A;  1SUQ A;  2IIR A;  4CF2 A;  3GBT A;  1EP4 A;  3V9Z A;  2ETJ A;  1BDG A;  5CYQ A;  3MAQ A;  3F9M A;  3SQ1 A;  3MDQ A;  1IKV A;  1EKE A;  3TTF A;  1N36 K;  2NUB A;  4CHZ A;  3NFA A;  1K73 O;  4GKJ K;  2AJQ A;  3C65 A;  3H08 A;  4BG9 A;  2OAN A;  4O0I A;  1BUP A;  4H5R A;  2P9N B;  5AR0 A;  3O4W A;  2DTU A;  1XWL A;  1K8K A;  5C24 A;  3M8P A;  3S3M A;  3P4I A;  4A61 A;  4M3T A;  3VQ4 A;  3AAQ A;  3PSF A;  4CZF A;  3IUC A;  5EX5 A;  3HOS A;  1KLN A;  5CE3 A;  3L2V A;  2HHS A;  3AVK A;  1QS4 A;  4DTN A;  3ZCM A;  3CJC A;  3LM2 A;  3FZF A;  2QWO A;  3CC7 N;  3FZK A;  2XY8 A;  3ENB A;  3N4P A;  3F5T A;  4CJP A;  3RMC A;  4LSN A;  4ICL A;  3CCE N;  4E19 A;  5EY4 A;  2QTD A;  4ISF A;  1XMO K;  4CJ5 A;  3KD5 E;  4YFU A;  5M1Q A;  4CHN A;  1J9A A;  3OY9 A;  4GMJ B;  1J6Z A;  3AVA A;  1ZBL A;  1YIT N;  5IWA K;  4AHU A;  3B6O A;  4KHY A;  4OPA A;  3CJ9 A;  5LJW A;  2P1J A;  1IKW A;  3Q7C A;  3ZT4 A;  1XQS C;  3NH2 A;  3KK7 A;  4DQR A;  4M42 A;  2HMI A;  2OZM A;  1A5W A;  1EQY A;  3C94 A;  4LFA K;  3H3O B;  1XNR K;  1RBS A;  4CJR A;  1QZ6 A;  1XNQ K;  1BWF O;  1HNX K;  2KFN A;  5C2D A;  3HP9 A;  1K8K B;  3TPQ A;  3BF3 A;  1KAX A;  2UUB K;  4IOX A;  2FC0 A;  3O4N A;  2JGU A;  5DM6 L;  4CZJ A;  5BN8 A;  4Z94 A;  4KTW A;  4BR2 A;  3PO4 A;  2RPI A;  4CEF A;  2E2Q A;  1LAV A;  3MEG A;  5E41 A;  1L3U A;  4U7B A;  4MLH A;  3MEC A;  3JS6 A;  1OH6 A;  4AHV A;  4NYF A;  3GE1 A;  1LOT B;  3LDP A;  3EE9 A;  4DWI A;  4FJM A;  4BRI A;  3K5N A;  3VQ8 A;  4Q5V A;  3AVM A;  2QWR A;  4BE2 A;  4EZ9 A;  1N34 K;  4FWQ A;  3QBW A;  2GUP A;  3TAE A;  2YNF A;  4DUY K;  4E1J A;  3JXU A;  2UXD K;  3TTD A;  3M8Q A;  3PO5 A;  4E7K A;  2W42 A;  5LMU K;  2ZF5 O;  3AVN A;  3TSP A;  5DK5 A;  4Z4I A;  2CH6 A;  3GDQ A;  1XHZ A;  4BAC A;  1KXP A;  5GIP A;  1RT7 A;  3OYC A;  4CJV A;  2P9U B;  2FSK A;  3VQB A;  5BN9 A;  2QA4 N;  3WT0 A;  2BE2 A;  3CQ8 A;  2GEL A;  4EHU A;  1S72 N;  3HZ6 A;  1S1T A;  4Z0U A;  3OTO K;  2HMP A;  3OYE A;  3CME N;  4YDU A;  3NE6 A;  3J8A A;  4I2P A;  4JKF A;  1X9J A;  4B3O A;  1KVB A;  5HRN A;  1IBK K;  4A62 A;  4DQ8 A;  3DXM A;  1DTQ A;  4CF0 A;  1HKG A;  1WUA A;  1ATN A;  4F2R A;  1J5E K;  4B9Q A;  2HW3 A;  4YOX A;  3T19 A;  3KK3 A;  3ZYY X;  4IG0 A;  2PYJ A;  3HL8 A;  3HSC A;  4DV5 K;  2NLX A;  4BY9 C;  4EFH A;  3SJJ A;  3DJC A;  4HUE A;  1U6Z A;  1B9F A;  4CFA A;  2UXB K;  4JS5 A;  1U2V B;  3QES A;  2D5R A;  3CHW A;  3O08 A;  3PX6 A;  3DM2 A;  4JI7 K;  1LAW A;  4FK4 A;  3NF6 A;  1C1C A;  1MWK A;  3M8R A;  2FSJ A;  5HRS A;  3H45 C;  3E01 A;  4JKC A;  4LF7 K;  4M3X A;  3V1R A;  3VQ7 A;  4M3R A;  3AAR A;  2PFU A;  4BVP A;  4IO8 A;  4B1Y B;  2DY4 A;  4LD0 A;  4JI5 K;  1Q9X A;  3AO2 A;  4FYD A;  3BZC A;  3QML A;  1QHA A;  3ULE A;  5J2P A;  4KHU A;  3DMJ A;  2KHO A;  4HVJ A;  2VQF K;  1BA0 A;  2G8H A;  4FJG A;  3T3F A;  1RT5 A;  4C8L A;  1EXQ A;  4HCB A;  4BGA A;  2P9P B;  2F96 A;  3J81 O;  2R7Y A;  4CFB A;  3CET A;  4JRP A;  4YHH K;  5KGX A;  4DTJ A;  3DOK A;  4LC9 B;  3LPT A;  5JLH A;  4IJN A;  2G8V A;  1C1B A;  3VEW A;  1C0M A;  3OYL A;  3U9D A;  4CEC A;  5AQU A;  3V9W A;  3E9P A;  2VWK A;  4PL8 A;  3MK6 A;  1HUX A;  2VG5 A;  4QCL A;  1SL0 A;  2YV0 X;  4E89 A;  2ZJP L;  3PV8 A;  1JXE A;  4GNI A;  2E5L K;  3LWL A;  4K8X A;  2IOC A;  4Y1D A;  1R59 O;  1RTH A;  4NLC A;  2EWS A;  3AVC A;  3HPH A;  4CK3 A;  3CFP A;  3AA4 A;  5JIC A;  3V9S A;  4DTU A;  1U47 A;  3L3U A;  1JLB A;  2O8F A;  5C25 A;  2UU9 K;  4DSE A;  4C1N I;  4EIA A;  2OA8 A;  3H46 O;  3I0R A;  3OW2 M;  3NGZ A;  2JWK A;  2JWL A;  3UKU B;  5B8H A;  2PBD A;  1RDU A;  1GLF O;  4JLH A;  4CJ4 A;  2I5J A;  1KFD A;  1QHT A;  1QTM A;  4KB0 A;  2Z1H A;  4FM2 A;  3LZJ A;  4L3Q A;  2A1S A;  3L4Q A;  1VSI A;  1FJG K;  2WUS A;  5SZT A;  3PUF A;  4DG1 A;  4E3S A;  3O9U A;  1MWM A;  3C7N B;  4FW1 A;  3LDL A;  1TK0 A;  2O8E B;  5KPR A;  3PIP L;  4DTO A;  4CEQ A;  1DKG D;  3V6D A;  3QLH A;  4H0O A;  3TAB A;  1ASU A;  3IAY A;  4BC2 A;  3TAN A;  4W5O A;  1HJO A;  4C8O A;  2CGJ A;  2UYT A;  2VYP A;  5D3G A;  4JK9 A;  1CXQ A;  2IGI A;  1S1W A;  2F8T A;  5FPE A;  1RDC A;  4BG8 A;  4FLZ A;  1VRU A;  4CHQ A;  2D0A A;  4FPA A;  3VMF B;  4DSI A;  4RCH A;  1C1A A;  1B9D A;  3KK1 A;  3NBP A;  3QEW A;  3CPE A;  4CGI A;  3KLE A;  5JS1 A;  4F2S A;  4G9Z A;  3EZW A;  1JCF A;  4ZTJ A;  1OH7 A;  3C0B A;  4FJJ A;  3FZM A;  3THV A;  2P9L A;  3A8Y A;  4X64 K;  1NK8 A;  1GLJ O;  1Z6R A;  3TR8 A;  4JD2 A;  5KPZ A;  4B3S K;  5AQM A;  1FK9 A;  4LFB K;  2OPQ A;  1CLQ A;  4DU3 A;  4M45 A;  4O5B A;  1N6Q A;  4O55 A;  3T69 A;  1WLJ A;  3LM9 A;  4AHR A;  3CG7 A;  4K42 A;  1J53 A;  2HBM A;  3QFU A;  1QVG M;  1VQN N;  5CYM A;  4I6M B;  4LF5 K;  4B9S A;  4F3T A;  4FOE A;  4JI3 K;  4KFB A;  1EET A;  1KVC A;  5CZ1 A;  3IDH A;  3PIO L;  3O4Q A;  4BRD A;  5CY4 A;  4C8M A;  3L6Q A;  1G99 A;  4WQ4 A;  2I7P A;  1TKT A;  5AQG A;  3K5L A;  3DLL L;  3CFO A;  4IZ9 A;  4I9Q A;  4CGH A;  1T7P A;  1VQ7 N;  4J2A A;  3VN5 A;  4CHY A;  4LF9 K;  2O8C B;  2F9W A;  3KK2 A;  1LCU A;  3HST B;  2HHU A;  3S9H A;  2YNH A;  1Q7Y O;  1NJW A;  1SV5 A;  2E20 A;  1TUY A;  4B9M A;  3G0Z A;  4DFM A;  1U4B A;  3AAP A;  4MFB A;  1IG8 A;  4O8K A;  4BDP A;  2XY7 A;  1C6V A;  2GV9 A;  4BRK A;  1QE1 A;  2O4G A;  4LF8 K;  3D2E B;  4H03 B;  1WSJ A;  4KO0 A;  4FJI A;  5I9E B;  1YTA A;  4FK2 A;  4K0K K;  3OJU A;  1N5Y A;  2KKZ A;  3HYF A;  4BR4 A;  5M1P A;  2VWJ A;  3MCA B;  2P9K B;  1HYZ A;  3AVJ A;  4B8A B;  4OPH A;  4KKO A;  4BRL A;  2Z1I A;  4PY5 A;  3LAL A;  3N4Q A;  4JKB A;  4DMN A;  4E1M A;  3NVM A;  4RW8 A;  4FJK A;  4LF6 K;  4ILJ A;  3VA3 A;  3T7Z A;  4KTZ A;  3T1H K;  2VQE K;  4ID1 A;  3LPU A;  4CEE A;  1QVF M;  4CJU A;  3AO5 A;  5AQN A;  5J2Q A;  1C0T A;  3QER A;  2QKB A;  4JAX A;  1S9E A;  1YVU A;  1KAY A;  4JI8 K;  3SZ2 A;  2YKM A;  4CJK A;  5MLC Q;  3G6E N;  3ID6 A;  2KFZ A;  4XH5 A;  3IRX A;  4A2A A;  3QIC A;  4KRF A;  4OKJ A;  4C8N A;  5E26 A;  3AY9 A;  5J1E A;  4YY3 K;  3B6P A;  3QNO A;  1Q82 O;  1VQK N;  2DFE A;  1FW6 A;  3CCR N;  1HKB A;  3ZEU B;  3LAM A;  3ITH A;  4M3U A;  4KAZ A;  3D6R A;  3U9Z A;  4A2B A;  5AZI A;  1YJN N;  1HPZ A;  1R0A A;  4CZM A;  4H5N A;  2BUP A;  4DKW A;  1JCE A;  3IFR A;  5CR4 A;  3DYA A;  1VK0 A;  3DRS A;  1IJJ A;  2O8D B;  2IS3 A;  4XH4 A;  1NGC A;  3WQT A;  1IO2 A;  4Y0W A;  4BRC A;  5GAG P;  4FPB A;  3AVH A;  1XMQ K;  1VRT A;  4YOU A;  3DOL A;  3VQA A;  4BRP A;  5JS2 A;  3ENH A;  5C15 A;  4FK0 A;  5HRO A;  3DXK B;  4CK2 A;  2P9N A;  5I42 A;  1GOB A;  1VSE A;  3UIQ A;  5BRD A;  2IC3 A;  2KLA A;  3M1F A;  5C0Y A;  4GVM A;  1V4S A;  4E7H A;  3T1Y K;  3KLI A;  2E2N A;  3TAM A;  3MCP A;  3P38 A;  3EZ5 A;  4B9V A;  1WSF A;  3ZT1 A;  4BRO A;  1SAZ A;  2E8A A;  2HF3 A;  3ZX2 A;  4K8Z A;  4IJA A;  3HVT A;  1BIZ A;  1K6Y A;  4AIL C;  4CJT A;  4JI0 K;  1T44 A;  1QQC A;  1BHL A;  4Z4G A;  1LWF A;  5LJV A;  1C0G A;  5K14 A;  4QS9 A;  1QZ5 A;  1VQP N;  3HM8 A;  4CFC A;  3LWM A;  4XH1 A;  3E1Y A;  3SCX A;  1NK7 A;  3CQY A;  3QBX A;  2AP1 A;  3ZX0 A;  3OYG A;  3AO4 A;  3CM5 A;  5AQJ A;  3VQC A;  3LDO A;  1M1K O;  4DV3 K;  3U3Y A;  3A5N C;  3VET A;  3JYT A;  4WYB A;  3L4I A;  2FF6 A;  4AHS A;  3EEQ A;  2OTL N;  3J7Z O;  3S3N A;  3BEX A;  3JAM O;  4CGJ A;  4E7J A;  3RSE B;  4OGE A;  3OBY A;  3VEN A;  4CJQ A;  1VSL A;  4FWO A;  3THX B;  2QWP A;  3A5O C;  3VGK A;  3DLK A;  2KZZ A;  3IS9 A;  1WAJ A;  3HJF A;  3LP3 A;  1P8Z A;  3ID8 A;  2D0C A;  3LP2 A;  2NNW A;  3L8B A;  2QXL A;  1VQ5 N;  5JLF A;  2ITM A;  3F9K A;  4IEI A;  2P5O A;  5KGW A;  4OX9 K;  4X66 K;  5F0X A;  1IBM K;  2ZD1 A;  1SQK A;  3TAF A;  4DV1 K;  1NK4 A;  2JLE A;  4ISE A;  1CZA N;  3D7E O;  3VQ9 A;  1NK6 A;  3OBW A;  5LMN K;  1RGI A;  1ZBU A;  4B3T K;  3CM6 A;  4W5R A;  2IVN A;  4MO4 A;  3CJ1 A;  4CZE A;  3AVF A;  2A41 A;  2HF4 A;  4DQI A;  3U3G A;  1ZXO A;  3NMU A;  4U67 L;  2P9U A;  3CPW M;  2QWL A;  3HI0 A;  4BWM A;  1X9S A;  1K8A O;  3QEX A;  4FM0 A;  1NKE A;  1BGX T;  2D0O A;  3AVI A;  1C0U A;  4GY2 B;  3WXK A;  3OYB A;  3K57 A;  4CJW A;  3SV4 A;  1OH8 A;  3EE8 A;  2QKK A;  4JKA A;  4JI2 K;  2QWM A;  4FSV A;  3IKM A;  3NHG A;  1A5X A;  1W7A A;  4E1N A;  3VQQ A;  4BRM A;  3GG4 A;  5BRF A;  4DUZ K;  4LSL A;  3NGY A;  4BR7 A;  4MLE A;  4FOI A;  4KPY A;  1JL2 A;  5EVZ A;  3RMB A;  2CGL A;  1RDW X;  4CHP A;  3VER A;  3SLC A;  4BC3 A;  4IWV A;  3K5O A;  3CC4 N;  1GOC A;  4PHT X;  5EU7 A;  4L8R B;  3AV9 A;  1GLB G;  2YHB A;  3QO9 A;  1U2V A;  2YHW A;  4H8K A;  1YXQ A;  2YNI A;  4FZY A;  3OYH A;  4EP5 A;  1IBL K;  2YJF A;  4CD3 A;  4OKE A;  3V9U A;  3FFK B;  3AO3 A;  3MN6 A;  1WSG A;  3OYM A;  3SMS A;  4FLY A;  2A42 A;  3LP0 A;  3R9P A;  4B08 A;  1XC3 A;  4CIG A;  5KPT A;  1U04 A;  1IKY A;  1MU2 A;  1DGK N;  3CCV N;  2YKN A;  3L2Q A;  4TSX A;  2GUI A;  1I3A A;  4LY7 A;  2E2P A;  2P9P A;  4DFP A;  3ENO A;  5F1X A;  5HL7 L;  2ASM A;  2HBL A;  5KI6 A;  2PZS A;  3OS1 A;  1VQO N;  3ZSR A;  1TGO A;  1UA1 A;  3SMP A;  1NM1 A;  4OVL A;  2XHB A;  4IFE A;  3UKR A;  1EWR A;  4CED A;  3TAR A;  4CE9 A;  4DV6 K;  4PQU A;  3TWH A;  4O44 A;  4J2E A;  2HBJ A;  1TV6 A;  4KV8 A;  1TYQ A;  3V81 A;  4CGF A;  4FJ5 A;  2E2O A;  4NCB A;  1G15 A;  3UB5 A;  2CH5 A;  3P5J A;  4K25 A;  4Q0B A;  5ELZ A;  1NKC A;  4YOW A;  3K0S A;  4YNQ A;  1N32 K;  1RBR A;  4DF4 A;  4BVO A;  1HYV A;  1X3N A;  3HPG A;  3LZI A;  1WB9 A;  1CZB A;  3CD6 N;  3FZH A;  4CIF A;  3QNN A;  4NO7 A;  3MN5 A;  3UKU A;  1YUW A;  4FLW A;  4H4O A;  3AGK A;  1W2B M;  3RRH A;  1ILY A;  4EAH D;  1ZBF A;  4PKG A;  1NOZ A;  1YF5 L;  2Q2R A;  4HUF A;  4W5N A;  3KKR A;  3WUH A;  2E1Z A;  3ATV A;  3EKS A;  4XIU A;  3HBT A;  3OYK A;  2RHK A;  1T05 A;  4PWD A;  3KJV A;  4PKI A;  1EX4 A;  4BRA A;  3W3D A;  4DR7 K;  1E4F T;  1WAF A;  3VQD A;  3E66 A;  4F9O A;  4M7Y A;  3NGI A;  3C7N A;  4CZK A;  2G8F A;  4DSF A;  5AQY A;  2O8E A;  3UKR B;  1BL3 A;  4Z4C A;  4B3M K;  4W5Q A;  4I2Q A;  2HHV A;  1NGH A;  3HP6 A;  1JL1 A;  1NU0 A;  5SWM A;  3A2F A;  3SNN A;  4CFD A;  1XI1 A;  1TYQ B;  3THW B;  4DV7 K;  4BWJ A;  3SPY A;  1QQM A;  1KTQ A;  3R8E A;  4DCH A;  2O4I A;  5BPN A;  4FJ7 A;  2W41 A;  5HRP A;  4DV2 K;  3TU5 A;  2NRW A;  4N56 A;  3DLG A;  4AM6 A;  1TKX A;  4CVN E;  1BQN A;  5C10 A;  3TSQ A;  4JRQ A;  4FXD A;  1BCO A;  2GWJ A;  4ZHR A;  1JCG A;  1ZBS A;  4IFV A;  3SUN A;  1SZ2 A;  3H1V X;  2Y1J A;  4OLB A;  4LH4 A;  4CJ3 A;  1NMD A;  3CER A;  1RT6 A;  3UE5 A;  1BOT O;  1GLL O;  3CIP A;  3M8S A;  1NGA A;  3DLR A;  4KI6 A;  3O3H A;  3KZB A;  3K2P A;  1KAZ A;  2HST A;  1JLE A;  4JV5 K;  4IDH A;  3K9J A;  4WCE L;  5AQW A;  1U45 A;  2RN2 A;  2BTF A;  4I6M A;  2QM1 A;  4LFC K;  2X78 A;  3U4L A;  4HWI A;  4R5P A;  4FJ8 A;  3P31 A;  1LWE A;  4WF9 L;  1QSY A;  3ZSV A;  3NF9 A;  4IKF A;  1O1W A;  4QS7 A;  3ZET B;  1U49 A;  2Z1J A;  3QFP A;  4H5W A;  3VEX A;  3J7Y P;  1OVQ A;  4CHO A;  4FWK A;  5LY3 A;  4JKG B;  4FJN A;  1CXU A;  3CQX A;  2E1Y A;  2O8C A;  4H0V B;  1HNI A;  4FL9 A;  1GLE G;  3CCQ N;  1KCF A;  4ELV A;  4FM1 A;  3P39 A;  4WQ5 C;  4BQL A;  3RRG A;  1NJY A;  2D4W A;  4C23 A;  3TAQ A;  4BR9 A;  1O13 A;  4H0Y B;  4A57 A;  3HT3 A;  4X65 K;  4B3R K;  4BE0 A;  4IEE A;  1UWB A;  3SJH A;  4MDA A;  2FF3 B;  4M41 A;  4FCY A;  4KHQ A;  1YTU A;  2YI1 A;  1XHX A;  3HK2 A;  3D2E A;  5AQR A;  2HHT A;  3V9X A;  4J8F A;  4B9T A;  4DS5 A;  2PAV A;  1KC8 O;  1Q81 O;  4OPK A;  4GVE A;  4CI6 A;  5JVH L;  2P9K A;  1VSD A;  4DTP A;  3RWU A;  2NRX A;  1TK8 A;  3AA2 A;  3DLB A;  5JVG L;  3OS0 A;  2UXC K;  3J7A P;  4KRE A;  4CER A;  3DAW A; 
#chains in the Genus database with same CATH homology
 1QZ6 A;  4CBU A;  1BWF O;  2BH1 A;  3DXK B;  5C2D A;  1K8K B;  3TPQ A;  2Q0U A;  1KAX A;  3BF3 A;  4IOX A;  2P9N A;  3KWI A;  5AQK A;  5AQX A;  3BUZ B;  3K9K A;  4KH5 A;  1ESV A;  2VGM A;  5AQZ A;  5M1F A;  5DM6 L;  2ZGY A;  4CZJ A;  5BN8 A;  4BQZ A;  4Z94 A;  5BRD A;  1H1V A;  3DXM B;  2YJE A;  4QS8 A;  4BR2 A;  2KLA A;  3M1F A;  5GIO A;  5C0Y A;  1V4S A;  5CHI A;  2E2Q A;  1VQL N;  3ZET A;  2E2N A;  4U7B A;  3MCP A;  3P38 A;  4MLH A;  3JS6 A;  1NWK A;  3CF5 L;  3G71 N;  2A3Z A;  4B1X B;  4RWT A;  4JKG A;  4BC4 A;  3GE1 A;  3WXM B;  1LOT B;  3LDP A;  3EE9 A;  4BRO A;  4JKE A;  1SAZ A;  4BRI A;  2E8A A;  3EKU A;  2HF3 A;  3A5M C;  2QWR A;  3ZX2 A;  4FWQ A;  3QBW A;  4IJA A;  4BRH A;  4WFA L;  2GUP A;  4E1J A;  3MWT A;  3ZEU A;  1S3X A;  2WC9 A;  2YHX A;  4FO0 A;  1HKC A;  3JXU A;  3KWG A;  4JHD B;  3TTD A;  1T44 A;  2P9I A;  4NB4 A;  3VTI A;  3S41 A;  4B1Z A;  4BRE A;  5KQD A;  4B1V A;  5AZJ B;  5FPD A;  5DM7 L;  5F2R A;  1BA1 A;  2VGN A;  5LJV A;  1C0G A;  2ZF5 O;  3DWL A;  3FLC O;  5EXW A;  3LL3 A;  1BG3 A;  3TSP A;  1Y64 A;  4QS9 A;  4PKH A;  1QZ5 A;  4A5B A;  4WFB L;  4FWL A;  1VQP N;  3HM8 A;  3SAH A;  4XH1 A;  2CH6 A;  3E1Y A;  3GDQ A;  5JMV A;  3QB0 A;  4IOC L;  1Z05 A;  4BRF A;  5AQT A;  4GV9 A;  1HLU A;  1V4T A;  1KXP A;  5GIP A;  3CQY A;  3QBX A;  2P9U B;  2A6A A;  2AP1 A;  2FSK A;  3E9L A;  3ZX0 A;  4IXC A;  1MDU B;  5BN9 A;  3WT0 A;  2QA4 N;  4CD1 A;  3O8M A;  5AQJ A;  3ULE B;  3LDO A;  4BR5 A;  1M1K O;  4H0X B;  1NGD A;  5HOO A;  2GEL A;  3A5N C;  3VET A;  4EHU A;  1S72 N;  3HZ6 A;  1GLD G;  3OA9 A;  4WYB A;  3DXK A;  2HMP A;  1YIJ N;  3I8B A;  3CME N;  3L4I A;  4YDU A;  2FF6 A;  5BPM A;  2OTL N;  3J8A A;  3MWP A;  4JKF A;  4AM7 A;  1S22 A;  1X9J A;  5BPL A;  3J7Z O;  3BEX A;  4CZL A;  3I55 N;  3RSE B;  4A62 A;  4DQ8 A;  4YDU C;  3DXM A;  3OBY A;  3VEN A;  4FWO A;  3WEE A;  2QWP A;  1HKG A;  2GTD A;  3A5O C;  5AQH A;  3VGK A;  1WUA A;  1ATN A;  1EO1 A;  4B9Q A;  4YOX A;  1P8Z A;  3ID8 A;  3O5B A;  1ATR A;  2NNW A;  3ZYY X;  2QXL A;  4YOV A;  3HSC A;  1VQ5 N;  5JLF A;  2ITM A;  2QEX N;  2NLX A;  4XEI A;  5AQI A;  3E9O A;  3EL2 A;  4IEI A;  5KQ8 A;  3GOI A;  3CCL N;  4BY9 C;  3D2F B;  4C1N K;  4OO1 J;  3VGL A;  2Q31 A;  5EOY A;  5F0X A;  5GIN A;  4EFH A;  2P9I B;  3IMX A;  2QWQ A;  3DJC A;  3W0L A;  2IVO A;  1U6Z A;  2V7Y A;  1HPM A;  3KVG A;  5AQQ A;  3C6H A;  1U2V B;  1SQK A;  4PL7 A;  3TSU A;  4ISE A;  1CZA N;  3CHW A;  3D7E O;  3O08 A;  2QWN A;  5AQV A;  3O6W A;  3OBW A;  1RGI A;  5AZJ A;  4FWN A;  1MWK A;  2FSJ A;  1C0F A;  1NLV A;  1GLC G;  1QQN A;  3H45 C;  4BGB A;  3CCS N;  4JKC A;  2HBK A;  2IVN A;  4MO4 A;  3CJ1 A;  3H6E A;  4AF1 A;  4CZE A;  3AAR A;  2PFU A;  4BVP A;  4IO8 A;  2A41 A;  2HF4 A;  2YCH A;  3BF1 A;  4B1Y B;  5BRE A;  3L0Q A;  1ZXO A;  3NMU A;  4U67 L;  2P9U A;  4BRG A;  3CPW M;  3QML A;  5H1S Q;  1QHA A;  3ULE A;  1ATS A;  2QWL A;  3HI0 A;  3WXJ A;  3KHY A;  1K8A O;  2GWK A;  2KHO A;  1N8R O;  2OTJ N;  3VTH A;  1BA0 A;  4A59 A;  2D0O A;  3FE1 A;  4GY2 B;  3WXK A;  1KD1 O;  4BGA A;  2P9P B;  3EE8 A;  4JKA A;  3CET A;  3WEE B;  2QWM A;  4FSV A;  3RSE A;  4JNE A;  3IKM A;  4LC9 B;  5JLH A;  4IJN A;  2FSN A;  4BRM A;  3GG4 A;  2Q1N A;  3VEW A;  5BRF A;  3U9D A;  4GV6 A;  5AQU A;  3RVC A;  3E9P A;  4BR7 A;  4MLE A;  3CXC M;  4FOI A;  3BP8 A;  4KBO A;  2NZT A;  4FWP A;  2NRV A;  4PL8 A;  3MK6 A;  5EVZ A;  1HUX A;  2CGL A;  1RDW X;  1NBW A;  3VER A;  3SLC A;  4BC3 A;  4IWV A;  5AQP A;  2ZJP L;  3CC4 N;  3D2F A;  4GNI A;  4PHT X;  4DB3 A;  1R59 O;  4NLC A;  2EWS A;  1GLB G;  2D1K A;  2VCP A;  3SBG A;  4JK8 A;  1HX1 A;  3GL1 A;  1OKJ A;  1U2V A;  2YHW A;  3R6M A;  4ILG B;  4MO5 A;  2ZGZ A;  3AGR A;  5JIC A;  1YXQ A;  1DEJ A;  3FR0 A;  4ISG A;  2FLO A;  2I7N A;  3ATU A;  3VPZ A;  3HTV A;  5GAH P;  2WBN A;  2YJF A;  4C1N I;  4CD3 A;  4EIA A;  3H46 O;  3OW2 M;  2P9L B;  2JWK A;  3QDK A;  3CJB A;  1SS6 A;  3FFK B;  3VF4 A;  2JWL A;  3UKU B;  3MN6 A;  5B8H A;  2PBD A;  1RDU A;  4JD2 B;  3O1W A;  5ADX A;  1TUU A;  3A5L C;  1GLF O;  3SAF A;  1T6D A;  3SMS A;  1YAG A;  2ZWH A;  3CC2 N;  2A40 A;  4FWR A;  3FGU A;  2A42 A;  3R9P A;  1XC3 A;  3B8A X;  4M7X A;  2GX9 A;  3VF6 A;  1VQM N;  1XUP O;  5KPT A;  2P9S B;  4L3Q A;  3CCV N;  1DGK N;  3L4Q A;  4MDB A;  2AA4 A;  2VWB A;  2E2P A;  2P9P A;  2WUS A;  3ENO A;  3CCJ N;  4KH6 A;  4A5A A;  4KH4 A;  5F1X A;  1YI2 N;  3EO3 A;  3VEZ A;  3O9U A;  4JKH A;  1MWM A;  1X3M A;  3C7N B;  4JN4 A;  2ASM A;  5HL7 L;  2HBL A;  3LDL A;  3Q7B A;  3O1B A;  1VQO N;  5C12 A;  5KPR A;  3PIP L;  3I56 N;  3SMP A;  1NM1 A;  1DKG D;  4H0O A;  4IFE A;  4H0T B;  3UKR A;  2RE2 A;  1OVY A;  2Q97 A;  3VGM A;  3G25 A;  4BRN A;  4BC2 A;  1HJO A;  4JK7 A;  3G4S N;  5AQF A;  2A5X A;  2CGJ A;  4CJ7 A;  2UYT A;  2VYP A;  2HBJ A;  4ILH A;  2F9T A;  5AFU A;  1TYQ A;  4JK9 A;  3F2K A;  1BU6 O;  2E2O A;  3VOV A;  2Q36 A;  2WFB A;  3MX2 A;  3UB5 A;  5FPE A;  3CI5 A;  2CH5 A;  4BG8 A;  4K25 A;  1T6C A;  5ELZ A;  4YOW A;  4FPA A;  3VMF B;  4RCH A;  4HTL A;  1Q18 A;  4IOA L;  4K43 A;  1QQO A;  4DHY A;  1VQ4 N;  1DT9 A;  2H3G X;  3SAG A;  5M1K A;  3SK3 A;  4BVO A;  1X3N A;  3CPE A;  4FVU A;  3CD6 N;  3R1X A;  4G9Z A;  3FZH A;  4GV3 A;  3EZW A;  1JCF A;  2ZJQ L;  3C0B A;  3FZM A;  1M90 O;  2P9L A;  4NO7 A;  2CGK A;  3A8Y A;  3MN5 A;  4BR0 A;  4H0P A;  3MMV A;  5FPM A;  1GLJ O;  1YUW A;  1Z6R A;  4JD2 A;  3UKU A;  5KPZ A;  3AGK A;  5AQM A;  5BRH A;  1W2B M;  3A0I X;  2D0P A;  1ILY A;  4EAH D;  4PKG A;  3T69 A;  1VQ8 N;  5E84 A;  3LM9 A;  1YF5 L;  2Q2R A;  4WFN L;  3M3Z A;  1NGE A;  4K42 A;  3WUH A;  2E1Z A;  2HBM A;  3ATV A;  3EKS A;  3HBT A;  3HRG A;  2RHK A;  3R3L A;  3QFU A;  1BO5 O;  1K9M O;  1QVG M;  1VQN N;  2P9S A;  2NRT A;  4PKI A;  4I6M B;  1VAZ A;  4JKD A;  4BRA A;  5BR9 A;  3W3D A;  4FOE A;  3WXL A;  2ASP A;  1E4F T;  4H5T A;  3E66 A;  4F9O A;  1VQ9 N;  4M7Y A;  3IDH A;  3WXI A;  3PIO L;  3C7N A;  4BRD A;  4CBX A;  4CZK A;  5ADX H;  5AQY A;  3UKR B;  3L6Q A;  1G99 A;  2J4R A;  4O5F A;  4WQ4 A;  1KQS M;  2I7P A;  4R79 A;  1VQ6 N;  1NGH A;  5AQG A;  3VEY A;  3SBT A;  5GAE P;  3DLL L;  3M5R A;  4IZ9 A;  1NGF A;  1VQ7 N;  3C6A A;  5M1N A;  4BRQ A;  1TYQ B;  1NGJ A;  4WQ4 C;  1YJ9 N;  1T3V A;  1RFQ A;  2F9W A;  2YHY A;  2HOE A;  1QQM A;  3H3N O;  1LCU A;  3MN9 A;  3R8E A;  4DCH A;  1Q86 O;  5BPN A;  2V51 B;  3I33 A;  2W41 A;  3VEV A;  3CJA A;  3TU5 A;  3M6G A;  2NRW A;  1Q7Y O;  4AM6 A;  4CZH A;  5C10 A;  2E20 A;  1NJI O;  3VEO A;  1TUY A;  2Q0R A;  3TTC A;  1YJW N;  3U8X A;  3TSQ A;  4CZG A;  3CCM N;  4CBW A;  4CZI A;  4H5V A;  2V52 B;  2GWJ A;  4O8U A;  1JCG A;  3AAP A;  5M1O A;  5AZI B;  1ZBS A;  1IG8 A;  4O8K A;  4FWS A;  1SZ2 A;  3H1V X;  3VES A;  1YHQ N;  4RTF D;  4EHT A;  1JJ2 M;  4UY8 O;  5GAD P;  2F7T A;  4B1U B;  4YOT A;  4BRK A;  2ASO A;  2NRR A;  1WOQ A;  1NMD A;  4B1W B;  3MN7 A;  4YOR A;  5C2F A;  3CER A;  3D2E B;  3UE5 A;  2IVP A;  4H03 B;  1P90 A;  5I9E B;  3O9R A;  5AFU H;  1BOT O;  1GLL O;  1ZC6 A;  3CIP A;  1NGA A;  2NRH A;  2KKZ A;  2FXU A;  3LDN A;  2DPN A;  1NGB A;  4M63 C;  5M1P A;  4BR4 A;  3MCA B;  2P9K B;  2IIR A;  2NRZ A;  3CMA N;  3KZB A;  4OPH A;  3OHR A;  1KAZ A;  3GBT A;  2HST A;  1BDG A;  4IDH A;  3F9M A;  3MDQ A;  4BRL A;  3K9J A;  3TTF A;  4WCE L;  3N4Q A;  5AQW A;  3HOT A;  5TKW A;  5TKY A;  1YVN A;  2BTF A;  4JKB A;  3NVM A;  1K73 O;  1NGI A;  3C65 A;  4ILJ A;  4I6M A;  2QM1 A;  2OAN A;  4BG9 A;  4YOY A;  1BUP A;  4H5R A;  3CCU N;  2P9N B;  3T7Z A;  5AR0 A;  3O4W A;  3U4L A;  4HWI A;  1K8K A;  1QVF M;  3P31 A;  5AQN A;  4K41 A;  4WF9 L;  4JAX A;  3P4I A;  4QS7 A;  4A61 A;  3ZET B;  1KAY A;  3AAQ A;  3QFP A;  4H5W A;  3VEX A;  4FWM A;  3IUC A;  4CZF A;  1MA9 B;  5EX5 A;  4FWK A;  4IO9 L;  5MLC Q;  3HOS A;  5CE3 A;  5LY3 A;  2QW9 A;  4JKG B;  3CJ7 A;  3G6E N;  3ID6 A;  4WQ5 A;  4XH5 A;  3CQX A;  4A2A A;  3QIC A;  2E1Y A;  5E26 A;  4H0V B;  3AY9 A;  3CJC A;  3LDQ A;  3FZF A;  2QWO A;  3LM2 A;  1GLE G;  4FL9 A;  3ZX3 A;  3CCQ N;  3CC7 N;  3NVK A;  1Q82 O;  3FZK A;  3MX5 A;  1VQK N;  3P39 A;  4WQ5 C;  4BQL A;  3CCR N;  3ENB A;  3N4P A;  3F5T A;  3O9T A;  1HKB A;  3ZEU B;  2D4W A;  4C23 A;  4BR9 A;  1NGG A;  3H1Q A;  3CCE N;  2ZJR L;  1O13 A;  4H0Y B;  4A57 A;  2V7Z A;  5AQS A;  5EY4 A;  2QTD A;  3D6R A;  4ISF A;  3U9Z A;  4A2B A;  2GEM A;  5AZI A;  4IEE A;  1YJN N;  3SJH A;  5AQL A;  3PLA A;  4CZM A;  4H5N A;  2BUP A;  2QI2 A;  4MDA A;  2FF3 B;  4JHD A;  1JCE A;  5M1Q A;  3IFR A;  5CR4 A;  4DKW A;  2YI1 A;  2YX6 A;  3D2E A;  1J6Z A;  5AQR A;  3VF2 A;  1YIT N;  1IJJ A;  5FPN A;  3O80 A;  4J8F A;  3FZL A;  3EN9 A;  1E4G T;  4XH4 A;  2PAV A;  4OPA A;  3CJ9 A;  1NGC A;  3WQT A;  5LJW A;  4Y0W A;  3O9S A;  1D4X A;  1Q81 O;  1KC8 O;  4BRC A;  5GAG P;  4FPB A;  3Q7C A;  4GVE A;  1XQS C;  4NLB A;  3KK7 A;  2P9K A;  4CI6 A;  4YOU A;  4BC5 A;  3O9Q A;  3WQU A;  2NRX A;  5JVH L;  5AQO A;  1W97 L;  4JEP A;  5JVG L;  1EQY A;  4BRP A;  1GLA G;  3H3O B;  3ENH A;  5C15 A;  2E88 A;  2W40 A;  3DAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...