1W9FA

Cbm29-2 mutant r112a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
144
Chain Sequence
VRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDAIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
molecule keywords NON CATALYTIC PROTEIN 1
total genus 27
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w9fA00
2C24A 1W8UA 2K46A 4CPBA 4LK7A 3ZYBA 1HN0A 4A6SA 4BQ2A 2O14A 1GWLA 2KR2A 4AL9A 4BQ3A 4BQ4A 5D21A 4CP9A 1W8TA 2JWPA 3UT0A 3ZYFA 2Q1FA 4YW6A 4YWAA 4LJHA 1W9FA 2LROA 4BQ5A 1WCUA 3F95A 4CPBD 2LRPA 1OH3A 2WYFA 4LKFA 3ZYHA 4LKDA 4CP9B 1GWKA 4LKEA 1W90A 1V0AA 1OKOA 1W8WA 3ORJA 1WMXA 4LK6A 1GWMA 1UOJA 1WZXA 4YW7A 2VXJA 1W8ZA 1L7LA
chains in the Genus database with same CATH superfamily
5F5IA 4Z2AA 1W6MB 3JB4C 3LFMA 1TE1B 1CX4A 5HV0A 3S57A 2HBUA 2PHUA 2DBIA 2F17A 3T4VA 1MZEA 3WP3A 2ZXQA 5FP7A 4UBGA 2WWJA 4Q8KA 3ZIWA 4BB3A 4OMCA 2AACA 2YFZA 2VZRA 4NE9A 2JG9A 1F2NA 2Q0AA 1S0GA 4AQTA 1MS8A 1X9PA 2WZR2 3UJQA 4C90A 2IXLA 1W6NB 2YB7A 2RDSA 3JUUA 4LBKA 5JZGB 3OGVA 2YXSA 1DGWX 2VJXA 2J22A 4HG6B 2R0HA 3BOWA 5HCHA 4ZS3A 2W47A 4JGZA 2WNUB 3EJKA 3P5BA 1R083 1W3VA 5FMOS 3QD6A 4Q0UA 3I49A 5LA1A 2GDFA 4LBQA 4WV8A 2ILMA 2J7MA 3G6JB 4GULA 4NMIA 4QM9A 1V70A 3O12A 3O1RA 2ZX4A 1QNYA 1SHWB 1HJGA 3JXSA 4TWTA 4E2QA 2WNUC 1SQ4A 1UYPA 4MGYE 1MZ6A 3H3UA 4BMEA 2ZHNA 3IMMA 3NNFA 1FI2A 2VZ3A 2ZGRA 1D4M1 1CN1A 3B93A 4UFJA 4YWAA 3WSOA 4QKBA 4AHZA 5E88A 3OF1A 4D7TA 1UF2C 2RDQA 3MLKA 4WVVA 1DCSA 4RR3C 3VBHA 4XE9A 2VL4A 4XJUA 3ZFEB 1ALYA 4UF0B 3AK0A 2E7AA 2WO2A 5GZEA 2CV6A 2ADEA 4PIZA 4UFHA 3VGIA 4PI2A 4GB32 3THCA 4COZA 4NRMA 3E1F1 4UXAA 2RJLA 2I07B 3HMYA 4G3YC 4DFSA 4R4ZA 1ND2C 1HXS2 3WW1A 5L19A 1AYN3 4QGLA 5FZ0A 1HN0A 4I3PA 3O0WA 2YHJA 4YM0A 5CADA 2BGOA 1A6CA 2ZTNA 3I3DA 4LLFA 2XQXA 4IV3C 3RJRA 3RZMA 1OQDA 4XUNA 4CCNA 2RDRA 3HVDA 2WJSA 4RFRB 4LULA 4DUXA 3GF6A 1OUXA 4AWDA 4XDQA 1LAJA 2W1SA 3CMGA 4AR2A 1CZVA 1YJLA 3MEPA 1AR83 4NPMA 3F95A 1BMV1 2WO7A 3CJIA 3UNPA 3ZYPA 4WVZA 2VMGA 2XJUA 5C4WB 3SQOA 4AI3A 5LBCA 3NL1A 3O1SA 3WUDA 5B4XA 1CAVB 2QVSB 5JR7B 2Z2SB 5JZGA 2D7FA 2GMEA 4YGBA 4I09A 1N1YA 4EN0A 1W8UA 3KT1A 5BNOC 5KHHA 2ZX2A 1DF0A 1G86A 2DV9A 4NJ4A 4MXVA 1JU4A 5T54A 2FQPA 3NQHA 4K20A 2HEYF 3U14A 2V4VA 2ZOEB 2PYTA 4CCMA 1AVBA 1LHVA 5I8TA 5L7OA 3W5NA 2C5DA 1MEC3 1VBD3 2HWC3 4M3CF 3RPQA 3FL7A 1PGL2 1UN1A 2Y6FA 1ZRRA 3WG3A 1UO9A 1EY2A 2YY1A 2Q8CA 2BNOA 2R071 3MBWA 4HSLA 4FAGA 1YYNA 3KZ4C 2AYHA 4IEPA 4OZOA 4Q0VA 4QX1A 1W2AX 3THDA 2VBDA 3W20A 2JD4A 2NLRA 2WSVA 3AL6A 4ES9A 4Q0SA 1KS4A 5B2GB 3AJZA 1Y7BA 5FFOC 4YW3A 1RVF3 4OZXA 5BNNC 2VBBA 4HBNA 1ZZBA 4MGSA 4EWDA 1S0FA 1X82A 3ILFA 4AEDB 1O8PA 4CUCA 4YM3A 5C71A 1MS0A 1M06G 4NHXA 4IE5A 1AR63 1RUD1 1VBB3 3PIJA 4DRVA 1EYBA 3AC0A 1K42A 3NJYA 3K4ZA 3MI8A 1W9TA 1YJKA 4CVUA 4HVQA 1Z7S3 2J1UA 4UBHA 4Y1XA 2P2KA 2JB4A 5GLUA 1EP0A 5DMYA 1H2LA 1OSGA 3NV1A 2E33A 2VCCA 1FOD2 4RGGA 5EQUA 3VKMA 1GWMA 4X6QB 1QJX3 1BXHA 1GQHA 3CZUA 1QKQA 3WW3A 3KCCA 5A1LA 3CKHA 4QAWA 4AZZA 2ZX3A 2CSGA 1O6UA 1OUSA 2XMLA 2KD7A 5E16A 1RMU2 2XHNA 3VDDB 3C2UA 4K3UA 1GNZA 1ZRCA 1NA1A 2ZBJA 3U75A 3NKGA 5JOYA 3GBWA 4U36A 1PMHX 4Q8LA 3KB5A 3AZYA 2V09A 4UYBA 4Q0QA 2K0GA 4RGAA 2WSUA 5LY1A 4WM8A 1QQP3 4PJYA 2YBKA 2G9GA 4OUMA 1MS9A 1WLCA 4RS5B 1UKRA 1OXCA 2GC3A 1U0AA 4FFFA 5EIYB 2B8MA 5K0UC 2OUJA 1PK6A 1QHDA 3MW3A 4NWVA 4OI1A 2RVAA 3H7JA 3KS7A 3S7EA 4CP9A 5A33B 2VOVA 3SITA 2FMDA 3RFRA 2JE8A 2ZGQA 4YM1A 4QB1A 4UW4A 2A5ZA 1POV1 5A7OA 1PIV3 2Y60A 3PVBB 1SLCA 1Y4WA 2YBSA 1C1LA 1ONAA 1WW5A 4XPVA 1W6OA 5BXXA 5L73A 3I3QA 5KXCA 4BZ4A 3THTA 2FBEA 3RGBA 3C7GA 2QZ3A 3H8UA 3ACFA 2ZEWA 4LOTA 1K5MC 3D6EA 2H0BA 4XJWA 1NCQA 1WCUA 3I3BA 4R8HA 5FYHA 1O59A 3JZVA 4LXLA 3VBFA 5FWJA 2ARAA 4AFDA 4QGMA 4XC9A 1UYYA 2PHFA 2WYSA 3B01A 3AMPA 4Z1VA 4YW7A 3SMHA 1UZWA 5FDBA 1G9CA 1RUF2 5FYMA 3MO4A 4CCLA 1RUE3 3N7KA 4KWLA 4MVTA 1RUOA 1PK6B 4HN0A 5IVJA 5JXGA 4RS5A 3A22A 1ULFA 4K9SA 4Q4X1 2E53A 4N43B 2GC2A 3JBG2 1Y43B 1PGW2 2RS52 4JGYA 3LPGA 3N9NA 3KGZA 2BGCA 4YW2A 3ZIXA 1W03A 1JYIA 2JDHA 4FPKA 2WNUA 5T55A 1XYOA 1ULEA 3LSDA 5K7PA 1RYYA 4RHV1 3WHTA 4YVSB 5F3CA 1SDWA 1V6NA 1EUUA 1W8WA 3L2YA 4OUEA 1YI7A 5CFCB 4PLNA 4AVCA 1SLLA 5A1AA 4JHZA 4KG0A 4Y1VA 1TEIA 1UU6A 3H50A 4YZ2A 1US3A 2DBNA 2XJRA 3ABZA 4PIXA 2EICA 2QDRA 3D3AA 1ND2A 4YZ1A 2QZ2A 1RXFA 5IUQA 5GLZA 5KXBA 1CZSA 4CEWB 1NG0A 5FPXA 1RUI2 2Z4FA 2IXJA 4ZPIA 2YBPA 4XIKA 1CAXA 2RS13 5LEKA 2MPFA 3NV4A 1OH4A 2JG8A 3GGLA 1QOSA 3T2QA 3DYOA 1V9U2 3P3PA 2ZGOA 5FPLA 2JDKA 1CAWB 3DKQA 3ILNA 5AVPA 1UMZA 3POFA 3ZXFA 4XDPA 4BA6A 1HQWA 5CBLA 3MUZ1 4QQHA 1UPSA 3VBOC 1AR93 5DUVA 5FYUA 2JDZA 3NAPB 4HL0A 3AKRA 3AXDA 1RHI2 1DQ1A 3A4UA 1VRH2 3KQ4B 4BQ2A 4URAA 1H9PA 4BIFA 1NT0A 4FP3A 2BERA 2D3SA 3POWA 4FXKB 4IERA 1H4HA 1HRV2 1WA4A 2XGXA 4HVOA 1AX0A 4ZU5A 3T2PA 5L9RA 5FYZA 1OURA 1NQJA 3HBZA 1PGSA 3KSCA 4XJAA 2AR6A 1QJX2 1GOHA 2OIIA 2QQOA 3O14A 1CAXB 4XFGA 2FCVA 4YW4A 4CDXB 1A34A 1FOD3 3BKZA 4XURA 2VMHA 4LBMA 3GJBA 3AP9A 2EAKA 3MYXA 2VG9A 1JOBA 1R1A2 1RHI3 2WA3A 2CTVA 5BNPB 3OBAA 1V00A 4LK7A 1R093 2VZQA 5ERLA 5I0DA 4FQ4A 4QGNA 3C7OA 2VR4A 3MDPA 4CDWB 1W05A 2R1DA 4A6SA 5CFDA 1HB1A 3FHQA 5F7UA 5FP9A 4DQAA 4XCAA 1RVF2 1CPNA 3N7JA 4B1MA 2VTFA 1URXA 5A3UA 4IXLA 4BU2A 1JTZX 2BGPA 1AL0G 2DVBA 1AX1A 3BYWA 2UYBA 4W6WA 3JB8A 3JU9A 5IW0A 4FXGB 1WLDA 5C3QA 3GM8A 1ODNA 3I2KA 4I0BA 4NRPA 3WXPA 5DPNA 4TTGA 4NIDA 2XONA 5FOBB 4CU9A 1QDOA 1W0PA 4XQDA 2PELA 4XAAA 4NHYA 1AL21 5F37A 1RUI3 5IWFA 2Y6KA 5F3EA 1VIWB 5DZGA 4WVWA 5FZEA 3TEYA 2GAUA 4ONUA 3H0OA 2HJIA 3FLTA 3WG1A 5C5UA 4OQ9A 2VTXJ 4LLOA 2C9AA 4P9GA 3CHXA 2JDYA 1GWLA 4KQ7A 2A1XA 1AF9A 1YFWA 2W94A 3IPVB 4JRLA 3ZFEA 1RUG1 2DVGA 4QD2A 1H8VA 4J6GA 1OQEA 3RYPA 4CDXA 4DO0A 4AW7A 2BZDA 4DMIA 4QX2A 4Q5OA 3UETA 2XBO2 3WQ7A 4HOOA 3HNYM 1HB3A 2AZ5A 4D7SA 3QLQA 1V6KA 1RUNA 2QQKA 3AYCA 3IDCB 4FOQA 1D2SA 3T1LA 3POEA 1C5IA 1OFNA 4RN5A 3I4IA 5JWPA 3BUCA 5FBZA 4JCKA 5BNQA 2VZVA 1CQ9A 2CAVA 3OPZA 3ZN6B 5C5TA 3QCWA 5JLVA 4JTNA 4PHZA 5FXXA 3ZXDA 5GZCA 1GQPA 1EPWA 4LBQB 3MF6A 2VVDA 1GU3A 5IAVA 3TAYA 4PQ9A 4WVMA 4J1WA 3WNXA 4AVTA 4D7YA 5A70A 1YFXA 1I5ZA 1QOTA 4Q29A 3CL1A 4QXKA 5JSRA 5FY7A 2DURA 3PJYA 1W28A 1F15A 4NHKA 1CIWA 3HBKA 1YHFA 4Y1YA 3D5OA 4FVVA 4Z82A 3VDBA 3IIAA 3Q8FA 3I54A 3DPRA 4HFSA 1UZZA 4QB6A 4HKWA 5ANNA 2XJSA 2JG8B 3NAPC 3HJRA 3ACGA 5FZ9A 4IEZA 1J1LA 2EA7A 3KHCA 4IL7A 3VBUC 2JICA 1PIV2 3K4DA 1KS5A 5CG8A 1UOFA 2DCYA 4ZHNA 3ZN4A 2C24A 1ZRDA 1F35A 2VVEA 2Y64A 3EO6A 3KMHA 4JGYC 3SC7X 2PHRA 3ZYIB 5CFCA 1Z78A 2J1AA 3D82A 1FYUA 3UGGA 2WZPP 2BVVA 4YVSA 4BQXA 4NUBA 4QPWA 4MG2A 1F4AA 1LHNA 3DPRB 3FLRA 2XKOA 4D3WA 4LJHA 1DGRA 1QJY1 4MGIE 5A80A 3MW2A 4BDVB 3RZKA 3H1WA 5C8CC 1GZWB 4X6RB 2UWCA 1R091 4QHOA 2VM9A 1RMU3 1Q3EA 1QGLA 1ZRFA 2D43A 4K8RB 3O1PA 1BQPA 2HWB2 3ZN6A 2VY0A 2VW1A 3TNPB 2X5IA 2VW2A 1K5MB 3APBA 2W92A 1D0GA 2C9KA 4PLMA 1CIYA 3KLSA 3MIBA 1SCSA 1WMEA 2YMZA 3VBHC 2X10A 4Z2WA 2H6CA 5FY8A 1KEXA 4LO7A 4EZ4A 4G4FA 1SLBA 2B45X 2R32A 5CKQA 2H6BA 5IVBA 3U0ZA 3WF4A 2WA4A 1AR62 1Q8PA 3OTFA 4CCKA 1JOPA 4PF1A 1HXS3 1QNWA 4RQPB 1JZ5A 4FO9A 1VBE3 2PQQA 4HN1A 1XOYA 5CA6A 3VV1A 2AEZA 1WCQA 2PFWA 2BEOA 4W4ZA 2D6MA 4S2FA 4WZCA 3B9CA 3LA3A 4F3JA 2ZMLA 3GBFA 1UKGA 3Q8CA 5IHRA 3MLLA 1CWPA 1J3RA 1LGBA 2XVKA 1REDA 4L2NA 4AVVA 2VZSA 4LOSA 3BCWA 1PZ8A 2DUPA 1VBA1 2RMU1 3P6BA 4OLLA 4WM7C 2ARXA 2ZEYA 1W2TA 4LHSA 1AR71 2RS11 3AVSA 2B4KA 1CVNA 5HXMA 5F6KA 1GP4A 5GLVA 1GWKA 2OZ6A 3POJA 1VBD2 1MEC2 1NA1B 4BXFA 3R4UA 3LFIA 4MUVA 1XYPA 3LEKA 2P3IA 5J09A 3VHPA 1XU2A 3QOPA 5ACA1 4XACA 1ZBE1 3U78A 3IMNA 3GYDA 1MACA 2HWF3 4XJ8A 4Q4W3 3SH4A 4EN8B 3X29B 5T5PA 4C91A 4UF0A 3AKTA 2RS31 3UL2A 4IW3A 1YUDA 3GBGA 1ZZ8A 5IK7A 2ZA9A 3W21A 1IKQA 3PIGA 2CGPA 1LHWA 2WZEA 2XOMA 3L9JT 4HZFA 3H8RA 2VNRA 1TNFA 2ZGKA 3AP7A 3O1MA 3BTXA 3UKVA 1AR82 1O4ZA 3EYPA 3I2GA 1PZ9A 5BNPC 1DQ6A 4JX0A 4NOTA 1UIKA 1BBT1 1ZZ7A 4W8JA 1RUE1 2JIGA 5GLTA 3VD7A 1FT9A 3WP6A 1OKOA 1MS3A 5F39A 2D44A 2ZX1A 1NY72 3EMRA 2XVGA 1H2KA 3C7EA 4N9IA 1AYN2 3FZ3A 5D8AB 3BODA 2YG0A 3O1VA 3LQCA 4IQPA 2WQ4A 1QH6A 5JOWA 1F9KA 4HT1T 4XDOA 2MEV1 4QKFA 5FZCA 4BOWA 3BVCA 4GB33 3WZ1A 1W6QB 3JQWA 2Z79A 2XDVA 1UXXX 5BNNA 3K2OA 4AHWA 5FZAA 2IUWA 2ZCWA 4YW6A 2JG9B 1SLIA 4LQRA 3GCXA 1LJ7A 3LWCA 5FZOB 5FZ4A 2QQNA 3JD71 4FT8A 1PNFA 3FFZA 5DG2A 1NLQA 3U4SA 4F7ZA 5ACA3 3IAPA 2AC1A 1F8VA 2UY9A 4YSFA 3DEMA 4QDRA 3VDAA 2ZS6B 4B8EA 5CFDC 3ALQA 1X33A 2Y0OA 5EHDA 4AE2A 3MGUA 2WNVC 3ES1A 5FRAA 4QKDA 5FZOA 1XE0A 4KI5M 4OULA 2XL9A 5FOJB 2G19A 4JKLA 1V6IA 4A7KA 5F6LB 1R082 2EIBA 5C9AA 5FZGA 2EXHA 2A71A 2YZ4A 1SDDB 2ARBA 3GCWA 4GD4A 3FX3A 4JGYB 2HWD2 5D8AA 3UJOA 2OUHA 4N43A 3JCIA 1DGLA 2BNNA 1QY4A 1WW4A 1J58A 5AC92 2MEV3 4JVAA 3ZXKA 2OQ6A 2OX0A 1F31A 3RMYA 1DLCA 1V0AA 1RITA 2VULA 4AFMA 4DXRA 3J8F2 3OG2A 5DAVA 2A70A 3M3OA 3VZMA 3IN9A 2WABA 4LA3A 4CCCA 2XWBB 4KU7A 3U11A 4MGQA 2WO1A 1UCXA 4JGZC 1PO13 3CBNA 4Z92B 1OLQA 2J1VA 1K5JA 2QBXA 1SACA 2ZABA 3KCXA 1BMV2 1DZQA 5J96B 5FXVA 5LK7B 1RB8G 2Y6LA 4AFCA 1DLLA 4Q1RA 1W9FA 2XUMA 3R6SA 3AJYA 4UT5A 3POSA 4XFIA 3VB9A 3LA2A 3KM5A 4OQ8A 2ZGPA 5LBEA 3ZLIA 4IESA 4XTMA 4Q4Y2 5LASA 4O7XA 1RUJ2 5FYSA 3DCQA 3WG2A 1KQRA 1FMD2 2E63A 4GH4A 4JV4A 3MV11 3TN91 1GFF2 1YQCA 3T4HB 1U5ZA 3LA7A 4D94A 3MIHA 3W58A 3LOBA 1SPPB 2DWRA 2IFWA 3CEWA 4YVWA 4YW1A 1TZOA 3IWZA 4FPHA 4XF3A 1HN1A 2DTYA 3H8OA 2LALA 4SLIA 1V9U3 4YVWB 1GP6A 2C0ZA 1JHNA 1AR73 5IK5A 2R043 3AZVA 3CO2A 1W6NA 2R072 2UY8A 4RGKA 1O4YA 3H1MA 1OLME 1OH3A 4IDZA 3K48A 2RR11 1LNSA 4FPYA 3O0XA 1PVXA 3Q8BA 3I8TA 4QKNA 5CAZA 3ZSMA 2E32A 5AFBA 4XYXA 1AYM2 1OA4A 4QB2A 3SCGA 3VBFB 3WDUA 3BTAA 4IE0A 4W6YA 3I2HA 1YXWA 4AK3A 2F4PA 4IEVA 4NIAA 2UWAA 3AZXA 1YLLA 3E5QA 3PUQA 1UIJA 5JSOA 2PQSA 3SEPA 1IS6A 1IHMA 5FZ1A 1BEV2 3VN4A 3NV2A 2W39A 2WS92 4MOAA 1M4WA 2DU0A 2W1UA 1EAH2 1RGSA 2BNMA 2D40A 2X5IB 2Y33A 3KF3A 4P5HA 4YG3A 3GJAA 3OBRA 4COVA 2I45A 2RM22 3EHKA 3GHMA 4H55A 1J3PA 4N8MA 2D3PA 4EN6B 4YGCA 5LA2A 2B9UA 1GZWA 1QJU2 2ZMKA 1RJ7A 1HJFA 1AXYA 1L3JA 1RUF3 2RG4A 5HV4A 1WD3A 2YU2A 2FHRA 2LUWA 3HNMA 5FZ6A 2B5HA 1LODA 2IVJA 1Y9QA 1L7LA 2W68A 4QXHA 4S2GA 4XVHA 1WUVA 5LB6A 5JDBA 3W5MA 5L9VA 5AFEA 2ZZJA 1WLTA 2J1RA 3OGJA 5FWEA 2FMYA 2KR2A 4AEJA 1RUG3 5CFDB 3B3QE 1NLSA 1I5PA 3FMGA 4XXPA 3S0MA 4M4PA 2YPDA 5CZKA 3KD4A 4NPRA 2VUDA 5HCFA 3WEZA 2ETEA 3KV6A 2P5BA 3ASIA 2WFF2 4Y5SA 3H3LA 3TB0A 4M01A 1HW5A 1VPHA 3VDCA 4DOUA 1S2BA 3I59A 1VE0A 4YFWA 4LKEA 3ZXGA 4XFBA 2GP3A 3WQ1A 4NHMA 3N35A 5E1RA 3ACHA 4ASMB 1XE8A 4LR4A 5BNOA 1CAVA 2VUJA 2WWSA 3ZO0B 1TMF3 3R0RA 4AFBA 2VMEA 4PBPA 2QCSB 1MS1A 4GKYA 1BCXA 4FOVA 4AAXA 3VD4A 4Y20A 1NA1C 2XJQA 3PVNA 3FWEA 2Y6HA 2AUYA 3DN7A 3DYMA 4CCDA 2D6LX 1ZBA1 2WDBA 4AOCA 3ZXJA 2EVXA 2W91A 1J3QA 2RS33 4OMDA 3T0BA 3WQ0A 2GP5A 2JD9A 5FKBA 3BIEA 2HWF1 5JCTA 4W65A 2IXHA 4MZUA 1IPKA 1ZBE3 4PDWB 1LEDA 4Q4V2 2RE9A 3M4FA 1GNHA 4EN7B 1SLTA 4XFCA 4XF4A 5JI7A 5LBBA 2X53S 1YQ8A 2IZWA 5C4WC 1LESA 1PGW1 3N36A 2VPVA 1LGCA 3ZXAC 5A3MA 4SBVA 1IPSA 4LIVA 4BMBA 1VB2A 1GV9A 2IXCA 4CUAA 3O7OA 2ATFA 1Z7S2 3ZYFA 5J36A 1DYPA 4FFGA 4FQZA 2HWE2 4IE4A 5EPAA 3SISA 4EZHA 3BN6A 3ZSKA 4D6QA 1VBB2 1JXNA 4P9IA 5LW9A 4YNIA 4IEXA 2A7AA 1IPJA 3VBRB 4AEMA 2F4LA 3AP5A 1AR91 3ZFFC 4KNCA 1WBLA 1DBNA 1QIQA 5JIUA 1GKBA 1VMFA 4ISRA 4X8NA 1DFQA 1OC1A 4XFFA 1RUC1 3OY8B 2RR13 3OSDA 5FJKA 5LA9A 1O3RA 2R061 3IT8A 4N90A 1ULPA 1W2NA 1W9YA 2PXJA 3LIGA 4KU8A 3MUY1 4EROA 1O5UA 3S5AA 1OMIA 3WP5A 4DY3A 5APAA 4Q2FA 5CFCC 5IAXA 3T09A 1V9U1 5C8CB 1G9DA 4E4ZA 3AX4A 1PX3A 4ZKTB 4TYSA 1IOAA 4BK5A 1F5FA 3LB9A 2OXBA 1A78A 3URFA 4M0HA 4EQVA 1Y9MA 2DUOA 2V73A 5CKNA 4YM2A 5A7PA 1YQ5A 1AJKA 5CISA 3WT3A 2QQLA 1AZDA 3TN93 5FR3A 4OFGA 3B02A 2GMPA 2JDMA 3LPFA 3OPWA 4ITCA 5DN2A 2QQPA 4GJZA 1QJEA 4W50A 4Q0PA 2VNGA 4CCEA 2BFUS 3PUAA 3PUHA 1RHI1 4EYUA 2D6KA 1RJ8A 2JDUA 4CYDA 5M0TA 3WDVA 1G9BA 2WKKA 4YGEA 5K0UB 2R0FA 2ID4A 1KFUL 5DZFA 4BQ3A 2VUAA 2XXZA 4CU8A 5H9SA 1KJRA 2Y26A 4LBOA 1FAYA 2IVIB 3D4KA 1GOFA 3IZOA 4KWUA 1QJY3 4QU1A 4QMAA 3ZFFA 5IK8A 1FNYA 1W8TA 2PMWB 4G9SB 3I2OA 1DGRN 2E6VA 1VAMA 2PN5A 2VMCA 2JE7A 3OCPA 1A8MA 2ZEZA 1JN2P 1WWYA 4CP1A 3FE5A 1N1VA 1ENQA 4KGGA 1JZ6A 3OOXA 5FV3A 3E6DA 3ZMNA 1G9AA 2FDIA 2JKBA 2C1FA 5C8WA 1OLMA 1S2KA 3FLPA 4NHLA 5J7MA 5C9AB 4WM8B 1I3HA 1LKNA 2QQVA 4CU6A 2EXKA 5JXHA 1OPOA 5C3OA 2GZWA 4DINB 3V0AA 4CEYA 4EWEA 3ZYBA 4Z8BA 5KXEA 2JE9A 5DAQA 4BJ0A 3DKWA 2FDHA 3GZAA 2QQWA 4L8QA 4P02B 2GSYA 2WLPA 4L0PA 2YC2A 2ZGTA 5EWSA 3QH7A 4JHTA 5IFTA 1W6MA 3WNPA 3ZFGC 3ZX7A 3AMNA 4BQYA 1OOPC 4K1YA 5C7GA 1OKQA 5CYYA 2PLV2 2BOIA 2WAAA 2ES3A 3RRDA 1BK0A 4GWNA 4OHWA 5I0RA 4AYUA 2XPJA 2BRTA 2YDEA 1UW8A 3CNAA 3VDDC 4A3XA 2R6QA 1TME2 4H14A 1H0BA 2W1WA 4X8PA 1AXKA 2B46X 3I2IA 4LBJA 2A6YA 1XRUA 4V2VA 1PVC2 1UOGA 5FAXA 4I0WB 2P6CA 4RHV3 1GBGA 2HLEA 5LRSA 1YQ6A 2VNVA 4A7YA 2VH9A 2FZ1A 4K1ZA 4JAAA 3HT2A 3SH5A 1WGPA 2WZR3 4CDQB 3H7YA 5DAWA 3T3YA 1TQ5A 3ITQA 5E8AA 2Q4SA 4Q4X3 4TLGA 2CYFA 5EYYA 4Y4YA 4OI0A 3VL8A 1UY0A 1PO22 3KV9A 1TMF1 4P00B 3VD5A 1Y9GA 1JYVA 3HD8B 2KXLA 1SMVA 2GNMA 4CUGA 5C33A 5IVCA 1POQA 3LKJA 3ZVXA 2WT2A 2PLV3 2VW0A 4CA9A 4LO5B 1UU5A 1AL23 2VO5A 5DG1A 2KM2A 5FQ0B 2BOJA 1HQLA 2W95A 1AX2A 3GNEA 3IDAA 3GZTB 3DYPA 5LRRA 4LIUA 2X09A 4NROA 1X7NA 3MIEA 1RUH2 1DQ5A 3HN1A 4LHKA 4YG6A 5EYXA 1LOCA 1UXZA 2XUEA 3D0JA 3LSEA 4P08A 2HKXA 4XQWA 4ARXA 2XL7A 3ZR6A 3KCYA 1W04A 1PX4A 4BQ5A 3V65A 5IVEA 1PIV1 2LRPA 4GIQA 1POV3 4CEWC 2EIDA 3NKTA 1RTVA 2NYYA 1JYCA 4GZ9A 1LHOA 5CNAA 5GALA 1NXMA 1S4CA 3TNQA 1ZREA 4KMQA 2P34A 2VECA 4IEWA 4IV1C 4RL7A 1W8ZA 1WA6X 3PUSA 4RR3B 1WBFA 4O65A 2VVFA 3HOBA 5FZ3A 1QEXA 4MGZE 3PVEA 1EV11 1V6OA 3OUJA 3FUOA 4DXTA 1L7QA 1N3OA 4MHRA 3AM2A 4NAMA 4JKMA 1QQP1 5JVVA 3ZXLA 3ZPOA 3INAA 1REEA 1NOVA 4MH0E 4AEKA 4YFZA 3U4XA 1KJLA 2JWPA 1I9RA 1C57A 1OBNA 3E5UA 2J1TA 1VBC2 3LCPA 2LS6A 1OVSA 5BNPA 1W0OA 3CJXA 1PM4A 3IDBB 1XNKA 1JH5A 4HONA 5EXOA 4B3NA 3UKTA 1KITA 1X9TA 2Y8KA 3B7MA 1D0HA 3ACIA 2EXJA 3VBHB 4ZU4A 1MR5A 1XPWA 2D6OX 4LBQD 1COV2 4YVWC 1NQDA 1QOOA 2BYVE 2PAEA 4FPOB 2V4AA 5GLWA 1REFA 4JDMA 3HAGA 3QBQA 4XCBA 2W0XA 3SLIA 4LBNA 1CD3G 3QACA 2W5FA 4QX3A 5JXJA 2OS2A 3E97A 3SCFA 3M8LA 3PURA 1TNRA 2LW8A 3GHNA 4XF1A 1DQ2A 4I0AA 3CIHA 3W9AA 5FZBA 4WZFA 4FPCA 2JB8A 4U2AA 5DDJ2 3SKJE 4EE2A 2R041 4N53B 1AR61 1RUD3 5EFUA 1GZTA 1WD4A 3ZYRA 1EV13 5LY2A 2YGMA 1WKYA 2GMMA 1GOGA 2YC4A 5FUPA 2GH8A 4QPYA 2VZOA 3T08A 3UGHA 4DS0A 1H8TB 1UMHA 4E2GA 3ZYGA 2JJ6A 4BXSV 1OF3A 1C4RA 2XB6C 3JD73 2RMU2 1CGPA 1ZM1A 3VLBB 5C9AC 3MZHA 5T52A 1ULGA 1D7PM 3ZXEA 1UY4A 3NVCA 1D2QA 3OGGA 4E2SA 4LO6B 1L7RA 2A3WA 3MIFA 3RVHA 2Q1FA 1VBD1 5F5CA 5J98B 4QXCA 5J37A 1QXRA 5FMOL 1LOFA 4XHBA 1GMMA 2Y6JA 4L9BA 3KVAA 5FYVA 3FUQA 4Y24A 2LM3A 5FPAA 5I8YA 3OGRA 1LTEA 2AENA 4QDQA 5J3UA 2G9FA 4IV3B 2A3YA 5A6QA 1DDLA 1LOFC 3N3HA 5FUNA 5FZLA 5CKMA 4CUBA 1IG3A 2RS32 5JUVA 1DGWA 1J83A 2NMNA 1POV0 5EJ3A 3K3OA 1XNCA 1OOPA 2HEVF 2WZR1 4RS5C 5FJHA 5C6CA 5T50A 3BB6A 2FZ2A 4URTA 1MQTB 1O8SA 3CZJA 5F3GA 3AYEA 3LAGA 1VMHA 2RHPA 1B35C 4KGQA 2JDNA 4FSJA 4PCRA 1NY71 4D0QA 4LEJA 4JZRA 3ON7A 4CU7A 1AYN1 1H1IA 4I2OA 4UFIA 4N7UA 3R4SA 3M7AA 2BW8A 3VKLA 1W39A 4PT6A 3LGRA 3WR0A 1JYXA 2VGDA 2P37A 2FDJA 4YARA 4PDWA 1MQTA 3OD4A 5FPUA 3KHBA 1OA3A 2WLQA 1VBA3 4GAZA 5FIXA 4YYOA 3TEWA 2ZHLA 3HR9A 5KXDA 5EJZB 5F2WA 4NWWA 1JMUB 3WINE 1OA2A 2TBVA 1X8EA 3OJBA 1GP5A 3PTRB 3OEAA 2GNDA 3CLPA 3OY8A 1FV3A 4GB31 4KH9A 4XFAA 2WAOA 2DCKA 4IV3A 1SBDA 4JGZB 4XJ9A 3J7LA 3UK9A 3EQEA 3L2HA 4EWAA 2R16A 3R05A 1AUYA 1HXS1 2NMOA 1GZCA 1HRI2 3VBSC 4CDWA 5FTTC 1VP6A 5GZGA 5DDJ3 4XABA 3DL3A 1CESA 2W87A 5IJRA 4C8DA 2VCBA 4LORA 4CPBA 1NZCA 2ZJCA 1CJDA 2BFUL 4Y1ZA 2BUKA 3C3VA 3B9IA 3VBRC 5BY5A 1ENRA 2D5HA 2HWD1 3PJQA 4QPIA 2Z42A 3T0DA 4JC1A 5AC91 4BQWA 3POYA 1H2MA 3DUIA 1Q5OA 1YI9A 2Z5WA 4K40A 4B1LA 1BKZA 3RQ0A 4KBBA 1DIWA 2GNTA 3MFAA 3POBA 1SFPA 5JMCA 4BHPA 1O4TA 3USUA 1JOJA 2Q1ZB 5DABA 2H0VA 4M3CB 3NSTA 1FOD1 1FATA 4CTEA 1OI6A 4FAHA 4A2UA 2XG3A 3MPBA 1Z0HA 4ATEA 4XUPA 5FMCA 5LA0A 4IE7A 4CDQA 3ZR5A 1I6XA 1KDKA 1S0IA 2W08A 3FFQA 2R1BA 1UZVA 2BTVC 3HQXA 3T1MA 5D21A 2E9QA 4H7MA 2JEMA 1CAWA 2JIJA 3WDWA 4AQSA 5FXZA 2Y38A 4UW3A 1XNDA 4Q4Y1 2RMU3 3AKSA 1RL3A 5FZFA 3VBOB 5A3TA 3ECQA 4FTSA 5F32A 2E31A 3ATGA 1UY2A 5D8AC 4GWMA 2OYZA 4FP2A 1UX7A 2R063 4LKFA 1RUC3 2ZX0A 2JDPA 3VZKA 2PHLA 2W9XA 4AI0A 2DVDA 1O3SA 4LPLA 3T2OA 3UKNA 4AGRA 1UZYA 4DPNA 4LUKA 4P9YA 3PHMA 1S55A 5JXIA 2P1BA 2Q1MA 1JZ8A 5A7SA 2NPIA 4CDUC 3ZSJA 1HIXA 1RUD2 2BDRA 4FFHA 3NRUA 4HPKA 1SBFA 2PTMA 4TLFA 4EJRA 3O1UA 1C8M2 1OHFA 3FHAA 1R64A 5BYNA 2SBAA 4XUTA 1W6PA 3B00A 3LE0A 2OPKA 2VD7A 3S6PA 2JECA 5FREA 3F2ZA 2P4EA 3N9QA 2BVBA 5EZWA 4QHZA 4XILA 3VHOA 4CDQC 1S0JA 5CG9A 1N3PA 2FCUA 4QX0A 1UQXA 3V64A 1E57A 2EAAA 2IFRA 3PLQA 4HLTA 4CEYC 2C6SA 1N47A 1RMU1 5JMOA 4H7LA 3RG0A 1S1AA 3RZLA 4A7ZA 5FYCA 1ZBA3 4CXWA 2WS91 1JZ7A 1XQNA 1GLHA 4LO4B 5JPNB 3PTYA 5HCBA 2QTWB 1PVC3 1LRHA 3OUIA 5FLIA 2XH6A 4EN9B 2BQPA 3N9PA 4Y22A 1Q8QA 1HDKA 4XMAA 3PDQA 1U5YA 4O61A 2WC2A 3PNAA 4FPGA 1QJU1 5LATA 5I0SA 5LK5A 1XSRA 4RYDA 4UAPA 4Y22B 2EXIA 4LE3A 3V0AB 5FLHA 4UWDA 4V1PA 2AGSA 5T5JA 1K12A 4YZ3A 5CU1A 1C3HA 1JYWA 5FZDA 4L99A 1FX5A 2I2SA 2VZPA 5HI0A 4BLIA 3HNBM 1XB9A 3ZOIA 1N1TA 2ZEXA 4QPGB 4L11A 1UX6A 4O9GA 2Z69A 3N9LA 4B7EA 3BGAA 4WM8C 4FPEA 4ES8A 3DXTA 5KHJA 1ZYBA 2OT7A 3ZSEA 2YYOA 1UU4A 3NNMA 3VHNA 5IVFA 4IUGA 5FYTA 3ZN5A 3NNJA 3VD9A 2IXKA 3E5XA 1YEWA 1SEFA 1QU0A 4UW6A 4QQ2A 5GJ6A 3VKOA 4QPGC 5FY5A 4AHYA 3MIDA 2IXIA 1YFYA 3LD8A 3RSJA 2AREA 2D97A 4WM7A 2K9ZA 4BPZA 3WNOA 3HN3A 2R7EB 1RUF1 2PHTA 3FBMA 1BZWA 3LF7A 1JYNA 1JW6A 5C70A 5A7WB 4AQ6A 3NV3A 1MQTC 1UYXA 4DXZA 4Q4X2 5FPZA 1Q56A 1UWWA 2WUHA 1NCRA 3MIGA 4E27A 4PF5A 3RZGA 1UZ0A 2L9LA 3ZKUA 2VTXA 4P14A 1AXZA 1TVGA 1MVEA 3BPZA 3KWVA 5FXWA 2VE1A 1SBEA 4BQ1A 2QQUA 3SHRA 3UT0A 5LZ6A 4RHV2 4CE8A 1VRH1 5FZKA 4CEYB 2W2IA 1YNAA 1H8TA 2JKXA 3BU7A 3SEEA 4B4PA 1US2A 4GALA 3C8XA 3A0KA 2P17A 4XHXA 1UL9A 3ELNA 4XETA 3RWKX 3AXEA 3GZEA 5IFPA 1OLRA 1LHUA 2ET7A 4AI9A 1O3QA 3IDEA 4N53C 5FPVA 3BI3A 4N7IA 4ZY9A 4XZUG 1RUI1 4GH4C 4FFIA 1NX9A 1Z7S1 4Y20B 5BUVA 1YC61 3AYAA 1YIFA 3FC0A 4LE4A 4BK4A 3DXUA 1WCKA 3KT4A 5FKCA 5A3PA 3AKQA 2G4IA 3V56A 2E51A 2B9VA 3G7DA 2WNEA 4META 1ZVFA 4I01A 3KQRA 5FPBA 2EIGA 5GZDA 3LDRA 3AP6A 3N9OA 3M3IA 1OD3A 2PHXA 2OKXA 4AG4A 4PI0A 1RUC2 3IPVA 4CEWA 1RUH3 2ZKLA 4AI8A 3AKPA 2DFCA 4E4HA 1IQDC 2HEWF 1JUHA 2OZJA 4QX8A 2O0OA 4MHUA 3VZNA 3ZSLA 4BYYA 5A7QA 2EIEA 1AL22 2F6BA 3UGFA 3UYJA 2EF6A 1DZRA 2XHKA 1LU2A 3CF6E 5H9PA 1LR5A 1O5LA 5GM0A 3FBYA 3CJIC 5CVRA 1NAEA 4MX3A 2J42A 1GUIA 4Y3OA 3WF2A 2OQ7A 1MZ5A 1AHSA 5F3IA 5B4NA 1PO11 4MO3M 4DIQA 1DG6A 1QDCA 2HWB3 1T6GC 1TG7A 1XNBA 5T5LA 5IK4A 2Q5TA 4QQLA 4DRRA 3O0VA 2ZZQA 2XBO1 4ASLA 4H2AA 1S0CA 4GQ7A 3VBRA 1WW6A 2DCJA 3USSA 1W3XA 3H42B 4N43C 2E26A 3ETQA 2BWAA 2K2SA 2VQ0A 2XKPA 3WDYA 1OD5A 5EP9A 4CCJA 3SXWA 5IVYA 1ASJ1 4ASKA 5F5QA 4CZSA 1HV1A 1VRBA 1UD1A 1UY1A 1YCIA 3RJ2X 4F8AA 5LCWL 4HK9A 4Q26A 2XLAA 1C8M3 5EJ1B 5FP3A 3ETPA 5I0TA 5FZMA 5FY0A 2NZ9A 1DP0A 4XOGA 1QXJA 5FO7B 4K7JA 2E7TA 2DTWA 2B39A 3MW4A 1ULCA 4IV1A 3DGTA 4GWJA 2Q30A 1CX1A 1ZA7A 1Q8VA 2VXRA 1HLCA 4PIYA 3T30A 1T6BX 1VAKA 4AFAA 5DUUA 5EV7A 3LDKA 1ODMA 1XBFA 1P8JA 4XBQA 2V5YA 3LDBA 3TRSB 5F9TA 2CL2A 1D4M3 4Y1UA 5T3NA 1SPPA 3AFGA 3DV8A 2TUNA 2CU5A 4RSUA 2ERFA 2P6HA 5BNOB 1ENXA 2A73B 3CU7A 1UPIA 4FTEA 1E5IA 4NR1A 5H9QA 3W59A 1ZZ6A 1GR3A 1LOGA 2ZGMA 3C7FA 2PA7A 4GH4B 5FMBA 1BVP1 5DAPA 2QUOA 5KBFA 1SFNA 3I2FA 4HPKB 4RQPA 3TOJA 1JODA 1QJY2 1BVVA 2RM23 4TXWA 4QWNA 3VZOA 4QX7A 1DQ0A 1GANA 2KA3A 4AVAA 3FJSA 3P1IA 1BBT3 5I93A 1E5SA 2DYCA 2V5DA 1WCDJ 3A0NA 3TBDA 1E5RA 1PMJX 1VR3A 4QQPA 5A7WA 2GU9A 2YGLA 1F5JA 1LECA 1JS9A 1X8MA 1HV0A 2HWB1 1JYTA 4GWIA 5SV5A 1C1FA 2VNOA 2VU9A 3M2MA 2BPA2 4IEYA 4I02A 5A3OA 4N9HA 1H2NA 4OCTA 1IGOA 1MS5A 1Q43A 1TMF2 2D93A 2WQ8A 3BALA 3ZDVA 1AYM3 4ATFA 4Q4W1 1XXNA 2WR9A 3J26N 2V72A 2VQUA 3NW4A 1RIRA 3FN9A 2OA2A 1U5XA 3MLJA 4MGTA 4EV0A 1WZXA 2YC0A 2VOWA 2R073 2O1QA 1H6YA 1NLRA 4QPGA 2D98A 4YW5A 3UESA 3VBUB 4AXOA 1HRI3 3E6CC 2WFF3 3AYDA 3T0AA 3N7MA 3AL5A 2PAMA 3RDIA 5BPXA 1O7FA 3ZFFB 3SNMA 5G04L 3AMQA 2HWC1 4DB5A 5KC6A 3VBFC 1QWRA 2BBAA 5DQ0A 1QXPA 1FPN2 1FPN3 4LA2A 1W9SA 4LUMA 1NCQB 1HB2A 1H9WA 5FP4A 5FUIA 3WNLA 1ZZCA 3PL0A 2HWE3 3GXUA 1VBA2 1IKPA 1W6OB 3AVRA 1WMDA 1VBE1 3VUOA 4ZXKA 1W2OA 1EV12 3OBTA 5KHIA 3BPSA 1KRIA 2O8OA 1VJ2A 2VAUA 4UFMA 1DZTA 3MFCA 4NRQA 1CR7A 1DYOA 2A6ZA 2G1MA 1H1MA 1JZ2A 3HQUA 3PMEA 2RJ2A 4GA9A 5A33A 1UAIA 4IE6A 2QNKA 3KGLA 4QXBA 3PUIA 1EAH3 2DCTA 4NIIA 1HQNA 4KBZA 4OHZA 2RV9A 3BOPA 3M70A 2E7QA 1ZBE2 1STMA 4E9KA 4TSVA 4OI4A 2DU1A 4ZZ5A 1ZX5A 4M0NA 1IS5A 3HEIA 4UW5A 2DVFA 1XNAA 2W52A 2P3YA 3PU3A 1W6PB 2Q8DA 5KR7A 3OEBA 3J8F3 1A8DA 5F8PA 3ZYHA 4V2WA 4P9WA 3ZDSA 4BIOA 1NCRC 2DUQA 1WW7A 3VDDA 2A6XA 4NIHA 2DCZA 1APNA 2DFBA 4P5YA 1ULDA 3J9SA 1BBT2 5DUWA 3MV01 2UURA 3RWNA 2ZGUA 4GMP3 1C8NA 3WW2A 5L36A 2R042 3B94A 4CDXC 3NNGA 1W06A 5IVVA 5LWBA 1PZ7A 1KGYA 3T2TA 3VKFC 1JHJA 4YZ4A 3ST7A 2VC9A 2UWBA 3J4UH 3Q9OA 5FMDA 2A6VA 1MEC1 1LGNA 4I30A 2QFEA 3VBOA 5DAXA 3EXUA 5A3NA 1D4M2 2VQAA 2PHDA 2Y0IA 4LITA 1D4VB 1XNTA 3ZKYA 3JD72 1LCLA 4A42A 1FMD3 5GKAC 5C3PA 5F1RA 4AEDA 2WL1A 4FCAA 1QJFA 4M00A 4UFKA 1FXZA 3SCHA 3WP4A 4A44A 3V0BA 2VQTA 3GZUC 3VD3A 2VOKA 1JU3A 3WW4A 5HXVA 3U07A 4UFLA 1ULOA 4P9LA 3POGA 2K46A 2B7YA 4W6XA 4D69A 1MZFA 3WNKA 2O14A 5FYIA 4RD7A 3I3EA 1AR81 3ZYJB 1QJU3 1CAUA 1PM7A 3EBRA 2VMFA 3GDBA 3I2JA 2X29A 4D6SA 2WFPA 1QJZA 1H6XA 3LOIA 4MV2A 1RUE2 2J1EA 1HX6A 1KDMA 2TEPA 2ZAHA 1XYNA 4CRQA 3OGSA 3WCSA 1YRZA 3VZLA 2WYFA 4LKDA 1S0DA 2WS93 2ZHMA 3DF0A 3H1YA 1W8HA 4QPIB 4Y5TA 4HMZA 5ISLA 2ARCA 3OB8A 3WD5A 1WMXA 5LBFA 2VOTA 1W8FA 2MEV2 1G8WA 4FOWA 1COV3 3NJZA 3NWKA 1CPMA 5FK8A 3J8F1 4Q27A 2CDOA 1UOBA 4Y5Z0 2WWUA 3WNNA 1RINA 4NO4A 4CDUA 4HXCA 4HKOA 5A1FA 1V6LA 4JKKA 4BH9A 5ANQA 2R30A 3CDZB 1WLWA 3RMXA 1DHKB 2LROA 3ZM8A 4AHXA 4DNYA 1ACCA 2GN3A 3AB0A 4JQTA 4OHVA 4CPBD 2ZGNA 3I7DA 2X05A 2OW4A 4C0HA 4IEUA 2VZTA 1CJPA 2HBTA 4FOYA 2QDNA 5I8SA 5A6XA 3V0BB 3ME2A 2NP0A 1PGL1 5A7NA 3VBUA 4RFT0 4M4RA 4QQOA 2AEYA 2X5IC 4OVEA 5DZEA 1S0BA 2ORZA 4UI9L 5CIRA 4ZS2A 1R081 4PLOA 1FMD1 4JDNA 4ZXEA 1E5HA 3MICA 3ZFGB 2GN7A 3OYWA 3LEGA 2JXAA 4LO8A 2XR4A 2JG8C 2NQYA 3WCRA 4B4QA 3RZHA 1NCRB 3DECA 1BJQA 3D0SA 1ST8A 4XFHA 4FBFA 5JI9A 1ND2B 4AGGA 2ZGLA 2A75A 4BCUA 2B42B 4XMIA 2CY6A 1HRI1 3P3NA 5GZFA 4D6RA 3FHIB 4CXYA 3BIWE 4WM7B 3WDXA 2LTNA 1EUTA 3IKWA 1G6NA 4AVSA 3Q8AA 3TWIA 1MPXA 5G05L 2HYKA 1H4GA 4IEOA 3S5QA 4ORFA 3THPA 1B09A 1CZTA 1YO8A 1B35B 1AYM1 4Y26A 3TYJA 2FDFA 1HKDA 2CWSA 4WVMB 5JPMB 4TZDA 2XQRA 4QM8A 1B35A 1XSQA 2D6PA 3K77A 3TEXA 3WG4A 2D5FA 1CONA 5AC93 1RUJ1 5D1IA 4S2DA 1BEV1 4MADA 1GQGA 2HWD3 2WZ8A 1VBC3 5F2SA 1EAH1 3TN92 2BP6A 4AGVA 2ADDA 4MGKE 2CGOA 5HCAA 1UOJA 2RM21 3MPPG 1BYHA 2Q8OA 4BLJA 1V6MA 1LU1A 4NAOA 5K8SA 3WX5A 4C1WA 5FCCA 3WF1A 1TME3 3NNLA 4FPJA 1ND3B 5FO9B 1VB4A 1GYKA 3OBZA 4XW3A 4FPFA 2CNAA 4AQ2A 5JOXA 4JQRA 3IAQA 4XEZA 4D8MA 4PDWC 4QPIC 5FY9A 3VKNA 3HIFA 4ZU7A 1UMIA 2VCMA 4F83A 2RR12 4OUSA 2R49A 4XJZA 4DUWA 3IB3A 3WF3A 4ET7A 2A6WA 4IGQA 2WT1A 2QE3A 2VZ1A 3LEMA 4AEDC 4ISQA 3MF9A 3RYRA 2WN3A 3VBSA 4CDWC 1SFYA 4LK6A 4LTAA 3HWJA 4XAEA 2WFF1 1GNYA 3WOGA 5A6ZA 4ZZ8A 5KHKA 4DZGA 3CQOA 3M1HA 4A41A 1G7YA 4M3CA 2VZUA 4P9XA 4AVBA 1JZ4A 5DXDA 3WLUA 3E6BA 3USUB 1C8M1 2GC0A 4M3CE 3NMBA 1GICA 3N7LA 2MHFA 3ILRA 3HQRA 2IC1A 2GC1A 3IIIA 1JI6A 3WY6A 2XJVA 1PO23 5FY4A 4CP0A 4C0BA 5JSPA 1IG0A 1ZNPA 2HH9A 2DVAA 1LEMA 2D6NA 3VL9A 3AFKA 3JBG1 5K4LA 3K46A 2RS51 2CGNA 1DQ4A 1UYZA 1ZBA2 3ORJA 4HANA 1MVQA 4JRAA 3B5LB 1O91A 2XBO3 3N4MA 2XLGA 3KVBA 4XTPA 2FDGA 1SG3A 1YFUA 1W2UA 4LNVA 4Z07A 2HWF2 1JZ3A 1ENSA 3KV4A 2UYAA 5TSWA 1CAUB 1K3IA 3M3CA 3J7NA 1MS4A 2ZKNA 4O9EA 4GKXA 1S2EA 1W8OA 4HKLA 3O1TA 1OVPA 2QQMA 1KD7A 2JX9A 3H3ZA 4B7KA 4E4SA 1EPZA 1KXGA 2GH2A 1R1ZA 1XE7A 3WQBA 2I74A 3NJXA 4COYA 1U5IA 2BU9A 4AAPA 5FZ8A 2CDPA 4MLOA 4Y33A 4GMP1 5JOZA 3SH3A 5K0UA 2FCTA 1V6JA 3HT1A 5A32A 4GJYA 3QH6A 2DF7A 3ES4A 4INDA 1W99A 4JTOA 2XWJB 1YWKA 3KT7A 4C1XA 1S0EA 3WDTA 5I91A 4ARYA 5FP8A 4YVSC 2ZACA 1LB2A 3AP4A 3PU8A 4K21A 1VMJA 2P3KA 5L7OB 4IETA 2R062 4LBLA 5T5OA 3OPTA 2XVLA 3WUCA 4XIOA 5IATA 5A3LA 4IGPA 4I3GA 3GALA 1R1A3 1Q8SA 3RI9A 1BLZA 1U12A 3J7HA 3ZPYA 3AZZA 1HRV1 1LOBA 4J1XA 4Q4V1 4TN7A 2ORXA 1DU3D 2VMDA 3N9MA 5JR2A 2OPWA 5H9RA 4IEQA 2NM1A 1QJX1 4BWOA 2CHHA 1N1SA 1J84A 1OF4A 3IM0A 4LKSA 4R52A 3OUHA 4ZONA 2PAKA 5E6HA 3ENRA 5FZ7A 2FD8A 5FZHA 2XLFA 4YZ5A 3K51A 1OQ1A 2YV8A 3UV9A 1BEV3 1R1A1 1LENA 1W8NA 1VRH3 4QHBA 2HWE1 4R9DA 2CWMA 1VBB1 3PMSA 3MHZA 4BISA 4DEQA 1NE4A 4YPJA 4A4AA 1AR92 3RZJA 3A21A 5FYBA 2OVUA 1RVF1 4E8CA 1UNBA 5KC5A 2ENRA 4R4XA 3I2DA 4LHNA 1ZRIA 2WNVA 4Y4RA 2WT0A 4KL1A 1QMJA 2XJTA 4R9AA 1VAVA 1C5HA 1XC6A 4LHLA 4OHXA 5ABJA 3H8XA 1PK6C 4XZPA 2QQIA 3POIA 5CEHA 3BU0A 1OFSA 3ZFGA 2FDKA 3RYKA 3AMMA 3ZMOA 4A45A 2Y6GA 5A32B 3S30A 4HETA 1XU1A 4FI9A 4AL9A 1YIPA 2EALA 1NKGA 4S2HA 4RQPC 3NJVA 5FBJA 2XJPA 1NXD1 3WHUA 2A3XA 2C26A 2IWGB 1H30A 1H8TC 4MYEA 5K9YA 1T2XA 5J48A 1RUG2 3WVJA 5LEJA 3TEZA 2NN8A 2P3JA 1LULA 4HK8A 2YUEA 5KWRA 4QT6A 2JG9C 5FY1A 2GALA 4MXWB 4NVPA 2PLV1 2RS53 3R4DB 4XF0A 2W3JA 3JBG3 3KF5A 1SLAA 1Y3TA 4AF9A 1GZ9A 4CP2A 5FLJA 4Q4V3 1G9FA 1HRV3 1OT5A 2WNOA 1YQ2A 1PO12 4BQ4A 5JZGC 4DEVA 5ABJB 1PVC1 3PVOA 4CXXA 4WBBA 4BE3A 1K45A 3LEIA 2WNVB 2VBPA 1X36A 2YROA 4FPLA 4YG0A 5AVAA 2TNFA 3RI8A 3AZWA 5FYYA 3U1XA 4J25A 4NPLA 1ZA4A 4AI1A 2WQZC 2JDAA 1J1TA 3A7QA 5BNNB 5C8CA 2VUCA 3JQXA 1W6QA 3VHRA 2VOXA 1Q8OA 5A6YA 1X50A 2JENA 2W1QA 4B29A 1A3KA 3SKVA 4RR3A 2VXJA 3HPNA 4GXLA 1ASJ2 1JUIA 5CB7A 3U37A 1H1AA 5C3RA 3I3MA 1QH7A 4N53A 4R9BA 2G9ZA 3B69A 5JAXA 2J1SA 3RZZA 3AMHA 4K6BA 5FZIA 4KWKA 5J1XA 2BWCA 5C3SA 2VCAA 2BV4A 4H3WA 3K4AA 4B4RA 4IV1B 1BHGA 2W46A 4XUOA 1W9WA 1VLNA 1ASJ3 1TME1 2ZAAA 2Q8EA 2WIIB 1JBCA 4UOJA 2GNBA 2Y34A 2BBVA 1WMFA 1RXGA 2YPJA 1XJAA 2PHWA 3H9AA 2C4XA 4DUVA 5KHGA 2WBKA 1I1EA 2UU8A 4COUA 1SCRA 2HYXA 4L97A 4BM8A 1R092 1ZZ9A 2QJVA 4OI2A 4Q1PA 4XXAA 5DUXA 5FO8B 1PMIA 1UY3A 4QX5A 2AH2A 5E89A 3D8CA 2QKDA 3BTYA 1VALA 4CCOA 1PO21 4YLZA 1IZ3A 1DYKA 1W0NA 4JDOA 4XUQA 1OPMA 1LOAA 4A6OA 3EB7A 4KWJA 5L7OC 1KFXL 5A3WA 1IQAA 5IYYA 4NIGA 4OYUA 3ROUA 1IS4A 2RDNA 5HPOA 1AJOA 3IBMA 1W90A 5C4WA 4AI2A 1PNGA 4MSVA 3CJIB 3ACLA 4QDSA 4FTBA 4OHYA 1RC6A 4K8FA 3LZZA 3J7MA 3M3QA 1RUH1 3ZFEC 3VZJA 2ZPXA 1BK1A 5D2AA 1QF3A 4YRDA 4LMFA 1NYWA 3M3EA 4Q4W2 1O3TA 1J59A 3RS6A 4DXSA 3I59B 1WCSA 4A3ZA 3K75B 2WRAA 2RJKA 2SLIA 5FQ0A 5I0UA 3A23A 2X8KA 4YGDA 3U10A 1GSLA 5DDJ1 4GMP0 4XBNA 2ZGSA 4R9CA 4XBLA 1AR72 2RS12 3S7IA 1F4HA 4CSWA 5BV6A 3OYWB 4LT5A 2WN2A 1SZBA 3DPRC 2QQJA 2YFUA 4COWA 2ET1A 1NCQC 1QQP2 1K5MA 2ZHKA 5L9BA 1FNZA 5FK7A 2HWC2 5F5AA 3WNMA 4XQ4A 4L92A 4MXWA 3O5SA 4NN0A 1HB4A 2O8QA 5IT6A 2ZMNA 1OOPB 1FPN1 1VBC1 5ACA2 3WV6A 2YU1A 4E8DA 2WO3A 4IGOA 1C28A 1NUKA 4E4DX 3NO8A 4KG8A 2BJSA 3VBSB 3O1OA 1RUJ3 4QU2A 5HBAA 1NE6A 1LOEA 3NAPA 3I97A 4Q4Y3 3KV5A 3RNSA 1N3QA 3WF0A 4PQQA 1VBE2 3BTZA 5JIAA 2D3RA 2WINB 3K3NA 3OD0A 2N7GA 4RA0A 4PBOA 1ND3C 1COV1 4CDUB 1PHMA 2CAUA 4XF9A 4CP9B 5ABJC 2MNGA 3C7HA 5SV8A 1NZIA 2DDUA 1IS3A 3Q8EA 4DY5A 1FV2A 4HVRA 3LIHA 4HSJA 1ND3A 2VMIA 4P9JA
chains in the Genus database with same CATH topology
2C24A 1W8UA 2K46A 4CPBA 4LK7A 3ZYBA 1HN0A 4A6SA 4BQ2A 2O14A 1GWLA 2KR2A 4AL9A 4BQ3A 4BQ4A 5D21A 4CP9A 1W8TA 2JWPA 3UT0A 3ZYFA 2Q1FA 4YW6A 4YWAA 4LJHA 1W9FA 2LROA 4BQ5A 1WCUA 3F95A 4CPBD 2LRPA 1OH3A 2WYFA 4LKFA 3ZYHA 4LKDA 4CP9B 1GWKA 4LKEA 1W90A 1V0AA 1OKOA 1W8WA 3ORJA 1WMXA 4LK6A 1GWMA 1UOJA 1WZXA 4YW7A 2VXJA 1W8ZA 1L7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C24 A;  1W8U A;  2K46 A;  4CPB A;  4LK7 A;  3ZYB A;  1HN0 A;  4A6S A;  4BQ2 A;  2O14 A;  1GWL A;  2KR2 A;  4AL9 A;  4BQ3 A;  4BQ4 A;  5D21 A;  4CP9 A;  1W8T A;  2JWP A;  3UT0 A;  3ZYF A;  2Q1F A;  4YW6 A;  4YWA A;  4LJH A;  1W9F A;  2LRO A;  4BQ5 A;  1WCU A;  3F95 A;  4CPB D;  2LRP A;  1OH3 A;  2WYF A;  4LKF A;  3ZYH A;  4LKD A;  4CP9 B;  1GWK A;  4LKE A;  1W90 A;  1V0A A;  1OKO A;  1W8W A;  3ORJ A;  1WMX A;  4LK6 A;  1GWM A;  1UOJ A;  1WZX A;  4YW7 A;  2VXJ A;  1W8Z A;  1L7L A; 
#chains in the Genus database with same CATH topology
 5F5I A;  4Z2A A;  1W6M B;  3JB4 C;  3LFM A;  1TE1 B;  1CX4 A;  5HV0 A;  3S57 A;  2HBU A;  2PHU A;  2DBI A;  2F17 A;  3T4V A;  1MZE A;  3WP3 A;  2ZXQ A;  5FP7 A;  4UBG A;  2WWJ A;  4Q8K A;  3ZIW A;  4BB3 A;  4OMC A;  2AAC A;  2YFZ A;  2VZR A;  4NE9 A;  2JG9 A;  1F2N A;  2Q0A A;  1S0G A;  4AQT A;  1MS8 A;  1X9P A;  2WZR 2;  3UJQ A;  4C90 A;  2IXL A;  1W6N B;  2YB7 A;  2RDS A;  3JUU A;  4LBK A;  5JZG B;  3OGV A;  2YXS A;  1DGW X;  2VJX A;  2J22 A;  4HG6 B;  2R0H A;  3BOW A;  5HCH A;  4ZS3 A;  2W47 A;  4JGZ A;  2WNU B;  3EJK A;  3P5B A;  1R08 3;  1W3V A;  5FMO S;  3QD6 A;  4Q0U A;  3I49 A;  5LA1 A;  2GDF A;  4LBQ A;  4WV8 A;  2ILM A;  2J7M A;  3G6J B;  4GUL A;  4NMI A;  4QM9 A;  1V70 A;  3O12 A;  3O1R A;  2ZX4 A;  1QNY A;  1SHW B;  1HJG A;  3JXS A;  4TWT A;  4E2Q A;  2WNU C;  1SQ4 A;  1UYP A;  4MGY E;  1MZ6 A;  3H3U A;  4BME A;  2ZHN A;  3IMM A;  3NNF A;  1FI2 A;  2VZ3 A;  2ZGR A;  1D4M 1;  1CN1 A;  3B93 A;  4UFJ A;  4YWA A;  3WSO A;  4QKB A;  4AHZ A;  5E88 A;  3OF1 A;  4D7T A;  1UF2 C;  2RDQ A;  3MLK A;  4WVV A;  1DCS A;  4RR3 C;  3VBH A;  4XE9 A;  2VL4 A;  4XJU A;  3ZFE B;  1ALY A;  4UF0 B;  3AK0 A;  2E7A A;  2WO2 A;  5GZE A;  2CV6 A;  2ADE A;  4PIZ A;  4UFH A;  3VGI A;  4PI2 A;  4GB3 2;  3THC A;  4COZ A;  4NRM A;  3E1F 1;  4UXA A;  2RJL A;  2I07 B;  3HMY A;  4G3Y C;  4DFS A;  4R4Z A;  1ND2 C;  1HXS 2;  3WW1 A;  5L19 A;  1AYN 3;  4QGL A;  5FZ0 A;  1HN0 A;  4I3P A;  3O0W A;  2YHJ A;  4YM0 A;  5CAD A;  2BGO A;  1A6C A;  2ZTN A;  3I3D A;  4LLF A;  2XQX A;  4IV3 C;  3RJR A;  3RZM A;  1OQD A;  4XUN A;  4CCN A;  2RDR A;  3HVD A;  2WJS A;  4RFR B;  4LUL A;  4DUX A;  3GF6 A;  1OUX A;  4AWD A;  4XDQ A;  1LAJ A;  2W1S A;  3CMG A;  4AR2 A;  1CZV A;  1YJL A;  3MEP A;  1AR8 3;  4NPM A;  3F95 A;  1BMV 1;  2WO7 A;  3CJI A;  3UNP A;  3ZYP A;  4WVZ A;  2VMG A;  2XJU A;  5C4W B;  3SQO A;  4AI3 A;  5LBC A;  3NL1 A;  3O1S A;  3WUD A;  5B4X A;  1CAV B;  2QVS B;  5JR7 B;  2Z2S B;  5JZG A;  2D7F A;  2GME A;  4YGB A;  4I09 A;  1N1Y A;  4EN0 A;  1W8U A;  3KT1 A;  5BNO C;  5KHH A;  2ZX2 A;  1DF0 A;  1G86 A;  2DV9 A;  4NJ4 A;  4MXV A;  1JU4 A;  5T54 A;  2FQP A;  3NQH A;  4K20 A;  2HEY F;  3U14 A;  2V4V A;  2ZOE B;  2PYT A;  4CCM A;  1AVB A;  1LHV A;  5I8T A;  5L7O A;  3W5N A;  2C5D A;  1MEC 3;  1VBD 3;  2HWC 3;  4M3C F;  3RPQ A;  3FL7 A;  1PGL 2;  1UN1 A;  2Y6F A;  1ZRR A;  3WG3 A;  1UO9 A;  1EY2 A;  2YY1 A;  2Q8C A;  2BNO A;  2R07 1;  3MBW A;  4HSL A;  4FAG A;  1YYN A;  3KZ4 C;  2AYH A;  4IEP A;  4OZO A;  4Q0V A;  4QX1 A;  1W2A X;  3THD A;  2VBD A;  3W20 A;  2JD4 A;  2NLR A;  2WSV A;  3AL6 A;  4ES9 A;  4Q0S A;  1KS4 A;  5B2G B;  3AJZ A;  1Y7B A;  5FFO C;  4YW3 A;  1RVF 3;  4OZX A;  5BNN C;  2VBB A;  4HBN A;  1ZZB A;  4MGS A;  4EWD A;  1S0F A;  1X82 A;  3ILF A;  4AED B;  1O8P A;  4CUC A;  4YM3 A;  5C71 A;  1MS0 A;  1M06 G;  4NHX A;  4IE5 A;  1AR6 3;  1RUD 1;  1VBB 3;  3PIJ A;  4DRV A;  1EYB A;  3AC0 A;  1K42 A;  3NJY A;  3K4Z A;  3MI8 A;  1W9T A;  1YJK A;  4CVU A;  4HVQ A;  1Z7S 3;  2J1U A;  4UBH A;  4Y1X A;  2P2K A;  2JB4 A;  5GLU A;  1EP0 A;  5DMY A;  1H2L A;  1OSG A;  3NV1 A;  2E33 A;  2VCC A;  1FOD 2;  4RGG A;  5EQU A;  3VKM A;  1GWM A;  4X6Q B;  1QJX 3;  1BXH A;  1GQH A;  3CZU A;  1QKQ A;  3WW3 A;  3KCC A;  5A1L A;  3CKH A;  4QAW A;  4AZZ A;  2ZX3 A;  2CSG A;  1O6U A;  1OUS A;  2XML A;  2KD7 A;  5E16 A;  1RMU 2;  2XHN A;  3VDD B;  3C2U A;  4K3U A;  1GNZ A;  1ZRC A;  1NA1 A;  2ZBJ A;  3U75 A;  3NKG A;  5JOY A;  3GBW A;  4U36 A;  1PMH X;  4Q8L A;  3KB5 A;  3AZY A;  2V09 A;  4UYB A;  4Q0Q A;  2K0G A;  4RGA A;  2WSU A;  5LY1 A;  4WM8 A;  1QQP 3;  4PJY A;  2YBK A;  2G9G A;  4OUM A;  1MS9 A;  1WLC A;  4RS5 B;  1UKR A;  1OXC A;  2GC3 A;  1U0A A;  4FFF A;  5EIY B;  2B8M A;  5K0U C;  2OUJ A;  1PK6 A;  1QHD A;  3MW3 A;  4NWV A;  4OI1 A;  2RVA A;  3H7J A;  3KS7 A;  3S7E A;  4CP9 A;  5A33 B;  2VOV A;  3SIT A;  2FMD A;  3RFR A;  2JE8 A;  2ZGQ A;  4YM1 A;  4QB1 A;  4UW4 A;  2A5Z A;  1POV 1;  5A7O A;  1PIV 3;  2Y60 A;  3PVB B;  1SLC A;  1Y4W A;  2YBS A;  1C1L A;  1ONA A;  1WW5 A;  4XPV A;  1W6O A;  5BXX A;  5L73 A;  3I3Q A;  5KXC A;  4BZ4 A;  3THT A;  2FBE A;  3RGB A;  3C7G A;  2QZ3 A;  3H8U A;  3ACF A;  2ZEW A;  4LOT A;  1K5M C;  3D6E A;  2H0B A;  4XJW A;  1NCQ A;  1WCU A;  3I3B A;  4R8H A;  5FYH A;  1O59 A;  3JZV A;  4LXL A;  3VBF A;  5FWJ A;  2ARA A;  4AFD A;  4QGM A;  4XC9 A;  1UYY A;  2PHF A;  2WYS A;  3B01 A;  3AMP A;  4Z1V A;  4YW7 A;  3SMH A;  1UZW A;  5FDB A;  1G9C A;  1RUF 2;  5FYM A;  3MO4 A;  4CCL A;  1RUE 3;  3N7K A;  4KWL A;  4MVT A;  1RUO A;  1PK6 B;  4HN0 A;  5IVJ A;  5JXG A;  4RS5 A;  3A22 A;  1ULF A;  4K9S A;  4Q4X 1;  2E53 A;  4N43 B;  2GC2 A;  3JBG 2;  1Y43 B;  1PGW 2;  2RS5 2;  4JGY A;  3LPG A;  3N9N A;  3KGZ A;  2BGC A;  4YW2 A;  3ZIX A;  1W03 A;  1JYI A;  2JDH A;  4FPK A;  2WNU A;  5T55 A;  1XYO A;  1ULE A;  3LSD A;  5K7P A;  1RYY A;  4RHV 1;  3WHT A;  4YVS B;  5F3C A;  1SDW A;  1V6N A;  1EUU A;  1W8W A;  3L2Y A;  4OUE A;  1YI7 A;  5CFC B;  4PLN A;  4AVC A;  1SLL A;  5A1A A;  4JHZ A;  4KG0 A;  4Y1V A;  1TEI A;  1UU6 A;  3H50 A;  4YZ2 A;  1US3 A;  2DBN A;  2XJR A;  3ABZ A;  4PIX A;  2EIC A;  2QDR A;  3D3A A;  1ND2 A;  4YZ1 A;  2QZ2 A;  1RXF A;  5IUQ A;  5GLZ A;  5KXB A;  1CZS A;  4CEW B;  1NG0 A;  5FPX A;  1RUI 2;  2Z4F A;  2IXJ A;  4ZPI A;  2YBP A;  4XIK A;  1CAX A;  2RS1 3;  5LEK A;  2MPF A;  3NV4 A;  1OH4 A;  2JG8 A;  3GGL A;  1QOS A;  3T2Q A;  3DYO A;  1V9U 2;  3P3P A;  2ZGO A;  5FPL A;  2JDK A;  1CAW B;  3DKQ A;  3ILN A;  5AVP A;  1UMZ A;  3POF A;  3ZXF A;  4XDP A;  4BA6 A;  1HQW A;  5CBL A;  3MUZ 1;  4QQH A;  1UPS A;  3VBO C;  1AR9 3;  5DUV A;  5FYU A;  2JDZ A;  3NAP B;  4HL0 A;  3AKR A;  3AXD A;  1RHI 2;  1DQ1 A;  3A4U A;  1VRH 2;  3KQ4 B;  4BQ2 A;  4URA A;  1H9P A;  4BIF A;  1NT0 A;  4FP3 A;  2BER A;  2D3S A;  3POW A;  4FXK B;  4IER A;  1H4H A;  1HRV 2;  1WA4 A;  2XGX A;  4HVO A;  1AX0 A;  4ZU5 A;  3T2P A;  5L9R A;  5FYZ A;  1OUR A;  1NQJ A;  3HBZ A;  1PGS A;  3KSC A;  4XJA A;  2AR6 A;  1QJX 2;  1GOH A;  2OII A;  2QQO A;  3O14 A;  1CAX B;  4XFG A;  2FCV A;  4YW4 A;  4CDX B;  1A34 A;  1FOD 3;  3BKZ A;  4XUR A;  2VMH A;  4LBM A;  3GJB A;  3AP9 A;  2EAK A;  3MYX A;  2VG9 A;  1JOB A;  1R1A 2;  1RHI 3;  2WA3 A;  2CTV A;  5BNP B;  3OBA A;  1V00 A;  4LK7 A;  1R09 3;  2VZQ A;  5ERL A;  5I0D A;  4FQ4 A;  4QGN A;  3C7O A;  2VR4 A;  3MDP A;  4CDW B;  1W05 A;  2R1D A;  4A6S A;  5CFD A;  1HB1 A;  3FHQ A;  5F7U A;  5FP9 A;  4DQA A;  4XCA A;  1RVF 2;  1CPN A;  3N7J A;  4B1M A;  2VTF A;  1URX A;  5A3U A;  4IXL A;  4BU2 A;  1JTZ X;  2BGP A;  1AL0 G;  2DVB A;  1AX1 A;  3BYW A;  2UYB A;  4W6W A;  3JB8 A;  3JU9 A;  5IW0 A;  4FXG B;  1WLD A;  5C3Q A;  3GM8 A;  1ODN A;  3I2K A;  4I0B A;  4NRP A;  3WXP A;  5DPN A;  4TTG A;  4NID A;  2XON A;  5FOB B;  4CU9 A;  1QDO A;  1W0P A;  4XQD A;  2PEL A;  4XAA A;  4NHY A;  1AL2 1;  5F37 A;  1RUI 3;  5IWF A;  2Y6K A;  5F3E A;  1VIW B;  5DZG A;  4WVW A;  5FZE A;  3TEY A;  2GAU A;  4ONU A;  3H0O A;  2HJI A;  3FLT A;  3WG1 A;  5C5U A;  4OQ9 A;  2VTX J;  4LLO A;  2C9A A;  4P9G A;  3CHX A;  2JDY A;  1GWL A;  4KQ7 A;  2A1X A;  1AF9 A;  1YFW A;  2W94 A;  3IPV B;  4JRL A;  3ZFE A;  1RUG 1;  2DVG A;  4QD2 A;  1H8V A;  4J6G A;  1OQE A;  3RYP A;  4CDX A;  4DO0 A;  4AW7 A;  2BZD A;  4DMI A;  4QX2 A;  4Q5O A;  3UET A;  2XBO 2;  3WQ7 A;  4HOO A;  3HNY M;  1HB3 A;  2AZ5 A;  4D7S A;  3QLQ A;  1V6K A;  1RUN A;  2QQK A;  3AYC A;  3IDC B;  4FOQ A;  1D2S A;  3T1L A;  3POE A;  1C5I A;  1OFN A;  4RN5 A;  3I4I A;  5JWP A;  3BUC A;  5FBZ A;  4JCK A;  5BNQ A;  2VZV A;  1CQ9 A;  2CAV A;  3OPZ A;  3ZN6 B;  5C5T A;  3QCW A;  5JLV A;  4JTN A;  4PHZ A;  5FXX A;  3ZXD A;  5GZC A;  1GQP A;  1EPW A;  4LBQ B;  3MF6 A;  2VVD A;  1GU3 A;  5IAV A;  3TAY A;  4PQ9 A;  4WVM A;  4J1W A;  3WNX A;  4AVT A;  4D7Y A;  5A70 A;  1YFX A;  1I5Z A;  1QOT A;  4Q29 A;  3CL1 A;  4QXK A;  5JSR A;  5FY7 A;  2DUR A;  3PJY A;  1W28 A;  1F15 A;  4NHK A;  1CIW A;  3HBK A;  1YHF A;  4Y1Y A;  3D5O A;  4FVV A;  4Z82 A;  3VDB A;  3IIA A;  3Q8F A;  3I54 A;  3DPR A;  4HFS A;  1UZZ A;  4QB6 A;  4HKW A;  5ANN A;  2XJS A;  2JG8 B;  3NAP C;  3HJR A;  3ACG A;  5FZ9 A;  4IEZ A;  1J1L A;  2EA7 A;  3KHC A;  4IL7 A;  3VBU C;  2JIC A;  1PIV 2;  3K4D A;  1KS5 A;  5CG8 A;  1UOF A;  2DCY A;  4ZHN A;  3ZN4 A;  2C24 A;  1ZRD A;  1F35 A;  2VVE A;  2Y64 A;  3EO6 A;  3KMH A;  4JGY C;  3SC7 X;  2PHR A;  3ZYI B;  5CFC A;  1Z78 A;  2J1A A;  3D82 A;  1FYU A;  3UGG A;  2WZP P;  2BVV A;  4YVS A;  4BQX A;  4NUB A;  4QPW A;  4MG2 A;  1F4A A;  1LHN A;  3DPR B;  3FLR A;  2XKO A;  4D3W A;  4LJH A;  1DGR A;  1QJY 1;  4MGI E;  5A80 A;  3MW2 A;  4BDV B;  3RZK A;  3H1W A;  5C8C C;  1GZW B;  4X6R B;  2UWC A;  1R09 1;  4QHO A;  2VM9 A;  1RMU 3;  1Q3E A;  1QGL A;  1ZRF A;  2D43 A;  4K8R B;  3O1P A;  1BQP A;  2HWB 2;  3ZN6 A;  2VY0 A;  2VW1 A;  3TNP B;  2X5I A;  2VW2 A;  1K5M B;  3APB A;  2W92 A;  1D0G A;  2C9K A;  4PLM A;  1CIY A;  3KLS A;  3MIB A;  1SCS A;  1WME A;  2YMZ A;  3VBH C;  2X10 A;  4Z2W A;  2H6C A;  5FY8 A;  1KEX A;  4LO7 A;  4EZ4 A;  4G4F A;  1SLB A;  2B45 X;  2R32 A;  5CKQ A;  2H6B A;  5IVB A;  3U0Z A;  3WF4 A;  2WA4 A;  1AR6 2;  1Q8P A;  3OTF A;  4CCK A;  1JOP A;  4PF1 A;  1HXS 3;  1QNW A;  4RQP B;  1JZ5 A;  4FO9 A;  1VBE 3;  2PQQ A;  4HN1 A;  1XOY A;  5CA6 A;  3VV1 A;  2AEZ A;  1WCQ A;  2PFW A;  2BEO A;  4W4Z A;  2D6M A;  4S2F A;  4WZC A;  3B9C A;  3LA3 A;  4F3J A;  2ZML A;  3GBF A;  1UKG A;  3Q8C A;  5IHR A;  3MLL A;  1CWP A;  1J3R A;  1LGB A;  2XVK A;  1RED A;  4L2N A;  4AVV A;  2VZS A;  4LOS A;  3BCW A;  1PZ8 A;  2DUP A;  1VBA 1;  2RMU 1;  3P6B A;  4OLL A;  4WM7 C;  2ARX A;  2ZEY A;  1W2T A;  4LHS A;  1AR7 1;  2RS1 1;  3AVS A;  2B4K A;  1CVN A;  5HXM A;  5F6K A;  1GP4 A;  5GLV A;  1GWK A;  2OZ6 A;  3POJ A;  1VBD 2;  1MEC 2;  1NA1 B;  4BXF A;  3R4U A;  3LFI A;  4MUV A;  1XYP A;  3LEK A;  2P3I A;  5J09 A;  3VHP A;  1XU2 A;  3QOP A;  5ACA 1;  4XAC A;  1ZBE 1;  3U78 A;  3IMN A;  3GYD A;  1MAC A;  2HWF 3;  4XJ8 A;  4Q4W 3;  3SH4 A;  4EN8 B;  3X29 B;  5T5P A;  4C91 A;  4UF0 A;  3AKT A;  2RS3 1;  3UL2 A;  4IW3 A;  1YUD A;  3GBG A;  1ZZ8 A;  5IK7 A;  2ZA9 A;  3W21 A;  1IKQ A;  3PIG A;  2CGP A;  1LHW A;  2WZE A;  2XOM A;  3L9J T;  4HZF A;  3H8R A;  2VNR A;  1TNF A;  2ZGK A;  3AP7 A;  3O1M A;  3BTX A;  3UKV A;  1AR8 2;  1O4Z A;  3EYP A;  3I2G A;  1PZ9 A;  5BNP C;  1DQ6 A;  4JX0 A;  4NOT A;  1UIK A;  1BBT 1;  1ZZ7 A;  4W8J A;  1RUE 1;  2JIG A;  5GLT A;  3VD7 A;  1FT9 A;  3WP6 A;  1OKO A;  1MS3 A;  5F39 A;  2D44 A;  2ZX1 A;  1NY7 2;  3EMR A;  2XVG A;  1H2K A;  3C7E A;  4N9I A;  1AYN 2;  3FZ3 A;  5D8A B;  3BOD A;  2YG0 A;  3O1V A;  3LQC A;  4IQP A;  2WQ4 A;  1QH6 A;  5JOW A;  1F9K A;  4HT1 T;  4XDO A;  2MEV 1;  4QKF A;  5FZC A;  4BOW A;  3BVC A;  4GB3 3;  3WZ1 A;  1W6Q B;  3JQW A;  2Z79 A;  2XDV A;  1UXX X;  5BNN A;  3K2O A;  4AHW A;  5FZA A;  2IUW A;  2ZCW A;  4YW6 A;  2JG9 B;  1SLI A;  4LQR A;  3GCX A;  1LJ7 A;  3LWC A;  5FZO B;  5FZ4 A;  2QQN A;  3JD7 1;  4FT8 A;  1PNF A;  3FFZ A;  5DG2 A;  1NLQ A;  3U4S A;  4F7Z A;  5ACA 3;  3IAP A;  2AC1 A;  1F8V A;  2UY9 A;  4YSF A;  3DEM A;  4QDR A;  3VDA A;  2ZS6 B;  4B8E A;  5CFD C;  3ALQ A;  1X33 A;  2Y0O A;  5EHD A;  4AE2 A;  3MGU A;  2WNV C;  3ES1 A;  5FRA A;  4QKD A;  5FZO A;  1XE0 A;  4KI5 M;  4OUL A;  2XL9 A;  5FOJ B;  2G19 A;  4JKL A;  1V6I A;  4A7K A;  5F6L B;  1R08 2;  2EIB A;  5C9A A;  5FZG A;  2EXH A;  2A71 A;  2YZ4 A;  1SDD B;  2ARB A;  3GCW A;  4GD4 A;  3FX3 A;  4JGY B;  2HWD 2;  5D8A A;  3UJO A;  2OUH A;  4N43 A;  3JCI A;  1DGL A;  2BNN A;  1QY4 A;  1WW4 A;  1J58 A;  5AC9 2;  2MEV 3;  4JVA A;  3ZXK A;  2OQ6 A;  2OX0 A;  1F31 A;  3RMY A;  1DLC A;  1V0A A;  1RIT A;  2VUL A;  4AFM A;  4DXR A;  3J8F 2;  3OG2 A;  5DAV A;  2A70 A;  3M3O A;  3VZM A;  3IN9 A;  2WAB A;  4LA3 A;  4CCC A;  2XWB B;  4KU7 A;  3U11 A;  4MGQ A;  2WO1 A;  1UCX A;  4JGZ C;  1PO1 3;  3CBN A;  4Z92 B;  1OLQ A;  2J1V A;  1K5J A;  2QBX A;  1SAC A;  2ZAB A;  3KCX A;  1BMV 2;  1DZQ A;  5J96 B;  5FXV A;  5LK7 B;  1RB8 G;  2Y6L A;  4AFC A;  1DLL A;  4Q1R A;  1W9F A;  2XUM A;  3R6S A;  3AJY A;  4UT5 A;  3POS A;  4XFI A;  3VB9 A;  3LA2 A;  3KM5 A;  4OQ8 A;  2ZGP A;  5LBE A;  3ZLI A;  4IES A;  4XTM A;  4Q4Y 2;  5LAS A;  4O7X A;  1RUJ 2;  5FYS A;  3DCQ A;  3WG2 A;  1KQR A;  1FMD 2;  2E63 A;  4GH4 A;  4JV4 A;  3MV1 1;  3TN9 1;  1GFF 2;  1YQC A;  3T4H B;  1U5Z A;  3LA7 A;  4D94 A;  3MIH A;  3W58 A;  3LOB A;  1SPP B;  2DWR A;  2IFW A;  3CEW A;  4YVW A;  4YW1 A;  1TZO A;  3IWZ A;  4FPH A;  4XF3 A;  1HN1 A;  2DTY A;  3H8O A;  2LAL A;  4SLI A;  1V9U 3;  4YVW B;  1GP6 A;  2C0Z A;  1JHN A;  1AR7 3;  5IK5 A;  2R04 3;  3AZV A;  3CO2 A;  1W6N A;  2R07 2;  2UY8 A;  4RGK A;  1O4Y A;  3H1M A;  1OLM E;  1OH3 A;  4IDZ A;  3K48 A;  2RR1 1;  1LNS A;  4FPY A;  3O0X A;  1PVX A;  3Q8B A;  3I8T A;  4QKN A;  5CAZ A;  3ZSM A;  2E32 A;  5AFB A;  4XYX A;  1AYM 2;  1OA4 A;  4QB2 A;  3SCG A;  3VBF B;  3WDU A;  3BTA A;  4IE0 A;  4W6Y A;  3I2H A;  1YXW A;  4AK3 A;  2F4P A;  4IEV A;  4NIA A;  2UWA A;  3AZX A;  1YLL A;  3E5Q A;  3PUQ A;  1UIJ A;  5JSO A;  2PQS A;  3SEP A;  1IS6 A;  1IHM A;  5FZ1 A;  1BEV 2;  3VN4 A;  3NV2 A;  2W39 A;  2WS9 2;  4MOA A;  1M4W A;  2DU0 A;  2W1U A;  1EAH 2;  1RGS A;  2BNM A;  2D40 A;  2X5I B;  2Y33 A;  3KF3 A;  4P5H A;  4YG3 A;  3GJA A;  3OBR A;  4COV A;  2I45 A;  2RM2 2;  3EHK A;  3GHM A;  4H55 A;  1J3P A;  4N8M A;  2D3P A;  4EN6 B;  4YGC A;  5LA2 A;  2B9U A;  1GZW A;  1QJU 2;  2ZMK A;  1RJ7 A;  1HJF A;  1AXY A;  1L3J A;  1RUF 3;  2RG4 A;  5HV4 A;  1WD3 A;  2YU2 A;  2FHR A;  2LUW A;  3HNM A;  5FZ6 A;  2B5H A;  1LOD A;  2IVJ A;  1Y9Q A;  1L7L A;  2W68 A;  4QXH A;  4S2G A;  4XVH A;  1WUV A;  5LB6 A;  5JDB A;  3W5M A;  5L9V A;  5AFE A;  2ZZJ A;  1WLT A;  2J1R A;  3OGJ A;  5FWE A;  2FMY A;  2KR2 A;  4AEJ A;  1RUG 3;  5CFD B;  3B3Q E;  1NLS A;  1I5P A;  3FMG A;  4XXP A;  3S0M A;  4M4P A;  2YPD A;  5CZK A;  3KD4 A;  4NPR A;  2VUD A;  5HCF A;  3WEZ A;  2ETE A;  3KV6 A;  2P5B A;  3ASI A;  2WFF 2;  4Y5S A;  3H3L A;  3TB0 A;  4M01 A;  1HW5 A;  1VPH A;  3VDC A;  4DOU A;  1S2B A;  3I59 A;  1VE0 A;  4YFW A;  4LKE A;  3ZXG A;  4XFB A;  2GP3 A;  3WQ1 A;  4NHM A;  3N35 A;  5E1R A;  3ACH A;  4ASM B;  1XE8 A;  4LR4 A;  5BNO A;  1CAV A;  2VUJ A;  2WWS A;  3ZO0 B;  1TMF 3;  3R0R A;  4AFB A;  2VME A;  4PBP A;  2QCS B;  1MS1 A;  4GKY A;  1BCX A;  4FOV A;  4AAX A;  3VD4 A;  4Y20 A;  1NA1 C;  2XJQ A;  3PVN A;  3FWE A;  2Y6H A;  2AUY A;  3DN7 A;  3DYM A;  4CCD A;  2D6L X;  1ZBA 1;  2WDB A;  4AOC A;  3ZXJ A;  2EVX A;  2W91 A;  1J3Q A;  2RS3 3;  4OMD A;  3T0B A;  3WQ0 A;  2GP5 A;  2JD9 A;  5FKB A;  3BIE A;  2HWF 1;  5JCT A;  4W65 A;  2IXH A;  4MZU A;  1IPK A;  1ZBE 3;  4PDW B;  1LED A;  4Q4V 2;  2RE9 A;  3M4F A;  1GNH A;  4EN7 B;  1SLT A;  4XFC A;  4XF4 A;  5JI7 A;  5LBB A;  2X53 S;  1YQ8 A;  2IZW A;  5C4W C;  1LES A;  1PGW 1;  3N36 A;  2VPV A;  1LGC A;  3ZXA C;  5A3M A;  4SBV A;  1IPS A;  4LIV A;  4BMB A;  1VB2 A;  1GV9 A;  2IXC A;  4CUA A;  3O7O A;  2ATF A;  1Z7S 2;  3ZYF A;  5J36 A;  1DYP A;  4FFG A;  4FQZ A;  2HWE 2;  4IE4 A;  5EPA A;  3SIS A;  4EZH A;  3BN6 A;  3ZSK A;  4D6Q A;  1VBB 2;  1JXN A;  4P9I A;  5LW9 A;  4YNI A;  4IEX A;  2A7A A;  1IPJ A;  3VBR B;  4AEM A;  2F4L A;  3AP5 A;  1AR9 1;  3ZFF C;  4KNC A;  1WBL A;  1DBN A;  1QIQ A;  5JIU A;  1GKB A;  1VMF A;  4ISR A;  4X8N A;  1DFQ A;  1OC1 A;  4XFF A;  1RUC 1;  3OY8 B;  2RR1 3;  3OSD A;  5FJK A;  5LA9 A;  1O3R A;  2R06 1;  3IT8 A;  4N90 A;  1ULP A;  1W2N A;  1W9Y A;  2PXJ A;  3LIG A;  4KU8 A;  3MUY 1;  4ERO A;  1O5U A;  3S5A A;  1OMI A;  3WP5 A;  4DY3 A;  5APA A;  4Q2F A;  5CFC C;  5IAX A;  3T09 A;  1V9U 1;  5C8C B;  1G9D A;  4E4Z A;  3AX4 A;  1PX3 A;  4ZKT B;  4TYS A;  1IOA A;  4BK5 A;  1F5F A;  3LB9 A;  2OXB A;  1A78 A;  3URF A;  4M0H A;  4EQV A;  1Y9M A;  2DUO A;  2V73 A;  5CKN A;  4YM2 A;  5A7P A;  1YQ5 A;  1AJK A;  5CIS A;  3WT3 A;  2QQL A;  1AZD A;  3TN9 3;  5FR3 A;  4OFG A;  3B02 A;  2GMP A;  2JDM A;  3LPF A;  3OPW A;  4ITC A;  5DN2 A;  2QQP A;  4GJZ A;  1QJE A;  4W50 A;  4Q0P A;  2VNG A;  4CCE A;  2BFU S;  3PUA A;  3PUH A;  1RHI 1;  4EYU A;  2D6K A;  1RJ8 A;  2JDU A;  4CYD A;  5M0T A;  3WDV A;  1G9B A;  2WKK A;  4YGE A;  5K0U B;  2R0F A;  2ID4 A;  1KFU L;  5DZF A;  4BQ3 A;  2VUA A;  2XXZ A;  4CU8 A;  5H9S A;  1KJR A;  2Y26 A;  4LBO A;  1FAY A;  2IVI B;  3D4K A;  1GOF A;  3IZO A;  4KWU A;  1QJY 3;  4QU1 A;  4QMA A;  3ZFF A;  5IK8 A;  1FNY A;  1W8T A;  2PMW B;  4G9S B;  3I2O A;  1DGR N;  2E6V A;  1VAM A;  2PN5 A;  2VMC A;  2JE7 A;  3OCP A;  1A8M A;  2ZEZ A;  1JN2 P;  1WWY A;  4CP1 A;  3FE5 A;  1N1V A;  1ENQ A;  4KGG A;  1JZ6 A;  3OOX A;  5FV3 A;  3E6D A;  3ZMN A;  1G9A A;  2FDI A;  2JKB A;  2C1F A;  5C8W A;  1OLM A;  1S2K A;  3FLP A;  4NHL A;  5J7M A;  5C9A B;  4WM8 B;  1I3H A;  1LKN A;  2QQV A;  4CU6 A;  2EXK A;  5JXH A;  1OPO A;  5C3O A;  2GZW A;  4DIN B;  3V0A A;  4CEY A;  4EWE A;  3ZYB A;  4Z8B A;  5KXE A;  2JE9 A;  5DAQ A;  4BJ0 A;  3DKW A;  2FDH A;  3GZA A;  2QQW A;  4L8Q A;  4P02 B;  2GSY A;  2WLP A;  4L0P A;  2YC2 A;  2ZGT A;  5EWS A;  3QH7 A;  4JHT A;  5IFT A;  1W6M A;  3WNP A;  3ZFG C;  3ZX7 A;  3AMN A;  4BQY A;  1OOP C;  4K1Y A;  5C7G A;  1OKQ A;  5CYY A;  2PLV 2;  2BOI A;  2WAA A;  2ES3 A;  3RRD A;  1BK0 A;  4GWN A;  4OHW A;  5I0R A;  4AYU A;  2XPJ A;  2BRT A;  2YDE A;  1UW8 A;  3CNA A;  3VDD C;  4A3X A;  2R6Q A;  1TME 2;  4H14 A;  1H0B A;  2W1W A;  4X8P A;  1AXK A;  2B46 X;  3I2I A;  4LBJ A;  2A6Y A;  1XRU A;  4V2V A;  1PVC 2;  1UOG A;  5FAX A;  4I0W B;  2P6C A;  4RHV 3;  1GBG A;  2HLE A;  5LRS A;  1YQ6 A;  2VNV A;  4A7Y A;  2VH9 A;  2FZ1 A;  4K1Z A;  4JAA A;  3HT2 A;  3SH5 A;  1WGP A;  2WZR 3;  4CDQ B;  3H7Y A;  5DAW A;  3T3Y A;  1TQ5 A;  3ITQ A;  5E8A A;  2Q4S A;  4Q4X 3;  4TLG A;  2CYF A;  5EYY A;  4Y4Y A;  4OI0 A;  3VL8 A;  1UY0 A;  1PO2 2;  3KV9 A;  1TMF 1;  4P00 B;  3VD5 A;  1Y9G A;  1JYV A;  3HD8 B;  2KXL A;  1SMV A;  2GNM A;  4CUG A;  5C33 A;  5IVC A;  1POQ A;  3LKJ A;  3ZVX A;  2WT2 A;  2PLV 3;  2VW0 A;  4CA9 A;  4LO5 B;  1UU5 A;  1AL2 3;  2VO5 A;  5DG1 A;  2KM2 A;  5FQ0 B;  2BOJ A;  1HQL A;  2W95 A;  1AX2 A;  3GNE A;  3IDA A;  3GZT B;  3DYP A;  5LRR A;  4LIU A;  2X09 A;  4NRO A;  1X7N A;  3MIE A;  1RUH 2;  1DQ5 A;  3HN1 A;  4LHK A;  4YG6 A;  5EYX A;  1LOC A;  1UXZ A;  2XUE A;  3D0J A;  3LSE A;  4P08 A;  2HKX A;  4XQW A;  4ARX A;  2XL7 A;  3ZR6 A;  3KCY A;  1W04 A;  1PX4 A;  4BQ5 A;  3V65 A;  5IVE A;  1PIV 1;  2LRP A;  4GIQ A;  1POV 3;  4CEW C;  2EID A;  3NKT A;  1RTV A;  2NYY A;  1JYC A;  4GZ9 A;  1LHO A;  5CNA A;  5GAL A;  1NXM A;  1S4C A;  3TNQ A;  1ZRE A;  4KMQ A;  2P34 A;  2VEC A;  4IEW A;  4IV1 C;  4RL7 A;  1W8Z A;  1WA6 X;  3PUS A;  4RR3 B;  1WBF A;  4O65 A;  2VVF A;  3HOB A;  5FZ3 A;  1QEX A;  4MGZ E;  3PVE A;  1EV1 1;  1V6O A;  3OUJ A;  3FUO A;  4DXT A;  1L7Q A;  1N3O A;  4MHR A;  3AM2 A;  4NAM A;  4JKM A;  1QQP 1;  5JVV A;  3ZXL A;  3ZPO A;  3INA A;  1REE A;  1NOV A;  4MH0 E;  4AEK A;  4YFZ A;  3U4X A;  1KJL A;  2JWP A;  1I9R A;  1C57 A;  1OBN A;  3E5U A;  2J1T A;  1VBC 2;  3LCP A;  2LS6 A;  1OVS A;  5BNP A;  1W0O A;  3CJX A;  1PM4 A;  3IDB B;  1XNK A;  1JH5 A;  4HON A;  5EXO A;  4B3N A;  3UKT A;  1KIT A;  1X9T A;  2Y8K A;  3B7M A;  1D0H A;  3ACI A;  2EXJ A;  3VBH B;  4ZU4 A;  1MR5 A;  1XPW A;  2D6O X;  4LBQ D;  1COV 2;  4YVW C;  1NQD A;  1QOO A;  2BYV E;  2PAE A;  4FPO B;  2V4A A;  5GLW A;  1REF A;  4JDM A;  3HAG A;  3QBQ A;  4XCB A;  2W0X A;  3SLI A;  4LBN A;  1CD3 G;  3QAC A;  2W5F A;  4QX3 A;  5JXJ A;  2OS2 A;  3E97 A;  3SCF A;  3M8L A;  3PUR A;  1TNR A;  2LW8 A;  3GHN A;  4XF1 A;  1DQ2 A;  4I0A A;  3CIH A;  3W9A A;  5FZB A;  4WZF A;  4FPC A;  2JB8 A;  4U2A A;  5DDJ 2;  3SKJ E;  4EE2 A;  2R04 1;  4N53 B;  1AR6 1;  1RUD 3;  5EFU A;  1GZT A;  1WD4 A;  3ZYR A;  1EV1 3;  5LY2 A;  2YGM A;  1WKY A;  2GMM A;  1GOG A;  2YC4 A;  5FUP A;  2GH8 A;  4QPY A;  2VZO A;  3T08 A;  3UGH A;  4DS0 A;  1H8T B;  1UMH A;  4E2G A;  3ZYG A;  2JJ6 A;  4BXS V;  1OF3 A;  1C4R A;  2XB6 C;  3JD7 3;  2RMU 2;  1CGP A;  1ZM1 A;  3VLB B;  5C9A C;  3MZH A;  5T52 A;  1ULG A;  1D7P M;  3ZXE A;  1UY4 A;  3NVC A;  1D2Q A;  3OGG A;  4E2S A;  4LO6 B;  1L7R A;  2A3W A;  3MIF A;  3RVH A;  2Q1F A;  1VBD 1;  5F5C A;  5J98 B;  4QXC A;  5J37 A;  1QXR A;  5FMO L;  1LOF A;  4XHB A;  1GMM A;  2Y6J A;  4L9B A;  3KVA A;  5FYV A;  3FUQ A;  4Y24 A;  2LM3 A;  5FPA A;  5I8Y A;  3OGR A;  1LTE A;  2AEN A;  4QDQ A;  5J3U A;  2G9F A;  4IV3 B;  2A3Y A;  5A6Q A;  1DDL A;  1LOF C;  3N3H A;  5FUN A;  5FZL A;  5CKM A;  4CUB A;  1IG3 A;  2RS3 2;  5JUV A;  1DGW A;  1J83 A;  2NMN A;  1POV 0;  5EJ3 A;  3K3O A;  1XNC A;  1OOP A;  2HEV F;  2WZR 1;  4RS5 C;  5FJH A;  5C6C A;  5T50 A;  3BB6 A;  2FZ2 A;  4URT A;  1MQT B;  1O8S A;  3CZJ A;  5F3G A;  3AYE A;  3LAG A;  1VMH A;  2RHP A;  1B35 C;  4KGQ A;  2JDN A;  4FSJ A;  4PCR A;  1NY7 1;  4D0Q A;  4LEJ A;  4JZR A;  3ON7 A;  4CU7 A;  1AYN 1;  1H1I A;  4I2O A;  4UFI A;  4N7U A;  3R4S A;  3M7A A;  2BW8 A;  3VKL A;  1W39 A;  4PT6 A;  3LGR A;  3WR0 A;  1JYX A;  2VGD A;  2P37 A;  2FDJ A;  4YAR A;  4PDW A;  1MQT A;  3OD4 A;  5FPU A;  3KHB A;  1OA3 A;  2WLQ A;  1VBA 3;  4GAZ A;  5FIX A;  4YYO A;  3TEW A;  2ZHL A;  3HR9 A;  5KXD A;  5EJZ B;  5F2W A;  4NWW A;  1JMU B;  3WIN E;  1OA2 A;  2TBV A;  1X8E A;  3OJB A;  1GP5 A;  3PTR B;  3OEA A;  2GND A;  3CLP A;  3OY8 A;  1FV3 A;  4GB3 1;  4KH9 A;  4XFA A;  2WAO A;  2DCK A;  4IV3 A;  1SBD A;  4JGZ B;  4XJ9 A;  3J7L A;  3UK9 A;  3EQE A;  3L2H A;  4EWA A;  2R16 A;  3R05 A;  1AUY A;  1HXS 1;  2NMO A;  1GZC A;  1HRI 2;  3VBS C;  4CDW A;  5FTT C;  1VP6 A;  5GZG A;  5DDJ 3;  4XAB A;  3DL3 A;  1CES A;  2W87 A;  5IJR A;  4C8D A;  2VCB A;  4LOR A;  4CPB A;  1NZC A;  2ZJC A;  1CJD A;  2BFU L;  4Y1Z A;  2BUK A;  3C3V A;  3B9I A;  3VBR C;  5BY5 A;  1ENR A;  2D5H A;  2HWD 1;  3PJQ A;  4QPI A;  2Z42 A;  3T0D A;  4JC1 A;  5AC9 1;  4BQW A;  3POY A;  1H2M A;  3DUI A;  1Q5O A;  1YI9 A;  2Z5W A;  4K40 A;  4B1L A;  1BKZ A;  3RQ0 A;  4KBB A;  1DIW A;  2GNT A;  3MFA A;  3POB A;  1SFP A;  5JMC A;  4BHP A;  1O4T A;  3USU A;  1JOJ A;  2Q1Z B;  5DAB A;  2H0V A;  4M3C B;  3NST A;  1FOD 1;  1FAT A;  4CTE A;  1OI6 A;  4FAH A;  4A2U A;  2XG3 A;  3MPB A;  1Z0H A;  4ATE A;  4XUP A;  5FMC A;  5LA0 A;  4IE7 A;  4CDQ A;  3ZR5 A;  1I6X A;  1KDK A;  1S0I A;  2W08 A;  3FFQ A;  2R1B A;  1UZV A;  2BTV C;  3HQX A;  3T1M A;  5D21 A;  2E9Q A;  4H7M A;  2JEM A;  1CAW A;  2JIJ A;  3WDW A;  4AQS A;  5FXZ A;  2Y38 A;  4UW3 A;  1XND A;  4Q4Y 1;  2RMU 3;  3AKS A;  1RL3 A;  5FZF A;  3VBO B;  5A3T A;  3ECQ A;  4FTS A;  5F32 A;  2E31 A;  3ATG A;  1UY2 A;  5D8A C;  4GWM A;  2OYZ A;  4FP2 A;  1UX7 A;  2R06 3;  4LKF A;  1RUC 3;  2ZX0 A;  2JDP A;  3VZK A;  2PHL A;  2W9X A;  4AI0 A;  2DVD A;  1O3S A;  4LPL A;  3T2O A;  3UKN A;  4AGR A;  1UZY A;  4DPN A;  4LUK A;  4P9Y A;  3PHM A;  1S55 A;  5JXI A;  2P1B A;  2Q1M A;  1JZ8 A;  5A7S A;  2NPI A;  4CDU C;  3ZSJ A;  1HIX A;  1RUD 2;  2BDR A;  4FFH A;  3NRU A;  4HPK A;  1SBF A;  2PTM A;  4TLF A;  4EJR A;  3O1U A;  1C8M 2;  1OHF A;  3FHA A;  1R64 A;  5BYN A;  2SBA A;  4XUT A;  1W6P A;  3B00 A;  3LE0 A;  2OPK A;  2VD7 A;  3S6P A;  2JEC A;  5FRE A;  3F2Z A;  2P4E A;  3N9Q A;  2BVB A;  5EZW A;  4QHZ A;  4XIL A;  3VHO A;  4CDQ C;  1S0J A;  5CG9 A;  1N3P A;  2FCU A;  4QX0 A;  1UQX A;  3V64 A;  1E57 A;  2EAA A;  2IFR A;  3PLQ A;  4HLT A;  4CEY C;  2C6S A;  1N47 A;  1RMU 1;  5JMO A;  4H7L A;  3RG0 A;  1S1A A;  3RZL A;  4A7Z A;  5FYC A;  1ZBA 3;  4CXW A;  2WS9 1;  1JZ7 A;  1XQN A;  1GLH A;  4LO4 B;  5JPN B;  3PTY A;  5HCB A;  2QTW B;  1PVC 3;  1LRH A;  3OUI A;  5FLI A;  2XH6 A;  4EN9 B;  2BQP A;  3N9P A;  4Y22 A;  1Q8Q A;  1HDK A;  4XMA A;  3PDQ A;  1U5Y A;  4O61 A;  2WC2 A;  3PNA A;  4FPG A;  1QJU 1;  5LAT A;  5I0S A;  5LK5 A;  1XSR A;  4RYD A;  4UAP A;  4Y22 B;  2EXI A;  4LE3 A;  3V0A B;  5FLH A;  4UWD A;  4V1P A;  2AGS A;  5T5J A;  1K12 A;  4YZ3 A;  5CU1 A;  1C3H A;  1JYW A;  5FZD A;  4L99 A;  1FX5 A;  2I2S A;  2VZP A;  5HI0 A;  4BLI A;  3HNB M;  1XB9 A;  3ZOI A;  1N1T A;  2ZEX A;  4QPG B;  4L11 A;  1UX6 A;  4O9G A;  2Z69 A;  3N9L A;  4B7E A;  3BGA A;  4WM8 C;  4FPE A;  4ES8 A;  3DXT A;  5KHJ A;  1ZYB A;  2OT7 A;  3ZSE A;  2YYO A;  1UU4 A;  3NNM A;  3VHN A;  5IVF A;  4IUG A;  5FYT A;  3ZN5 A;  3NNJ A;  3VD9 A;  2IXK A;  3E5X A;  1YEW A;  1SEF A;  1QU0 A;  4UW6 A;  4QQ2 A;  5GJ6 A;  3VKO A;  4QPG C;  5FY5 A;  4AHY A;  3MID A;  2IXI A;  1YFY A;  3LD8 A;  3RSJ A;  2ARE A;  2D97 A;  4WM7 A;  2K9Z A;  4BPZ A;  3WNO A;  3HN3 A;  2R7E B;  1RUF 1;  2PHT A;  3FBM A;  1BZW A;  3LF7 A;  1JYN A;  1JW6 A;  5C70 A;  5A7W B;  4AQ6 A;  3NV3 A;  1MQT C;  1UYX A;  4DXZ A;  4Q4X 2;  5FPZ A;  1Q56 A;  1UWW A;  2WUH A;  1NCR A;  3MIG A;  4E27 A;  4PF5 A;  3RZG A;  1UZ0 A;  2L9L A;  3ZKU A;  2VTX A;  4P14 A;  1AXZ A;  1TVG A;  1MVE A;  3BPZ A;  3KWV A;  5FXW A;  2VE1 A;  1SBE A;  4BQ1 A;  2QQU A;  3SHR A;  3UT0 A;  5LZ6 A;  4RHV 2;  4CE8 A;  1VRH 1;  5FZK A;  4CEY B;  2W2I A;  1YNA A;  1H8T A;  2JKX A;  3BU7 A;  3SEE A;  4B4P A;  1US2 A;  4GAL A;  3C8X A;  3A0K A;  2P17 A;  4XHX A;  1UL9 A;  3ELN A;  4XET A;  3RWK X;  3AXE A;  3GZE A;  5IFP A;  1OLR A;  1LHU A;  2ET7 A;  4AI9 A;  1O3Q A;  3IDE A;  4N53 C;  5FPV A;  3BI3 A;  4N7I A;  4ZY9 A;  4XZU G;  1RUI 1;  4GH4 C;  4FFI A;  1NX9 A;  1Z7S 1;  4Y20 B;  5BUV A;  1YC6 1;  3AYA A;  1YIF A;  3FC0 A;  4LE4 A;  4BK4 A;  3DXU A;  1WCK A;  3KT4 A;  5FKC A;  5A3P A;  3AKQ A;  2G4I A;  3V56 A;  2E51 A;  2B9V A;  3G7D A;  2WNE A;  4MET A;  1ZVF A;  4I01 A;  3KQR A;  5FPB A;  2EIG A;  5GZD A;  3LDR A;  3AP6 A;  3N9O A;  3M3I A;  1OD3 A;  2PHX A;  2OKX A;  4AG4 A;  4PI0 A;  1RUC 2;  3IPV A;  4CEW A;  1RUH 3;  2ZKL A;  4AI8 A;  3AKP A;  2DFC A;  4E4H A;  1IQD C;  2HEW F;  1JUH A;  2OZJ A;  4QX8 A;  2O0O A;  4MHU A;  3VZN A;  3ZSL A;  4BYY A;  5A7Q A;  2EIE A;  1AL2 2;  2F6B A;  3UGF A;  3UYJ A;  2EF6 A;  1DZR A;  2XHK A;  1LU2 A;  3CF6 E;  5H9P A;  1LR5 A;  1O5L A;  5GM0 A;  3FBY A;  3CJI C;  5CVR A;  1NAE A;  4MX3 A;  2J42 A;  1GUI A;  4Y3O A;  3WF2 A;  2OQ7 A;  1MZ5 A;  1AHS A;  5F3I A;  5B4N A;  1PO1 1;  4MO3 M;  4DIQ A;  1DG6 A;  1QDC A;  2HWB 3;  1T6G C;  1TG7 A;  1XNB A;  5T5L A;  5IK4 A;  2Q5T A;  4QQL A;  4DRR A;  3O0V A;  2ZZQ A;  2XBO 1;  4ASL A;  4H2A A;  1S0C A;  4GQ7 A;  3VBR A;  1WW6 A;  2DCJ A;  3USS A;  1W3X A;  3H42 B;  4N43 C;  2E26 A;  3ETQ A;  2BWA A;  2K2S A;  2VQ0 A;  2XKP A;  3WDY A;  1OD5 A;  5EP9 A;  4CCJ A;  3SXW A;  5IVY A;  1ASJ 1;  4ASK A;  5F5Q A;  4CZS A;  1HV1 A;  1VRB A;  1UD1 A;  1UY1 A;  1YCI A;  3RJ2 X;  4F8A A;  5LCW L;  4HK9 A;  4Q26 A;  2XLA A;  1C8M 3;  5EJ1 B;  5FP3 A;  3ETP A;  5I0T A;  5FZM A;  5FY0 A;  2NZ9 A;  1DP0 A;  4XOG A;  1QXJ A;  5FO7 B;  4K7J A;  2E7T A;  2DTW A;  2B39 A;  3MW4 A;  1ULC A;  4IV1 A;  3DGT A;  4GWJ A;  2Q30 A;  1CX1 A;  1ZA7 A;  1Q8V A;  2VXR A;  1HLC A;  4PIY A;  3T30 A;  1T6B X;  1VAK A;  4AFA A;  5DUU A;  5EV7 A;  3LDK A;  1ODM A;  1XBF A;  1P8J A;  4XBQ A;  2V5Y A;  3LDB A;  3TRS B;  5F9T A;  2CL2 A;  1D4M 3;  4Y1U A;  5T3N A;  1SPP A;  3AFG A;  3DV8 A;  2TUN A;  2CU5 A;  4RSU A;  2ERF A;  2P6H A;  5BNO B;  1ENX A;  2A73 B;  3CU7 A;  1UPI A;  4FTE A;  1E5I A;  4NR1 A;  5H9Q A;  3W59 A;  1ZZ6 A;  1GR3 A;  1LOG A;  2ZGM A;  3C7F A;  2PA7 A;  4GH4 B;  5FMB A;  1BVP 1;  5DAP A;  2QUO A;  5KBF A;  1SFN A;  3I2F A;  4HPK B;  4RQP A;  3TOJ A;  1JOD A;  1QJY 2;  1BVV A;  2RM2 3;  4TXW A;  4QWN A;  3VZO A;  4QX7 A;  1DQ0 A;  1GAN A;  2KA3 A;  4AVA A;  3FJS A;  3P1I A;  1BBT 3;  5I93 A;  1E5S A;  2DYC A;  2V5D A;  1WCD J;  3A0N A;  3TBD A;  1E5R A;  1PMJ X;  1VR3 A;  4QQP A;  5A7W A;  2GU9 A;  2YGL A;  1F5J A;  1LEC A;  1JS9 A;  1X8M A;  1HV0 A;  2HWB 1;  1JYT A;  4GWI A;  5SV5 A;  1C1F A;  2VNO A;  2VU9 A;  3M2M A;  2BPA 2;  4IEY A;  4I02 A;  5A3O A;  4N9H A;  1H2N A;  4OCT A;  1IGO A;  1MS5 A;  1Q43 A;  1TMF 2;  2D93 A;  2WQ8 A;  3BAL A;  3ZDV A;  1AYM 3;  4ATF A;  4Q4W 1;  1XXN A;  2WR9 A;  3J26 N;  2V72 A;  2VQU A;  3NW4 A;  1RIR A;  3FN9 A;  2OA2 A;  1U5X A;  3MLJ A;  4MGT A;  4EV0 A;  1WZX A;  2YC0 A;  2VOW A;  2R07 3;  2O1Q A;  1H6Y A;  1NLR A;  4QPG A;  2D98 A;  4YW5 A;  3UES A;  3VBU B;  4AXO A;  1HRI 3;  3E6C C;  2WFF 3;  3AYD A;  3T0A A;  3N7M A;  3AL5 A;  2PAM A;  3RDI A;  5BPX A;  1O7F A;  3ZFF B;  3SNM A;  5G04 L;  3AMQ A;  2HWC 1;  4DB5 A;  5KC6 A;  3VBF C;  1QWR A;  2BBA A;  5DQ0 A;  1QXP A;  1FPN 2;  1FPN 3;  4LA2 A;  1W9S A;  4LUM A;  1NCQ B;  1HB2 A;  1H9W A;  5FP4 A;  5FUI A;  3WNL A;  1ZZC A;  3PL0 A;  2HWE 3;  3GXU A;  1VBA 2;  1IKP A;  1W6O B;  3AVR A;  1WMD A;  1VBE 1;  3VUO A;  4ZXK A;  1W2O A;  1EV1 2;  3OBT A;  5KHI A;  3BPS A;  1KRI A;  2O8O A;  1VJ2 A;  2VAU A;  4UFM A;  1DZT A;  3MFC A;  4NRQ A;  1CR7 A;  1DYO A;  2A6Z A;  2G1M A;  1H1M A;  1JZ2 A;  3HQU A;  3PME A;  2RJ2 A;  4GA9 A;  5A33 A;  1UAI A;  4IE6 A;  2QNK A;  3KGL A;  4QXB A;  3PUI A;  1EAH 3;  2DCT A;  4NII A;  1HQN A;  4KBZ A;  4OHZ A;  2RV9 A;  3BOP A;  3M70 A;  2E7Q A;  1ZBE 2;  1STM A;  4E9K A;  4TSV A;  4OI4 A;  2DU1 A;  4ZZ5 A;  1ZX5 A;  4M0N A;  1IS5 A;  3HEI A;  4UW5 A;  2DVF A;  1XNA A;  2W52 A;  2P3Y A;  3PU3 A;  1W6P B;  2Q8D A;  5KR7 A;  3OEB A;  3J8F 3;  1A8D A;  5F8P A;  3ZYH A;  4V2W A;  4P9W A;  3ZDS A;  4BIO A;  1NCR C;  2DUQ A;  1WW7 A;  3VDD A;  2A6X A;  4NIH A;  2DCZ A;  1APN A;  2DFB A;  4P5Y A;  1ULD A;  3J9S A;  1BBT 2;  5DUW A;  3MV0 1;  2UUR A;  3RWN A;  2ZGU A;  4GMP 3;  1C8N A;  3WW2 A;  5L36 A;  2R04 2;  3B94 A;  4CDX C;  3NNG A;  1W06 A;  5IVV A;  5LWB A;  1PZ7 A;  1KGY A;  3T2T A;  3VKF C;  1JHJ A;  4YZ4 A;  3ST7 A;  2VC9 A;  2UWB A;  3J4U H;  3Q9O A;  5FMD A;  2A6V A;  1MEC 1;  1LGN A;  4I30 A;  2QFE A;  3VBO A;  5DAX A;  3EXU A;  5A3N A;  1D4M 2;  2VQA A;  2PHD A;  2Y0I A;  4LIT A;  1D4V B;  1XNT A;  3ZKY A;  3JD7 2;  1LCL A;  4A42 A;  1FMD 3;  5GKA C;  5C3P A;  5F1R A;  4AED A;  2WL1 A;  4FCA A;  1QJF A;  4M00 A;  4UFK A;  1FXZ A;  3SCH A;  3WP4 A;  4A44 A;  3V0B A;  2VQT A;  3GZU C;  3VD3 A;  2VOK A;  1JU3 A;  3WW4 A;  5HXV A;  3U07 A;  4UFL A;  1ULO A;  4P9L A;  3POG A;  2K46 A;  2B7Y A;  4W6X A;  4D69 A;  1MZF A;  3WNK A;  2O14 A;  5FYI A;  4RD7 A;  3I3E A;  1AR8 1;  3ZYJ B;  1QJU 3;  1CAU A;  1PM7 A;  3EBR A;  2VMF A;  3GDB A;  3I2J A;  2X29 A;  4D6S A;  2WFP A;  1QJZ A;  1H6X A;  3LOI A;  4MV2 A;  1RUE 2;  2J1E A;  1HX6 A;  1KDM A;  2TEP A;  2ZAH A;  1XYN A;  4CRQ A;  3OGS A;  3WCS A;  1YRZ A;  3VZL A;  2WYF A;  4LKD A;  1S0D A;  2WS9 3;  2ZHM A;  3DF0 A;  3H1Y A;  1W8H A;  4QPI B;  4Y5T A;  4HMZ A;  5ISL A;  2ARC A;  3OB8 A;  3WD5 A;  1WMX A;  5LBF A;  2VOT A;  1W8F A;  2MEV 2;  1G8W A;  4FOW A;  1COV 3;  3NJZ A;  3NWK A;  1CPM A;  5FK8 A;  3J8F 1;  4Q27 A;  2CDO A;  1UOB A;  4Y5Z 0;  2WWU A;  3WNN A;  1RIN A;  4NO4 A;  4CDU A;  4HXC A;  4HKO A;  5A1F A;  1V6L A;  4JKK A;  4BH9 A;  5ANQ A;  2R30 A;  3CDZ B;  1WLW A;  3RMX A;  1DHK B;  2LRO A;  3ZM8 A;  4AHX A;  4DNY A;  1ACC A;  2GN3 A;  3AB0 A;  4JQT A;  4OHV A;  4CPB D;  2ZGN A;  3I7D A;  2X05 A;  2OW4 A;  4C0H A;  4IEU A;  2VZT A;  1CJP A;  2HBT A;  4FOY A;  2QDN A;  5I8S A;  5A6X A;  3V0B B;  3ME2 A;  2NP0 A;  1PGL 1;  5A7N A;  3VBU A;  4RFT 0;  4M4R A;  4QQO A;  2AEY A;  2X5I C;  4OVE A;  5DZE A;  1S0B A;  2ORZ A;  4UI9 L;  5CIR A;  4ZS2 A;  1R08 1;  4PLO A;  1FMD 1;  4JDN A;  4ZXE A;  1E5H A;  3MIC A;  3ZFG B;  2GN7 A;  3OYW A;  3LEG A;  2JXA A;  4LO8 A;  2XR4 A;  2JG8 C;  2NQY A;  3WCR A;  4B4Q A;  3RZH A;  1NCR B;  3DEC A;  1BJQ A;  3D0S A;  1ST8 A;  4XFH A;  4FBF A;  5JI9 A;  1ND2 B;  4AGG A;  2ZGL A;  2A75 A;  4BCU A;  2B42 B;  4XMI A;  2CY6 A;  1HRI 1;  3P3N A;  5GZF A;  4D6R A;  3FHI B;  4CXY A;  3BIW E;  4WM7 B;  3WDX A;  2LTN A;  1EUT A;  3IKW A;  1G6N A;  4AVS A;  3Q8A A;  3TWI A;  1MPX A;  5G05 L;  2HYK A;  1H4G A;  4IEO A;  3S5Q A;  4ORF A;  3THP A;  1B09 A;  1CZT A;  1YO8 A;  1B35 B;  1AYM 1;  4Y26 A;  3TYJ A;  2FDF A;  1HKD A;  2CWS A;  4WVM B;  5JPM B;  4TZD A;  2XQR A;  4QM8 A;  1B35 A;  1XSQ A;  2D6P A;  3K77 A;  3TEX A;  3WG4 A;  2D5F A;  1CON A;  5AC9 3;  1RUJ 1;  5D1I A;  4S2D A;  1BEV 1;  4MAD A;  1GQG A;  2HWD 3;  2WZ8 A;  1VBC 3;  5F2S A;  1EAH 1;  3TN9 2;  2BP6 A;  4AGV A;  2ADD A;  4MGK E;  2CGO A;  5HCA A;  1UOJ A;  2RM2 1;  3MPP G;  1BYH A;  2Q8O A;  4BLJ A;  1V6M A;  1LU1 A;  4NAO A;  5K8S A;  3WX5 A;  4C1W A;  5FCC A;  3WF1 A;  1TME 3;  3NNL A;  4FPJ A;  1ND3 B;  5FO9 B;  1VB4 A;  1GYK A;  3OBZ A;  4XW3 A;  4FPF A;  2CNA A;  4AQ2 A;  5JOX A;  4JQR A;  3IAQ A;  4XEZ A;  4D8M A;  4PDW C;  4QPI C;  5FY9 A;  3VKN A;  3HIF A;  4ZU7 A;  1UMI A;  2VCM A;  4F83 A;  2RR1 2;  4OUS A;  2R49 A;  4XJZ A;  4DUW A;  3IB3 A;  3WF3 A;  4ET7 A;  2A6W A;  4IGQ A;  2WT1 A;  2QE3 A;  2VZ1 A;  3LEM A;  4AED C;  4ISQ A;  3MF9 A;  3RYR A;  2WN3 A;  3VBS A;  4CDW C;  1SFY A;  4LK6 A;  4LTA A;  3HWJ A;  4XAE A;  2WFF 1;  1GNY A;  3WOG A;  5A6Z A;  4ZZ8 A;  5KHK A;  4DZG A;  3CQO A;  3M1H A;  4A41 A;  1G7Y A;  4M3C A;  2VZU A;  4P9X A;  4AVB A;  1JZ4 A;  5DXD A;  3WLU A;  3E6B A;  3USU B;  1C8M 1;  2GC0 A;  4M3C E;  3NMB A;  1GIC A;  3N7L A;  2MHF A;  3ILR A;  3HQR A;  2IC1 A;  2GC1 A;  3III A;  1JI6 A;  3WY6 A;  2XJV A;  1PO2 3;  5FY4 A;  4CP0 A;  4C0B A;  5JSP A;  1IG0 A;  1ZNP A;  2HH9 A;  2DVA A;  1LEM A;  2D6N A;  3VL9 A;  3AFK A;  3JBG 1;  5K4L A;  3K46 A;  2RS5 1;  2CGN A;  1DQ4 A;  1UYZ A;  1ZBA 2;  3ORJ A;  4HAN A;  1MVQ A;  4JRA A;  3B5L B;  1O91 A;  2XBO 3;  3N4M A;  2XLG A;  3KVB A;  4XTP A;  2FDG A;  1SG3 A;  1YFU A;  1W2U A;  4LNV A;  4Z07 A;  2HWF 2;  1JZ3 A;  1ENS A;  3KV4 A;  2UYA A;  5TSW A;  1CAU B;  1K3I A;  3M3C A;  3J7N A;  1MS4 A;  2ZKN A;  4O9E A;  4GKX A;  1S2E A;  1W8O A;  4HKL A;  3O1T A;  1OVP A;  2QQM A;  1KD7 A;  2JX9 A;  3H3Z A;  4B7K A;  4E4S A;  1EPZ A;  1KXG A;  2GH2 A;  1R1Z A;  1XE7 A;  3WQB A;  2I74 A;  3NJX A;  4COY A;  1U5I A;  2BU9 A;  4AAP A;  5FZ8 A;  2CDP A;  4MLO A;  4Y33 A;  4GMP 1;  5JOZ A;  3SH3 A;  5K0U A;  2FCT A;  1V6J A;  3HT1 A;  5A32 A;  4GJY A;  3QH6 A;  2DF7 A;  3ES4 A;  4IND A;  1W99 A;  4JTO A;  2XWJ B;  1YWK A;  3KT7 A;  4C1X A;  1S0E A;  3WDT A;  5I91 A;  4ARY A;  5FP8 A;  4YVS C;  2ZAC A;  1LB2 A;  3AP4 A;  3PU8 A;  4K21 A;  1VMJ A;  2P3K A;  5L7O B;  4IET A;  2R06 2;  4LBL A;  5T5O A;  3OPT A;  2XVL A;  3WUC A;  4XIO A;  5IAT A;  5A3L A;  4IGP A;  4I3G A;  3GAL A;  1R1A 3;  1Q8S A;  3RI9 A;  1BLZ A;  1U12 A;  3J7H A;  3ZPY A;  3AZZ A;  1HRV 1;  1LOB A;  4J1X A;  4Q4V 1;  4TN7 A;  2ORX A;  1DU3 D;  2VMD A;  3N9M A;  5JR2 A;  2OPW A;  5H9R A;  4IEQ A;  2NM1 A;  1QJX 1;  4BWO A;  2CHH A;  1N1S A;  1J84 A;  1OF4 A;  3IM0 A;  4LKS A;  4R52 A;  3OUH A;  4ZON A;  2PAK A;  5E6H A;  3ENR A;  5FZ7 A;  2FD8 A;  5FZH A;  2XLF A;  4YZ5 A;  3K51 A;  1OQ1 A;  2YV8 A;  3UV9 A;  1BEV 3;  1R1A 1;  1LEN A;  1W8N A;  1VRH 3;  4QHB A;  2HWE 1;  4R9D A;  2CWM A;  1VBB 1;  3PMS A;  3MHZ A;  4BIS A;  4DEQ A;  1NE4 A;  4YPJ A;  4A4A A;  1AR9 2;  3RZJ A;  3A21 A;  5FYB A;  2OVU A;  1RVF 1;  4E8C A;  1UNB A;  5KC5 A;  2ENR A;  4R4X A;  3I2D A;  4LHN A;  1ZRI A;  2WNV A;  4Y4R A;  2WT0 A;  4KL1 A;  1QMJ A;  2XJT A;  4R9A A;  1VAV A;  1C5H A;  1XC6 A;  4LHL A;  4OHX A;  5ABJ A;  3H8X A;  1PK6 C;  4XZP A;  2QQI A;  3POI A;  5CEH A;  3BU0 A;  1OFS A;  3ZFG A;  2FDK A;  3RYK A;  3AMM A;  3ZMO A;  4A45 A;  2Y6G A;  5A32 B;  3S30 A;  4HET A;  1XU1 A;  4FI9 A;  4AL9 A;  1YIP A;  2EAL A;  1NKG A;  4S2H A;  4RQP C;  3NJV A;  5FBJ A;  2XJP A;  1NXD 1;  3WHU A;  2A3X A;  2C26 A;  2IWG B;  1H30 A;  1H8T C;  4MYE A;  5K9Y A;  1T2X A;  5J48 A;  1RUG 2;  3WVJ A;  5LEJ A;  3TEZ A;  2NN8 A;  2P3J A;  1LUL A;  4HK8 A;  2YUE A;  5KWR A;  4QT6 A;  2JG9 C;  5FY1 A;  2GAL A;  4MXW B;  4NVP A;  2PLV 1;  2RS5 3;  3R4D B;  4XF0 A;  2W3J A;  3JBG 3;  3KF5 A;  1SLA A;  1Y3T A;  4AF9 A;  1GZ9 A;  4CP2 A;  5FLJ A;  4Q4V 3;  1G9F A;  1HRV 3;  1OT5 A;  2WNO A;  1YQ2 A;  1PO1 2;  4BQ4 A;  5JZG C;  4DEV A;  5ABJ B;  1PVC 1;  3PVO A;  4CXX A;  4WBB A;  4BE3 A;  1K45 A;  3LEI A;  2WNV B;  2VBP A;  1X36 A;  2YRO A;  4FPL A;  4YG0 A;  5AVA A;  2TNF A;  3RI8 A;  3AZW A;  5FYY A;  3U1X A;  4J25 A;  4NPL A;  1ZA4 A;  4AI1 A;  2WQZ C;  2JDA A;  1J1T A;  3A7Q A;  5BNN B;  5C8C A;  2VUC A;  3JQX A;  1W6Q A;  3VHR A;  2VOX A;  1Q8O A;  5A6Y A;  1X50 A;  2JEN A;  2W1Q A;  4B29 A;  1A3K A;  3SKV A;  4RR3 A;  2VXJ A;  3HPN A;  4GXL A;  1ASJ 2;  1JUI A;  5CB7 A;  3U37 A;  1H1A A;  5C3R A;  3I3M A;  1QH7 A;  4N53 A;  4R9B A;  2G9Z A;  3B69 A;  5JAX A;  2J1S A;  3RZZ A;  3AMH A;  4K6B A;  5FZI A;  4KWK A;  5J1X A;  2BWC A;  5C3S A;  2VCA A;  2BV4 A;  4H3W A;  3K4A A;  4B4R A;  4IV1 B;  1BHG A;  2W46 A;  4XUO A;  1W9W A;  1VLN A;  1ASJ 3;  1TME 1;  2ZAA A;  2Q8E A;  2WII B;  1JBC A;  4UOJ A;  2GNB A;  2Y34 A;  2BBV A;  1WMF A;  1RXG A;  2YPJ A;  1XJA A;  2PHW A;  3H9A A;  2C4X A;  4DUV A;  5KHG A;  2WBK A;  1I1E A;  2UU8 A;  4COU A;  1SCR A;  2HYX A;  4L97 A;  4BM8 A;  1R09 2;  1ZZ9 A;  2QJV A;  4OI2 A;  4Q1P A;  4XXA A;  5DUX A;  5FO8 B;  1PMI A;  1UY3 A;  4QX5 A;  2AH2 A;  5E89 A;  3D8C A;  2QKD A;  3BTY A;  1VAL A;  4CCO A;  1PO2 1;  4YLZ A;  1IZ3 A;  1DYK A;  1W0N A;  4JDO A;  4XUQ A;  1OPM A;  1LOA A;  4A6O A;  3EB7 A;  4KWJ A;  5L7O C;  1KFX L;  5A3W A;  1IQA A;  5IYY A;  4NIG A;  4OYU A;  3ROU A;  1IS4 A;  2RDN A;  5HPO A;  1AJO A;  3IBM A;  1W90 A;  5C4W A;  4AI2 A;  1PNG A;  4MSV A;  3CJI B;  3ACL A;  4QDS A;  4FTB A;  4OHY A;  1RC6 A;  4K8F A;  3LZZ A;  3J7M A;  3M3Q A;  1RUH 1;  3ZFE C;  3VZJ A;  2ZPX A;  1BK1 A;  5D2A A;  1QF3 A;  4YRD A;  4LMF A;  1NYW A;  3M3E A;  4Q4W 2;  1O3T A;  1J59 A;  3RS6 A;  4DXS A;  3I59 B;  1WCS A;  4A3Z A;  3K75 B;  2WRA A;  2RJK A;  2SLI A;  5FQ0 A;  5I0U A;  3A23 A;  2X8K A;  4YGD A;  3U10 A;  1GSL A;  5DDJ 1;  4GMP 0;  4XBN A;  2ZGS A;  4R9C A;  4XBL A;  1AR7 2;  2RS1 2;  3S7I A;  1F4H A;  4CSW A;  5BV6 A;  3OYW B;  4LT5 A;  2WN2 A;  1SZB A;  3DPR C;  2QQJ A;  2YFU A;  4COW A;  2ET1 A;  1NCQ C;  1QQP 2;  1K5M A;  2ZHK A;  5L9B A;  1FNZ A;  5FK7 A;  2HWC 2;  5F5A A;  3WNM A;  4XQ4 A;  4L92 A;  4MXW A;  3O5S A;  4NN0 A;  1HB4 A;  2O8Q A;  5IT6 A;  2ZMN A;  1OOP B;  1FPN 1;  1VBC 1;  5ACA 2;  3WV6 A;  2YU1 A;  4E8D A;  2WO3 A;  4IGO A;  1C28 A;  1NUK A;  4E4D X;  3NO8 A;  4KG8 A;  2BJS A;  3VBS B;  3O1O A;  1RUJ 3;  4QU2 A;  5HBA A;  1NE6 A;  1LOE A;  3NAP A;  3I97 A;  4Q4Y 3;  3KV5 A;  3RNS A;  1N3Q A;  3WF0 A;  4PQQ A;  1VBE 2;  3BTZ A;  5JIA A;  2D3R A;  2WIN B;  3K3N A;  3OD0 A;  2N7G A;  4RA0 A;  4PBO A;  1ND3 C;  1COV 1;  4CDU B;  1PHM A;  2CAU A;  4XF9 A;  4CP9 B;  5ABJ C;  2MNG A;  3C7H A;  5SV8 A;  1NZI A;  2DDU A;  1IS3 A;  3Q8E A;  4DY5 A;  1FV2 A;  4HVR A;  3LIH A;  4HSJ A;  1ND3 A;  2VMI A;  4P9J A; 
#chains in the Genus database with same CATH homology
 2C24 A;  1W8U A;  2K46 A;  4CPB A;  4LK7 A;  3ZYB A;  1HN0 A;  4A6S A;  4BQ2 A;  2O14 A;  1GWL A;  2KR2 A;  4AL9 A;  4BQ3 A;  4BQ4 A;  5D21 A;  4CP9 A;  1W8T A;  2JWP A;  3UT0 A;  3ZYF A;  2Q1F A;  4YW6 A;  4YWA A;  4LJH A;  1W9F A;  2LRO A;  4BQ5 A;  1WCU A;  3F95 A;  4CPB D;  2LRP A;  1OH3 A;  2WYF A;  4LKF A;  3ZYH A;  4LKD A;  4CP9 B;  1GWK A;  4LKE A;  1W90 A;  1V0A A;  1OKO A;  1W8W A;  3ORJ A;  1WMX A;  4LK6 A;  1GWM A;  1UOJ A;  1WZX A;  4YW7 A;  2VXJ A;  1W8Z A;  1L7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...