1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN AF1318
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
6ABPA 1RT2A 4FVMA 1LAVA 1TGOA 4EYQA 2HNDA 3HCWA 3OYKA 4YGXB 3CG7A 3QX8A 1KFDA 5HBMA 3NCIA 3BGRA 3I09A 5KRTA 4ELVA 1UOCA 5FWXA 3PY8A 5C42A 2G8UA 4HHTA 3P1GA 4KI4A 4WUTA 4OATA 3DI6A 1M2FA 1S1VA 2E4WA 4FLZA 4LY7A 5HQJA 4KAZA 4DQSA 1NOZA 3SZ2A 5KC8A 2DY4A 1WNSA 4R5PA 4KHYA 2NZVG 4M3TA 1B9FA 1DRJA 1JX6A 3A0RB 5KC9A 1LBIA 4MS4A 3LP1A 4MR9A 4J2DA 4FLWA 1RBRA 3DRPA 2MYPA 4EVSA 2D5RA 3LP2A 3JY6A 3QEKA 2JRLA 4Z4IA 4LRQA 3TB6A 1Z2EA 3VN5A 1W9HA 2F8SA 4PY5A 2WRZA 4DS4A 3HDVA 3F73A 2G8HA 3GT7A 2OQRA 3NHGA 3I0SA 1WAJA 3TD9A 2JBAA 3RMAA 1NK7A 5KQLA 2JGUA 3K5OA 3HJFA 4KZKA 2F8TA 5DKFA 4M3ZA 3KYJB 1KSPA 2HNYA 4S04A 4FJJA 2WB4A 3OLVA 4DS5A 1SL0A 4MR7B 1ZN2A 4O1HA 3ZSRA 4N47A 5TQ0A 3CFOA 4CFDA 2HQBA 1VRTA 3AVCA 3L8BA 1VSHA 5SZTA 1RT3A 3RVJA 5K14A 3NH0A 1U49A 1GUDA 3NBPA 4CJVA 2LIVA 2H0AA 3O75A 4KFCA 2KZZA 3LWLA 4PE5B 4Z9AA 3IP9A 3QETA 1LAWA 4IILA 1QTMA 3H5IA 1JLCA 3OO1A 3RWUA 1OXKB 4EY3A 1YVUA 4G0XA 3KLNA 4DFPA 1VKRA 4RKRA 2GBZA 4YRZA 2WWVD 3KS9A 5KQGA 2VWKA 2FLKA 2V0NA 4DFKA 2G8IA 1J56A 3LZJA 5HP1A 2QKKA 3KD1E 4GVMA 4BE0A 3GV0A 3SPYA 2H3HA 4O4GA 4S05A 3SUPA 2FEWB 1QQBA 4B9VA 4L4UA 1Z2DA 3CKMA 2KQ2A 2E4UA 3AO4A 4DTPA 1RXIA 1E6MA 1L5YA 3K5MA 1NJXA 4IFVA 2OYQA 4EVQA 4E7JA 1RT7A 3A0UA 5FWYA 4FJ9A 1RT1A 1GCAA 1EKEA 3RR7A 2WJWA 3OO0A 4RK5A 4CBVA 4MS4B 2X78A 3JYTA 4H3KB 1IKWA 2I5JA 1ASUA 1ZH2A 1ZESA 4RW9A 4FB4A 2PY5A 3AO3A 3HXMA 1U2QA 2HHTA 2QU7A 3C95A 2QK9A 4XLTA 2E4XA 1N6QA 2R4QA 2QKBA 4E1NA 3QO9A 1CXUA 4CEFA 5KTQA 1A2OA 4RZSA 3FMVA 4FJHA 3VA3A 3RVRA 3NE6A 4TSXA 1Z13A 1D9FA 2X6NA 4IMJB 1BHLA 5CZ1A 3OLWA 3TARA 2A9OA 2FMHA 3OQNA 2CD7A 3EAFA 1DBWA 4PWDA 4C8MA 2AJQA 2DFHA 3K4HA 4JA2A 3KD5E 3VQEA 4AHSA 2XY6A 1IO2A 3K9CA 4KI6A 2NUBA 4CFAA 3TO5A 4FCYA 4RXTA 3ROFA 1P6QA 3B6PA 4DF4A 4CIFA 3IPCA 4ZYLA 2YKMA 2HHXA 2QR3A 3DM2A 5HRPA 1DC7A 1K68A 3SQ4A 1K6YA 3M8QA 1HNVA 1LK0A 4MQFB 2L19A 3IS9A 1TKXA 3LP3A 1A5VA 3RMCA 4KB0A 2XDYA 1C1BA 2MSKA 3E61A 3O3HA 5IX8A 6CHYA 4DFMA 3RVLA 3LTEA 1JL3A 3FFXA 4G0PA 1BDHA 1KCFA 2PYJA 1LW2A 4E7PA 1ZY2A 3U6FA 3OYJA 2HHVA 4DFJA 1HYSA 4UQGA 3LANA 2Z1IA 4DTOA 2GWRA 3DBIA 3HL8A 3KIOA 1F51E 3NFAA 3ROTA 1ZH4A 4RXUA 3JPYA 4B9MA 3RR8A 1JH9A 4KKOA 1U2PA 1ZITA 1IIBA 2AYZA 4CJLA 3TMYA 3VQ5A 4B08A 1SKWA 3GBPA 2G8WA 4FM2A 4F06A 2HSGA 4JRPA 4LE0A 4G86A 1NKCA 1TVMA 2VUIB 4F3OA 2FQYA 1MAVA 3SUNA 1RDBA 4AHCA 5DK5A 4KVFA 5EWJA 2O4GA 3CS3A 1R8JA 4OPJA 1USGA 3D45A 1NK4A 4L8RB 1WSJA 3ITHA 3WNEA 1EWKA 4P1ZA 1ABFA 4RK4A 2A9QA 4HUFA 4F8RA 2Q3SA 3MF4A 1U45A 2Y1IA 1LWFA 3KK1A 2G8KA 4DQDA 2PUFA 1T8EA 1XI1A 1MVOA 4DSJA 1KFSA 3ALYA 4CK1A 3OMWA 3C6TA 2ETJA 3NBMA 2E4YA 3R0JA 3ZT2A 3IP5A 4UHJA 1KTQA 1OXBB 1EHCA 1CXQA 3V9XA 4RK6A 4H4MA 4IBNA 2RKIA 1TL1A 4FJXA 5T7BA 1VRVA 2RN2A 3I42A 1T03A 4I7FA 3K59A 1NXPA 4CFCA 1Z18A 1EX4A 1TMYA 3M9XA 1BI4B 3A3KA 4CHQA 3S3NA 3LUHA 1VSMA 8ABPA 3TAMA 3DMJA 4RKQA 2PAFA 3O1IC 3BDPA 1RPJA 3S9HA 4CJPA 4FJNA 3L2QA 2AYXA 4RG8A 4WZZA 1JXEA 2FXIA 4E7KA 3LP0A 4MS3A 4JS5A 1A5XA 1BIZA 1RT6A 3ZT3A 1D1PA 5KRSA 5C25A 2PL9A 2KTQA 4JRQA 4CHNA 3GYBA 1ZBLA 3IAYA 3MQ4A 5DGCA 3OYNA 3O74A 5SWMA 2GUIA 3H5TA 4CJRA 1WSIA 3MEGA 1CYEA 3TANA 1RDAA 2PL1A 5HRSA 4KV8A 3NGZA 2F96A 1NOYA 5FRMA 3CTPA 4FJMA 3OS0A 2MSWA 2YHBA 1JHZA 3EODA 4DTMA 5JNTA 3QLUA 4M88A 5EWMB 1CLQA 4Y1DA 4OBBA 5PNTA 4F4KA 3N8IA 1VK0A 5FWYB 4EVRA 4DTRA 5TQ2B 3DGFC 1E6KA 4EUKA 4FJGA 2FBYA 4XAQA 3VNBA 3CRNA 5HKOA 3OVNA 3ZSOA 1D4ZA 3DLKA 1WSHA 4LZLA 3GWGA 3M8PA 3V6DA 3H6HA 2VWJA 4FZXC 3THVA 2HVHA 4RU1A 1WSFA 3ZSYA 4HVJA 2IPLA 4MS3B 3N75A 3OYBA 3TAGA 2A1RA 3RRGA 4CF1A 3QELB 1NY5A 4CEOA 1Z17A 3D02A 1JL1A 1YIOA 3RMBA 3F6PA 1S9GA 3ZCMA 4Z99A 4FJLA 4I9LA 1DLOA 5JNRA 3T95A 4AHVA 3BRSA 1TL3A 2PKXA 2LBPA 2WJAA 4FZZA 4CJFA 1IG9A 3L2VA 4B9UA 3KG2A 1T34A 4AHUA 1VLZA 4UHKA 5KGXA 4IFYA 1ZDMA 5IEBA 3HP6A 3O2JA 2OPSA 1TJYA 2DFEA 5KI6A 2KFNA 4F11A 3SY8A 3U3YA 4RK0A 1HEYA 4OLAA 4YFUA 4OKKA 2ID9A 3ZT1A 1NXTA 1J54A 1VSDA 3CZCA 3KJVA 2ZQBA 4BDZA 3NDKA 3LZIA 4E7LA 3Q7SA 1PEYA 5KQPA 4KHSA 1ZBUA 1JF8A 2QVCA 4FLYA 3TI0A 3IRXA 1EAYA 1BA2A 4C8OA 4B8CA 4CHOA 1BAPA 1BDIA 3L2WA 2LUOA 2IDOA 4KTWA 2BDPA 3N53A 4HNSA 4OKJA 3FFTA 3Q7TA 3SPZA 3MM4A 3O4QA 3RRHA 1U48A 4OJRA 1YK0A 4CIEA 3DZDA 1SRRA 5D2CA 4DLEA 3K5LA 4MS1A 3LPUA 2IDMA 3OMXA 1MIHA 2ZWMA 1TAUA 5FWXB 4DQPA 4KHNA 4RK1A 1F21A 2QZJA 3RVPA 1DBPA 1FFSA 4I2QA 3RVQA 1ZBHA 4KO0A 3AVFA 3KLGA 1JLFA 4B9SA 3DLEA 3AV9A 4KHWA 1UWBA 1JWLA 2PLNA 1UA1A 4ELTA 1NK0A 1A5WA 3GBVA 2VG6A 3F9KA 1ZGZA 1KRXA 5JS2A 4NICA 3CHYA 5CYMA 3L3UA 3MXMA 3VQ8A 3OLXA 4W5QA 3O1JC 4NYFA 1F4VA 1FKOA 3HUTA 3KKRA 4ICLA 3NNSA 4KHQA 2PUAA 1HRHA 1B9DA 5T3YA 5HLFA 3SQ1A 3NF7A 4FK0A 4N56A 2M98A 4O5AA 2WOMA 4CEEA 2JBAB 3P83D 3L2UA 3CFPA 1L3VA 3OYEA 4D6XA 1BCOA 3MXJA 1IKVA 2HQOA 3SV4A 1ZBFA 3EYZA 3E3MA 3T8YA 4C8KA 4Z4FA 1YT3A 2ZE2A 1RBUA 2X7XA 5TE9A 4ZTJA 3OYHA 2PUDA 3KLEA 2R25B 4WXEA 3LUGA 5E41A 4CGIA 1M2EA 1SV5A 3HSYA 1SUQA 1QHTA 2E6MA 1USKA 1M5UA 1D5AA 3L2RA 5CNIA 4RK7A 3LAMA 1BQMA 2OZMA 4CESA 1DTTA 4KTZA 1XHEA 1HYZA 4CF8A 4JB2A 3K2PA 1QSYA 3H1GA 1RT5A 2BANA 5FDLA 5IEJA 4FXDA 5EWLB 1ISSA 4E7OA 3DLRA 4M3RA 3MEDA 3KLOA 3QLVC 4JS4A 1LJUA 2FQXA 3QIOA 3RTVA 1A0OA 3F7NA 4CFBA 4CJEA 3MECA 1VSFA 2P51A 4DSEA 3LKBA 2WY2D 4FW1A 1RXEA 1NJZA 4XFKA 3ASMA 4ETIA 5C24A 2M1ZA 4GMJB 5IC5A 4DTNA 1TM2A 4W5NA 2CWDA 3W9SA 2PJUA 1Z15A 1YK1A 1NKEA 2CHEA 1NXOA 3NAEA 5KGWA 2E4LA 4FJ7A 4IGAA 3N0WA 1EWTA 3OY9A 4RW8A 2OPQA 3TAEA 3M9WA 3DYAA 4G0OA 3EY1A 5KQMA 3LDSA 4OGCA 2IYNA 3CZ5A 1AB6A 4LE2A 4MR8B 2GV9A 3KKSA 4NV3A 4DN6A 3G85A 1RTJA 3AVNA 3OM1A 2QV0A 3RH0A 4W5OA 4Q6BA 3RVOA 2BE2A 1JFVA 3BILA 3OYFA 3WNFA 3LWMA 3QEXA 4I9QA 3H5WA 3NGYA 3V9UA 1HQEA 4DU3A 2FMIA 1YTUA 4XXHA 1L3TA 3VQPA 2FEKA 4IG3A 4M3YA 4PYRA 4RY9A 3CFYA 1DBQA 5GQSA 4B09A 3B6OA 3HPOA 2G8FA 1DG9A 1S1WA 2B1JA 4MRMB 3V4IA 3HV2A 4E1MA 2YKNA 3CQ8A 3SQ0A 3H6GA 1S6QA 2B6AA 3A2FA 4JAVC 4C8NA 1NK9A 1HJRA 2KYRA 4N03A 1ITGA 3VQ9A 1KGSA 3M8RA 2JK1A 4DMNA 2B5JA 3ZSWA 4LSNA 2WONA 4J2EA 1TAQA 4BWJA 3UK0A 1J9AA 4EYOA 2KZMA 3AVKA 4D6YA 2IGIA 4CEQA 5HM6A 4LSLA 5DLEA 2GKGA 4ID5A 4CGGA 3V9ZA 7ABPA 4IG0A 2W42A 2FC0A 2XRIA 4FK4A 1E2BA 3K58A 1RNHA 4TLLB 4MAAA 3KSMA 1C0MA 3NF6A 2R7YA 1I3CA 1S8NA 3DGEC 3QELA 4CGFA 3DLBA 4XASA 3VQ7A 4FJKA 1W0HA 2LSNA 1Y97A 1TK0A 1NTRA 4YP9A 1LW0A 1P6UA 4DG1A 1XWWA 3LUDA 4JASB 3KCNA 1NKBA 3T6KA 2P9HA 3TAQA 3HT3A 1JLKA 1FKPA 5GOTA 3DLHA 4YV7A 5DMRA 1QPZA 3AA5X 5D3GA 1UAXA 4NCAA 1APBA 3LUCA 3ILYA 3SV3A 1WAFA 4QOZB 1RDCA 4XARA 3TAFA 1W25A 5TPWB 3LUJA 4Q5VA 2X74A 3CYMA 4G1QA 4CIGA 4DSFA 4CJQA 4F12A 2HW3A 1GOCA 3CFRA 3KYIB 4KNYA 2IAJA 3RVMA 3DOLA 2YNFA 4ZJPA 1L3UA 2B4JA 3PX4A 2OA8A 3QLTA 3JTEA 1VSKA 4G0QA 3I0RA 5HRRA 2P5OA 3EJWA 1CZBA 2E4ZA 1TV6A 1Z12A 2D0BA 4DWIA 5CNKA 1JDNA 3AVHA 1JKHA 3JS5A 2JVJA 2JVIA 1ZVVA 1DTQA 2FN9A 1X9WA 1RDDA 2GI4A 3NHZA 2FEPA 3SQNA 3PX0A 4CGDA 2QVGA 3LUKA 1PHRA 1RBVA 1HYVA 4RY0A 1XHZA 4BE1A 3OQMA 2J48A 3KKEA 4ZTFA 3OYCA 3C3MA 1S5JA 2FVYA 5B3JC 2MSLA 2HHUA 1P8AA 1HQUA 3LUFA 4FK2A 3QEMB 5HRNA 1JBEA 2RDMA 3RVNA 4GW6A 5EWJB 4CHPA 3NGIA 2QW1A 3ZSXA 1T7PA 1X1PA 3SUQA 1ABEA 3EQZA 4M41A 2A9RA 2B4AA 4MQEB 3Q15C 2L17A 3AA2A 3AVAA 4MLDA 4PEVA 5J2MA 3MYYA 1D8YA 2TMYA 2DFFA 3AA3A 4M3XA 4DQIA 4MPTA 4N76A 5JNWA 3BRQA 3OYGA 3CM5A 2X6SA 2R48A 2KFZA 3C3WA 2HHSA 1FFWA 3IP6A 1Q8IA 3HYFA 4RS3A 1C0UA 2FBTA 1D9DA 5JNSA 1QS4A 4CJTA 1NJWA 3PV8A 3L49A 2CHFA 1JLGA 5CY4A 3NH2A 4RW4A 1IKXA 4QAGA 3LMKA 3OQOA 1RBSA 3ZT4A 3NNNA 3JPWA 1BVHA 1JFTA 3IG1A 4LH4A 2HB5A 3TR8A 3AVIA 1USIA 1SL2A 3GRCA 4HNQA 2LP4Y 1DC8A 3EQ2A 4WWHA 2LPMA 4E89A 1G15A 3OLZA 5JNUA 4KRFA 2QXYA 2VUHB 2HPHA 5JS1A 1N5YA 5IUNC 3HS3A 3GA5A 1E6LA 1RILA 1S1UA 2BGGA 4ID1A 4CJUA 3NNDA 1WN7A 3RVKA 3M8SA 1WLJA 1RZRA 3JVIA 5CNJA 4AILC 4H3HB 1SL1A 1RTHA 4CF0A 4M45A 1LWEA 1IH7A 2Q5CA 3SJJA 4CJ5A 4FJ8A 3NHMA 4LDAA 4MQFA 1PNTA 3N6VA 3KTQA 4ZHRA 4PICA 2JVKA 3SCXA 3H75A 4DTJA 4E3SA 4MLCA 1EWVA 3IPAA 2R47A 1QKKA 4K8ZA 1HMVA 1GCGA 4FW2A 3PO4A 4CEDA 1BI4A 1ZYQA 2VK2A 4Z0UA 3LKVA 2PYLA 1VSLA 1MU2A 1X9SA 3C6QA 4ZMSA 5C5CA 2ZAYA 4MQ3A 4HUEA 3QIPA 4NCBA 3QERA 4MR7A 4DTUA 5TPZA 4YR7A 3QNNA 1WETA 3BBLA 4MR9B 4O0JA 1DJMA 1TK8A 4DSKA 4L85A 3V9WA 3HPHA 2DTUA 1JLQA 1PNRA 3AO2A 5CHYA 4FM1A 1SXIA 1WSGA 4MGEA 1IKYA 4Z0NA 1NXVA 4G0ZA 2NT4A 2PUBA 4KHUA 2EX3A 3HP9A 1C4WA 4J2BA 3KJXA 3P9YA 5F64A 3RVSA 4C8LA 1CZ9A 2PUEA 4FM0A 1L5ZA 3C6UA 1QO0D 1KMIY 1I3AA 4MS1B 1TVRA 1YS6A 4MQEA 4EZ6A 4KB1A 4NCGA 4DF8A 4O1IA 4F2RA 3SAJA 5I4CA 3HDGA 1QQCA 3O3FA 4YLEA 1CEYA 4PUOA 3QESA 3CG0A 3ULDA 5C5EA 4DQRA 3OJUA 3DOKA 3IDOA 2VG5A 2RJOA 4DTSA 4KK4A 1JDPA 2KW4A 3VQBA 4MR8A 5BRAA 4KV7A 4K8XA 1NK6A 3T38A 4YCSA 4OVLA 1TK5A 3QNOA 4ZMRA 1JLAA 4DSIA 2OPPA 4RY8A 4CJ4A 5ED4A 3KLIA 3I45A 4OLBA 4F3TA 2L2QA 2VG7A 3K5NA 3AVMA 4M3UA 3AO1A 3LUAA 3RQIA 4N0QA 1ASWA 3EDCA 1P2FA 3QEIA 1VSEA 2YNGA 4ETNA 2IPNA 3OYMA 3V1RA 3QEPA 3V1OA 1JFSA 3MIZA 4KMRA 3URMA 1C0TA 1D5WA 1NATA 2Z1HA 2YV0X 2I6FA 1KRWA 5CZ2A 4FLVA 1ZHHA 2IPMA 3OYDA 1DZ3A 3AO5A 1XC9A 2HNZA 5JNVA 5HROA 3P5JA 1T05A 1AB5A 1ZGGA 3A10A 4F2SA 4WT7A 2PUCA 3FFIA 1B00A 1XHFA 2HQRA 1U04A 3KK2A 1TKTA 5DTEA 4ETMA 3LPTA 1SD5A 2RF2A 1D1QA 4LE1A 1NJYA 3VQDA 5IBQA 1JYEA 1ASVA 1S1XA 4AHTA 5IUKC 3O21A 4BDYA 1PUXA 4MRMA 5KWSA 5IULC 3KLHA 3QLUC 3VQCA 1JYFA 4CJKA 3NF9A 1FQWA 3UIQA 1QSLA 3H5LA 1KLNA 4OGEA 4YS6A 3KK3A 4N5SA 4IMIB 3T19A 3DRRA 4RW7A 4OTZA 4ZPJA 1URPA 1DCMA 4CCHA 4LDZA 4M42A 1H9CA 1D2AA 1DCKA 4KQCA 2O20A 4NQRA 1NK8A 1C1CA 3C3KA 4YWHA 3MXIA 2A9PA 3T3FA 4B9LA 3SYZA 3SM9A 4FLUA 4IF4A 1L5UA 4CK3A 4Q7EA 4M3WA 1MB0A 3U3GA 3FDFA 3N0RA 4MYRA 1U47A 4BDPA 1Z16A 3HO1A 1Z26A 2XY7A 1TLFA 4RXMA 5J2QA 4CEZA 1DP4A 2ZD1A 3SNKA 3MA0A 4HNRA 3S3OA 3HM9A 4HTUA 4Q0BA 1BIUA 3ZT0A 3Q7RA 3S99A 4Y1CA 3OJSA 2P4UA 4ELUA 1KVBA 2Y1JA 3VQQA 3KHTA 5BRJA 4QPJC 2RPIA 4GPAA 4N41A 5EWLA 4O5BA 4ML3A 5FBHA 4JOQA 1ZBIA 3OYLA 4RSMA 3I5AA 2HHQA 4B3OA 4H60A 1BISA 3VA0A 3TX6A 3HK2A 1UDRA 3ZSQA 1BGXT 1NK5A 1DRKA 1MB3A 4DU4A 2VYCA 1ZAYA 1I39A 3QLVA 3CLKA 1CHNA 5B3JA 2XO7A 4O55A 3AVLA 3E01A 1U0SY 4KK3A 4Z9BA 3WNHA 3KTOA 4E7HA 4G0MA 3S3MA 4G0YA 1Q9YA 3MAQA 3QX9A 4CGHA 1BL3A 2ATQA 1X9MA 3Q41A 2FMFA 4HUGA 1SKSA 5EU7A 3BREA 2FLWA 1RNLA 2IKSA 3RMDA 2G8VA 4PZ0A 4KTQA 1QP7A 3G0ZA 1M5TA 1WSEA 3G10A 3SQ2A 2PMCA 2HJ9A 5BQ3A 5BR1A 1UA0A 1QSSA 1KLMA 2N9UA 3MEEA 1L3SA 2A1SA 3CNBA 1B92A 4FJ5A 5ABPA 3EZ5A 1ISRA 1JL2A 3AVBA 4AHRA 4E19A 3QK7A 1Y1LA 5I42A 4BE2A 3HVRA 3H5VA 3C94A 4FE7A 1HNIA 5TQJA 5FBKA 4DADA 1LV5A 1YMUA 4Y9TA 3HPGA 3VNAA 1QP0A 2EHGA 1C6VA 4E7IA 4TLMB 1O1WA 2PZSA 4FE4A 3V1QA 3F6CA 1C1AA 1XWLA 2JB9A 3Q9SA 5IUJC 2FQWA 3O1HB 3O2QB 2OPRA 2MYTA 4JLHA 4CJSA 1NXSA 4D74A 3H08A 4E0DA 4LD0A 4TN5A 3LAKA 3UKJA 5TQ0B 2WMYA 2OZSA 3QEMA 4IKFA 5DCLA 2D0CA 4Z4CA 2XY8A 3FFWA 4Z4HA 4KQ9A 1VSJA 4CJWA 2ID7A 3QLHA 3EULA 1YS7A 3HZHA 4WXMA 2YHAA 3OLYA 2FSPA 3H5OA 3SNNA 3CU5A 4GNRA 3QEWA 4OG2A 1U4BA 4HCBA 4YNQA 4J2AA 3PX6A 2XHBA 4LX8A 2OENG 2FBXA 1FXXA 3OS1A 5J2NA 4FLTA 4CE9A 4DLGA 4RV5A 1JLBA 3ZSZA 2MYNA 3V9SA 4B9TA 2HVIA 4P98A 2IS3A 4EYGA 3OS2A 1K66A 1S1TA 1BCMA 2YNHA 4BWMA 3V81A 2E4VA 4IRXA 2ITGA 2HMIA 4O44A 4YO7A 3DLGA 3O3GA 2L18A 3ISNC 3ZSVA 3LOPA 3QINA 4AH9A 1VPWA 3B2NA 9ABPA 4RW6A 3TAPA 1LJLA 1Z25A 1FK9A 1EP4A 1DCFA 3IP7A 3T1AA 4Z4GA 1VRUA 1KVCA 1YMVA 5I3UA 4NYNA 2IOCA 1RTIA 4F8JA 4MFBA 4PA1A 3FGZA 1JXBA 1RCHA 5CNMA 2NZUG 4BACA 4QYWA 2JLEA 5TQ2A 2FMKA 2FW0A 1JLEA 5FROA 4B8AB 1RZRD 1GUBA 1BQNA 3JSMA 4EP5A 3OYAA 4H4OA 1TKDA 4CEBA 3JVDA 3N0XA 2IOYA 2Z1JA 2PE5A 4B9NA 1PEAA 4Q6WA 3ILHA 4DTXA 5FRNA 1S6PA 4RDCA 1EETA 3VQAA 3PO5A 3TWHA 1BDJA 3AVJA 3TABA 4W5TA 3D0PA 1QMPA 4EGSA 3SUOA 1FFGA 2P1JA 2HHWA 4KFBA 3NH1A 3KLFA 4CEAA 2QSJA 2O4IA 1REVA 2GBPA 1QNLA 4I2PA 3GL9A 3O4NA 4KREA 1QP4A 4OPKA 2GX6A 1A04A 5EWMA 2YNIA 2D0AA 5J1EA 4CK2A 4CERA 4CF2A 1U8TA 3OYIA 1LWCA 3QEVA 3VQ6A 3I8DA 4TMYA 1S9EA 1EFAA 5CYQA 1YTAA 4RWEA 5TPZD 3VQ4A 3SG0A 2QXFA 1J53A 4CGJA 4DQQA 4HCCA 4CHYA 1KVAA 3M6MD 3LFTA 3AVGA 2JCGA 4QYMA 3SI6A 4KPYA 2MYUA 2IPAB 1GLGA 3H1EA 2FBVA 5HSGA 4DSLA 1SXGA 4CF9A 4FLXA 4CHZA 4H8KA 2PUGA 3PUFA 1QQAA 3WNGA 3HSTB 2FKAA 4DU1A 1GOAA 1KRPA 4O0IA 2XY5A 1HPZA 1TKZA 4EZ9A 4CJ3A 1SKRA 3L3VA 4FJIA 4JP1A 4WE1A 1QO0A 4LH5A 1GOBA 5TPWA 3O2SB 4XIUA 3CM6A 1R0AA 1XHXA 2Z1GA 4G97A 2P5GA 3OM0A 2NT3A 3G1WA 3LALA 3D8UA 4CECA 3EGCA 4JB0A 1J5OA 4QCLA 3CG4A 3HEBA 4FYDA 3MMNA 5E3JA 4EP4A 3UUGA 2FN8A 1FSPA 3L6UA 2FTKE 1Q9XA 1SXHA 1LBHA 1VSIA 4PQUA 1NXWA 2RGYA 1NXXA 3HVTA 2IC3A 1RBTA 4HYEA 4N0PA 2DRIA 4EYKA 2RJNA 1EXQA 3NF8A 3C97A 1RTDA 1C0EA 1RT4A 5J2PA 2E6LA 1QE1A 3HUUA 4FZYA 4W5RA 4OKEA 3AA4A 3K57A 4IDKA 4Z4EA 4QICA 3H1FA 3DRSA
chains in the Genus database with same CATH superfamily
4EJSC 1T1SA 3D2FB 1UJBA 2F9LA 3EB9A 4IPTA 3ZEUA 1BWQA 5E9AA 1BXKA 1EJ2A 3QFTA 3PUJA 3CERA 4UBIA 1WMAA 4EABA 1P73A 3CG7A 1DRWA 2Z1NA 3W9UA 3QX8A 5L53A 2XQFA 2CV2A 4WBXC 1P5FA 2DEUA 5GIOA 4YJ2F 4EECA 4IXCA 2J3KA 4FXOA 1KFDA 3VZSA 4CL8A 3EQ8A 3EZ6A 1NL3A 3NCIA 5KSPA 4A8JB 3EFEA 5CJJA 5KNBA 5FRDA 5KRTA 3TM5A 2PJRA 3TOVA 4JKCA 2C8VA 2XB8A 3O91A 4ELVA 1UOCA 2JI7A 5C9ZA 3PY8A 4HHEA 3MWDB 3KDSE 4C4YA 3W2TA 4YOUA 2G8UA 3G9TA 3NV7A 3J8AA 4ZC1A 5LOVB 1D2EA 1MDBA 1Z83A 2QHXA 2MHCA 1JDBC 2VA8A 2WI8A 2ZPUA 4KI4A 3G2OA 3HCNA 5D6OA 3UJHA 3FGOA 1NJ8A 3WMRA 4BMSA 1EGMB 4QEDA 3QVWA 4HLNA 4M89A 5ITSA 3CNOA 1KARA 4TKUA 2XT9A 2JANA 3R6TA 3J81k 4G65A 2OE2A 4UM5A 1OLSA 2QUAA 4JR0A 4UUQA 4W7SA 4FCTA 5A0VA 4V3BA 1PU2A 2VNHA 5T6MA 3QLJA 3NTLA 2W11A 4N9WA 4R7ZA 2XADA 4M3TA 4RIGA 1GL3A 2DECA 5HK9A 4URVR 2OMKA 1I1QB 5EESA 1Z0AA 3TPCA 1LBIA 3UAXA 1T8RA 2Z8ZA 3VPAA 2X15A 3ST7A 2AJDA 1E2IA 2AHOA 1RLOA 4UM9D 2ACVA 1QHHA 4AJJA 4RVGA 3DVAA 5ECGC 4XEHA 3WNZA 1WCYA 5JAOA 1N8KA 3LWBA 3UMGA 4AJ9A 2HTFA 4KO8A 2B1QA 4WBNA 1GNLA 3U3RA 2D5RA 1UXKA 1NF8A 2X4GA 4LGVA 3FTQA 4N5MA 5CIYA 4HWPA 4YJGB 3GUCA 3QEKA 2JRLA 4LVUA 2VHWA 2OA0A 2HR1A 1KWKA 3LDPA 1VOTA 1Y7PA 1N5LA 1QK5A 1EWYA 3VN5A 1HYHA 1W8DA 4LYGA 3TB6A 4F8EA 3B1ZA 3LL3A 3AF1A 3HDVA 4HOYA 4WY8A 1KS2A 1AQIA 3F73A 4YY3K 3VYRB 2B6NA 1ZM4A 3KQPA 2W6QA 4QG7A 3G0CA 1Q0RA 4IQFA 4G8CA 4BVLA 4GR9A 3OHSX 2XTMA 1RRVA 5KJ6A 3GDQA 4F6CA 1Z39A 2Z04A 1S7CA 1U6IA 2QPLA 3PXUA 2DBZA 2DC1A 3A6LA 2D0OB 1AURA 1OTXA 1UT5A 3DC2A 3FDJA 3CLVA 1U7OA 1D4FA 4JNKA 5C34B 2W6MA 5DULA 5BNWA 5LZ9A 4HF7A 2QBYB 1JLRA 3S55A 3V46A 1F5NA 5IWCA 3GLGB 3R76A 2Q0XA 2HBLA 1NK7A 1T13A 3OIYA 4C9BA 5EC8A 1YRWA 5AQPA 4YAOA 5DKFA 2OORA 1JALA 3X2EA 3KYJB 5EVJA 1OVMA 3I0ZA 2Z56A 3OPYB 4PZYA 4F6RB 3G2HA 1XPOA 3QBWA 1YA8A 4RELA 2EZ9A 4U7HA 2ZIXA 2WB4A 2YIJA 5DXJA 4DIDA 4IHAA 5CXUA 3C0KA 2BEVB 4DS5A 1XXHA 4YAFA 4N3AA 1CRZA 1TB4A 2IEDA 2KLAA 1GTRA 1ETUA 1NF9A 4IHKA 2P2GA 3ZSRA 4DDMA 2VP3A 3DXYA 1QDUA 4Q3BA 1XAJA 2WF7A 1ZKDA 3DVQX 1PD1A 1KQ3A 5LSAA 2RIPA 2NW6A 7YASA 3ZD6A 2VCPA 1BX1A 3WIDA 1VSHA 3CX3A 3LVFO 4ZV7A 3QKTA 2VWBA 2LW7A 5SZTA 3FMFA 4M9XA 3SICE 1LI7A 3OQIA 4BFUA 4D98A 4I3FA 1JIKA 1H2BA 1HLGA 2DFDA 2VHTA 1U49A 2LIVA 2O23A 4PS1A 3GLFE 2RH5A 3O75A 2KZZA 3NHUA 3KP1A 4J76A 4P4GA 1YXMA 4UY8O 1U0HC 4JLPA 4PE5B 2C1ZA 2JI8A 3TK1A 5AVTA 2RKOA 5JY1A 1ES9A 4M8LA 3S0JA 5J2TB 4BRQA 3IUJA 1XOIA 4NENA 3DE1X 3H5IA 2F1HA 3QIVA 3RWUA 4EY3A 3AONB 4GT1A 4J29A 2AKYA 5JE8A 4OI1A 4RVUA 4CRWB 5JTTA 5KPDA 5F1PA 4OXRA 2OGSA 4BREA 3E27A 2QRVA 3H8WA 3ZQUA 2FPUA 2I80A 4YRZA 3F78A 2ZUDA 1CQIA 4IOXA 2HHJA 3QKUA 1XZNA 4K8RB 2ERCA 3EAQA 3H5NA 4QFCA 1ATIA 2ZI9A 4QWMA 4BR5A 3KAPA 2J9GA 2FLKA 2AXQA 2OCIA 4XDGA 2OCAA 1K63A 1N6PA 5E6RB 4YRMA 2I4TA 3QUAA 1AA6A 4KPEC 2V1XA 4LZPA 4DCTA 4PKGA 4D9MA 1FSFA 1Q50A 4OB6A 3RFCA 1CIJA 1KMCA 1WMEA 2JGEA 5HP1A 2QKKA 4OMFG 4AU1A 4WLNA 2IKQA 4GVMA 1V3QE 5FTLA 3GV0A 4C87A 5KQDA 2NTYC 2ZUSA 2H3HA 3H9CA 3INYA 3LX8A 2BZSA 2Y27A 2Y1WA 2P9YA 3HY3A 3PR1A 4LHYA 3TI7A 4MJLA 1TCBA 4BEWA 3HZZA 4MUKA 1B0UA 4B9VA 4ND8B 4XPZA 2HQSA 4BC0A 3LQ1A 4TKVA 2WICA 5FB3A 3ML1A 1J1ZA 2E4UA 5DZSA 1NF3A 4K9KA 2NMVA 1MOQA 4X6YA 3WLEA 4Z1OA 1DSSG 1JSXA 2FH5B 3D43A 1ZJZA 4L0QA 4E30A 1GTZA 1K0FA 1KAOA 1NMEA 5ANRB 2HOEA 1LLCA 3L4BC 2WJYA 4Z86A 1T15A 4F85A 4G25A 4CLEA 4IFVA 2YKGA 3KVOA 3N4QA 2OYQA 5H3LA 2YWJA 4HWIA 4E7JA 1EX7A 3MK31 5IDVA 5K3CA 2EZ4A 4CN8A 3VA7A 2IV3A 1CRLA 2QJOA 1N2CB 2AC4A 3CJ9A 2PR2A 2WJWA 4YMSA 3GP3A 4Z7JA 1PR2A 4FFSA 5C0OE 4KIUA 4KWCA 3ZWVA 1K7CA 3OO0A 1WXFA 3H86A 5AFUA 5F5LA 4CBVA 3TR0A 3A25A 5HX7A 4QU5A 3W6OA 4R8RA 1I9GA 3QUCA 4BRUA 1FUIA 4EGCB 1ZN7A 1OAAA 2XVZA 5K0CA 2DR2A 2A0FA 2A9VA 4QXQA 1BA3A 1ZWLA 2GT1A 5MN6A 1IBKK 5JLFA 2IOQA 4FR2A 1BYUA 3MGBA 2PAVA 2I5JA 1NBMA 2FN4A 1ASUA 2GVDC 2VF4X 4RQAA 3HDHA 1MDUB 1ZH2A 1ZESA 3UF0A 2Q1YA 4IDBA 1JQ3A 3DXZA 4QG3A 1GTMA 2BE9A 3J81A 2C0QA 3HXMA 2QIOA 2HHTA 4ZGWA 4BRHA 4CQMD 5FOWA 3AGPA 5BT8A 5ULLA 1J2RA 1IEVA 4XLTA 4AM8A 2ZXUA 4ZCRA 1BOTO 2Q2RA 4JD2A 1DIOB 4X65K 1N6QA 2B4TO 5AHKA 1Y9EA 4IV0A 2QKBA 2BC9A 3EA0A 3QO9A 1NQAO 5EPEA 2P78A 3W77A 4DCCA 1CXUA 4DJEC 1BMFA 3SS9X 2CNDA 3PPVA 4GS5A 2PEZA 1A8HA 1NYRA 4RZSA 4C43A 2ZE6A 3G3EA 2I66A 3N2LA 1R4MB 2QPTA 5KVAA 3W3ZB 4BFZA 3E9YA 2YASA 3D3KA 3JAKB 5FBLB 3LX5A 5CU7A 3ZHSA 1SC1A 3MN7A 2OORC 2FEOA 2YOFA 3D6JA 2GNOA 2A1TR 3O90A 5FIUA 3TNDA 3F49S 4R5HA 1VSQA 3OX2A 3HKEA 1YJ9N 1D9FA 1Z4OA 1BHLA 4MJXA 1ZBQA 2OEPA 3MMVA 4KDCA 4IG9A 1QU2A 5AJWA 2BISA 2I29A 1KVUA 2PG3A 4M0LA 1FU8A 4NFYA 3WP0A 2UUCB 5E7QA 3CF5L 3MVEA 3INTA 3EAFA 2X3YA 2O1SA 3D5TA 2WF5A 4JBIA 1W34A 4JI6B 2XH8A 3THXA 1DBWA 2XPCA 3B9QA 3NIWA 4C3ZA 2I7PA 2Q2QA 2WSMA 3GUHA 5FOVA 4BV8A 2ZXFA 2DFHA 4JA2A 3R3YA 1ZL0A 2WWRA 3BE6A 2TMDA 3D5EA 4KI6A 4OQNA 2WINI 2ASEA 4ZANA 2GF0A 2EGGA 2G9QA 3TO5A 4OJQA 4GWGA 5IASA 1G20B 3GLQA 2PWAA 1QZ6A 1P6QA 1X87A 3SJHA 1OU0A 3I73A 3P9CA 3B6PA 4H5NA 1YSCA 2DPLA 2HZ7A 2NV2B 2VH1A 4DF4A 3C7TA 4IUDS 4QD3A 1T5SA 4JJGA 5JMTA 3EPKA 4QA9A 1M6HA 4U7FA 3TLGB 4ZYLA 5AHRA 3SF0A 2Y2UA 5IJ0B 4BBAA 3EKSA 2DE0X 4FEAA 3SXUA 4LF7B 4M8NE 2JGMA 4HGRA 3DM2A 1CJVC 2FUCA 1XQ6A 3MTDA 2BFDB 3A1WA 2Z6UA 5HW0A 2GLTA 3K8QA 2XE4A 3VPBA 3T5CA 4BEJA 4LC9A 4CM7A 2H59A 4L0MA 2N1BA 1T36B 4PX9A 3RADC 3HFSA 1TQ6A 3K2EA 4PCUA 1X9IA 4AKSA 4D57A 3K0FA 1TM3E 4M0MA 3IEKA 5K8IA 2VHZA 2ID8A 4IH4A 1TUIA 2B7CA 3E7WA 4JNCA 3I76A 5DT2A 1Z8HA 3IMCA 4KJZA 2A59A 2ZT8A 3L8EA 3OSUA 1HT3A 2NOAA 1JCFA 3SJ7A 5FBQB 3WJ7A 4EPWA 1TKXA 1A5VA 1ADGA 2IJGX 2MSKA 1V1MA 3O3HA 3VVBA 2W2LA 3ZKWA 4DNQA 1HNNA 3L46A 1WBJB 3PDWA 3RVLA 1JL3A 2IXAA 1CQJB 1UK8A 2YW9A 3AR9A 3E7FA 3FFXA 4G0PA 3JRWA 4IXMA 3RFTA 4BGAA 3ZBPA 1BDHA 2CNWA 1GAQA 1U2TA 4LDRA 2PSSA 4A0FA 4BRWA 1NW9B 4EY5A 5KNDD 2FZEA 5AKYA 4CG3A 3NCHA 2CMGA 2IP1A 1G4HA 1JHVA 4PLTA 4XQGA 5LUBA 4E7PA 1ZY2A 3QSGA 5AIBA 3K1AA 5GZ3A 3K4PA 5B1EA 3U6FA 2RHJA 3OM8A 4I1UA 4ZVKA 3PK0A 4RPKA 4CQJA 2HHVA 4F8JA 3BD8A 4URYR 4BMOB 4OHYA 1HKCA 2DOKA 4GYKA 4D82A 1ZM3A 3QW4B 4DTOA 4M2LA 1YU9A 3DBIA 2DCMA 4YP7A 3HL8A 1JB1A 1S3GA 2VNAA 1N9GA 3LTNC 2DPXA 3GZ4A 1F51E 3OC6A 4DMUB 3RS7A 3TKAA 3CUTA 4RXUA 4HXFB 1KE2A 1SEVA 1NOJA 3NUQA 4BMZA 4CMHA 1IK6A 3RR8A 1KQPA 1X74A 3IEIA 4IINA 3ZWBA 5ESDA 1XG5A 4EJSA 1ZITA 3E48A 3QPCA 5F2RA 3D2EA 3E53A 4L5IA 4YRRA 2GEKA 2R8OA 4PBRA 4CM3A 4YLYA 3VR5A 3PZBA 2E7ZA 3JQ6A 3RUEA 3GGDA 5KYXB 4BR7A 1RCFA 5BWMA 2HV8A 1OZHA 3VQ5A 1ZM2A 3OOHA 1XZCA 1EKXA 2FJ0A 2WT9A 3EIQA 1DWQA 1QGED 1RYEA 5H59A 1KC3A 5T41A 1D9ZA 2ECFA 3U3MA 5AZJA 1LJ8A 4F06A 1NZFA 4FWSA 3DB2A 2C2HA 4JRPA 2PKRA 3KJQA 4IIBA 2VI5A 1TVMA 1CUJA 2VSXA 4MLHA 5DTQA 5EKUA 4Y1GA 1HDOA 1WEHA 2HBZA 3WLFA 3FVTA 3F4BA 4F4DA 2ALJA 1IPEA 3ET4A 5IAEA 3AEXA 5P8WA 4NG5A 2QUBA 4YIKA 4GH5A 4L08A 2Y6UA 3RV3A 3T7KA 4AHCA 4MVJP 3GN2A 3CM0A 4QQNA 5DK5A 5EWJA 5B12A 2O4GA 4L8FA 3HE3A 4DA6A 2X8JB 3ZEAA 1UZLA 2HM7A 1S7GA 3N9IA 5KQ8A 2QT9A 3DVSX 4IDNA 3V8RA 3WLOA 3HFRA 1NK4A 4K42A 4L8RB 1WSJA 4CQMB 7ADHA 2BM9A 5MN5A 3DHYA 1B6GA 5DGIA 1XDWA 3EBPA 3OKPA 4L8YA 1XJCA 1C4XA 2L69A 2RKWA 3GPIA 3AI1A 1DBRA 4LJKA 4F8RA 5EI5A 2GN1A 1FIUA 3MF4A 2P1ZA 4TM8A 4WZAA 2J0QA 1N1EA 1DWOA 3C7DB 3B5JA 3BGIA 1WMBA 2PZFA 1OH5A 3GW8A 2VTVA 4KXFB 1AGPA 2ECPA 1CRWG 2HCRA 1DJOA 4FSHA 2ZRCA 4LAFA 4YXWD 1EVLA 2XT6A 1PEKE 4JI0B 1QTIA 1YIAA 5JANA 1GUFA 5AOAA 1ZK1A 4DYDA 1XTRA 4P6VF 2ZJZA 2SKDA 3Q5DA 1LF5A 4KV9A 3ZT2A 1O5IA 1JDUA 1R64A 1Y8QA 2H7CA 1QG4A 4NU8X 2A4KA 4U63A 5KWJA 3GG2A 3Q3CA 4O25A 1KTQA 1BGVA 1K7YA 4H1HA 4CTOA 3IOEA 2QY9A 5KNCH 4ME6A 5CA0B 3V9XA 4PG4A 2PS1A 2W90A 3PQEA 2DHCA 4IBNA 3HTXA 3G9UA 2ZTVA 2CH6A 1ODLA 4BN5A 1NV9A 4CZHA 1E18A 1V6AA 3ZD7A 5BQ5A 2FMUA 2Y93A 1PVVA 5DF1A 4E94A 3I42A 4LHSA 2PA3A 3TEMA 2RK4A 3AG6A 4JYZA 1HQCA 3JZFA 3JYQA 3MN1A 2A3RA 2VNSA 3K59A 2R1UA 4CFCA 1E32A 1TMYA 1Z6PA 1SUBA 4OJKA 1BI4B 1GSIA 4YMHA 4CHQA 2R8BA 8ABPA 4URXR 3NKVA 4J49A 1OXVA 5E4TA 1W85B 1I1HA 1GZ6A 3H2ZA 4PHCA 4WYBA 2X22A 1T4DA 1T44A 1X38A 1EBUA 1RPJA 2QMQA 1QC5B 3ED5A 2E2NA 1ZCJA 2IXGA 3EIWA 5ERXA 2ORVA 5I7RA 3S8YA 1VSUA 3UG7A 3LE8A 4U2EA 3IVAA 3ADPA 4O4LA 1M75A 3GJQA 1JI3A 2GBIA 3NAGA 4BDTA 4C6RA 3LP0A 3CF4G 1DC6A 1OREA 4RE5A 4ZP1A 4CMIB 1BIZA 2XOEA 3TWOA 2AKEA 1NR5A 3E15A 2VT3A 4BQZA 4EGQA 1E3TA 3VUEA 3AR3A 3RLFA 4EUHA 3QV2A 3ZT3A 3OW2M 3TDMA 5J47A 1RM3A 4GX1A 3VEYA 1IHDA 2IVZA 1VQ6N 2AQKA 3FVVA 5CGZA 2X0FA 2X1LA 3C3EA 5HR5A 4BO2A 4F4JA 1ISFA 4Z0PA 1N7HA 2IZ0A 4CETA 3COJA 4HS4A 4EG8A 1GLBG 2YHXA 1HNXK 3GEBA 1MP0A 4YASA 4B8YA 2WKSA 1E98A 1ST3A 4I50F 5DGCA 2R60A 1N7JA 4HN2A 5AQYA 1NRWA 3CNHA 3QFSA 5AO9A 4DR5B 1Y3IA 2WKWA 3LT2A 4QBHA 1E2KA 2V3CC 2GUIA 2VJQA 3H45C 2XDWA 4CJRA 5EKTA 1UAAA 4JJZA 3AHCA 4ZT3A 1CE8B 4M9SA 1WSIA 3MEGA 1IQPA 1PGNA 1QR6A 3TANA 1FSGA 3H3XA 4S1WA 5DP2A 5FA6A 1A8SA 3NVMA 3I28A 4BMVA 1KYTA 2IHBA 4PZEA 5HRSA 4EUFA 3I8XA 3N39C 5SZJA 4CXMA 4KU4A 2E1PA 2PX3A 3CRZA 4JT4A 4UXIA 4EHKA 3A28A 2EP8A 1UFRA 4K0RA 3WLTA 3VOVA 2GFHA 2O0MA 1RD4A 2AL7A 2MSWA 4GGPA 2R6AA 4B74A 4U00A 4R2KA 4DTMA 4QUEA 1HR0K 4DDTA 1NY6A 2FUNB 4UNPA 2Q1WA 2NO6A 3AKDA 4GMGA 2ODNA 1XVIA 2BFCA 2R8EA 4QUBA 1NJSA 1RYBA 4F4KA 2O4CA 1FF9A 1T0HB 3N8IA 4PO8A 5AK3A 1S02A 4MV0A 3RREA 3WQBA 2PZKA 1DZIA 2IP2A 1H2EA 1N7GA 3HB5X 3DZBA 4JVLA 4HFNA 5FWYB 5C8ZA 3HWWA 4TRNA 4DDUA 4QTZA 1QCCA 2PKQO 2YRXA 3I9JA 3BZUA 1P18A 1V7QA 3EZ9A 2WUSA 3SLGA 2IHNA 1KKUA 1U7ZA 4MQ5A 1CR2A 2G08A 5BNZA 4I14A 4WIAA 1G8JA 2G1JA 5DBGA 5FD8A 1L5LA 5A71A 5HKOA 4BFSA 1WSHA 1DJNA 1PS8A 2FSSA 2R1VA 3LDHA 2YMMA 4GEKA 3M8PA 2EJVA 1X2EA 3GBTA 4G4JA 3T9FA 4BEVA 3KUXA 2VWJA 3T5DA 3ERCA 1H2XA 1SXJE 2C5FA 5FOSA 3THVA 4C7MA 5B64A 2WJIA 3CLRD 3QZUA 4M0EA 4MS3B 5KCZA 1GDDA 2BF4A 1YJXA 4MV4A 1P77A 4Q3AA 5F7ZA 3QXCA 2AIRA 2OGTA 4UM9B 3WSVA 4EY6A 1G5PA 5FLXO 2WE8A 4PR3A 5A7FA 2AS0A 5AW8A 2JFZA 3PFGA 2XTZA 1NWKA 1DMRA 2HRQA 2HA7A 3OTWA 5FLXA 2CNWD 5C7LO 1T8SA 4XPIA 1JL1A 1VAZA 2HA2A 1JAIA 1SK8A 2Q3JA 2W37A 2Z6VA 1X42A 4M0FA 5CURA 5F2EA 4BRDA 1S9GA 2QUJA 2GCNA 3MWEB 2RAPA 4L72A 1U8XX 5JI3E 2Z3ZA 4QLAA 4P0QB 4JN6B 4N3CA 3O4WA 1R0SA 2JI6A 1FRNA 4KYUA 5A4KA 5CLQA 1Q0ZA 2IX9A 1Y4UA 3RTDA 4C2BA 1P8JA 4HN9A 1QF6A 5GJBA 2PKXA 4GOXA 4PO9A 1RAIA 2Q3BA 4W1SA 5ALFA 1I2ZA 4OH7A 1XXLA 4DV4K 1JT2A 2RHHA 3KD2A 5C1OA 4U2CA 2C2KA 2V1UA 4P36A 2NYRA 1GLEG 2E1ZA 2XBUA 1IG9A 3SZOA 1JPVA 5K8CA 1HTBA 3A6JA 4AHUA 4QT0A 1J0AA 4BXOB 4IFYA 1ZDMA 2PRSA 1C30A 3HP6A 2QLNA 1WQ3A 3WJ2A 5BR4A 2GETA 2OPSA 5AFUH 1P7ZA 3FCCA 3MXOA 3ZW8A 1UFVA 2GEJA 4OMCA 1T2CA 1LRJA 4IQ4A 2VBIA 2WOOA 4RK0A 3SY8A 3P9RA 4AS3A 3CMMA 2CVOA 1PW5A 1GL7A 2ID9A 5BSRA 4D4IA 1AMNA 1R3DA 1YZYA 5FFMA 5F23A 1J54A 1JG3A 3CZCA 3NORA 4BYMA 2ZQBA 1YE5A 4RKFA 4BRMA 2UYQA 2YZMA 3H2JA 3EVBA 4YHBA 3RWOA 3FGNA 5DIZA 1XPUA 2X0KA 3LZIA 4ISGA 4HNAA 1F7UA 3ZQJA 5KQPA 1P33A 2E49A 2QVCA 2XHEA 4X1IB 1J8MF 3SS7X 2R6FA 3RC8A 1I5EA 2GPNA 4L22A 4PQGA 4YJKA 4DUYB 2H9IA 4HFJA 2JLSA 2HJWA 2IEIA 3F6RA 4LBVA 4NB4A 1Z5PA 3I0MA 2BEUA 3RT1A 1FDRA 1FFCA 1V8OA 4I3GA 5BVHA 1BDIA 1HE5A 4FBGA 3CVVA 4LXUA 2IDOA 2E1RA 3HBFA 3RNOA 3UW1A 5ADXH 1MO2A 2UYGA 1G9TA 3IC5A 4KTWA 2WHPA 3N53A 4C0JA 1JPJA 4C4OA 3RLIA 1OAKA 1BW9B 4YUZA 1GGHA 4FL9A 4BAZA 4HS9A 5BP7A 3O2NA 4KQEA 3SJCA 4PNHA 2P9LB 1G20E 2ORIA 3ICOA 3OD1A 5F5NA 4K03A 4CI6A 1MF7A 2NTNA 2KB0A 4MPDA 5ER9A 3VH1A 1YK0A 4B9AA 3QE4A 4UHBA 5ERYA 1EFTA 4CIEA 4WFQA 5A0FA 2YWFA 1YQ9A 3BQNB 3JWIA 3R0XA 4A27A 1BD3A 3PKIA 4BRNA 5K4AA 2CDCA 3IVRA 1HUQA 1YWGO 1NLUA 1JSLA 2GN2A 1TAUA 2L82A 3C6HA 1L8QA 2JFHA 2YYYA 5AOBA 4BLQA 4E2FA 4WE3A 3S7TA 1IBRA 3T5PA 2I9KA 4RK1A 3B1YA 3CR3C 1E5TA 5F1XA 1U5BB 2QZJA 2ZKLA 3S7ZA 1FFSA 5JY6A 1P61B 1Y5MA 3AHEA 3MYRA 4ZCLA 4KO0A 4D4JA 3KLGA 5YASA 3OQ6A 4C5AA 1JLFA 4AG6A 1WOYA 1E2GA 1TQHA 3FR0A 3AWDA 3T3GA 3TSCA 2YC2C 1CZRA 4FU0A 1OA1A 2C2WA 4ZHQA 2D8MA 2PLNA 3EMBA 1UA1A 4LK2A 4ELTA 1M1YE 3R75A 3RUDA 5BUSA 4JYAB 1TL7C 4P3KA 4OK3A 2QRPA 2VG6A 4Y2RA 5DX8A 3S44A 5L45A 4RD4A 3H9GA 1QAMA 1H42A 1LS1A 1QE0A 1UEXC 4LWPA 3ZDEA 2PCJA 3LDOA 1L7BA 4B1ZA 4XQ0A 4PHTX 4M49A 4KIFA 4NICA 3QKSB 2P6OA 1QE5A 1X80B 1VHXA 5CIWA 3MXMA 2RE8A 4NECA 3VQ8A 1GG2A 4M1YA 4ARAA 1VMEA 5L6LB 4W5QA 4YAKA 3LQFA 1EVEA 4DL9A 1ZPDA 4ZJYA 3KKRA 1ZKMA 4MI9A 4ISCA 4O2AA 4ALLA 3GF4A 2O8FA 1WPRA 4UEJA 1YO6A 5H8WA 1LEHA 1OPXA 3HVJA 5HIIA 3N58A 4D7AA 1U1EA 3ITDA 1NONA 1G8YA 1HH4A 2H1HA 1XXHB 4RJIA 4URUR 3SXJA 2H00A 2JCBA 3SQ1A 2XYPA 2H31A 2XKBA 3PYXA 1Q21A 4BQRA 5EIAA 5AI5A 1C7QA 5CMLA 2DLDA 4B1UB 1GL9B 3F6EX 1CEQA 5A04A 3MSCA 5B30A 3MMZA 1OWNA 1U80A 4PC2A 4TZTA 4WACA 3C6MA 2JGNA 5JAPA 1D7OA 4I81A 1XSEA 2JBAB 3BL5A 5I9SA 4X45A 5EG5A 3PUHA 1WJGA 2XD9A 4L4RA 1BCOA 1WG8A 5FL7D 3G2QA 2G0NA 3FROA 3A9SA 4MUGA 3MXJA 1J22A 1NLMA 3CH5A 5CDGA 1SEPA 5E9QA 1M0EA 3JQ8B 2HQOA 3SV4A 5CT8A 3DR5A 1ZBFA 4CE6A 4BNNA 4HQNA 5EZYA 3PEVA 3QF4A 2OMEA 4Z4FA 4GG1A 4Z3DA 1YT3A 2BL4A 4UE6A 1C50A 4P4LA 4CMKA 2WAXA 2NX2A 4ZQFA 4Q4LA 2ZYAA 2BI4A 2SKCA 2PUDA 1RM5A 3DDNA 1L5OA 3ISJA 3UV7A 3LA8A 3QITA 3W7AA 5JZMA 4QUHA 1K9SA 1QLHA 2GRUA 5KNLA 3G8BA 4B1XB 1GFIA 2R25B 3RSGA 1SUEA 1G8HA 4P3XA 3ZGVA 2DM6A 2HH9A 2PLWA 4L4XA 5KDOA 1XZPA 4CGIA 3ROEA 3UICA 1KJ9A 3QM1A 4B17A 2E6UX 3DO8A 5JFTA 4MUMA 2OTJN 3HSYA 1SUQA 4ZRNA 7MHTA 2Y1EA 2E6MA 1KZGB 1QF7A 3B48A 1EXVA 1M5UA 3IVMA 1D5AA 3G0GA 3G4SN 1EO1A 2XQJA 2ZIUB 3N8DA 4QDOA 2R44A 2RHBA 2UZIR 2CUZA 1N75A 1HSZA 4AFNA 4AJ1A 4OO1J 2V5AA 2I3ZA 4X63A 5C46F 3R3ZA 4RK7A 5EMKA 2OV4A 1Y82A 3SKYA 4LEIA 1BQMA 2OZMA 1ZWKA 1SVLA 4U8HA 1YB4A 1QSYA 2OFPA 4YCCA 1CY1A 2DJIA 3H1GA 4M21A 3EPLA 1Z05A 3O03A 1E2MA 1NMXA 2Y1KA 3QVXA 2BANA 4CL2A 5FDLA 5IEJA 4LMRA 3NVKI 2KSQA 3OPXA 4NBNA 1LCUA 5ITVA 4B1WB 2V7GA 4EB6A 5AQWA 3MEDA 2O7RA 4EKYA 1FFXA 5A7HA 5JARA 3UMFA 4EB3A 5JO0A 3QLVC 1RMQA 4E6EA 1KSJA 4V03A 4JS4A 2RK6A 2D5AA 4RTPA 4CZIA 4BZWA 3D6VA 3K9WA 1PX0A 2PUTA 4ENWA 3ANLA 3F7NA 3L43A 4Q4DA 4RA9A 5K1ZA 5JLHA 3DZ8A 4A59A 2P2CA 3ICQB 3MECA 2JJ2A 5CFNA 1GQ2A 1Y80A 3IR7A 4UM7A 3U1BA 1GZ4A 3LKBA 4FCCA 4FW1A 1NJIO 4YOWA 2IHTA 2N1MA 3DHVA 3SD7A 4N5HX 4DCPA 3FLCO 4XFKA 4CCSA 4O8UA 3GLHB 1DEHA 2FWNA 1PR0A 1OR8A 1TMGE 1W88A 2ZVQX 4P31A 5IC5A 1TOAA 3QWFA 4TYYA 2HBKA 3H9UA 1PKEA 1O2DA 4W5NA 2CWDA 3Q8LA 3EBOA 1ZMBA 3K73O 5HS4A 3A6GA 5K0TA 1IBSA 2BFWA 3CLUC 1GPNA 1HDIA 2CHEA 3COWA 4ZD6A 2PJDA 1NDHA 3DE6X 5K0GA 1WKBA 1MU0A 2LTAA 5I9BA 5ELZA 4A9AA 2XECA 3ZH2A 4EL0A 5KGWA 3GGOA 2CB0A 4MKIA 3JSAA 4NBTA 1TGVA 3GRYA 4KOEC 1T5BA 1M90O 1WHSB 1BDMA 3GBSA 4R8VA 3TG8A 3O6WA 1LPBB 3IJEB 3O8DA 3OPNA 1THGA 1EWQA 1OI3A 1N5IA 4FFBB 3BS4A 4GC9A 2OPQA 4KXWA 5BNTA 2C94A 1KJZA 2WG0A 1A2BA 3TAEA 3KLPX 1YXQA 3M9WA 3ROKA 4G0OA 3F9RA 3EY1A 1GT6A 2HDNB 5KQMA 1BS1A 3TR5A 4RKYA 1SY7A 1MJGA 2NSLA 4UD6A 5CH5A 5P21A 1U2RA 4D1YA 3V5NA 3RFFA 4C7KA 4MR8B 4LFCK 3JQCA 1VYTA 2PIDA 2GV9A 1UBSB 3RRYA 4RTRA 3KKSA 4KAFA 2VAVA 4IDPA 4L5BA 3WRXA 4DN6A 1Z4IA 3G85A 4B40A 4LF8K 1RTJA 3AVNA 2C2YA 3OM1A 1P0MA 3OX4A 3R20A 5AW9A 1Z4MA 4MSUA 1VQ8N 4N40A 4O4IB 1KE1A 3TVDA 1PYGA 2QENA 3RH0A 2AFIB 4W5OA 4AF1A 4HUQA 3P2EA 1P2BA 1K8RA 2R6ZA 3RVOA 3CLSD 4AN1A 4A91A 3WNFA 1NRXA 3LWMA 3QEXA 2CXOA 1VBNA 4QARA 1H69A 3M4XA 4FTWA 3D5QA 3UYLA 1GPJA 1U2DA 1MO3A 2GPAA 4NSNA 2W71A 2Z5GA 2DPMA 1ZD1A 1F6DA 1TZMA 3AM3A 3BXFA 4XOUA 5LD2B 2RGNC 1KO1A 4XXHA 1J25A 1J2JA 3I01A 1X1AA 3VQPA 1Y8RA 3A1EA 1WZUA 2F17A 2FEKA 1DT9A 2W00A 1R0WA 4MP8A 1LRKA 4RY9A 3VMFA 3CFYA 3OF3A 2P4HX 4D02A 5T57A 4Y2GA 4PTYA 1KIMA 1S1WA 2B1JA 3QE3A 3J81O 3RKUA 1Z7BA 4E1MA 2FN7A 3CUEF 2YKNA 3G2KA 5IAJA 3EVNA 3EXG1 4DPKA 4IL5A 1EFKA 1GEEA 2MU1A 2VRCD 3AGQA 3H6GA 1U2VB 2CLOB 2B6AA 2OP0A 1E6WA 3AZQA 3IHLA 3CLHA 4EDFA 3WT0A 1NK9A 4PYKA 1NYLA 3JQGA 1YQGA 4JROA 1HJRA 5L3VA 3NOVA 3AAQA 2RHOA 4RD2A 5TVKA 2EDCA 3E5MA 3LX6A 4FKMA 1U28C 2Q1SA 5BW4A 4Z53A 1WVGA 2WQ7A 1YB1A 1KGSA 4PX2A 4MB0A 3UA4A 3U7JA 1D9XA 1HYBA 1LFDB 2PSDA 1EGHA 2B5JA 4ETWA 3KXKA 2Y1FA 4C6HA 4ZZ3A 1AK1A 4BO9A 2ITMA 3VTHA 2QN3A 1Z82A 2YYSA 3PQ6A 4R40A 4Y2XA 3CRMA 4EWLA 1UFOA 4C7JA 4BWJA 1OH7A 1L4KA 1QDLB 2CMKA 3A2LA 1N34K 1W0CA 4IIJB 4FJ1A 4B3TB 2D5BA 4UCWA 5F33A 3T9BA 4D6YA 1T10A 1YR8A 4DEYA 3K1JA 2IGIA 4UTOA 4CEQA 3T1NA 4MWEA 4BNVA 1XRRA 2QVZX 3GFQA 4Y9UA 1YBFA 4LSLA 3QXHA 5ILQA 2OESA 1G1MA 1QVRA 1ZH6A 3WE7A 1VL0A 4HDKA 2IXFA 2ATEA 4DLZA 3A7DA 3OZWA 4CGGA 3A37A 3MOSA 5M7EA 1SIWA 4K6GA 4GP7A 2R97A 3UJCA 7ABPA 4R8KA 5JZOA 5A0TA 4ARZA 1P62B 2HYIC 3FNHA 1H6CA 1LA2A 2OECA 5EIWA 3SZMA 2O2SA 1B2RA 4CEIA 3OJFA 5DH9A 2P9TA 3TLKA 1UBNA 1V11A 4YJ2A 4F3YA 5BR9A 2B20A 3ZKAA 3JASB 4FK4A 2O7NA 4HL6A 3WL6A 3K58A 3O1BA 2P9JA 3DE3X 3VV3A 1RNHA 1CUEA 2QAJA 2XI4A 3KBOA 5ICFA 3C2QA 2CK3A 1A9XA 4HH1A 4KB5A 4U8GA 5FWDA 5T4HA 3H04A 3GCWA 3KSMA 4MAAA 3KSUA 5JBIA 2ZDGA 3N5CA 5BSGA 2R7YA 4NYJR 4EKDA 1S8NA 4P0PB 2XSZD 3IULA 4JD5A 1BU8A 4D9CA 2ZAMA 4CF3A 2EATA 2BI7A 4KE6A 4P81A 1RKQA 4EEKA 5K0BA 4XR9A 5IJ9A 3VQ7A 4M37A 1NN3A 4JXXA 3TOCA 4ER0A 2HK7A 1E58A 3JYOA 1DEJA 4YUXA 3R7NA 3K9LA 1Y6GA 3ZWCA 4HD8A 4UQLA 1PI3A 4PX3A 4V1CI 1KI6A 2HTEA 2NRZA 2WM2A 3LCMA 4HATA 1IDOA 2J85A 1M5RA 3ZYCA 4INJA 1U3VA 1VPTA 4D96A 3MS4A 2VJPA 3S81A 3LUDA 4XWOA 1N6LA 4PTZA 2HEGA 4FFLA 5IXJA 5THXA 4YOYA 4BGUA 3T6KA 3KCNA 3IE1A 3IELA 3AYZB 2VAXA 3FUXA 1U2VA 3BXPA 1JLKA 1FKPA 1ZL2A 3DLHA 1XU9A 3K9HA 4WFJA 3RJTA 3VC2A 1UKEA 3ZK7A 1QJ4A 3DKIA 1NBEA 2Z6AA 4BVEA 4LRXA 1FQOA 1P7YA 3IQXA 1QFZA 4HEJA 1A71A 5BVGB 4PYLA 2A0YA 4ARCA 3X1KA 3CYMA 1RTKA 1QIFA 3LY5A 1KEKA 1T3GA 5AJHA 3AL2A 4AZVA 3K9JA 1K4MA 1GPMA 1QPBA 1ZN8A 2HC9A 4DSFA 3HV0A 1EG2A 3LC2O 2JLAA 1RRFA 2DTDA 3GAZA 4FD2A 1B6SA 2C4TA 4NMHA 4UHCA 3KIPA 3KYIB 3ZCPA 4KNYA 3OA9A 1EQUA 3DOLA 1YQWA 3FSEA 4J8FA 3UJBA 4K3VA 5HCIA 1L3UA 1CRQA 2CNLA 4CF6A 5ALQA 1VE7A 2JIZD 3UC9A 3HUFA 2I3AA 4PM4A 1JQAA 3OQJA 2OY0A 4G0QA 2ZS9A 4HUQB 2HIMA 4YREA 1CZBA 1O8BA 1WD5A 3CCEN 3W2GA 1CZNA 2AX4A 4FDUA 3KYCA 3I5YA 1KMNA 4DWIA 4YCAA 4QTUB 1EFCA 3Q6IA 3LPAA 5CNKA 4GQIA 5AQHA 4K8OA 4XVQA 4DCJA 3H65A 5CA0F 1BN6A 1TYQB 2KPOA 2IYQA 3SS8A 5LP1A 1KORA 5AW6A 1ANKA 1TE2A 3IAHA 1NBOA 1O9BA 2IEGA 3DF7A 1AHNA 4MV9A 4QRHA 3U81A 4DAEA 1Q6ZA 3ZETA 2R65A 3IQDB 4EKIA 2WDZA 5GAGP 5FNZA 1F0KA 4W6ZA 4CGDA 3QUBA 2QRNA 3C8ZA 2ZZKA 3LUKA 1MG5A 4M98A 3CO0S 3FBGA 2N42A 1JZTA 4J1TA 2XDQB 5JDCC 3STXA 3OF2A 2Q2WA 2I4LA 4EFHA 3PCTA 4PCLA 1OBVA 2PLFA 4I2VA 3X1JA 2GK4A 2I65A 1WSWA 1W8IA 3TPQA 4ZI5A 1FNNA 2XWSA 1VXRA 2FW1A 1WXXA 3L4IA 1Q86O 1KEVA 3F5MA 4TS3A 5ITZB 1OCEA 1OYYA 3U9SA 5G53C 3C3MA 3RS9A 1GKKA 4Z0TA 1VPLA 2VL7A 1PWZA 3MJDA 2EF0A 3DEZA 1E2UA 3MZ0A 2PAAA 6YASA 3DBHB 1UFKA 1I3NA 3B8HA 5B3JC 1GA6A 2HEIA 4FFVA 1ZVMA 3LYAA 4C04A 3QTTA 2AMJA 2KE5A 1VCNA 4XWYA 1AH2A 2HHUA 1E7QA 4RQUA 3CA8A 3P5BA 1YBHA 2FW6A 1E7MA 1XTTA 3UB5A 3H11A 3AGKA 4O2BA 4Y0NA 5K3BA 4Z3KA 1YAJA 4EI7A 3W9BA 3EG5A 3TU5A 2D1QA 3LDUA 1IQRA 4L5JA 3GJYA 3OZRA 3ZE6A 4YUWA 3ELBA 2I6UA 1T5HX 1XE3A 3PGVA 3ZV6A 3U5ZB 3BTOA 5H02A 1ONOA 1HL3A 1RYHA 3H18A 3OU6A 1YQDA 2H9YA 1T7PA 4JKDA 1NSFA 5LM3A 1X1PA 3SUQA 3TTXA 2RE2A 4DUZK 3OIWA 2VT2A 4AY2A 1FMCA 3PXGA 1G2IA 2YZNA 2QAGB 2Q5LA 3MWKA 1ZJJA 4LJSA 4IMRA 3K8YA 1U0NA 1FEZA 3D1LA 4OXKA 5TF4A 3PE6A 5JHGB 4UTZA 3AFGA 1ZCAA 1ACMA 4IR7A 1FU4A 1UODA 1VGQA 1VBKA 1SUFA 2WF6A 4DV3K 2IYTA 1OV6A 5J2MA 2O3TA 4PEVA 3C3YA 3OZIA 3GLIA 4YJ3A 2QU8A 3CLSC 3WRXC 2UZ1B 1R3UA 5A1JA 3GRPA 3L5OA 2HNAA 3HY6A 2OFFA 4EFKA 5A5DA 3WADA 1UM9B 4DR1K 1OTHA 4DQIA 2R79A 2YHWA 1NUSA 1TYDE 3QYJA 4BNHA 1G2PA 3FHJA 3UV6A 3ZCVA 4D46A 5IPFA 2II6A 4I1OA 4MX8A 3CF4A 5B37A 3LG2A 5JQGA 3K5HA 2J9ZB 3BL8A 1YDMA 3OZDA 4XJSA 5DO9A 3NHSA 4UU0A 2X6SA 4P35A 5FX2A 1RFLA 3REFA 3AHIA 1K8YB 3WYCA 1X1DA 3ACCA 3U4AA 3A3YA 4BJ1A 1BHJA 1AG9A 1WXEA 3FYTA 3GHHA 4PPNA 4YV1A 1UOQA 1LLDA 1QHSA 2PM8A 3GQBB 2OTCA 4PTLA 4CJTA 1ENZA 3AM4A 5JNSA 3FZNA 3PV8A 3N2YA 1V1MB 4DLUA 3T0IA 2A5FA 3UFBA 3LVBA 2C5GA 4AN0A 3RUFA 3DXKA 1EUDA 4BJ5A 2ZI7A 3NYWA 5JJIA 1IM5A 2QTDA 3LMKA 2NU7B 1RBSA 2XJ4A 3M81A 5DM1A 3TQTA 4D0SA 5CD1A 3JPWA 4ND5A 1NGBA 2PV0A 5CCXA 1JFTA 3IG1A 1NI4A 1VIDA 1ZFNA 3K09C 3Q87B 4OYRA 2HYDA 3L01A 4M3NA 5C81A 4LH4A 2HB5A 3ROMA 3V4ZA 3H1PA 3T1TA 2W22A 4ER7A 1VHQA 4HNQA 2LP4Y 4EW2A 4JV5B 4G67A 1Q91A 2YHYA 1QVWA 1Y7IA 2C9ZA 4E89A 2GX9A 2G9UA 3CLTD 3GROA 3CF0A 4FGUA 4Q66C 3WGLA 1BCRA 2HIHA 2F64A 3OLZA 2JAXA 2QRJA 5T3UA 2BFEA 1GYQA 2VUHB 2I67A 1ZJ6A 3E81A 1T8PA 4HXYA 4J0EA 3W8RA 1QVGM 4JEPA 4Q5IA 4XKJA 3VPDA 5C35A 2JEYA 5IBPA 1PLLA 1DADA 2EBUA 1KH2A 1RPNA 2X9NA 3BN3A 4RFLA 1RILA 1K08A 2FZWA 2RGNA 2CK3D 1N2JA 2VXCA 5GINA 5THKA 4X66B 1DQSA 4IOLA 3UGJA 5CD9A 4DUZB 4WOCA 4ZJUA 2UXCB 4K6OA 2OCYC 4HWGA 4Q1VA 5CT6A 2H1WA 1YI1A 2ZJRL 1MRSA 3S2UA 2ZU6A 4DVJA 2R8XA 3ND7A 1EFUA 3JVIA 4F2GA 5CNJA 3DMGA 3F46A 1ZOOA 1KS9A 4AILC 1UADA 1KAEA 1YZLA 1RTHA 1CLEA 3CN9A 2QUHA 3DXXA 3FNIA 4OIFA 4RVFA 4DCHA 1D1SA 1EGAA 4AZTA 5JISA 4HR7A 1J9GA 3K6SA 2GAIA 3G17A 3I55N 5JR3A 5AQQA 3O80A 4FJ8A 1XNJA 3M6WA 1NM1A 5I45A 4FO0A 2ODWA 3NHYA 3B6MA 4IJMA 3GPCA 3MCUA 4K88A 4LDAA 4ARVA 1H4TA 2V9PA 1ONBA 2XWBF 3KTQA 3ACBA 4Q3DA 3EE6A 1U63A 5KU1A 1A2QA 1V39A 4ZHRA 4QS8A 1WZIA 2B99A 4H1TA 4N5DA 2WPDD 2FW7A 2IXBA 3VJKA 9ATCA 3U4QB 1SBZA 4LDJA 3A11A 4PXAA 3TSYA 3TVTA 3SCXA 2OG1A 3A3OA 3TMKA 4DTJA 1EVIA 3L0BA 4BKMA 1C8KA 1VPEA 3A31A 3L0DA 4KWIA 3ON5A 4MLCA 5IJ0A 1YONA 3CCCA 3TTCA 2H2WA 3P0RA 2R47A 1KZYC 3KZ1E 2XW6A 4MUIA 4OU4A 1QKKA 5CRIA 3E9CA 1U3CA 1Q19A 3EOBI 4J2TA 3OJXA 2Q3MA 4PNZA 2F1IA 3WL7A 2FXUA 3L1VA 4X20A 3BZCA 1WCIB 2ZUWA 3JALB 2VKQA 3UK2A 5DNVA 1ZXXA 3UT6A 2JIDA 5HOEA 1MC5A 1AZLA 2AW5A 2OXEA 2ST1A 3BFVA 1VSLA 3E8MA 5BSTA 2A7XA 4BC1A 2A2ZA 2GN8A 1MU2A 2PGDA 1H5NA 3WO0A 3WWCA 1X9SA 4B6JA 4JI5B 3DKRA 2P6PA 3G13A 4L15A 1H2AS 1DG3A 4ERXA 2VQ6A 2ZAYA 3SZ3A 1H5UA 4HUEA 2CF5A 4Y0AA 4Y6QA 5NLLA 1J8YF 4NCBA 3QERA 1QVVA 4FP9A 4ZGBA 3EIUA 3WV5A 1E1NA 2H5LA 5EXXA 5AW1A 2XR1A 5GJCA 4PN3A 4PYJA 4UBMA 4EHIA 2E6KA 5TMBA 3KXDA 1LWOA 4GR5A 1NVEA 4MR9B 3HCPA 1OXUA 4MDYA 1TK8A 1HLFA 4L85A 5IDWA 2RGGA 2VC2B 4E88A 5CDFE 1SAZA 1PR5A 1TM4E 1U6KA 1P29A 2YXEA 4O1MA 4RMIA 5CX1A 4JGBA 4BIIA 3AO2A 2YR0A 4WFIA 3GOIA 5CHYA 2E5LB 1NSTA 2NTEA 4JIGA 2G80A 2X3UA 3WGOA 1OXSC 1E1CA 1AF7A 1OX4B 5CE3A 1DRVA 4ZDKA 4RJJA 2CT8A 5H7XA 1D03A 4KODA 5A6SA 5DK4A 2ZXEA 5FUVA 4ZVVA 2C3MA 1D2GA 4P08A 2NQ8A 2J31A 3ZHXA 2DPNA 1VRWA 2D8AA 4XWTA 5C5DA 3P2KA 2NT4A 3EW9A 1J24A 3N74A 1ZGJA 4KHUA 4OQYA 1PCXA 3O47A 3G2LA 3OH8A 1BDBA 1HYEA 4JBLA 4QOJA 4ASUD 4PG8A 5JPCA 3W06A 1SKBA 1XVAA 1Z08A 4KO3S 2F9WA 1G41A 1YL7A 1VI6A 5L3SB 5AI4A 2E48A 1L2TA 2DJ5A 2OLEA 2V6IA 5AVYA 1VZ3A 4RJLA 4J07A 2XLBA 3DKPA 3PDHA 1KEEA 5J4HA 4OBEA 3PSHA 3A6PC 5IHPA 5C1DA 3KR1A 1YS6A 4RANA 1JLSA 2R2GA 1ZEMA 3UJAA 5HBGA 1TX4B 3EE9A 2ODPA 5KTNA 4ZDJA 4HRAA 3G6KA 3KBBA 2V7BA 3IAAA 3MT0A 4A7PA 4YLEA 2G17A 2PSJA 2HLNA 1QG0A 3OE4A 3OT1A 1PK7A 1WHTA 3FPSA 2H08A 5C5EA 4NMMA 5EFOA 1Y9AA 3I6QA 4NV1A 4NCJA 5EHQA 2C4NA 4G1EB 4JN4A 3C3BA 4GMXA 1RIIA 5EJ5A 1ZXBA 3NFYA 5I7VA 2KW4A 3VQBA 4HWKA 4RETA 4EHNA 3WEEA 3TPFA 4EY4A 3HDQA 1XCMA 3WGUA 1EP2B 4K8XA 4IWNA 3VZPA 4P2BA 3HU3A 3T38A 2G9NA 1DEKA 1UCFA 1LTQA 4BRFA 1TK5A 1H3FA 2ZI4A 4RVCA 2R6JA 3QNOA 5CFOA 1E7WA 1ONSA 4KNVA 5KKCA 3RSEA 2REOA 3O4HA 2ZUBA 4FS8A 4C7VA 2O5CA 4ZMRA 4OSEA 1NBHA 2F1JA 3FGUA 2XXAA 4DSTA 5ED4A 4J8PA 2XQVA 3E2PA 1EE2A 2AH5A 4UMFA 1YHYA 2FX3A 3GLIB 5A5VA 4F3TA 2P9KA 2PANA 1R50A 3BDAA 4MVJG 2VTBA 4YRSA 1RPTA 4G3XA 4R5MA 5JXGA 4KCGA 1YF5L 4AUMA 4C1NA 1WY5A 4MMZB 1OQAA 1T6YA 4HPWA 4WEOA 3RQIA 1GYPA 4E5YA 1Q1EA 3DNPA 3Q2OA 5FL3A 2AB0A 1IWBB 2DLNA 2YUTA 5ECDA 3VOAA 3QEIA 1T4GA 2QA4N 3FYHA 3GEHA 4WGFA 1VSEA 1LPPA 4H5TA 2ZAOA 2IUFA 4JOBA 5K0NA 1C0GA 3O9RA 3IQGX 3KL2A 2I1LA 4GVPA 4ALJA 4BGEA 5DM2A 1DQYA 4GI3A 1V9SA 1GCIA 3H9QA 4JENA 5HJ7A 3L0ZA 3V1OA 1U65A 3H3OB 3DB1A 4U5QA 2RHWA 5HF8A 1W2WB 4EG3A 3KWJA 3ETCA 1D5WA 5CYFA 2VK4A 3IQHX 4J1QA 2HXGA 4ZT7A 2NUTA 3TNJA 1XEXA 2I6FA 4FFMA 3MJRA 1S2LA 2O0LA 3IBFA 3Q40A 3TZLA 3M2TA 3ZJ4A 3OD5A 4JLAA 3ENQA 1C9DB 2J8ZA 4FLVA 4IJUA 1ZHHA 4BNIA 3WAGA 1IMOA 2E9SA 1KY2A 4MV8A 1DZ3A 1EX1A 4CNBA 1CUFA 3Q8WA 1QR2A 1JQKA 2PBFA 2GCPA 1XC9A 3AERB 1QCYA 3KK7A 4X66K 1EVKA 1WHTB 2LRHA 3JQFC 1GKYA 4IIXA 1NQWA 4NE7A 1JFRA 1LQ2A 1YGPA 5C4GB 1E62A 5LWQA 1L4YA 2B9EA 1GQYA 1BIFA 4JY7A 3TSWA 2HPZA 2NLXA 3A10A 3DKKA 4EBBA 1MA9B 5EUQB 2PUCA 2NUPA 3FFIA 3LDNA 2WHQA 5DVZA 3CPJB 4GOMD 5B2ZA 1LLUA 1FSSA 2F48A 2HT6A 1QAQA 5F4ZA 1TKTA 3QWIA 2PD4A 3W7VA 4BS9A 2ONZA 3IPYA 4TMWA 3RJMA 4ETMA 3PNOA 4FFRA 3L4QA 3HKBA 5U1PA 3ZLVA 3BA1A 4V0SA 1CZOA 2MOKA 5K0EA 4P33A 3RSEB 9LDBA 2VJYA 1WA5A 5IBQA 2ZBRA 2IPXA 3KM0A 4MUBA 2XX3A 3FD8A 3FGPA 3K96A 5HF9A 3FVRA 1JYEA 4CEIB 1EA7A 3CYFA 1KZ4A 4WASA 1ASVA 1ILWA 1K86A 1S1XA 5FTWA 4I5IA 4AHTA 1B4DA 2RAFA 4I5GA 1KSFX 4PN7A 5AM3A 5F2OA 3HNOA 4M1KA 2BKAA 1Y1TA 1I0LA 1FNMA 1SOWA 3MRVA 4MRMA 4OO3A 1QS0A 4IH1A 4DCSA 4EJMA 5KWSA 4LF9B 2XKKA 3SK0A 1RAGA 4RS4A 4H0OA 3VH4A 2B94A 2DWCA 2X23A 5JXWA 3WXBA 1DAFA 1WS6A 3SHOA 1ATSA 2WPDA 3WUHA 4IGEA 4JEIA 3VPXA 1VKOA 4PHFA 5I51A 5JBNA 2F00A 1RI5A 2H51A 1E4YA 2ZWVA 2GSWA 4MQUA 4OXYA 4P4TA 3B53X 5LMCA 3KK3A 4N5SA 1XT6A 3IUYA 4QGGA 2CXNA 4YNBA 3KKOA 4RW7A 1E0JA 1RLMA 1XWIA 3NXKA 1URPA 4OUDB 1Q81O 4ZI7B 2P67A 1ORWA 2PUWA 3EXG2 2HWYA 5DTIA 4P4UA 1VMAA 3QVKA 5DOVA 4AUEA 4M42A 3VX4A 4GWLA 1GZ5A 2C00A 2P65A 1QZ5A 1QH1B 4KQCA 4MLZA 2J6IA 3HBMA 5LA6F 1Y98A 4D9FA 2I78A 4GPEA 4DR6K 1ZUNB 2WNHA 3SMPA 4P93A 3VZBA 3PA6A 2HRZA 1NM5A 3MD0A 1M7HA 3PSAA 1UK9A 4G23A 4Q1FA 3Q88A 4QYIA 3DOFA 4GDMA 4MUJA 1L4BA 5IRCD 1FDIA 2A9PA 1B41A 5SYNA 2CNNA 1MT0A 3H3NO 1G5HA 3LU1A 3ENHA 1NM5C 1F2DA 1IJJA 2R1ZA 2ZTMA 3X1ZA 1PTKA 4C0AC 1TUBA 5E38A 5AW5A 1U3TA 2FW8A 2OGWA 3V34A 1O9HA 3TR6A 4FLUA 1ZU4A 3EVFA 2HV9A 3FW1A 4ZVMA 2VO1A 2XUOA 1XAHA 4IF4A 1N0WA 4CK3A 1IHPA 2PXCA 5L3RA 3JARB 4M3WA 4NS1A 4QHTA 1MB0A 2F3UA 3GUZA 1G8MA 3OTGA 4C6SA 2ZPTX 3CEAA 1AE1A 5H80A 1VA4A 1YBVA 3NWOA 3AFIA 1KMQA 3KVGA 2PWYA 4FWRA 1VE9A 3KOXA 4BB0A 4X8LA 3C65A 5CHIA 2CVFA 3DZGA 4PAOA 2AE2A 4JK3A 2J0UB 4OGWA 3HO1A 1IHYA 4BRSA 4CCYB 3TM4A 3IAS1 2IXTA 4J3FA 4RXMA 5TARA 3RIGA 4LJLA 4C4TA 4CLHA 4YRKA 1HFEL 3SHFA 1LBTA 3MCAA 1H4QA 4NVRA 3HU5A 4CIAA 1DV1A 4AWBA 5HOQA 1CEEA 2DF8A 4LZZA 2JLCA 3MA0A 2FCRA 5DBFA 1RYYA 1YOVA 1FYEA 2Y92A 3AUUA 4IDDA 5JCOA 3T7JA 4I4NA 3A7EA 2Q29A 3EGXB 5FO0A 1GLDG 1BUPA 1E94E 4QFMA 2HBQA 3Q7RA 2HCBA 1U7PA 3DTTA 2TS1A 1SQSA 3DTNA 4Y1CA 2V98A 4GYJA 3INGA 1F17A 2J3LA 5DE3A 3OJSA 2X0RA 5IC6A 4CIWA 1NU0A 1RJEA 3CTMA 4FZ3A 4K0KK 2EX4A 4KOAA 4RTKA 1IONA 3C4JA 3ZDCA 1GPH1 4ZALA 1ORHA 1WWKA 2UV8A 3KYDB 1KVBA 3EN9A 3L0PA 3LBNA 4KXMA 3VQQA 2FSUA 3NT5A 4JKIA 4LTDA 2RHRA 3KHTA 1BVYF 4TZKA 2GBFA 2QE7D 4QDXA 1HNZB 3G2JA 4Y2SA 5G4LA 5EWLA 5H1SQ 4JSTA 2QVBA 4ZT2A 5HFNA 4ML3A 4DW8A 5C37A 1QMGA 3ZGXA 1JH8A 3DE5X 3DQQA 3HN7A 4JOQA 2UVPA 3OYLA 1CUCA 4Y2YA 4ZCSA 1WUJS 4RGQA 5HK8A 1R4ZA 1BNCA 1DJQA 1KI1A 1TZCA 4LXIA 4EUNA 4M36A 4H60A 2AMLA 3UM9A 4X0EA 3D64A 2OO5A 3SXPA 4FVTA 1N5RA 4HQ0A 5LP6B 3V2HA 3E4CA 3ULEB 2YQZA 2OQIA 4MKRA 3ZSQA 1Q7YO 3HKEB 2WWFA 2OG2A 4X94A 4ZYZA 5LQUA 1PT8A 2FPMA 2BR5A 1CXZA 3KXIA 4NLBA 4HDAA 4DU4A 5JDIA 2PWPA 1I39A 4CF7A 5LMNB 4CW7A 4PRYA 1P5ZB 3H0KA 1VA5A 3MAJA 4FNAA 1SHTX 1TM1E 4B0PA 1UZNA 2WZQA 2XDAA 4RF5A 4C05A 3PWSA 3SXUB 3K0EA 2FWJA 2I76A 4PC6A 2GPSA 1MQAA 2AEFA 1YQUA 4TS1A 4XIIA 2PX4A 2OM6A 1EDBA 4TMKA 4D3YA 3I32A 5ALEA 3ZK8A 1HNWB 3KKKA 1FFXB 2HL6A 4E7HA 3ESDA 2Q1TA 4NFSA 4UCQA 3S3MA 1LUAA 1TCVA 4LSMA 4C7BA 4F4FA 4CGHA 1BL3A 2ATQA 4WW0A 4TWJA 2AQHA 2F7TA 1YB6A 2G0AA 3BICA 3HJCA 3GHYA 2H2AA 2Z08A 4R51A 3KFLA 2C2ZA 5SY6A 1ZHOA 1Z5GA 2I2CA 2Q6IA 3QU9A 5EU7A 3EFBA 3T41A 2C0PA 3WRYA 3LFHA 1UEJA 4BVOA 3KEMA 3QVSA 4R16A 3RC7A 2FLWA 4S2UA 1FYDA 3H84A 3NX4A 2IKSA 2I4OA 5LDHA 1MX5A 1RWWA 2G8VA 1XL1A 3U8XA 1ZGHA 4DE5A 3NDJA 4Q0MA 5KTPA 1JDBB 1IULA 1ULBA 1I2DA 4FJ2A 4XH9B 3MTEA 1M5TA 1VKZA 3Q6NA 4QGBA 1XRSB 2X42A 1VJ0A 5BV8A 3G10A 3T5AA 3SQ2