1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN AF1318
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
4MS1A 3CKMA 3KS9A 1BL3A 4I2QA 1KGSA 3HV2A 3RQIA 5IX8A 4M3TA 1PUXA 5JNTA 1GOCA 3NBMA 2RJNA 4M41A 4HNRA 1PNRA 3DLRA 1SKRA 1JLCA 4MRMA 1S9EA 4DQIA 1U2QA 5SZTA 4M45A 4E7PA 1JWLA 1LJUA 3RTVA 4FLWA 4EZ6A 1JLEA 3AVGA 5HSGA 4CGGA 1QTMA 3ZT2A 4XARA 3UUGA 1PNTA 4E7HA 1WSJA 4Q6WA 3KSMA 2GWRA 2OPRA 1C0TA 4F2SA 5KGXA 4F8RA 3OYEA 4DN6A 5DK5A 1DCMA 5FBHA 4KI4A 3PX4A 4OLAA 2FSPA 3CM6A 5HRSA 3QLUA 8ABPA 5FWYB 2YV0X 3A3KA 3G1WA 3RVOA 1IKVA 3MQ4A 3IS9A 3NNNA 2E6LA 2OZMA 3NF9A 2RDMA 4CJFA 1DRKA 3LOPA 2WJAA 4FJXA 2XRIA 1EKEA 1LW2A 3KLGA 3S3MA 2MYTA 1U49A 3GBVA 2VG7A 3HL8A 1T34A 2PAFA 4CGHA 4OATA 5C42A 3H08A 1RT7A 4DTRA 2HHUA 4AHVA 3DM2A 3O4NA 1N6QA 4YNQA 4KHNA 2FW0A 1TKTA 4M3YA 2Q5CA 4BDYA 2FQXA 1HYVA 1DCKA 1D5WA 1WSGA 4LRQA 1GOAA 3C6TA 3IG1A 4KMRA 5KRSA 3OYBA 3OMXA 1J53A 1QSLA 3AVMA 4E7JA 3K58A 1ASUA 4E3SA 4F3OA 4DFMA 1VSMA 2OPPA 1BI4A 1FKOA 4KHWA 3OYNA 1UWBA 4L4UA 2I5JA 3DLHA 3L2UA 2HHVA 3TAQA 1ISSA 2L2QA 3HVTA 4FZYA 4O0JA 3ZSRA 1P6QA 4I7FA 4G1QA 4PUOA 1TKXA 4CJVA 1TMYA 4LD0A 4R5PA 1SV5A 1D1QA 1R8JA 3I8DA 4RU1A 1JHZA 3ZCMA 4MR7A 1QP7A 3NCIA 4OKKA 5GOTA 1BHLA 3EDCA 1WAJA 3OYGA 4CJWA 1U48A 4K8ZA 2Y1JA 1Z18A 5EWLB 1SL0A 4JB0A 4BE1A 1BA2A 3NNDA 4EVSA 1EFAA 3HCWA 3WNGA 4RXUA 2PYLA 1VSFA 3N0RA 1S5JA 1E6LA 4M3RA 4BWMA 3B6PA 1Z17A 1NOZA 3D45A 5J1EA 1A5VA 1SL1A 4P98A 2WWVD 1RDBA 4ETNA 7ABPA 1RBVA 4MGEA 4BE2A 3I45A 1WSEA 2YNGA 4FM1A 4FB4A 3L3UA 4EYQA 3LKVA 3V81A 4IFYA 1FFGA 1TGOA 1D8YA 3A10A 2MSLA 4RW7A 3AVFA 1WN7A 5IUNC 1DBQA 3DRPA 1K6YA 4NYNA 4B8AB 3NGIA 3OYIA 4Z9AA 3O2SB 3O3GA 1A0OA 3QLTA 5T3YA 4CFAA 4CHYA 2HVHA 2H3HA 4ETMA 3TAFA 2Z1HA 4YFUA 2LSNA 4CFCA 3GA5A 4DTSA 1NTRA 3EULA 4RXTA 1VK0A 3KJVA 4DU1A 4LX8A 1HMVA 3QEVA 3S9HA 3Q7RA 2DY4A 3QEPA 1ISRA 4Z0UA 4FLZA 4RY8A 4CEEA 1JL3A 3FMVA 3VQCA 4EY3A 2IYNA 3K2PA 1TV6A 3NAEA 4RDCA 4RY0A 2FQYA 2PY5A 3D02A 1EP4A 3AA4A 4Z0NA 3CG7A 3LUDA 3T38A 3N75A 1P2FA 3C97A 3FFIA 1B92A 3V9ZA 5I4CA 4UHKA 3HPHA 1M2EA 5CYMA 5KTQA 2QZJA 5FWXB 2D0CA 1R0AA 4ZYLA 4Q0BA 3C3WA 3VQ5A 1BQNA 1RNHA 2OYQA 2A9PA 3HUTA 3RRGA 4NQRA 3DLBA 2VYCA 4CIEA 4KPYA 5ABPA 4FLXA 1KTQA 3VQ9A 5T7BA 2FLKA 2HNYA 4CK2A 1RDCA 2QKBA 3DRSA 2A1SA 1UAXA 4FJJA 3C3MA 1Z2DA 2P4UA 4CE9A 4ML3A 1C4WA 1C1AA 4DSEA 3RR7A 3SUOA 3NH1A 5KC9A 4FJGA 3QNOA 1QKKA 4B08A 4CESA 4MS3B 2ETJA 4F2RA 3K57A 1D2AA 1JH9A 4FW2A 2ZAYA 3MXMA 1Q9YA 4MPTA 4OPJA 1NJWA 4KB1A 5JNRA 2KTQA 4Y1DA 5DMRA 4BDZA 3OLXA 3SQ1A 1XHXA 1VRUA 4CERA 4MR8B 1GCAA 3O2JA 3SQ4A 4MS4B 3BGRA 5TQ0A 2HVIA 4CECA 1QMPA 1ZYQA 1SXGA 1F4VA 1DC8A 2FQWA 1JFVA 2HQOA 3PY8A 3RVQA 2GBZA 3AV9A 4NICA 1JBEA 4ZMRA 3EJWA 4OBBA 5KRTA 5EWMA 3V4IA 3LFTA 4FE4A 4YRZA 4M3XA 4FJ5A 2I6FA 3NH0A 3EZ5A 4PWDA 1YVUA 2QSJA 1C0MA 3E01A 1S6QA 3CZ5A 4ZTJA 3EODA 1D9FA 2MSKA 4KTWA 3H6GA 4JAVC 3C6UA 3OS0A 3OLZA 3AO5A 4YS6A 3MIZA 1J9AA 3O75A 3CG0A 3LAMA 3JVDA 4YV7A 3R0JA 3DBIA 1CZBA 4RSMA 2RJOA 1ITGA 5HM6A 4IMJB 3HP9A 5FROA 1QQAA 2WOMA 3PO4A 1Y97A 2B5JA 1CXUA 4AHCA 4CJTA 1KSPA 1NXWA 2LPMA 4IRXA 3DLEA 1RBSA 3QX9A 4KRFA 2VWJA 5D3GA 3S3OA 3RVKA 3BBLA 4J2AA 3QINA 3TD9A 4RWEA 4DQQA 1N5YA 1B9FA 2PKXA 1C0UA 4CEDA 4N56A 3MEDA 3VQBA 1IKXA 1G15A 4KK4A 2G8WA 3V9SA 1VRTA 1SRRA 3HK2A 2JCGA 4MFBA 2MSWA 1ASWA 3KLIA 4N5SA 4LZLA 2ZE2A 3UK0A 3B6OA 4CHNA 1TM2A 2GI4A 1X1PA 3RH0A 3DMJA 3OYLA 3H5TA 2L18A 1VSIA 4NCGA 4D74A 4LH4A 4B9UA 4FW1A 1C1BA 4PYRA 5CY4A 3QEKA 3ROFA 1XHZA 3G85A 3SAJA 1RTDA 1WSHA 1NXTA 2LUOA 3SNKA 4ZJPA 3AO4A 4FJLA 4DQRA 1NJZA 3AVCA 4F8JA 2YNHA 1APBA 2JLEA 4H8KA 4E7IA 3K5NA 5HRPA 2W42A 3NE6A 5K14A 4KNYA 4GNRA 2R47A 3BREA 3A0RB 5DTEA 3AO2A 5IBQA 4ICLA 2HNDA 2FBVA 4ZTFA 2JB9A 1L5YA 4F4KA 4MQ3A 3LPTA 4F12A 2L19A 3A0UA 1PEAA 1Z16A 3O1IC 3VQ6A 4UQGA 2FMHA 4H3KB 3SUQA 5CZ2A 1RBUA 4CHQA 4JRQA 1NXXA 1MU2A 4CGFA 1LAVA 4B9LA 1J54A 3LUKA 3T6KA 1B9DA 2PJUA 1YTUA 3Q7TA 1GOBA 1JLAA 3C94A 2LIVA 4QOZB 3GL9A 4GVMA 1K68A 2B1JA 3H5IA 4FE7A 5HROA 2G8UA 1YS6A 3C95A 3JPYA 4IGAA 4KREA 4EYKA 3VQQA 2HMIA 3O74A 2A9RA 5KQLA 5B3JA 4CJ3A 5KGWA 4CK3A 1FFSA 3TI0A 2KZMA 3HZHA 3L2VA 3TAGA 5IC5A 2PUCA 3KHTA 4E0DA 3M9WA 1GUBA 3L8BA 5I42A 3ILYA 1JDNA 3QK7A 4FJKA 1HRHA 3AA2A 3LWLA 1RXEA 1C6VA 2FN9A 4E19A 3I42A 3DOKA 3NF6A 3KYJB 1QS4A 1D5AA 1RDDA 3O2QB 1WLJA 3F73A 2FEWB 2IPAB 2YKMA 4D6YA 2HQRA 3CFYA 1TVMA 3JTEA 4TMYA 5SWMA 3T3FA 3LUFA 4BE0A 3RMDA 1P6UA 4LE1A 1CXQA 3PUFA 1NXPA 3FFWA 4CBVA 3LUAA 3TAPA 4M88A 3U3GA 4KHQA 1WSIA 4Z4EA 3QEMA 4RK6A 3H5OA 2B4AA 1RBTA 2A1RA 5FBKA 4C8KA 4DTPA 3IAYA 2BGGA 1M2FA 4EUKA 4DS4A 4O1HA 3MYYA 4CIGA 4BWJA 3F7NA 1EAYA 4JRPA 1NKBA 2M1ZA 3THVA 1RTJA 4L8RB 4PY5A 4GPAA 4Z4CA 5D2CA 3M8SA 2JVKA 3DLKA 5HBMA 3IPCA 1DBPA 1TAUA 3JY6A 4Z9BA 2HJ9A 1VSHA 4IMIB 3HYFA 3RRHA 2OA8A 2LBPA 4I9LA 3QEWA 3TMYA 4EYOA 5KC8A 2QKKA 3O1HB 1U4BA 3A2FA 2RKIA 5J2QA 2HW3A 4DSIA 2KQ2A 3M9XA 1RT1A 4MLDA 1SKWA 1OXBB 5FRNA 4B9MA 2P5OA 3HUUA 5TPWB 4HCBA 1Z15A 3GYBA 2XY8A 4CF1A 4N47A 4LSNA 2F8TA 3SUNA 4Z4IA 1TJYA 4EZ9A 2ZD1A 5J2NA 3QELB 2FEPA 1SUQA 3SJJA 2YKNA 1Z26A 3ZSZA 1T03A 2PZSA 4PZ0A 3SCXA 1SXHA 1QQBA 3G0ZA 2V0NA 1JFSA 5CHYA 1KVAA 3L3VA 4MR9A 1VSLA 2QXYA 4DG1A 1FFWA 2JBAB 4O5BA 2XY7A 2AYXA 3QLHA 4ELTA 4JS4A 4XLTA 1RILA 3K9CA 2FBYA 4E7OA 3AVHA 5J2PA 1S6PA 1RBRA 4FK0A 3QLUC 3EYZA 1QO0D 4RK5A 2ID9A 3RR8A 4MQFA 2DRIA 3H6HA 2X74A 2A9QA 4G0MA 1NKCA 1DC7A 3MA0A 1ZH2A 1S8NA 2AYZA 4ELVA 3QEIA 4CGDA 3SG0A 1KFDA 3SV4A 4CHOA 1DG9A 3VA0A 4TLLB 3ZT3A 3K59A 1BIUA 5GQSA 5FRMA 3TWHA 4CJKA 1CHNA 2QVCA 1IO2A 4TLMB 2NZUG 3HPGA 1IKYA 3BILA 2P1JA 5EWJA 4EGSA 4Z4FA 3H1EA 4CHZA 3PV8A 3LP0A 3V1RA 4W5RA 3IP5A 4HTUA 3RMCA 3LP1A 3C3KA 1WNSA 4IF4A 1REVA 1VSKA 4MS1B 1XC9A 2E4VA 3NNSA 4BACA 3UIQA 3KIOA 4DU4A 2L17A 5I3UA 1XWWA 2PYJA 2IC3A 3CRNA 1RXIA 3CQ8A 1MB3A 4KAZA 2NT4A 4ETIA 3H75A 4C8NA 3LP2A 4MRMB 2HHTA 3QLVA 4J2DA 4CJEA 2E6MA 1J56A 4KO0A 3OM1A 2WB4A 4KHYA 4O1IA 3CG4A 3HVRA 2H0AA 2WMYA 2HSGA 4OKJA 1FSPA 4GMJB 3NGZA 3VQ7A 2IGIA 1E6KA 3K5OA 3QETA 4LDAA 3MXJA 5E41A 3I0RA 1ZESA 3S99A 1KFSA 3RVJA 5TQJA 3K5LA 4AHSA 3SPYA 5TQ2A 3GBPA 2OPSA 1ZBIA 4DFPA 2CWDA 4FLYA 3PX0A 5JS1A 2G8FA 4JLHA 4DTMA 1UA0A 2ZWMA 4DSLA 1HJRA 1RZRA 4CEOA 3CU5A 5KWSA 3NBPA 1MAVA 3ULDA 1J5OA 2G8HA 3ZSWA 1XI1A 5TPZD 4Z4GA 1JLGA 2QU7A 1DTQA 4ZPJA 1D4ZA 2LP4Y 4FM2A 2XHBA 1DBWA 4YP9A 3WNFA 2IPLA 4N0QA 1Z12A 1A2OA 3MEEA 3ZSYA 3KK3A 4CEAA 3CFRA 3LZJA 4M3ZA 1QE1A 3LALA 3MM4A 2X6SA 3I09A 2Z1IA 3LDSA 2EX3A 4DFJA 4ID1A 1NK6A 5IEJA 4NCBA 4Q6BA 4O55A 3NDKA 3W9SA 2BANA 5F64A 2QXFA 1BI4B 2MYUA 4KQCA 4MQEA 5BRJA 2YNIA 4PICA 2CD7A 4WE1A 3WNEA 1KRWA 1ZN2A 1M5UA 3H1FA 4CEFA 1L3UA 1A5WA 4GW6A 4XIUA 1RCHA 4HNQA 1TLFA 3N0WA 3OQMA 1A5XA 3KLOA 1QP4A 4G97A 2HNZA 2BDPA 4HYEA 2GUIA 4J2EA 4DTOA 2D5RA 4MAAA 4MR7B 1NK4A 4KFBA 1XHEA 1YMUA 3ZSXA 2Z1GA 5C5EA 4W5QA 4B09A 1LV5A 2PL1A 9ABPA 2FKAA 4IG0A 3H5WA 1NK5A 1LBIA 1C0EA 1I3AA 3V1OA 1RTHA 2GKGA 3ISNC 1VSDA 4RK7A 3OVNA 4JASB 2MYPA 3SV3A 2IPMA 2FC0A 4KV7A 1NOYA 3OM0A 5DKFA 3DI6A 4RG8A 1JXBA 1E6MA 1DTTA 1IH7A 3BRSA 1F21A 4F3TA 3HDGA 1T05A 3OY9A 3KLEA 1Y1LA 2DFHA 4DSFA 4N41A 4KKOA 4AH9A 1BISA 2FMKA 2P51A 4H4OA 3TR8A 4G0XA 4W5OA 4FZZA 3LPUA 3IPAA 6CHYA 1Z25A 3NHZA 4J2BA 4FK2A 3LTEA 1S9GA 3LUGA 4Z99A 4I2PA 3TAEA 1ZY2A 4DU3A 4FZXC 3NFAA 1JFTA 1LJLA 3AVKA 4DQPA 3C6QA 4WZZA 2FMFA 4PE5B 3RVPA 3HS3A 4H4MA 2GBPA 3DOLA 1JLKA 2WONA 3V9WA 2Z1JA 2CHFA 4CGJA 2PUBA 3OLVA 4IILA 2PUFA 4CJRA 3L49A 1JX6A 4HUEA 2FXIA 5KI6A 1RDAA 3SQ2A 1Z2EA 1EETA 3H5LA 1EHCA 3RVSA 2VK2A 3KLFA 3Q15C 3OYFA 4RK1A 1CEYA 2WRZA 3SPZA 5FWYA 3TX6A 3KKEA 3EAFA 3T19A 2IPNA 3HT3A 4WUTA 1Z13A 1F51E 3KG2A 3NHGA 2O20A 1CZ9A 3CYMA 4RK0A 3NH2A 1YK0A 3Q7SA 4IDKA 2D0AA 4CEZA 4L85A 3AVIA 5JNWA 1ZGGA 1L3TA 2Q3SA 5KQPA 5CNKA 1MIHA 4O5AA 3OO1A 3QO9A 1X9WA 1BDJA 1I39A 1LWFA 3P9YA 1UA1A 3HSYA 4TN5A 3QERA 1SD5A 2FTKE 2F96A 3RVMA 4OGCA 1KLNA 2GX6A 2PE5A 3P1GA 4YR7A 4QPJC 1JF8A 3QEXA 4JOQA 3ALYA 5JNSA 3LUCA 3QESA 2TMYA 4DTXA 3SI6A 1ABFA 3EGCA 3VQPA 4CHPA 3I5AA 3L2WA 1L5UA 2QR3A 3AO1A 1ZBHA 4B3OA 3CFPA 1JXEA 3QELA 2E4WA 3OJUA 4AILC 1NXSA 2QV0A 1CYEA 2FMIA 4QYMA 2Y1IA 2OPQA 3ZT4A 3TANA 3OYJA 4RV5A 5C24A 3NF8A 2KFNA 3DZDA 1VLZA 1DP4A 3VQEA 4E89A 3U3YA 3K4HA 1NATA 3MAQA 4PQUA 1EX4A 4FJMA 1S1VA 1NY5A 4E1NA 5BRAA 3T95A 2OQRA 3CLKA 3GT7A 1U04A 3ITHA 3Q41A 4WXEA 4E1MA 1LBHA 5EWLA 3RWUA 2G8VA 2KZZA 1YT3A 3IP6A 3EY1A 1RTIA 1LK0A 1KVBA 5CYQA 4OKEA 1TK5A 1YMVA 3FFXA 3M8PA 3OLYA 2E4XA 4W5NA 1QO0A 3F6PA 3LWMA 3KLNA 1FXXA 4EYGA 1EXQA 3BRQA 4KQ9A 1KLMA 1HQEA 3ZT0A 2O4IA 3H1GA 5TQ0B 1IG9A 1MVOA 1ZGZA 2PMCA 3QIOA 4OVLA 5CNMA 1D9DA 4UHJA 2P5GA 4RW4A 4PA1A 2IKSA 3AVBA 2E4LA 3EQ2A 1H9CA 4FJHA 5EWMB 3O1JC 3HDVA 3NHMA 4CGIA 5IULC 4DLGA 4JP1A 4IG3A 4WXMA 1O1WA 4AHUA 2JK1A 3FFTA 4RW9A 2G8IA 1KVCA 2XO7A 3T8YA 2PL9A 1L3SA 1CLQA 3OYAA 3V1QA 4KV8A 3AVAA 3CTPA 3QX8A 4CCHA 1A04A 1RPJA 2P9HA 4KI6A 1NK0A 1RT6A 1ZBLA 1ZBUA 1VSEA 3OYMA 1NXVA 4FJ7A 2KFZA 4OTZA 3OQNA 1GCGA 5KQMA 4YLEA 2E4UA 3DGFC 1BAPA 4CJ4A 3E61A 1XWLA 4DF8A 4KK3A 5HP1A 1QHTA 4IFVA 1YTAA 1BCOA 1VPWA 4FJIA 1IIBA 4NYFA 4QAGA 1AB5A 1U47A 4DSJA 1JLFA 4KHSA 3BDPA 1RT2A 2YHBA 4WT7A 5B3JC 2IDMA 2DFFA 3ASMA 3KYIB 2JVIA 2DTUA 4K8XA 4B9NA 5CNJA 5FWXA 2IOCA 3HP6A 1LW0A 3UKJA 3EQZA 1K66A 5TPZA 3ZT1A 1Q8IA 1NJYA 4DTUA 4NV3A 2X6NA 4NCAA 3HPOA 2WY2D 4Q5VA 2MYNA 4F11A 1QP0A 3IP7A 4G0PA 1U45A 4KTQA 2ITGA 1IKWA 1TKDA 4CF2A 2X7XA 1ZDMA 3RMAA 1VSJA 3KKSA 3O21A 3URMA 3CFOA 1JLQA 2DFEA 1ZVVA 4CJPA 4MLCA 4CJUA 1YIOA 3JYTA 4YGXB 2RPIA 4G86A 1NK8A 3RVLA 3MEGA 3P83D 3KD1E 4O44A 4G0OA 2OENG 1KMIY 3NGYA 1TL3A 2A9OA 2E4YA 5TE9A 4KB0A 4MS3A 4XASA 1BDHA 3IRXA 1WETA 4DFKA 1BCMA 2WJWA 5CNIA 4CFBA 5PNTA 5BR1A 2IS3A 3KLHA 3T1AA 4HHTA 3TAMA 4FVMA 1BVHA 1W25A 2IAJA 4MR8A 1ASVA 3ZSQA 3HM9A 3VQ4A 3FDFA 4MS4A 1EWTA 5JNUA 3PX6A 1HNVA 1BDIA 4DMNA 4G0QA 1JYEA 4G0ZA 1USKA 2PUGA 2M98A 2HB5A 3KTOA 1GLGA 4CEBA 1S1XA 3F9KA 2RGYA 4LY7A 3V6DA 2RF2A 4OLBA 6ABPA 3NF7A 4HUFA 1Q9XA 3VQDA 1QNLA 3V9UA 4QCLA 3SZ2A 2FN8A 4XXHA 4S04A 5HQJA 3V9XA 3LUJA 2OZSA 2FLWA 4CJ5A 1GUDA 2VWKA 3OYKA 3SM9A 2EHGA 4N0PA 4FLTA 4I9QA 3D8UA 2NZVG 3M8RA 1ABEA 3JPWA 1W9HA 4DF4A 1UDRA 4M3WA 2HHXA 2YHAA 1T8EA 2HHWA 3HEBA 1ZHHA 3L2RA 2ZQBA 1QQCA 5EU7A 1NKEA 3SQNA 3OJSA 3QEMB 5CZ1A 2AJQA 2B6AA 3AA5X 4B8CA 4F06A 4KHUA 1FQWA 1JKHA 5HRNA 3TABA 4W5TA 4CJQA 2KW4A 4RS3A 3VN5A 2G8KA 3LZIA 3MECA 1TK8A 1PHRA 3OQOA 3OYDA 3QNNA 1YS7A 5DLEA 4B9TA 4N76A 3LKBA 4G0YA 5HKOA 4KFCA 5JNVA 4LH5A 4E7KA 1QSSA 3CM5A 3ZSOA 2JVJA 3HSTB 3HO1A 3TO5A 3L6UA 4DADA 1RT4A 3FGZA 2PUEA 3B2NA 4FLUA 3SY8A 3CNBA 4RZSA 1VKRA 3D0PA 1U0SY 2QW1A 3KJXA 4LE0A 2R48A 2F8SA 4KZKA 1SL2A 1U8TA 4H60A 2KYRA 4YO7A 5E3JA 2VG5A 1DZ3A 1SKSA 3Q9SA 3H5VA 4MYRA 4Y1CA 4DTNA 2YNFA 1DRJA 1HPZA 4HNSA 4DTJA 1JYFA 1HEYA 3E3MA 5IUJC 4B9SA 4XFKA 1S1TA 1RT5A 1KCFA 4FJNA 4XAQA 3ZSVA 2FEKA 4IBNA 4C8OA 3QLVC 4E7LA 3DYAA 4N03A 3GRCA 3O3FA 3MF4A 3O4QA 4MR9B 1L3VA 3MXIA 4AHTA 5C5CA 1ZAYA 1HQUA 4IKFA 1P8AA 3LUHA 1HYZA 1KRPA 2N9UA 1NK7A 3SNNA 1JDPA 3G10A 1SXIA 5KQGA 4YCSA 4CF9A 3KK2A 4P1ZA 4M42A 4OGEA 3CHYA 3AO3A 4OPKA 2O4GA 3GWGA 3LAKA 4FK4A 1VRVA 2JGUA 4ELUA 4CFDA 1HNIA 4KVFA 3KD5E 1JL1A 4MQFB 3OLWA 3N53A 1RNLA 4H3HB 2D0BA 3TB6A 4O0IA 4RW6A 1S1UA 4FJ8A 1DJMA 2PUDA 4PEVA 3KK1A 1ZITA 2ATQA 3N0XA 2QK9A 1RT3A 4FYDA 1YK1A 4CF0A 1PEYA 1TL1A 3VQ8A 3VNBA 2VUHB 2NT3A 1DCFA 3S3NA 4LSLA 2HHQA 1URPA 1TVRA 2HPHA 5EWJB 3CZCA 1M5TA 3SYZA 5FDLA 1B00A 3N8IA 3HJFA 1QPZA 4DSKA 3ILHA 5IUKC 3KCNA 4DQDA 4C8MA 4CF8A 1X9SA 4LE2A 4KTZA 4CJLA 3GV0A 2HHSA 3TARA 2GV9A 4JB2A 2QVGA 1NJXA 3OS1A 2X78A 2NUBA 5DCLA 5HLFA 2XDYA 3LMKA 1EWVA 2R7YA 2FVYA 1BGXT 3KKRA 4ZMSA 4Q7EA 1L5ZA 4OJRA 3IDOA 3ROTA 3LP3A 1NK9A 1DLOA 1LAWA 1S1WA 4HCCA 4DS5A 3RVNA 1WSFA 4DWIA 2R4QA 4Y9TA 5C25A 3VNAA 4JA2A 5HRRA 4RXMA 5TQ2B 3I0SA 1MB0A 1NXOA 4DQSA 2VUIB 1HYSA 4ID5A 4HVJA 3WNHA 2HQBA 5J2MA 2E4ZA 2VG6A 3M8QA 1RZRD 1FKPA 4RK4A 1USIA 1D1PA 4OG2A 1TAQA 3DGEC 4EP5A 3OYHA 3OYCA 5TPWA 3DRRA 3PO5A 4FXDA 2B4JA 4CIFA 1BQMA 3MMNA 4RY9A 1ZH4A 2ID7A 4CJSA 3AA3A 4JS5A 1ZBFA 4FLVA 3OS2A 3M6MD 3RMBA 2FBXA 1JL2A 3DLGA 3VA3A 1X9MA 1W0HA 2XY5A 3SUPA 3KTQA 5IEBA 4EP4A 5BQ3A 3RVRA 4EVRA 4M3UA 2J48A 4MQEB 1E2BA 2IOYA 3AVLA 3IP9A 1C1CA 2PLNA 4RKQA 5ED4A 3K5MA 3OO0A 1AB6A 4LDZA 4CK1A 2JBAA 4CEQA 2JRLA 5DGCA 4TSXA 3SQ0A 2FBTA 4BDPA 4EVQA 4S05A 3QIPA 3AVJA 3O3HA 1LWEA 4HUGA 4FCYA 1JLBA 5JS2A 3AVNA 4FJ9A 2R25B 1U2PA 3F6CA 1UOCA 1USGA 1TKZA 2BE2A 3HXMA 4RKRA 3JS5A 1LWCA 2PUAA 2XY6A 4YWHA 3N6VA 1EWKA 3U6FA 4B9VA 1I3CA 4QICA 4WWHA 1T7PA 4FM0A 2IDOA 3CS3A 3OMWA 1FK9A 1QSYA 4D6XA 3LANA 4O4GA 4DLEA 1BIZA 4Z4HA 4QYWA 3VQAA 1KRXA 4RW8A 3P5JA 3L2QA 3JSMA 1WAFA 4C8LA 1OXKB 2CHEA 4AHRA 1XHFA 3JVIA 2RN2A 4ZHRA 1TK0A
chains in the Genus database with same CATH superfamily
1O57A 5LPNA 3OZEA 1J0AA 1XNGA 2RSLA 3NBXX 3IDHA 1L6IA 3C3JA 1PUXA 2ENWA 1ZIYA 3DMGA 4M41A 3GFOA 1ZN7A 3B85A 3O92A 4V2IA 4CF3A 1CRLA 4XEIA 2I5PO 1JLEA 3AVGA 5AJTA 2VDLB 2C98A 1TE2A 2IEAA 2IVFA 1CJUC 1XR3A 1FL9A 1QAMA 2WF7A 1SHZA 4TLEA 1EK5A 5CLHA 1ZISA 4MARA 5DK5A 2X5NA 5KYVA 5HRSA 3UHAA 1UKZA 2VYVD 3EG5A 1Q91A 3QDKA 4A82A 2XZOA 2XODA 2AEMA 2JBHA 4NS4A 3DA8A 1H5QA 3IL2A 2ADOA 1KVTA 5DXJA 2GN9A 2A5FA 2NACA 2NXNA 3ID6A 1S1MA 1ZC3A 3L0IB 2H4FA 1KI4A 3KOUA 3WVNA 3ZV5A 4UTZA 3P9KA 3CJ9A 1UBGA 1YIJN 3DXFA 3TQRA 1P74A 1QSLA 4L9WA 2OWEA 1MJFA 2IHBA 5DM1A 1U7UA 1VMAA 1DQZA 4WH0A 1S9HA 2VNKA 4QYIA 3ISVA 4A5SA 4O0JA 3GGJA 3W77A 4Q4HB 4PTLA 4OHCA 1TKXA 1W4RA 2F3PA 4KIWA 4C1NK 4GBJA 1NPTO 1TMYA 1CUCA 2PQ6A 4M0FA 1JJ2M 4G1BA 4KPEC 4QATA 3A8YA 4C7VA 2OAEA 2QX4A 3K2EA 2Y1JA 1JSRA 2DTEA 3HCWA 5FLXA 4NBTA 1JVSA 2VJMB 4TZTA 4FVUA 1HDCA 5EP4A 4M3RA 4O25A 5EG5A 3CF5L 1R88A 3MEQA 1A5VA 3CMAN 2QWQA 4PTYA 3PNOA 4IO8A 4MKZA 1VE9A 4FS8A 2YNGA 2DTXA 1L7PA 2PH5A 3AYZB 1M34B 1WN7A 1AF4A 3JQGB 3MCVA 4FCWA 5L40A 4CR8A 2YV3A 3EDQA 3UHFA 3E9QA 5D3ZA 1LPBB 1C29B 4CHYA 2CUKA 1MA3A 2YYZA 3FH0A 3KTAB 3O7WA 3PQ7A 4MJXA 2V51B 1U1CA 2E4AA 2XQKA 4RXTA 3QEVA 4ZRMA 4YYEA 2DQZA 1IQPA 3QU7A 2C5LA 4RY8A 2Z5LA 1KAEA 2WWGA 3K2PA 3QTBA 1VXRA 1EM8B 4FWNA 2X0IA 2ONYA 3P45A 4W63A 4YJ2A 1CP3A 2Q0UA 4AJ1A 5LC1A 1XCOA 3I64A 1E2QA 1WZCA 3JZMA 3CYFA 3VQ5A 1DPGA 1W5FA 4ABTA 3I3OA 4BRQA 1TZBA 2BUCA 3K9KA 4MKIA 3OZSA 1P91A 4Q3KA 3VQ9A 1U1IA 3PTLA 4I5IA 4MVCA 4FJJA 2VHUA 3C3YA 4R71A 5B36A 2OZLA 4K0KK 5BVHA 1C1AA 4J16C 1H8ED 5FPPA 2YV1A 2FF5A 5KC9A 2J0UA 3T1QA 4FJGA 4DT1B 4CETA 3BWVA 3SF8B 3ZBPA 2ETJA 4HNAB 1JH9A 4B1VA 3R44A 3TI9A 2WWHA 2ZAYA 2FFQA 3IIEA 5I7OA 1NJWA 1N8RO 1D0SA 4K86A 4KVAA 5JVHL 4PGMA 3ILVA 2WG2A 1Y8AA 2BGNA 1DC8A 2Q2RA 1LWNA 2QG9A 3H46O 4XGRA 2ZANA 4G8JA 4ZVOA 4WEOA 4Q3CA 4BO7A 5EFOA 1MAUA 2I6FA 4A92A 4EI9A 5A4KA 5THKA 3AL0C 3GLKA 1SZ2A 2QYOA 4DB4A 3SQXA 1U7WA 2NOAA 4BREA 1KMCA 3G68A 4MWOA 4KSBA 4UQPA 2B37A 1V7PC 3Q12A 1AO0A 5EQDA 4P86A 3BCRA 1U9YA 1VI2A 1AZSC 3CNLA 4LECA 1EUCB 1RBSA 4GBMA 1ZU4A 5AJUA 2O8EA 2IYOA 3OU6A 2PKXA 5C8DA 3P0JA 5C7IO 4JI1B 4XX0B 1X8KA 3OA0A 4EFMA 2IPXA 2XUQA 1GPNA 3BWDD 2GQ0A 1B8PA 1UDBA 2QPTA 1YRYE 4MRVA 1XMPA 2TECE 4WECA 2WF8A 1LLQA 3AVCA 3HFGA 1GCOA 2CV0A 4E14A 1ZXOA 4CN9A 3CX7A 1XK6A 4J1TA 3HDTA 5JSUA 4Y7DA 4GNRA 1BU5A 4HQLA 1XC7A 3AO2A 2HNDA 2C83A 1UPBA 3RG2A 1NP3A 2JB9A 1FDOA 3OUZA 1HTWA 4G24A 3AL2A 5GWXA 3LAWA 2ZJ4A 5EUBA 1FJHA 1GRQA 3BB3A 1B9DA 3R5TA 1CE8A 1YZLA 1VG9B 3C94A 5AQSA 3GZNB 5CA0F 1JDBB 1PWEA 5MGNA 3CR8A 3GXBA 3AI2A 1JLSA 5B3JA 3LVBA 4AKGA 1ABBA 1YDEA 4M9RA 4WJKB 5LOVF 4E0DA 4PW0A 1K8QA 1O03A 3D8RA 1DBSA 3DL7A 3GJRA 4BGIA 3QK7A 2ANBA 1TPYA 3DOKA 4L22A 1BX0A 4PZPA 3JW8A 1SD1A 2XUJA 3QLEA 4HDRA 1WOYA 2GPTA 1OX5A 1HRDA 5G0TA 2PBFA 5JCOC 1X74A 1OI3A 3Q4GA 1YR2A 3BD7A 4ILKA 3TAPA 1FP4A 2FUCA 3QEMA 2Z58A 3QUCA 3WR5A 1E18A 1XNRK 2J46A 2RMKA 3KBBA 5HHTA 3LA6A 4TTSA 3NOVA 2WR8A 4DV1K 5JO0A 3EY9A 3OHRA 3QSYA 1T9KA 4PY5A 3SXUB 1TF5A 3O3OB 3HB1A 2EDAA 1NM1A 4HRAA 3UJ9A 5K8TA 2F1JA 5JROA 3GQBA 5KC8A 4KEAA 1G9SA 4BASA 1WMEA 5KWEA 5JLAA 3A2FA 5THXA 1Y8ZA 1JAIA 4TTTS 5FL3A 4B9MA 4CZKA 4DQXA 4B6EA 2WHXA 3HO8A 3T1VA 1IMOA 3QKUA 4H7HA 4CF1A 2XECA 1MQ9A 1O1YA 3D2EA 3VO8A 2JG3A 1LNSA 2J6HA 2IHZA 1QAOA 5DVZA 3GC6A 4Y0AA 4ND8B 2B3TA 4FJ1A 4KR6A 2PJDA 1G38A 3PGA1 2G9VA 3D6NB 3WL7A 1I7QB 2ITMA 1QYIA 1KHTA 1H8EA 2YZGA 2WAXA 4RVOA 1MTOA 4DGQA 5CD1A 1KMNA 3TSWA 4C2UA 3BWCA 1N7GA 2QD2A 1U0RA 2ZW9A 3FCCA 3KAJA 1WKBA 2DRIA 1P5FA 5J2TF 2AOWA 1CZRA 4U2KA 2ODBA 2WNSA 4ELVA 1BWPA 3PLAE 2AGVA 2E2WA 2IS4A 3L1JA 3ZY6A 3RYIA 4RHXA 3ID6C 1HEUA 2PTHA 2H4XA 5E4JA 1C7JA 3RTEA 1Q83A 3OHMA 1MX9A 4Q7MB 1MB9A 2HFJA 4AMBA 4YPFA 3IP5A 4AF8A 4HXFB 4TTQA 1VSKA 2E4VA 2ZBVA 4DU4A 2GA8A 1ML4A 5FI3A 2R96A 4FD3A 4QPDA 3K31A 3A3PA 2J4RA 1WDLA 2A1UB 1JI3A 4O1IA 4C5AA 4YIHA 4OAQA 3OZWA 1C4OA 4IS2A 3ZWBA 2B25A 4FWQA 2EGUA 5AK5A 4R1LA 1KKMA 3CJ7A 3RS2A 2J5BA 4Q12A 1N3IA 1JHXA 4JJIA 1IG8A 1GZ6A 4D44A 1SPBS 1R8SA 4DIDA 4H0NA 5J9FA 4V0NA 4R9UC 4IH1A 4E15A 1L7BA 4H7KA 5B2ZA 3BFVA 3I05A 3NAZA 1YS4A 2ECQA 2LKCA 3IB3A 2ZB3A 1LCUA 3OT1B 1GRCA 1Q14A 4KFRA 1CUSA 2YNIA 4IVPA 4R2MA 5G53C 4ZVMA 1RIIA 2PLFA 3GA0A 3N0WA 1P45A 1PEDA 3LLMA 2NU9A 3VEZA 5AVKA 3G7NA 2ZRCA 3ZD7A 4MAAA 5B1EA 2P79A 2VFAA 3DBVO 4H7EA 1SVIA 1NF2A 2F3TA 4AWXA 3K8OE 1XWFA 4LF5K 2D5LA 4BC4A 1NRIA 1XZGA 3E3NA 4ADSG 1J5XA 1RTHA 1SB8A 4C2AA 4RK7A 4OB7A 4TWAA 4O4LB 5DNDA 4UVHA 2I2WA 4O2RA 4TTVA 5DN6D 2QRZA 4E32A 1NKSA 4RM3A 3OY9A 1W6RA 1WNFA 1F4PA 2RHJA 1H2BA 3W1EA 1GTJ1 3ZWNA 1O0SA 3ZGZA 4GGPA 4YMVA 4YMHA 1X7DA 1AKWA 1GKYA 2HMSA 4PKGA 1ETUA 2PX4A 3CW8X 2BBSA 4NMMA 1NN5A 4NFYA 4J0KA 4LBZA 2H92A 3TUJC 4D8WA 3L49A 1PGJA 1T8WA 2FK7A 2C59A 5KI6A 4NE7A 1FLAA 3UOAB 4KO1S 4BMCA 1EHCA 1X2BA 2XXAA 4FIZA 1RHRA 5BOSB 3CLRD 2WRZA 3SPZA 2J0SA 1NASA 3HT3A 4PF1A 4BFLA 5AK4A 3KR0A 3KG2A 3VR6A 3KB2A 1L5HA 3QMWA 3IBCA 1L3TA 1PWYE 1L7XA 2ZSUA 2HMPA 1U0HC 3OE7D 1C2YA 5JXJA 4P3YA 3P9YA 2I87A 4F7WA 2H5EA 2FTKE 5EHGA 3INRA 3ZHTA 2GX6A 1I4LD 2Q4OA 2NAPA 4ND7A 4FWOA 5E3IA 2C8JA 3C1AA 4CHPA 4W9MC 3K2BA 4LSGA 5ICCA 5JVDB 3ONNA 3OJUA 2IOHA 4JC4A 5LJWA 2OPQA 3TYXA 3OYJA 3CMCO 3WHIA 5C24A 1NATA 4OQLA 2A9VA 1OQAA 3ZVNA 1SU6A 2DKNA 3GB9A 5DLQC 3GFPA 5B7GA 3IP6A 2OD9A 5CYQA 1N2OA 1P3DA 1RFQA 2H08A 1TAGA 4NCNA 4BGEA 3K35A 5BWOA 1QZUA 4DUPA 4LNHA 5AKIA 3SJBA 4LAFA 1BCRA 4FYXA 5HOEA 5C34B 4G1MB 1JAXA 1MZPA 4FFPA 5KVAA 5JAZA 2GVZC 4IRMA 1DKQA 2NADA 1KQPA 4WKGA 3HDVA 3BHMA 2BRUA 4PX2A 1XU4A 4YOVA 4J1TC 4JP1A 2I2DA 4A1OA 4AHUA 2YY5A 1PG5A 2R8YA 1IY1A 3OJWA 4XGIA 2XOXA 2NRXA 4BNTA 2F43A 2GAAA 1NOJA 1CF4A 4ALLA 4D2IA 4NX2A 3DVLA 3KKMA 3AIKA 1W94A 5KYYB 2Q50A 3BTOA 5CVCA 3WYGA 2GHIA 3QPCA 3QKIA 2KFZA 2ZBPA 1PK9A 2DWOA 5AK6A 1PLJA 3DGFC 5AVUA 3WC4A 2Q6OA 1XWLA 5HP1A 3T3EA 3L0SA 4WN9A 2HMYB 1VPWA 2FF6A 5DX0A 3NBAA 4DSJA 1HT2E 1R0SA 5B3JC 3RNLA 1P4SA 3IFSA 3QYJA 2IVPA 1JSXA 1PJAA 5HE8A 1ID8A 3T9CA 4K8XA 1Q20A 2V58A 4NV1A 1AXGA 1W1IA 13PKA 4C07A 2ZB2A 4NV3A 3D7EO 1RM3A 3G5AA 3PQ2A 2ITGA 4U2FA 2G7ZA 3S1AA 4ATNA 5JIBA 3K9BA 3LCUA 1XQXA 4AW9A 2MU1A 3JYTA 2OXEA 4G86A 2H8KA 3BZCA 1A72A 3RHFA 3LSYA 3ONEA 3DM5A 2MSNA 3DCYA 3CRRA 4KNWA 3T12A 4Q47A 3AZQA 2DFKB 5ERXA 1JA0A 2AJLI 3H6KA 1MRSA 5BR1A 4OGWA 2XRFA 4LJRA 3QU2A 3FBTA 4MIEA 1FXWA 1GLLO 4MR8A 3STWA 1DE0A 1KO7A 2E2NA 2WIBA 2ZUEA 5P21A 5DHFA 4WNAB 3G2MA 2F3QA 1YR7A 4PZAA 2PRYA 2RH8A 4OLBA 1GVHA 1Q9XA 4G2NA 4YJ3A 3CVVA 5AI5A 5H81A 4FEYA 3SBTA 5DN6A 3TFWA 4PQFA 1XZBA 3LCJA 1QLJA 4E08A 2I80A 4OREX 2CXQA 4EGCB 4IUDS 2I76A 2X2OA 4N0PA 4A10A 5AKYA 2XGSA 4CHTA 5KTSA 3NONA 3ZQUA 3R3SA 4PVCA 2IQ5A 4M3WA 3IE1A 8LDHA 4GZ5A 1QM5A 2J0VA 3PDWA 4B8CA 4AULA 1ADGA 1JNYA 5EVCA 3L8EA 1VPLA 3W9UA 2FZLA 1U80A 2JFZA 3IUBA 4RPJA 1Q0QA 3IJPA 1KORA 2OKGA 3OQOA 2JHCA 4U7PB 1W85A 4BATA 1OD6A 1GARA 4Z9FA 5AVSA 3W5JA 1QSSA 1CQJA 4RFLA 1VIDA 3UA4A 3QYAA 2ZUDA 4MQLA 3RS3A 5I4KA 1U0SY 3C1OA 3CNEA 1Y9JA 3OE7A 1S01A 2R1VB 3KZBA 4EB6A 1DX9A 4FBMA 1QHFA 5EJ4A 1U98A 1TA0A 1U8AA 3IDZA 5CA1F 3DLIA 4GOMD 2F90A 1FFXA 1HEYA 2HMAA 1O87A 4MMXB 1YHNA 4JKDA 2B36A 1E6EA 2OR3A 1E20A 4Q7LA 4YI5A 2VI5A 4Y30A 1G20B 4DYHA 2VDWB 4ZK6A 4S1WA 4UW9A 2REQB 3DTVD 3WHKA 1JDPA 1DKUA 5KQGA 4P4SA 3AEKB 3ILXA 3ZEUB 2KB0A 1UR5A 4FK4A 2CJWA 3O8CA 1NUAA 4CFDA 3PCTA 4X65K 3IKMB 3IUEA 4KOEC 3KHYA 3ZZTA 2PMDA 3ND8A 4X60A 2C9ZA 5KHAA 2E2PA 4OQYA 1UJ2A 1RWVA 1E2FA 3P38A 3ASVA 5DYYA 5E0OA 1IBMB 1B2RA 3ILHA 2HF7A 3UJ6A 3D4OA 4DKWA 4LE2A 1A5SB 4TKLA 5TJHA 4MDHA 3O94A 3E27A 4GZ3A 3BP8A 2OP1A 2X8BA 2WUSA 3ZH9B 3OF5A 3IVCA 1XF1A 3F97A 3CCEN 3FYTA 2RHDA 1MLDA 3Q8KA 4IHJF 4U7BA 4B9AA 3GUVA 4RXMA 2OQIA 5J2TA 4MDEA 3G2LA 3ZK9A 4DGSA 2O3UA 4UBMA 3RJ5A 5AVQA 1DXHA 3TTSA 2PZMA 4Q1CA 3OE4A 3OYCA 3DRRA 2I91A 1M75A 1C4XA 3VNVA 4PONA 1TZ2A 1A7JA 2RG1A 5NLLA 3NWEA 5IAEA 1NBAA 3IMGA 3WWDA 1G6Q1 1OYYA 1Y6RA 2BEUB 4HWOA 2MINB 5FL7D 3P71T 2HJVA 3KUCA 1EXWA 3W8RA 3TAUA 2PMBA 4FEAA 1Q17A 2AOTA 4NU5A 1ZCFA 1A8HA 4RKRA 1UJNA 4ZAFA 1W6UA 5BWMA 3H17A 2QU8A 2D06A 1V35A 1BX1A 1HKGA 1KDYA 3JAWA 4ILGB 5L3SA 4PFKA 3EFHA 3DBLB 2HTFA 1CIPA 4R6XA 4KUEA 2P9KB 1IL0A 5H9WA 4GWLA 4QD3A 1I2MA 4QDUA 1Q86O 5EERA 2HEGA 3HV0A 4BJ3A 1HPMA 3GYGA 4IXDA 3GH3A 4FO0A 4RHEA 1CS0B 1WOQA 2ZWVA 4DQIA 5F7OA 3IEKA 3D7LA 1M2HA 2QYHA 3QI2A 3ZT2A 2RH4A 3WGNA 4OQZA 2PAVA 4TWJA 2D5CA 4EGJA 3UJBA 4DREA 1UJ5A 1F2VA 3QLUA 5EVJA 2VTBB 3KQHA 1KBOA 4WESB 3ADBA 3ORFA 5KHLB 3GPLA 5BQFA 4EHHA 2VA9A 2A67A 3GBVA 2EWWA 2QJOA 1RCFA 5DJ5A 4DR4B 1MWKA 1E1LA 3WP1B 4YCNA 1TU3A 1XQVA 2Y9PB 2AN9A 5EUQB 2V6MA 1KJZA 4OX9B 1YQEA 3TNDA 4QHTA 1SUSA 4OKSA 2Q62A 2BRUC 3EC7A 4WNIA 4LCJA 5IM5A 4E7JA 3SK3A 4ESHA 4DPMA 4XM0A 4OU5A 2CY0A 2NO5A 2HJSA 3S68A 2ZJPL 3EZYA 4QTZA 4M9SA 2R3SA 3CO0S 5K2OA 4C7OA 3MCAB 1D1QA 5C3UA 3D2FB 1SC9A 2YVQA 5KYUB 4R1MA 3IIIA 3WDLA 4OKKA 1BHLA 2VZLA 3G17A 3Q6IA 1I4OA 5E2BA 3PU6A 3DTVA 3KV1A 1OKKD 4OHMA 1WU8A 4QGHA 1RJ9A 4A2BA 1Q1NA 2Q29A 3NWBA 1R2QA 2ECPA 1U6KA 2P90A 2CBZA 3DYVA 1TK2A 1UL1X 3IJ5A 3AZOA 2X0EA 4BR2A 4I4IA 3EVEA 3W05A 2E7ZA 1RAHA 3LKVA 3ICVA 1PFUA 3DMRA 5TJ9A 1SC3A 3INNA 2NP6A 1GNQA 2BY4A 5F5LA 3FOEC 1W5TA 3RG8A 2PZ8A 3WG9A 3EXIB 5KDOA 5U4QA 3Q7QA 3L77A 1TXGA 4KBFA 4KXVA 4M1QA 3O3CA 3O2SB 5EHIA 3WXLA 4CFAA 4OQXA 3NBZC 4V0RA 4TMKA 3WGQA 3GA5A 3D6UA 1YJWN 4NHOA 5M3BA 5A5DA 4PZLA 5C37A 1J09A 1Z5GA 1QHGA 3IAHA 2WQ6A 2QV7A 5IKMA 3RIHA 2DY4A 3B6ZA 4KWTA 5DULA 4TMXA 4COOA 3W4KA 1I7NA 3C1UA 4G4JA 4FNMA 1YS2X 3CEMA 4IFTA 2BFOA 3NRJA 1NRXA 2FCRA 3MN6A 3DEYX 3C97A 4J3NA 1SIBE 4BO0A 3HI6A 3HKBB 3TZCA 5CRIA 1WZ2A 4Q66C 1ZCJA 3D6AA 2LIPA 4D46A 4FLXA 2X1VA 4G5QA 2Q8NA 4K8RB 2HNYA 1XJQA 5E6SA 1N34K 1G5RA 3T5MA 1TCVA 4G2TA 5K0NA 4QPNA 3CGGA 4FT2A 4O4JB 1JDVA 1JKJB 2X40A 3ES9A 3FMIA 2P3LA 3ZUPA 2QTMA 1GFSA 3ENVA 2PUHA 2BMFA 3EG9A 2UYOA 5KYWA 5FL7A 3GRKA 2HH9A 2QAGA 3OZTA 5DIZA 3CLRC 3SDSA 4WZBB 3BK7A 4JU8A 2YS6A 4AJKA 1NHWA 3EMKA 1VRUA 2PKWA 3NR2A 1Y3HA 5DX8A 1JFVA 4Y9DA 4AWAA 3JAMA 3QSGA 1JBEA 4CF5A 2Z2IA 2I33A 4EDFA 3C3XA 3LYLA 3NH0A 5LSAA 1XA3A 4PTZA 4ZTJA 4TT3D 2KMLA 2V7TA 4R1QA 1THZA 1D7AA 1QB8A 1YJXA 2RH9B 2H1HA 4FMCB 3H8WA 3HJHA 1NP7A 5CR9A 4W5HA 5FROA 2UUOA 4WI1A 4FLMA 4CJTA 2VSNA 1L7EA 3U9ZA 4M1EA 4CBXA 2CHUA 4X44A 3MEDA 2BHSA 4D45A 4O8ZA 3FOWA 4L1KA 4K1XA 1B26A 3SS7X 3HVIA 4AY3A 3JWHA 4B2IA 1E92A 4RFSB 4NK4A 2Q5JA 2P11A 2OG2A 1GZDA 4ZJPA 3PKZA 2R8EA 3VPHA 4BO2A 2JLEA 3Q2OA 1DADA 3SJ7A 1ADYA 3BREA 1S5PA 2NWQA 2CCGA 3GVXA 1J25A 5ALTA 4XH5A 1XYGA 3ZDAA 4XWAA 4LEIA 5B7QA 5K20A 3D81A 3H9BA 2YZKA 4H3KB 4X85A 3ZJTA 4BC3A 4CHQA 4V1CA 1MU2A 4CZ2A 3VH1A 1GFZA 3BRWA 4B9LA 1Y1TA 4LF7B 4HL6A 5K3DA 1RKXA 1ES9A 3WP0A 4FL9A 2Y1CA 3DYIA 2Q6LA 2RAUA 1ZONA 1EFPB 4IGAA 2E48A 3QFFA 2G71A 4YJ2F 5KQLA 4FLEA 3E7FA 1CXZA 3L2VA 5IC5A 4BP3A 3TTYA 5KHOC 3IT3A 5FPTA 3G2OA 1I0ZA 1CT9A 1H4TA 3T3HA 1E5LA 1UZAA 5AZJB 4I6MB 2VEDA 1QS4A 4H6PA 1POWA 3DS8A 2PAAA 3L4IA 3KYBA 3N2IA 1ZK1A 3G5LA 1BKSB 1JDTA 4CMHA 1FDSA 3LUFA 5CA1A 2P0EA 3VF4A 2IDJA 4HTFA 3ICCA 1X87A 3LUAA 2DY1A 3MN5A 3T3OA 4FMDF 1PBNA 1K3TA 4REQB 3LDHA 3CZMA 2IY7A 1Q6YA 4O63O 4GWKA 3EO3A 1ECGA 1L8QA 3A6ZA 1CVRA 2PKQP 4X71A 3NEYA 3NJ4A 5AK3A 4YMTA 4CIGA 3VBEA 1VJ5A 3UTCA 3AHCA 3MGAA 4XIYA 2YWEA 2ZG6A 1FBTA 4JR2A 1WY5A 5HF8A 1X7YA 9LDBA 3ZE9A 2ZI5A 3HRKA 2ZE6A 1KAHA 3G9TA 2LBPA 5DM70 1E9RA 3FPHA 3ETGA 3ITNA 3OJXA 1U4BA 3INTA 3KZKA 4DSIA 3F2VA 3UT0A 1E3WB 3WK5A 2GVDC 4JI3K 3NH9A 1LSJA 1YCDA 1DEXA 1WIWA 2TMDA 2JEYA 3J7AC 1KA9H 2OFOA 3F9MA 2A58A 4EA7A 3O1BA 1U63A 2YKNA 1T03A 3FR8A 1R64A 5F78A 1TKAA 1DPFA 2AV6A 4PGHA 3M6IA 4MUMA 4JYBA 3ZGNA 4O5BA 1RWXA 4QE3A 4UTRA 3AVHA 1IHUA 2Q4DA 1BH6A 1U8EA 3GR6A 3HA3A 5FNVA 3QLUC 1XRRA 1QRRA 5ILOA 4AZ0B 1WB6A 3G4SN 2FU5C 2FPKA 3FN4A 1OV4A 2XITA 1CD5A 1QYCA 2OXTA 3PXBA 1DG9A 1V47A 2QVLA 4F4UA 3VA0A 3ZT3A 4J0DA 3WQQA 3EVBA 4JI7B 4KQJA 1IKYA 2ASMA 4Z4FA 4CLRB 2FPPA 3NM6B 5DT9A 3NHJA 2FSNA 3ZQKA 2X8AA 2V3VA 4B33A 4MJ7A 4BQEA 3T4UA 2QTWB 3QKSB 4M54A 2G3YA 4TT3A 3NRBA 4E3ZA 1XWWA 4OHBA 5P8WA 2BLLA 4OXKA 3ICOA 2QXUA 3CG4A 4XOUA 5A4FS 4LJSA 2A5LA 1PG0A 3UICA 4B2PA 4CDGA 2QLBA 4FPBA 5CM9C 1AVTA 3ZDCA 4PRZA 5TQVA 4LDJA 4OI1A 5CAEB 1HJRA 3OKFA 3Q3CA 2RBGA 5AQ1A 1GIAA 2G8HA 9MHTA 3BJMA 3EVZA 4LPSA 1XA4A 4OXRA 3TTWA 1QQ6A 4R1PA 1HBJA 2OFFA 1I1QB 2IYAA 2OHGA 4GM0A 4MMZB 2JAHA 3PLAA 5AQYA 4OGGA 2BANA 2MYUA 2Y0PA 1M7BA 4GVPA 3WNEA 5AW7A 1NMZA 3V48A 2PSHA 4F92B 1Q1EA 1JJFA 3DR5A 2FWBA 4BP8A 2QBYA 4UXIA 3ZYYX 1HLFA 3A6LA 5KOIA 1N2ZA 1IN5A 4XEHA 1KDRA 3V7FA 2PZAA 4XVCA 3QP9A 3CVWA 5AKHA 3JWIA 2XDQB 3ZCTA 3SN6A 4E1VA 5EGSA 4S12A 3FZFA 1X0VA 3U7RA 4ND4A 1I51A 3HDGA 5T57A 1W35A 4JBXA 4ZTBA 3L7MA 3NVMA 3EVGA 4QAJA 4W5OA 4HEHA 4Z9YA 4LFCK 1NI4B 4CL3A 3PDIB 1JVBA 4W9NA 3HU1A 1AQIA 1DMSA 1Z0UA 3LTEA 2O8BA 4PFQA 5FHQA 3LUGA 4RJTA 2QD4A 1FMCA 4D3YA 3TRJA 3NVDA 2FVXA 2C4NA 1VPVA 4LF9K 2GZ3A 3AUFA 2CHFA 3RUIA 1TLLA 2YJNA 1CY7A 1SU8A 3FRHA 1U4SA 3HG7A 3HR8A 5F33A 5LYJF 1OJ7A 2IXBA 2PXXA 2VK2A 4Z0TA 3Q15C 5JSYA 5BNWA 2QAGC 4YT4A 4WOPA 3HY4A 3KRTA 2CBXA 2P4QA 2O20A 4GZ6A 1SEPA 1VE1A 4CMIA 1DKPA 2W2OA 4TZ0A 4A8PA 3SKYA 2OD2A 1J7KA 4KWCA 5IJ9A 3OO1A 1C8KA 5BN5A 3ZVMA 3EEBA 2AJTA 2E37A 1AIPA 1GD1O 2UVPB 3AO1A 3H1TA 4G5FA 2Z2YA 5IMBA 3ENHA 3ELUA 1NXSA 4U3JA 4ABYA 4RV5A 2QRPA 3GLHB 2J45A 3O8OA 4CF4A 4UXHA 1KK2A 1N7IA 4M83A 3ZBQA 1DC4A 5KOYA 4UU1A 5JCXA 4K9QA 3B9QA 3LPMA 1Y8RA 2VF5X 4CW7A 2NNWA 5AJZA 9LDTA 3F6PA 4MGYR 4DKJA 4CQLB 3P0FA 4P4UA 3E18A 2RHKA 1HQEA 1KI3A 3PNBA 2FPGB 3C0BA 4PA1A 1MJ5A 3EGEA 1KP9A 1YBMA 1P2GA 4J0GA 1L7RA 3NDPA 1WSDA 4AO7A 5CIWA 3TDMA 4B3RB 5IULC 4RTRA 2D1KA 2I03A 4E3WA 4NAVA 1YR6A 2ONZA 4OKIA 2QJFA 5TLSA 3T8YA 1N33K 2RC6A 3WKEA 2W11A 3UC5A 3TPZA 3HCBA 4RF5A 4AS1A 4DV7K 3TRKA 1C4KA 5TSDA 1WJGA 4OTZA 1IUKA 2XA2A 4OB8A 2E4UA 5T5QA 3E61A 4PS0A 2YXBA 5JD3A 4IFVA 2CV1A 3VNUA 1H5NA 4R0NA 1XTVA 3COVA 5KAPA 2V7VA 4CG2A 1X1BA 1T0BA 5JANA 5DP1A 2VRBA 1DJLA 4F3CA 1V4NA 3VTFA 3RUCA 2G9QA 4DUZB 2RGXA 3DAYA 3C6YA 4KPUA 3DC7A 5HGJA 5GMOA 1TKDA 4IYRA 2CFSA 3TS1A 4H17A 2QRNA 5JZBA 3KKSA 4INZA 3BWEA 3C8UA 1GL7A 2P9IB 4XPIA 2C4MA 1MRZA 4ERXA 1KAQA 4EYEA 2UUBB 1NVDA 3KD1E 1SB9A 3AF5A 3BORA 3E8MA 5C8YB 2A9OA 3EWAA 4OQ4A 3BCHA 3BZWA 3Q1LA 4LQCA 4XYEA 4EENA 2OYRA 4JUDX 3WYBA 2GCNA 2V1XA 4B81A 1FNDA 3IEMA 5AICA 1V4BA 4X8LA 1GLGA 1QV9A 3COPA 4LY7A 2IT1A 1T1IA 5GVSA 1XOIA 1CY8A 1U8YA 1XTJA 4JNCA 1HXHA 2FN8A 4BP9A 2SKCA 4I7EA 4NC9A 4C03A 3LUJA 2I4RA 3F1KA 4C4SA 2C9MA 1ABEA 1W9HA 2V5AA 4BQSA 5DDIP 1R10A 2D2EA 5LMNB 3RI3A 3A6EA 2NRTA 1EE2A 4NCJA 4GY2B 1NMYA 3JQPA 1HLPA 3HP4A 3H13A 2IDKA 1VIVA 4FLFA 1DOHA 3SX2A 3PR2B 3WL5A 1GA4A 4G0YA 1UFQA 2CZQA 4AMYA 3VX4A 3W2IA 4HADA 5CFPA 1DKLA 2P9QA 3CUVA 4E5KA 2VT6A 2VP9A 2PUEA 2HYDA 1TCBA 1YE5A 4R5MA 4LKRA 4XR9A 1Q0TA 4FOIA 1GAQA 3D4LA 3UGKA 3T0GA 3I73A 4B3SK 1OYOA 1GAXA 4Y1CA 2QSYA 1P7PA 1MMFB 4BR7A 4MVJM 2Z9CA 3GF4A 1S1TA 1EFVA 3HXLA 2XY4A 4FGSA 1T0JB 1P4GA 2C7BA 3TKLA 4WACA 5EE9A 2YJFA 1HC7A 1XQ1A 4WZAE 1HG1A 2KBEA 3LUHA 2HK7A 4WLFA 2EEPA 1C9YA 4OHZA 1NJIO 5AKGA 4FMPA 3V8QA 3CETA 1I6LA 2FPRA 3T4PA 2M32A 2Q9CA 1RNLA 3TB6A 3QBTA 2PUDA 3O0DA 4QJIA 2YWBA 3KZOA 4PYLA 3PPXA 5A0VA 3WYNA 4R69A 1LDEA 1RT3A 2QTTA 5C1PA 3FZHA 3LIPA 2NXJA 3VNBA 1IJKA 1X38A 2J9FB 3EZ7A 4LSLA 2NRHA 5EWJB 4OJMX 4JI6K 5BW4A 5FDLA 5T64A 3I30X 1ELOA 1T9AA 1QPZA 1GYRA 1QLWA 2VRWA 3NTXA 4IWYA 2ERCA 4CEHA 4Q3EA 4AQ7A 1Y4AE 3Q7BA 1J0DA 3W1WA 3PZRA 1TA4A 4CJLA 1CBUA 3SIXA 1BA0A 5IKPA 4CI0B 1KR5A 3OS1A 4LW8A 3STXA 2X78A 4OGKA 4X8HA 1FTNA 2A84A 3UCFA 5A6SA 3R6MA 3MYRA 4RSRA 4ZMSA 4MWEA 3U4QB 3OTOK 5ALSA 1BQEA 3JQEA 3S3TA 4OLHA 1FXWF 2JCYA 3QH4A 1B0PA 3BF1A 4IKPA 5HUQA 1V1RA 1R18A 5AWFC 4QBHA 4X63A 2PBRA 1XRQA 3A6DA 2VKQA 3PCRB 4IEEA 4PAQA 2I7PA 5CT5A 4YJ3F 3ZDFA 5AQOA 3ULEB 1G2IA 4LYHA 4EP5A 1I8TA 3T34A 4EAQA 3C6KA 3I04A 3WDSA 2B4JA 4X62K 1GSAA 1W47A 5K0FA 4W9NC 2IYLD 1FIUA 4JZYA 5KVSA 1JL2A 1LU9A 2OZPA 2QXTA 2XY5A 2O2DA 2OBYA 2VHVA 4KIUA 3NDJA 2JZCA 3MT8A 3SBGA 4X1YB 3WLTA 1V5FA 4WJZA 3ZWAA 4BDPA 4IJAA 2OGUA 4ZVPA 3DKKA 1RWWA 4IX1A 1DUIA 2WIKA 1A71A 3PYMA 1HKCA 1A9XA 5I7VA 2ZVDA 3L8YA 2P7IA 2ZKIA 1TKZA 2HDNB 4EP1A 2BFMA 5K3FB 4M1OA 2LCQA 1FF9A 3A4TA 1PL0A 1BUPA 1XMJA 4D6XA 1SKBA 4L28A 3HWWA 4CIDA 5BRDA 1JEYA 3NX4A 2IV7A 2CXRA 3I4FA 1YR1A 4Y8VA 3DVQX 4MS1A 2B2NA 2IOFK 4FYIA 3U6BA 1DO8A 1RQPA 4QG7A 4C2BA 1T2UA 3C4JA 4YQZA 2HA4A 3NBMA 2RJNA 3EGIA 3NEPX 4A3SA 1IZYA 5DB4A 1O4WA 3LPCA 1S9EA 1EVLA 3R6LA 4IXWA 1L1EA 1MX1A 1ORIA 2QP4A 2F9LA 2VPIA 4RA6B 1LRJA 4E7HA 4ZTUB 2JHPA 1AQ6A 1HMPA 1L7MA 2QM1A 2Y0DA 3KU4A 3ZKWB 3LDNA 5KGXA 5AQEA 4E5VA 4PG6A 4OLAA 4GMFA 2D1SA 4HDQB 3A3KA 1SZPA 3VR6D 5C31A 3WNVA 5AVVA 4UNQA 1GZ3A 1D2RA 5GM1A 4HDCA 5JJIA 2XI4A 3HL8A 2RHCA 2YQ5A 2EKLA 2QJRA 3N28A 2X9QA 3H08A 4L51A 3KQNA 2A0YA 3DM2A 3CGWA 1E4EA 1A5TA 3P32A 5EIAA 2R8ZA 4F2HA 2IFTA 2BH9A 2OO7A 1WSGA 2HHLA 4RZQA 3NBKA 5KOJA 1ISFA 2HBRA 1F6WA 1WMAA 4IZOA 4DJDC 5CB4B 4HQ0A 2XT6A 4H7DA 1ZI9A 7REQB 4FZYA 4MUBA 4MVXA 4UPVA 3H3OB 2BFNA 1SV5A 4RU1A 4CGYA 4U0KA 1WMBA 3JAKA 3LHIA 3QENA 3WK4A 4KFUA 4HAIA 3TIFA 3WV5A 2XKKA 1AN9A 5MLCQ 2C78A 5LYJA 1PFGA 1A5ZA 4F45A 3KDAA 1YU6A 2FQ1A 1SL0A 3UTDA 5EZ5A 4EVSA 1I10A 3L93A 4H77A 3HRIA 4FSHA 2DFTA 4YRLA 2YC4C 1EINA 3EXFA 1REQB 2WUWE 1VQ5N 1YTLA 4ZIRA 2O0JA 4EIWA 4Z49A 2F00A 4NBLA 3IRUA 4DCPA 2P91A 4RW7A 1ZA1A 2OM2A 2Y0EA 2WMDA 1NBMD 4B6RA 1SPXA 2J3LA 3ER9A 1D4FA 4GSYA 2ZPTX 4AUKA 4BNHA 1QRSA 3AY9A 3KQVA 4U8HA 4DU1A 4P6VF 4RVGA 1Z8NA 5DGDA 2H52A 3WAJA 5JXWA 3AR7A 4UJ3A 3WXMB 2R6GA 3FCEA 1E96A 1TX4B 2XCSB 1TV6A 1KYZA 1AKTA 2BTQB 5JSZB 3T54A 3ZNOA 1JAZA 1JR4A 4F56A 3RLFA 1WXFA 3OLQA 5BVGA 1B3BA 3EXEB 4DLYA 3RV4A 5FLEX 3SJCA 4R2LA 3WIEA 3MJDA 2PN1A 2J32A 1Z47A 2QTDA 1BQNA 3DLBA 4WQ4A 2HF4A 5D3MA 3W0LA 3GCGA 1YJCA 2OCYC 3FUXA 1W4ZA 4PLTA 1KU0A 2RGGA 1XMSA 2I99A 2A1SA 2AS0A 4LOHA 1A8SA 4IZ9A 3KKKA 3KPUA 3I12A 4HFRA 4BFZA 3ZYCA 3LDLA 3SMSA 3U39A 1E2LA 2EZ4A 3WQUA 3CRMA 4C4XA 3HSKA 2WHYA 3QJYA 4IS3A 2Z3WA 3O9SA 4F5ZA 4JOBA 2XVMA 1HL7A 5ADXA 1B16A 3KVRA 4KB1A 3EARA 1OYWA 3FWNA 1XHXA 3M4XA 2DBQA 3L6OO 5TQ0A 4ENQA 3ZLJA 2Y2VA 5H80A 4QVGA 5I45A 2FQWA 1HLUA 3PY8A 1A5AB 2ILTA 6REQA 2WKSA 4N5MA 3RBAA 1SG6A 2VQEK 1F0PA 4YDRA 3UKRA 3USZA 4EKGA 3KB6A 4XWWA 1UMBB 2MSKA 3VKUA 3H6GA 3Q85A 3W6ZA 3C6UA 5AJYA 2NTYC 4RA9B 3ONDA 4V3CA 4F6RA 2UXBB 3I4LA 4RSMA 2X8WA 2O3TA 3MOGA 3RGWS 3LU1A 3HP9A 1VQ4N 1NVEA 5TGDA 2I1WA 3WAGA 2Q4EA 5MF6A 2E8AA 3HLTA 4JNKA 3BBLA 4I1RA 2R68A 5D85A 1IZ7A 5IRCD 1RC1A 5EUMA 4R2HA 1YL5A 3F5DA 1PZNA 4BVHA 5TT0A 5D87A 4B9UA 4ER3A 2PUVA 1MX3A 3BKWA 3TNLA 5AKXA 2Y1LA 4RIFA 3ZUGA 5JYCA 4DEVA 5K14A 3GAFA 1J39A 1HM5A 1H3NA 2ZUWA 3I6IA 5DTEA 4WPGA 3NPMA 2FBVA 1YITN 1B76A 4PANA 1LX6A 3FROA 4IOLA 1TT5B 3BIWA 2OL4A 4J9UE 3UXMA 2B34A 3ASYA 1L1QA 1GEGA 1YKSA 1X8LA 4TXLA 4CGFA 1RZVA 3SYLA 2VHWA 1IY9A 4Q4AA 1JLAA 4XR4A 3THYA 5BSUA 4GVMA 3T3NA 3JQ8B 1G64A 3C95A 2DZDA 2WTEA 3IT1A 1IOVA 3NHUA 5BN9A 1FJ2A 4R8RA 3G6KA 1QTNA 1THGA 3O4IA 4GYKA 4D6PA 1RJFA 2W2PA 3TXAA 4OD0A 3DE6X 4BOYA 3TSQA 1U94A 5AMXA 1JEOA 1NJGA 4G67A 4ALNA 3A3NA 3QW4B 1RLJA 1P9RA 5E9AA 5E6UA 4KCGA 3ULKA 3PUIA 2W8ZA 3Q5GA 4UUQA 2AFIB 1CB0A 3F6SA 3H9UA 4ME6A 2VYPA 1NBMA 1IXRC 1QGOA 5A7HA 3C5WP 5KPRA 2EJBA 2QE7D 2X3FA 3MN1A 1F60A 4YWJA 1JA9A 1IZ9A 1US8A 4RK6A 1N2BA 2GJKA 4ASUD 1PNOA 5FBKA 3IQWA 3JQBA 2QM0A 4KR7A 3ISJA 4ZEWA 3HCDA 4W6ZA 3R3LA 1M2FA 2QQ0A 2Y9MB 2GOYA 3MYYA 2BLNA 5NULA 2PMEA 4DR3B 3H2ZA 5D2CA 3TTFA 1I9CA 1Q21A 3UT5A 4HPJB 4LY3A 3DLKA 1TAUA 2GO7A 2QX6A 3HYFA 1T91A 2NTEA 1JPJA 2GXAA 2JH8A 3L8DA 3W5AA 2ZSBA 1TF7A 1XZIA 2Y1OA 1RT1A 1SKWA 4M9ZA 1SAYA 3G5MA 4YCCA 1WBBA 4TRJA 5LFAA 3IEIA 4JYZA 1Z15A 3KE9A 3C45A 4EJ0A 2P9PA 2Q3FA 2MIIA 4J4HA 1BG3A 4HMOA 4NTZA 4XYGA 2NTNA 3SM3A 2WW8A 1FVXA 3TJRA 2ZRLA 1SUQA 1Z4LA 2Q8PA 3N8HA 3V3TA 1O96A 1I94K 1UKEA 4JJ4A 1JTFA 4Q9NA 4C7BA 4NYMQ 2B20A 1MHPA 1CEXA 4DG1A 5AFUA 2WE7A 3ND7A 2FBYA 2PJZA 3AOEA 3BY5A 3QVGA 2LVBA 3MSCA 5BR8B 3IT2A 2DCUA 1LQTA 4JJAA 2A9QA 2I3DA 3KDPA 4EQ6A 5JAPA 1N5OX 2OK7A 1JP7A 4P22A 1SBYA 1A95A 3L4BA 4Q48A 2FXUA 3NP7A 4CGDA 3DKIA 4F46A 2PVSA 3BUZB 1YL7A 3IAUA 1OWPA 1CJMA 3SZOA 3C16C 3NUGA 1CTQA 1Z5UA 3IV6A 2XV1A 2N1BA 1PWHA 4EL0A 1ZD3A 3KWIA 4ZYZA 4DG8A 5TARA 3LP0A 4YBZA 1S4QA 4YY3B 4HTUA 3I33A 5LR6A 3VF2A 5DIFA 5CCDA 5KU7A 1OXTA 4ZU3A 2XKBA 2HBYA 4MVJG 3T7TA 3UIQA 3GI1A 1G41A 3CQ9A 1W2HA 3OOEA 4CG3A 1N78A 4ZOLA 4DYDA 5JADA 1J22A 3KUUA 1PJ2A 3IQHX 5AXAA 4M8SA 4YMLA 4B5LA 5A4AA 3LP2A 5EIBD 2HHTA 3H9JA 1M6EX 4C87A 5BWLA 1EFHA 1FRZA 3I0MA 2WJYA 1PT5A 3P52A 4DV5B 3D43A 4R8VA 1MENA 2RHWA 1UUFA 1NVXQ 3KPYA 3K5LA 3PHIA 4PS1A 3TW6A 1H2WA 1G42A 3ME5A 4DFPA 3BMNA 1Z08A 2C31A 5E3HA 2QL5A 3DMPA 3EZ2A 3T0FA 1TUBA 2GK3A 1I5OA 1T6XA 1RAAA 1DKNA 4NLBA 1NR1A 2CVHA 2GSDA 5KBYA 2AJBA 1VL0A 3ZR4B 1TQHA 4OL0A 4ZPJA 2YHIB 1R5NA 3CEJA 7YASA 2ZYRA 4EGAA 3PUYA 4LZOA 3ELBA 3NLLA 5LN1A 2QL7A 1UPFA 5JXHA 1S3SA 4ID1A 3I1YA 5JC1A 1BU6O 2PT9A 1EFCA 3DJFA 3S2EA 1IVSA 3CC7N 2ZBDA 5FAKA 3AV3A 1RCHA 4BR4A 1IONA 1OC4A 3KKLA 4AIIA 1YRLA 2JLQA 3PKJA 1IZZA 3PCXA 5AI8A 4C3OB 4ZQFA 4KYIB 1Y34E 1XHEA 1DLJA 1G5FA 2HZBA 3Q3GE 3AJDA 3H5WA 2VDKB 3V1OA 1JQBA 1IAQA 3E1KA 1VSDA 4DTCA 2MYPA 4FJ2A 2FC0A 3OM0A 2NVUA 1E6MA 4L72A 2FDCA 4F3TA 2I6QA 5AYVA 1Q22A 4IAOA 4PG7A 3TR8A 4C7XA 4IDGA 1USVA 4WQ4C 1NZDA 3LECA 4X97A 1MT0A 2F3UA 4ZT2A 3A70A 1I3OA 3EFOA 5AT1A 3DHWC 2VUTA 2ZIUB 4CYMA 1KFEB 3X2SA 3AVKA 4JELA 4BLVA 5K3SA 1AQLA 3FCUB 1TUEA 4G4SP 4AFNA 4EB0A 4YQEA 3OLVA 4H7JA 4MICA 1LI7A 2F8LA 1LZLA 3P4YA 1KZ9A 1EETA 4X8OA 1M2GA 3VPGA 4KX3A 2QE7A 4D96A 1PU2A 3BJRA 5FNVF 3VZRA 4PLPA 2ZZMA 4ASUA 2HU2A 1AGNA 4KIGA 5FWYA 3CH5A 4M9QA 4WUTA 5CA0B 3V4OA 4MI1A 3I52A 4JT8A 4M6WB 2C77A 4CEZA 1SH7A 4OQFA 1AN0A 4TSRA 1XRPA 5F4BA 1X14A 1GL9B 2B35A 4HBGA 1JHQA 1X1RA 3C3CA 1EFKA 5CNKA 1OI2A 4R05A 5IABA 4O5AA 5LOVB 3PT9A 1BDJA 3HSYA 4D3SA 1BX3A 1DEOA 1V4TA 2PE5A 1UKAA 3H65A 1TM5E 5HIMA 4F9GA 3NOXA 1QH8B 3ALYA 3LUCA 4EW6A 4BVOA 1ABFA 5CXXA 2QJTA 1Y4SA 4MI3A 1CX9B 2QWOA 4ZEOA 3IR6A 1D0VA 4QYMA 2J4FA 5FT9A 4M2LA 2C2ZA 3F5SA 4BQIA 3JD0A 4IO9L 1UBJS 4H15A 4CIXA 4P3NA 4LGMA 2Q8QA 2G8VA 1JQDA 3LQRA 2IKQA 1QIDA 4G25A 2RD2A 1PRYA 3FFXA 3LJKA 3B7WA 4ZC8A 3PBKA 5A04A 2DFDA 4DHEA 4OMFG 3HUEA 2JLBA 4UHJA 2P5GA 3LTNC 2YZNA 3ZTYA 3FPSA 2I1QA 4E33A 2XRMA 1C3OB 5JPIA 2BAGA 1ZRNA 3HJUA 1LBSA 2K6GA 1RJDA 1RMTA 2CGEA 2JHAA 3P0HA 3ROQA 3MTJA 4LF6K 1DDGA 1QHIA 4IF6A 3FFTA 2H2FA 4AO8A 5T41A 4RW9A 1JSCA 5DASA 1M8JA 1JLHA 5CYOA 2OCBA 4JI2B 1H6DA 4WXYB 1WULS 2C1XA 3NYQA 3LUPA 3DXMA 3H83A 5JQGA 1HNNA 3RRBA 4IDFA 3UGTA 1VDMA 1VYVA 4WKPA 2BFFA 1XVAA 4QXRA 1VMDA 1R5BA 1UFVA 2NV6A 3PWZA 4EO4A 1AURA 3BFPA 4EA8A 1RT2A 2FDRA 3FDZB 4K26A 2IDMA 2YXDA 3KYIB 2CNNA 3SJAA 3UB5A 4C43A 2NVBA 5FYQA 4A0RA 2RONA 4C05A 1GHTA 4X95A 4NCAA 3BTVA 2I4NA 1D4AA 3NHSA 3KKNA 5IANA 4JKOA 1PUIA 1ZDMA 1QPBA 4TMTA 2LCFA 3OX3A 1JLQA 4CJPA 3OPYI 3WZLA 4ZT7A 1S2IA 3OCVA 4O44A 2AFRA 3TLZA 2DHQA 3NGYA 3KR1A 3JQBC 3BRWD 5ELMA 2GJSA 4NEHB 4X6LA 3EUFA 4AAYA 2R8OA 2WJWA 4KGVA 1JPNA 3GDHA 3BTUA 4YRCA 1TZMA 2JFWA 4U7GA 5GAJA 2PLRA 2CMGA 1MHTA 4ZDIA 2A1IA 3LT1A 4DSOA 4KPFC 1P80A 10MHA 3MXOA 1TQ2A 3OQIA 3NF7A 3ZGVA 3F7MA 1E2KA 4QCLA 2HT1A 4BFTA 3RFFA 1IUOA 3TK1A 4ZVVA 1QRDA 4D3FA 1GUDA 4PL7A 2CGJA 2EHGA 3V42A 4DEYA 1K6IA 5ILGA 5EC8A 1IN8A 5L4LA 1G5TA 1GV1A 1H0HA 3OZIA 1HYHA 4CEJA 3NTRA 4HRXA 5A71A 2ZQBA 4MEJA 3K0BA 3WYCA 3SQNA 2B5OA 3HHPA 2AN3A 4YJHA 3IURA 3AOEC 4KBYA 2B6AA 2I6UA 3O73A 2IGBA 2XBMA 1LDBA 2UUAK 1WZEA 3W3AH 3TI7A 5L51A 4PXAA 4HEQA 3W6OA 1UPCA 2C3PA 3L4BC 2IS2A 2JVJA 3HACA 4LWOA 2PJRA 4FDVA 4NPAA 4BWVA 4YJKA 2WIAA 4LHSA 1C3EA 1J49A 1FYXA 1K98A 2ZCVA 3R9WA 4PLVA 3VC7A 1ZGHA 3WYAA 1G8MA 3L1KA 2PL5A 3VKWA 2ASPA 4H60A 2JFYA 1RCUA 1JEAA 4LTDA 3UY4A 3DAGA 1DAKA 2ZIXA 1JYFA 4IOKA 5LD2C 4NENA 5FUQA 1HE3A 3UWKA 3B6KA 4ZCIA 3HCCA 4NQZA 4RTSA 4NJEA 4F4CA 2X6QA 3VHXA 3LXRA 1X1EA 2C96A 3TTTA 3MWYW 2N9UA 5T6BA 3EDYA 1IEXA 4B71A 3WGLA 3KQKA 1GFWA 2W6OA 3KD5E 4H0TB 5BT9A 1SRQA 4R2XA 3AINA 3IEUA 4PEVA 5G4KB 4IDBA 3EKSA 2AKEA 1PQ4A 2WWTA 4J0QA 4MB2A 4L4RA 4FYJA 3RRZA 3OY2A 4BDTA 2ZQ5A 2NZTA 1VQKN 1NUHA 2OLEA 1B00A 5BXQC 1CDZA 5GONA 3ZOKA 1IBKB 3HFRA 2X3YA 5J63A 4JBGA 3EGXA 3CVXA 1NUUA 5EMJA 3WLOA 2CLMB 4EM6A 1V43A 3L46A 4XRRA 5DCLA 4AJEA 1G3QA 1T0HB 3FNEA 1OAKA 2WJ3A 4IIJA 1MQ8B 4MQ4A 1T2VA 3RSHA 3D31A 1KL7A 1XELA 4FFNA 4BZQA 3WX0A 2DG2A 4WZAA 1U7OA 4FXPA 4UHHA 3VGMA 4UUNA 2AXQA 1KOGA 2ZBFA 2X2EA 2V7XA 2P9LB 4U2BA 4FEGA 1UZNA 4YDHB 4L5BA 2A88A 3M3HA 2WVAA 2XB2A 1NBME 1ZH4A 4AX8A 2Q6TA 3AA3A 1Q15A 2VNSA 3GMIA 1B6GA 2Y1WA 4JKEA 1Z0DA 1MR3F 3VYRB 3E2MA 2J48A 2PG3A 1ULHA 4MYDA 1LQ2A 3QEBZ 4CLOA 2VQDA 4P36A 1OPXA 4M7RA 4UOZA 5EXXA 5C0YA 4EVQA 3KZ1E 1CUGA 4A6PA 3PEYA 1LS1A 4MLHA 3AVYA 1W1UA 3VVBA 1SUWA 5H82A 4HOYA 5G3YA 2ZBEA 1YGYA 5BN8A 1EB9A 2QL6A 4QU9A 3FKQA 4NNOA 1KY3A 3BMOA 2TRSB 3RANA 4ACBA 1IQ0A 2QW0X 5A5EA 1TW3A 3OKPA 5F1KA 5C53B 4NCXA 5GGYA 4K25A 1RPAA 2F3SA 3I2KA 5I7WA 4OPAA 1R5OA 2JLWA 4BV9A 3QMLA 5E2AA 3B60A 2HRDA 1UKCA 2E2QA 3GDFA 3B3QA 3DLRA 3L7OA 4ZCLA 1VB5A 1OU4A 3WGGA 2ZFUA 2P9SB 1Y4ZA 1FVFA 1GZ5A 4BFCA 3RC2A 2FSVA 2UU9K 1L7NA 1WSJA 4POOA 2QD5A 2EBHX 2YIVX 4MQMA 4H0PA 1Y7PA 2O8VA 3KUKA 3NWPA 2JGFA 3AEUA 3QQ5A 3EBLA 4O3FA 3EFEA 1AKVA 4TLAA 2FEXA 1RDUA 1JPUA 4K2AA 1H6BA 5K8UA 4KGZA 2RDMA 2W93A 3MK6A 4CJFA 2K87A 3VTHA 2SECE 2F7SA 2PUTA 3LXMA 1GCUA 1G0NA 4CGHA 2HIAA 3ZGXA 1RT7A 3R3VA 4EHUA 4P2BA 2GPWA 2X0KA 1VKJA 1R4NA 4RQAA 1XQWA 2AXNA 1XALA 1KWGA 2XA9A 1PV2A 3R6TA 4QM7A 1P0PA 2PSDA 1ZM3A 3VTZA 3DLHA 3V1NA 3ELYA 1ISSA 1R16A 1X8JA 3ZWCA 4DIOA 3FMOB 5EIBC 5K01A 4GYJA 1RLIA 4X24A 3SEQA 3KOOA 5EJ8A 3HBJA 1OIXA 5DSZA 1JU9A 4HUJA 4HTAA 2NNLD 1QYWA 4IOJA 1X7HA 2ZGYA 5M34A 4U1RA 1LTKA 5HYVA 1U11A 3WNGA 2Q1TA 4FK8A 4JYAK 2JIQA 3A58B 4YASA 5LQMA 1JXMA 4QRHA 1VXOA 4E4TA 1GA6A 4C29A 3GX1A 2EU8A 3SE0A 1Y3CE 4E12A 4R8MA 1FJGK 4O4HA 3AVFA 4NMWA 2FW1A 2YWDA 4HXYA 3AP2A 2WWWA 4JHLA 3WK8A 2BMEA 1E3MA 4JA0A 1RYBA 1NRJB 3F46A 4AZTA 2C92A 3H4IA 4DTSA 2GA9A 4PZDA 4RO0A 2WG1A 2XDWA 3T7KA 3ZCRA 1GILA 3B8HA 2GBCA 1OWMA 4B8WA 4L2IB 1Y37A 3Q7RA 3P0IA 4AJLA 1GLAG 1M8KA 2YWCA 5EYPA 1NGCA 2YRXA 4H3SA 1SQSA 4RDCA 4OBXA 2QN7A 4ZVKA 1CF2O 1VBNA 4YRIA 4DANA 4YMUA 2VZ9A 3JWJA 1V1MA 1M1ZA 5KKAA 3CG7A 4YT8A 3R5SA 3L3BA 1GRRA 2GHQA 4EJFA 4Y7CA 4B76A 121PA 4DR6K 4UULA 3I34X 2HMWA 4BQRA 1THMA 3OPYB 4NQRA 4KPYA 4QLOA 1MW9X 2P30A 1KJ8A 1OY1A 4C0HA 2XMQA 1UDCA 1Z4PX 1EGQA 4RY2A 3VFDA 3AQIA 1RDCA 2QKBA 1PS0A 1E9CA 3BFKA 2QTVB 1YD7A 4PWZA 3RO7A 2HOQA 1LOTB 4ML3A 1OLXB 3T3MB 3BF7A 4XVUA 1MG0A 2XR1A 1QVAA 1GT91 2WM2A 3KE8A 3X1YA 3SF0A 3K9FC 1OXXK 4U6NA 2NXCA 1U2ZA 1FE8A 1QHHB 3QMVA 4IHJB 5HCUA 2RKOA 5DMRA 5KWVA 1DWUA 1KYTA 2ZGVA 1TJPB 1RLTA 2JLVA 4QU5A 4U5XA 1A7KA 2W2VA 4EK9A 1ZIOA 1XN4A 2E5FA 2GBZA 5KRTA 3LFTA 5EA2A 2HL6A 4IV5A 3TRDA 2F4VK 1UMCB 2AHRA 5K8IA 2I3GA 3BK2A 3IMKA 4KTWA 1KPIA 1M1YA 1NMSA 3G0BA 5AXCA 5LQDA 2WD7B 3CG0A 2M6SA 2PSSA 1RVV1 3JVDA 3AFIA 2FP3A 1H6AA 1KMHA 5HCIA 3VGJA 4PRKA 2ZI9A 1OFUX 2GILA 2B5JA 4YHBA 5C1BA 1M0TA 1ZVKA 3EAQA 1NQTA 3T9AA 1S02A 2QT1A 1IQUA 3SHOA 3QINA 3TD9A 4Y6RA 3R20A 2ZT5A 1BQ4A 2G8WA 4CMEA 4FKMA 2R44A 3ZU2A 4QHSA 3K0AA 1UZLA 4YTEA 2E82A 3Q0IA 3WMEA 3B8AX 2X0DA 1P73A 1NMDA 4CG0A 3T4XA 3OYLA 2RGRA 4DHYA 4WMLA 3GGDA 2QNIA 1GV0A 4FW1A 4H16A 2J67A 821PA 1C0FA 5A5FA 2EFDB 1RTDA 2J6BA 4DQRA 4JDPA 4QUIA 2J9XB 4LHVA 5KIAA 3I72A 5FWNA 2FOIA 2GZAA 4IIHA 4RF2A 3I6QA 1KMQA 1TO1E 3D3WB 1N4DA 3BQNB 4GIBA 1T0UA 2JIMA 2FW9A 3AH8A 4DMFA 3EMVA 4TTPA 3FMPB 1J97A 2ODWA 3BJZA 3DL4A 2G4LA 2HD4A 3RS9A 1EUQA 3EMBA 3PPYA 4G5OA 4E13A 4Q9AA 4FWKA 1LPPA 1EGVB 3KTFA 4AKEA 2LIVA 1K68A 4FE7A 3TSUA 5JALA 1OT3A 5SICE 5T8KA 2W6LA 3VQQA 3MUFA 4G1EB 1ZXXA 3AGQA