1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
b'LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN AF1318
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
1EWKA 2X6NA 4FJKA 4B3OA 4CHZA 4CGHA 1Z25A 1ZBHA 1PHRA 2OPRA 1JXEA 2IDMA 1NATA 4HHTA 3EAFA 2QK9A 3KS9A 3HV2A 4I2QA 4DU4A 2Z1JA 4EUKA 1TJYA 1QKKA 4CEEA 4F2SA 1ISRA 3ITHA 4CJVA 4DFPA 2ZQBA 3NHGA 4FZXC 3V4IA 1QP0A 2QVGA 4ETMA 3RVJA 1YTAA 5SZTA 1QHTA 3S9HA 4EYKA 4CGIA 2EHGA 4CIEA 1HRHA 1VSMA 5EU7A 3GBPA 3PO4A 4KVFA 1YS6A 4ZPJA 4RK0A 1E6MA 3I45A 1GLGA 3H6GA 3EQZA 4PICA 3L6UA 1KFSA 4F8JA 2HSGA 5ED4A 2HHXA 1KFDA 2B6AA 1BL3A 4W5TA 4JP1A 4KHUA 2ID7A 4QYMA 3F7NA 3ZT4A 2H0AA 4ELUA 4WWHA 1RT1A 4FLYA 3S3OA 1TAUA 3AVNA 1XHXA 3AVJA 1SD5A 4BDZA 2YNGA 4RXUA 3NGYA 1EX4A 4N41A 1VSDA 2XDYA 4Q0BA 1QP4A 1ZITA 4RK6A 2Z1HA 2BE2A 2A9QA 3L2VA 1IO2A 5E3JA 3DLGA 2HVHA 1U4BA 3LP2A 3VQ4A 3DLRA 1TKXA 4DTSA 3KKSA 1A5WA 4MQFA 3LP3A 5CYMA 3O2SB 3MECA 1T05A 4RS3A 4W5NA 3MQ4A 4IFYA 4JRPA 4BWMA 3H5TA 3EYZA 3SI6A 3Q41A 2WMYA 1E2BA 4B08A 3MMNA 1C0TA 8ABPA 4EVRA 2HQRA 1FFWA 1Q8IA 5EWJB 1YIOA 5KI6A 1SKWA 1C0EA 3WNHA 2P5GA 3K9CA 3S99A 2O4IA 3T8YA 4DSKA 4JS5A 3O21A 2E6MA 3CQ8A 5C5EA 3B6PA 3H1FA 4I9LA 1FKOA 2HHVA 4DF4A 1UAXA 1L3SA 1AB6A 4IG3A 5DK5A 2JB9A 3DYAA 4DS5A 2FBXA 3TWHA 1BCMA 2PUDA 2X78A 4CF8A 4CJQA 4W5OA 3VQ5A 4ID1A 1WSIA 4I7FA 2DTUA 4WT7A 1RPJA 3Q7RA 1XHZA 1BDJA 4PEVA 5I3UA 1TGOA 1ZESA 6CHYA 5TPWA 1D9DA 3ASMA 4NQRA 3HP6A 5HM6A 5FBKA 2M1ZA 1PNRA 4O0IA 2YNHA 5T7BA 4F11A 2KW4A 3H5OA 3RMDA 1K6YA 2VK2A 2YNFA 3TB6A 4EYGA 4CK3A 1CHNA 3MF4A 2HNDA 3CHYA 3NH1A 3OQNA 1ITGA 4OPJA 3IP5A 3HYFA 4CJLA 4B8CA 1S5JA 3SNKA 4RU1A 2FSPA 1JLGA 1HJRA 1C1AA 3KJXA 3OYJA 2ETJA 1WSJA 3LUGA 3K5MA 2R47A 4BDYA 4ZMSA 2FTKE 1NK5A 1HQUA 1EAYA 4YO7A 3NNNA 4LE0A 3OLVA 1TK8A 3CLKA 5DCLA 1KSPA 3SUPA 4DFKA 4FE7A 1A5VA 4XAQA 4GVMA 3SJJA 3IPCA 4JB2A 5FRNA 1Q9XA 3JS5A 4O5BA 5IUJC 1M2EA 4H60A 1DTQA 3HVTA 4UHJA 2DY4A 1NJYA 5D3GA 1SKSA 4RW8A 1JYEA 4DADA 2RDMA 3U3GA 3DGFC 4TN5A 4B09A 4RV5A 1D1QA 2GUIA 1S6QA 3QEXA 1S8NA 4E89A 5IC5A 3V9XA 2FKAA 3F6CA 5D2CA 5I42A 2YHBA 1NOZA 3H1GA 3NNSA 1S1VA 4HTUA 2G8WA 4MYRA 3C97A 3JVDA 3L2UA 1TK0A 3V9WA 4FJLA 4E7OA 3MEGA 4KB0A 5HRNA 1C0UA 1FK9A 1KLMA 1L5UA 4G86A 4OATA 3CKMA 3KSMA 5JS1A 3Q7SA 3ZSXA 2RJOA 3RVSA 4CK1A 3RH0A 4MR7B 3KLFA 3H08A 4H4MA 3KK2A 3THVA 3D8UA 4CESA 4CJ4A 2CWDA 4WXEA 1IKXA 1X9MA 4CJUA 4KHSA 4B9MA 3C94A 5CY4A 3NH2A 3E01A 2E4WA 2F96A 3RR7A 2HW3A 5JNSA 4Z9AA 2IC3A 1NOYA 3RRGA 3SV3A 4IDKA 1NK0A 3RVKA 3O75A 4DTRA 3LUFA 5EWMB 1BGXT 2O20A 2FEKA 4G0XA 3LKBA 3L2QA 4DFMA 4DSFA 3QIPA 2O4GA 3N75A 5KRSA 2XHBA 4RXTA 2OYQA 3SYZA 4G1QA 1WSHA 3HDVA 3SQ1A 4EZ6A 4ID5A 4WZZA 4KNYA 3AVGA 1NJZA 3CNBA 2KZMA 1QNLA 3EJWA 3K58A 1ASUA 2B4JA 2D0CA 1RBVA 2RJNA 4FJGA 1URPA 3OS2A 1HYVA 3C95A 3A10A 3E61A 4EY3A 4J2DA 3BRQA 4S05A 4CFCA 1RTDA 4CGFA 3TARA 3URMA 3HUUA 2AJQA 1RT4A 4C8MA 3NH0A 2R4QA 3F73A 5FBHA 3ZSWA 3LAMA 2CD7A 5FWXA 1NK8A 1S1UA 3OYEA 1JKHA 4RWEA 3H5LA 4RY9A 4YCSA 4TMYA 5KWSA 3L8BA 4QICA 3H75A 1REVA 3LDSA 2QXYA 3P83D 2J48A 3ILYA 1ASWA 1QQAA 2QV0A 2TMYA 2DFFA 1G15A 4UHKA 3LUCA 4KV8A 3OS1A 3S3MA 1TAQA 2MSLA 4FJ5A 3KHTA 3ZSZA 2FQYA 3C6TA 1LJLA 2HMIA 2LP4Y 3CTPA 3LUJA 2L19A 1OXKB 3VQAA 1DCMA 1RT6A 1USGA 3V1RA 3HM9A 4DQQA 4Z99A 1BIZA 5TE9A 3GYBA 1GUBA 5E41A 3VQ7A 3O3FA 4DF8A 3I42A 3LP1A 4KO0A 4YWHA 4F12A 3L3VA 1A0OA 1AB5A 1JFVA 1I3CA 3NF9A 4PE5B 3KLEA 4E7KA 3SZ2A 4CJEA 3K57A 1RDDA 4WE1A 4PQUA 3ULDA 3TX6A 1JHZA 2OA8A 4JAVC 3OM1A 3TO5A 1I39A 3MM4A 3T1AA 3NF7A 1E6KA 4Z4IA 3HSTB 1DCKA 3BGRA 4CJFA 1VKRA 4O44A 4HVJA 4BE2A 4EGSA 4NYNA 3AO2A 4CJRA 3BREA 4Y1CA 2FVYA 1NK7A 3NNDA 4HNRA 1JYFA 3TABA 2PMCA 4N56A 2MYUA 4JA2A 1Y1LA 3OYKA 3JY6A 1TL1A 3MAQA 3I8DA 2FBVA 4EYOA 4CEOA 3UK0A 4IFVA 3N0WA 4NYFA 3QEKA 5IUNC 2OPSA 1ZH4A 3CM6A 4B8AB 4K8XA 4M42A 1NXPA 1EXQA 2X7XA 4M3RA 3SUNA 3TAFA 4DTUA 3G10A 3OYHA 2GI4A 1S9EA 1D4ZA 4MS3B 4HNQA 2KTQA 5KQLA 3KKEA 2Y1JA 2HNYA 1M5UA 4KAZA 1LWCA 3DM2A 3C3WA 4FJNA 3AA2A 4J2EA 1Z16A 3TAQA 2NZUG 2Q3SA 1HEYA 3PUFA 3KIOA 3VQPA 5IX8A 3KK3A 1ZH2A 1SL1A 4FK2A 1VSHA 2WONA 5HSGA 3HP9A 1L3VA 3SQNA 2D5RA 3I0SA 2IOCA 5BRAA 4LH4A 1ZGZA 1XHFA 1TKDA 5HBMA 4AHCA 4Z4HA 3NHZA 2X6SA 3LALA 2B5JA 1X9SA 4N76A 4Q6WA 4FXDA 4CECA 1NTRA 4MQEA 2DRIA 3OQOA 4CJKA 2ATQA 1KVAA 3PX4A 2IAJA 1HPZA 4AHUA 3QEWA 1TM2A 3GT7A 1RBTA 2FBTA 3ROTA 1NJWA 3V6DA 1T03A 4XASA 4O4GA 1NXOA 1YT3A 5JNUA 4FLTA 3GRCA 1Z15A 3AO3A 4DLEA 1MU2A 3IDOA 2FBYA 4DTNA 3CFYA 3SUOA 4MS4B 3OLYA 3QELA 2YKMA 1XWLA 1BQNA 3KLOA 4CE9A 3RVOA 4JS4A 1DP4A 4P98A 4LH5A 4E7JA 2PUBA 2GV9A 2XRIA 3QERA 4BWJA 1ASVA 3LUDA 3CG0A 2G8FA 4TSXA 1MIHA 5JNRA 2IYNA 2LPMA 4ZTFA 4KMRA 5KC9A 2OQRA 4CK2A 5IBQA 3A3KA 4Z4CA 3JVIA 4NCGA 1A5XA 2I5JA 4KHWA 5TQ2A 5DKFA 1CXQA 3GBVA 1ZDMA 1LW0A 4OKKA 5CNIA 3BBLA 5TPZD 2PZSA 1PEAA 4M3WA 1TL3A 4O5AA 1WSEA 1U2QA 3TD9A 3BILA 4PZ0A 4CGDA 4KPYA 3AVCA 1JDPA 2R48A 3M9WA 2JGUA 3K2PA 3LUHA 3R0JA 3NFAA 4KQCA 3IAYA 1MVOA 4DTXA 4Q7EA 1B9DA 3EODA 1NJXA 4WXMA 4FW2A 1CEYA 3JTEA 3QEMB 2OENG 4J2AA 3IS9A 4DTPA 3P5JA 3OQMA 3F6PA 1GCGA 1P6UA 3Q15C 2EX3A 3SG0A 3I09A 1IIBA 2NT4A 1EHCA 4RXMA 1NK6A 5J2PA 2FQWA 5HLFA 2FEPA 4C8KA 1L5ZA 1JL3A 1JWLA 5HQJA 1T34A 3T3FA 2HHSA 2DFHA 2FMKA 4RZSA 4S04A 1JLKA 3VA3A 1GOAA 2A9RA 4CHPA 2GBPA 3LPUA 2PLNA 1S6PA 2E6LA 4H8KA 2CHEA 2NT3A 1TMYA 3DZDA 3O3HA 2HVIA 3DOKA 3TAMA 1FKPA 4FK0A 3LUAA 4WUTA 3GA5A 4E7LA 1ZBUA 4MQ3A 3KLNA 2VYCA 1TVMA 3LKVA 1HYSA 4ZTJA 1GUDA 3CG4A 3RMCA 3OO0A 3MXIA 2RKIA 4GMJB 4KHNA 4NCBA 3KTOA 3M6MD 3DGEC 4KZKA 4CERA 1S1XA 2WY2D 1YMVA 3OLZA 5KC8A 4FJXA 1B9FA 4TLLB 4H3HB 4G0OA 4RW9A 1CZ9A 3EQ2A 5TQ0A 2QR3A 4M3TA 4KHQA 3RVPA 1SXIA 1P8AA 3KD1E 3GV0A 4RW4A 3IP7A 3JPYA 2NUBA 1F51E 3OYMA 5CZ1A 3VNBA 4JLHA 1C1CA 1KRXA 3DRRA 2KZZA 4Y9TA 4QPJC 4XARA 4D6XA 3KLHA 1RTHA 4CIGA 3AA3A 4OGCA 4N0PA 4AHRA 4FW1A 3ZCMA 5HROA 4AH9A 5JNTA 3SNNA 2G8KA 4MQEB 1RTIA 3LWLA 1L5YA 2LBPA 4D74A 2JRLA 2R25B 1D5WA 4XLTA 1JFTA 1JLCA 4DU1A 2HQOA 1LAWA 5C42A 4Z4GA 2YV0X 4EYQA 3AV9A 4QCLA 1BDHA 4IMIB 3ZT1A 4FM1A 2M98A 4DWIA 3W9SA 3O74A 3TI0A 3HL8A 3SPZA 4Y1DA 3U6FA 1NXSA 4XIUA 2HJ9A 4RK4A 1LBIA 3D0PA 4C8OA 3K5NA 2ZE2A 1JLEA 4CJ5A 1R8JA 4MR9A 3N6VA 1MB0A 1CYEA 1XHEA 3ZSVA 5B3JC 4IKFA 1X1PA 3JPWA 4FJJA 4KQ9A 3HUTA 1J5OA 3RVQA 4RK7A 3JSMA 4CF0A 2IPMA 1T7PA 1JLBA 2ITGA 2MYNA 2N9UA 3O2JA 1PNTA 2E4XA 4C8LA 2IPLA 3KLIA 4I9QA 3K5LA 3SQ2A 1GCAA 3OS0A 3CG7A 4HUEA 3G85A 4JB0A 2R7YA 1ZN2A 5BRJA 2FN9A 3A0RB 3IRXA 3TR8A 1KGSA 2JBAA 1SXGA 1LWFA 3TMYA 2QKBA 4PA1A 6ABPA 1N5YA 4CGGA 2L2QA 1CLQA 1JLQA 3A2FA 3QX8A 1JBEA 1RDBA 4GW6A 3VQBA 4RKQA 5B3JA 1QPZA 3CS3A 4IF4A 4CJPA 4CEZA 2JVIA 3V1OA 2PUCA 3O1HB 4GPAA 3AVHA 3MA0A 4DSJA 3AVMA 3TAPA 1TV6A 2PUFA 5FWYA 4MQFB 4HYEA 4H3KB 3NHMA 4ZJPA 3AVIA 3C3KA 4M45A 1H9CA 1RILA 4FJHA 3HDGA 1RDAA 4YNQA 3QETA 1EWVA 1OXBB 4RY0A 4LSLA 1DBQA 5TQJA 2E4VA 4QYWA 1NXVA 1Q9YA 3C3MA 1SV5A 3RMAA 4E19A 4AHVA 4LDZA 2OZSA 1TVRA 1ZGGA 1QE1A 3VQCA 3I5AA 4MPTA 3OLWA 1C1BA 1F21A 3NDKA 1JL1A 1U0SY 3WNFA 4ICLA 4G0YA 4QOZB 4FVMA 2G8UA 2HB5A 1RBRA 3C6UA 2MSKA 4LDAA 4E3SA 2JVKA 2PAFA 2MYTA 1J53A 4FLXA 2KFNA 4M3ZA 3EDCA 5CNKA 2DFEA 1PEYA 3VQ8A 3QNOA 3ZT2A 4LE2A 1IH7A 1RNLA 1QSSA 4CFDA 4OG2A 3PV8A 2PY5A 5TQ0B 4E7HA 5TPWB 1RNHA 3B6OA 3OYLA 4Z9BA 3SY8A 5BR1A 4RK5A 3HT3A 1UOCA 4YR7A 4NCAA 3H6HA 1S1WA 4DG1A 3RVRA 3F9KA 1QSLA 5HRRA 2OPPA 3RR8A 5BQ3A 5JNWA 1VSEA 1RZRA 4DQPA 2OZMA 3KYIB 4YFUA 1LBHA 1HNVA 1WSFA 3OYBA 4RW7A 5JNVA 2QKKA 4BACA 2GX6A 3V81A 4RY8A 4BE0A 3EY1A 1WLJA 3TAGA 4FJ9A 2L17A 3P9YA 1NKEA 2IGIA 3KG2A 3GWGA 1IKWA 2RN2A 4CF2A 1ZAYA 3HPHA 1A2OA 2ZAYA 1B92A 2WJWA 4FLUA 1YTUA 3RRHA 1QS4A 1YK1A 3DLBA 4G0MA 4Z4FA 4KK3A 3NCIA 2LSNA 2WJAA 1U49A 1EKEA 1C4WA 1HMVA 3AVAA 4FYDA 2IPAB 3MXJA 5CZ2A 3RTVA 3AA5X 5CHYA 1T8EA 1SKRA 1EETA 3PX0A 4FJMA 2BANA 1XI1A 2E4ZA 3QLUC 2RF2A 3CYMA 2E4UA 3O1IC 4FCYA 4ETIA 4Z0UA 1K68A 1BISA 2X74A 3U3YA 3CFPA 1VRTA 1N6QA 3WNEA 3VQDA 2XY6A 4HUGA 3CZCA 3H1EA 2HNZA 4EP4A 3MEDA 5GQSA 1F4VA 1IKYA 3HPOA 3LFTA 4HUFA 3CFRA 5CNJA 3TAEA 3LOPA 1RZRD 4DLGA 2VG7A 2G8HA 4OGEA 5EWJA 1ZHHA 4XFKA 3VQ9A 3CRNA 3QIOA 2YHAA 1GOCA 3VQEA 3OY9A 4FE4A 1JH9A 4L85A 2OPQA 4B9VA 2HPHA 1D1PA 5DLEA 1GOBA 4NICA 1NXXA 1DJMA 1QO0A 3QLUA 4JASB 5J2QA 1NXWA 3CFOA 4KV7A 3OO1A 3RVNA 4DFJA 1YVUA 2W42A 2JBAB 3FFTA 3LMKA 1WNSA 3DRSA 1FFSA 1BQMA 1KRWA 4RDCA 3QEPA 3L3UA 2KYRA 2YKNA 1RBSA 2FC0A 2LUOA 1S9GA 2RPIA 2FLKA 3QX9A 2PUAA 1LK0A 2PUEA 4YP9A 3OYGA 5KRTA 4RW6A 5DMRA 3UIQA 4B9NA 3FFIA 1VK0A 4KKOA 4BE1A 1LV5A 1JX6A 1U8TA 4N5SA 5FDLA 2ZWMA 3D45A 3V9UA 4OBBA 4ETNA 1NKCA 1J54A 4E7IA 4DMNA 4AILC 1VSIA 3B2NA 1QTMA 3N0XA 1VRUA 4I2PA 3SUQA 4CFAA 2L18A 3WNGA 1FQWA 2Q5CA 3Q9SA 4KI6A 5FROA 4ZHRA 5KGXA 3KTQA 1UDRA 1ABFA 3KYJB 1YS7A 2PE5A 5DTEA 3P1GA 4N47A 4OTZA 4B9SA 4M3UA 3D02A 3I0RA 2XY5A 2CHFA 1QO0D 4O0JA 1EFAA 1VSJA 1Z2EA 1BDIA 4G0PA 3BRSA 3HEBA 3AO4A 3OYDA 4JRQA 1NK4A 2P51A 1S1TA 4ELTA 3QINA 1U47A 3K4HA 3ALYA 2F8TA 3VN5A 3FDFA 3QEIA 1CXUA 1LWEA 4E7PA 4F06A 2FW0A 5FWXB 4MRMA 1KTQA 3DOLA 3LZJA 3S3NA 1Z2DA 3EULA 4G0QA 2G8VA 1MAVA 3O4QA 5HP1A 3RWUA 3T95A 3LUKA 1RT5A 3O3GA 3EZ5A 1DC7A 2Y1IA 1JFSA 4YRZA 4CHQA 2FLWA 3FFXA 4KTZA 3NGIA 3OYCA 4CHOA 1WN7A 1J9AA 3HSYA 3VQQA 3A0UA 7ABPA 4CJTA 4KFCA 3RVMA 2QSJA 3MYYA 4PUOA 4CIFA 3LTEA 3M8PA 4FZYA 3E3MA 4B9TA 2IDOA 3T19A 1SL2A 5HKOA 5ABPA 4CEBA 4OLBA 5EWLA 3H5VA 4OLAA 4FLWA 2LIVA 1DRJA 4LZLA 1TKZA 3ZSYA 1BI4A 5HRSA 1DTTA 3CU5A 2E4YA 4MR7A 4M3XA 3IP6A 3NF8A 3HS3A 3SQ0A 2PUGA 2D0AA 3MXMA 4FJ7A 3DI6A 3OVNA 3O1JC 2HHUA 4LSNA 4MAAA 4O55A 4CJSA 3TANA 4MS1A 4ELVA 1USKA 3N53A 2PL1A 4M3YA 1RBUA 4MLCA 1BA2A 5CNMA 4LX8A 4CBVA 4ZMRA 4HCBA 3FFWA 4DTMA 1WAFA 5CYQA 2FMIA 1O1WA 2P9HA 5EWMA 3RMBA 4O1IA 3L2RA 2WWVD 5C5CA 4IILA 1DC8A 2PJUA 4IRXA 5J1EA 2QVCA 3AVKA 1RTJA 4UQGA 2H3HA 3M8RA 3MEEA 4G0ZA 1ZBIA 1ZY2A 1FFGA 4F3OA 2BGGA 3OYFA 1ABEA 1L3UA 2JVJA 2FMHA 2PKXA 4QAGA 4EZ9A 1KRPA 4Q5VA 2A1SA 1MB3A 3QO9A 3OYIA 1IG9A 3HZHA 5IEBA 4IG0A 3OJSA 4CHYA 4W5QA 3ILHA 3NF6A 4LD0A 2VG6A 2E4LA 4FLVA 4L8RB 3V9ZA 3L49A 4CEFA 1B00A 1QQBA 4E1MA 4FM0A 4LE1A 4DQSA 5JS2A 2HQBA 1DG9A 1CZBA 4DSEA 5IEJA 3LPTA 1A04A 3AO5A 1LAVA 2VWKA 4DQIA 2I6FA 4RSMA 3NBPA 2QW1A 5IUKC 2QU7A 4F3TA 3SM9A 4FJ8A 1Z12A 4C8NA 4FM2A 4YLEA 1QP7A 4Z0NA 2GKGA 2PYJA 5C24A 1UA0A 5J2NA 1Z18A 1ISSA 3QESA 2XO7A 1QQCA 2KQ2A 3O2QB 4Z4EA 1VRVA 4F2RA 3T38A 5SWMA 3EGCA 3QELB 4MR8A 3JYTA 1USIA 3RVLA 1LW2A 1U2PA 3ROFA 4FLZA 1VLZA 2HHQA 4KB1A 4LY7A 1W0HA 3QK7A 2MYPA 1VSLA 4KTQA 3HXMA 1K66A 3K5OA 3QLTA 5TQ2B 4MRMB 1HNIA 3AO1A 4EVQA 5FRMA 1IKVA 5IULC 3AVBA 4L4UA 2V0NA 3MIZA 1YMUA 1JXBA 3BDPA 1VSKA 5I4CA 4J2BA 3FMVA 1JDNA 3LAKA 3AVLA 3UKJA 1Y97A 4R5PA 3LP0A 4LRQA 4ML3A 4F4KA 3V1QA 1I3AA 5KGWA 1NKBA 2JK1A 5KQPA 5DGCA 4E1NA 3IG1A 1RXEA 4FK4A 1RT7A 4DU3A 1TK5A 1DBPA 1LJUA 4HNSA 3NGZA 3OM0A 4MS3A 1L3TA 1M2FA 4PWDA 2P4UA 4GNRA 4B9UA 3M8SA 2B1JA 1WETA 3H5WA 1D8YA 2PL9A 1RT3A 4CCHA 5T3YA 5EWLB 1VPWA 1JLAA 3QEVA 2G8IA 2FQXA 4PYRA 4DSLA 1FSPA 4KFBA 3LANA 1BI4B 4OJRA 3OYAA 3IPAA 4D6YA 4OKJA 2RGYA 2Z1IA 1VSFA 1DBWA 1M5TA 1Z13A 2HHWA 3VQ6A 4CF9A 3LZIA 1XC9A 4HCCA 2B4AA 4MS1B 1E6LA 2NZVG 3PY8A 3DRPA 4MFBA 2VWJA 1PUXA 3ZSQA 1Z26A 3OLXA 3DLEA 4DTOA 1HYZA 4KI4A 5PNTA 4DS4A 3KKRA 3LWMA 3G0ZA 3V9SA 3HK2A 2XY7A 1P2FA 5GOTA 4FZZA 4RG8A 3DLKA 1BAPA 2QZJA 5J2MA 4K8ZA 1BHLA 3SQ4A 1KLNA 4MLDA 4CJWA 4F8RA 4RK1A 1KVBA 4MS4A 3QLHA 4KRFA 1D2AA 2IS3A 4G97A 4TLMB 4YS6A 3OMWA 2A9OA 2P1JA 3O4NA 1UWBA 1SXHA 3N8IA 1WSGA 3NE6A 3AVFA 3HO1A 4CF1A 2FN8A 1ZBLA 4H4OA 3G1WA 2PYLA 3KCNA 1SRRA 2FEWB 1KCFA 2IPNA 4KK4A 4OPKA 4RKRA 1C6VA 1X9WA 4JOQA 4W5RA 4CEQA 5C25A 3H5IA 3HPGA 1JF8A 4M88A 3ZSOA 1W25A 2IOYA 3QNNA 1BIUA 5KQGA 3VA0A 1UA1A 3SAJA 1QMPA 3NBMA 1W9HA 3ZSRA 3M8QA 1XWWA 1JL2A 2WRZA 4FJIA 1RT2A 4DQDA 1APBA 4OKEA 3UUGA 2A1RA 2KFZA 3OYNA 1P6QA 3AA4A 3CM5A 4CGJA 3C6QA 3QEMA 3PO5A 3SPYA 1EP4A 1DCFA 1TLFA 3NAEA 4AHTA 1FXXA 3RQIA 3KK1A 1RCHA 1U45A 1U04A 2GBZA 3ZT3A 3HJFA 4MR8B 1EWTA 5F64A 4PY5A 5KTQA 4N0QA 2AYZA 3DMJA 4DSIA 2D0BA 5HRPA 2P5OA 1SUQA 2BDPA 3SCXA 4FB4A 3KLGA 3N0RA 4MR9B 2AYXA 3ISNC 5K14A 3ZT0A 2WOMA 1QSYA 4IGAA 4EVSA 1YK0A 1NY5A 2FMFA 1HQEA 4KHYA 3FGZA 3T6KA 2JCGA 3QLVC 4YV7A 1BVHA 1D9FA 2ID9A 3HCWA 3OJUA 3DBIA 4MGEA 1U48A 1TKTA 2FXIA 1WAJA 4B9LA 3M9XA 4ZYLA 4YGXB 4CHNA 4DN6A 2GWRA 2VUHB 1DZ3A 4BDPA 1RXIA 4OVLA 3KJVA 4KREA 4IBNA 1C0MA 3L2WA 5KQMA 3GL9A 1NK9A 3Q7TA 1BCOA 2XY8A 4DQRA 2JLEA 4EP5A 4Q6BA 3HVRA 1NXTA 3PX6A 3VNAA 4N03A 2YNIA 1ZVVA 3IP9A 2A9PA 1RDCA 3QLVA 1DRKA 1JLFA 4CJ3A 2F8SA 4IMJB 9ABPA 5FWYB 2HHTA 4XXHA 1KVCA 4P1ZA 4CFBA 1Z17A 4DTJA 4M41A 4CEDA 2VUIB 2WB4A 4AHSA 3K59A 1J56A 3DLHA 3OMXA 1ZYQA 2QXFA 4NV3A 5TPZA 2IKSA 2MSWA 2ZD1A 1D5AA 3CZ5A 4KTWA 2VG5A 1DLOA 1KMIY 4O1HA 1SL0A 1ZBFA 1R0AA 4E0DA 2Z1GA 3KD5E 4CEAA 3SV4A
chains in the Genus database with same CATH superfamily
1QF9A 1Z35A 2X6NA 1Z25A 4HFJA 4YH1A 4Q4HB 4MDHA 4IDQA 3LWNA 4HRXA 2BUBA 4MA4A 3RYIB 5JMWA 3E22B 3SF0A 1WCYA 1SC6A 5I9SA 4FGSA 4CWAA 1E5XA 3MWYW 5FFMA 1TQ2A 1RRMA 2XZDA 3UGKA 1EFPA 2FRDA 4ZPJA 1E6MA 3CEMA 1J5EB 1RABA 4LNUA 3O9TA 2C5EA 1V16A 3BP8A 1ADYA 3H2IA 1J2YA 3HCEA 1E4EB 3EXHC 4YRDA 3R3VA 3V1TC 1GAXA 1ZNZA 5C10A 1D7AA 2W2LD 1BIFA 1K6XA 3SS9X 3AVNA 3PGXA 2DQSA 1CQWA 2P2GA 3EWIA 3F78A 1YS2X 2Z1HA 2BE2A 1X2BA 4IJAA 2JIRA 3S28A 1IO2A 1XMSA 4G0UA 3MWEA 4EG1A 1U4BA 4Z49A 1SOAA 4P0QB 3F2KA 1NJIO 2HOQA 4BL5A 3ADOA 3EFHA 1THGA 1L4UA 4RMGA 1AN0A 1M8PA 3D7RA 2XQFA 4BWMA 2AOTB 1ZBSA 1TAGA 1LH0A 5DTJA 4XTRA 2WB2A 5EWJB 3NFYA 1A8HA 3RARA 1UK8A 5EE0A 3UAZA 4LDQA 4PYNA 4X63A 5A1JA 4F3NA 4ODIA 4RHYA 2HRZA 3VR2D 4HDAA 3DYIA 4LZAA 1BEZA 2FDXA 2XMCA 4HPXB 4ED9A 4J2HA 1IM8A 2GB4A 4WT7A 1A8SA 1BDJA 3RTGA 1E1MA 3WLPA 5T7BA 1U2SA 2FFJA 3RBAA 3QEJA 2FDCA 3QSYA 3C5WP 3GLIB 2WTNA 3HA2A 1FE8A 3HYFA 4CIYA 1RIIA 1JLGA 1ZZEA 4JBNA 1ZX1A 4QELA 3VZDA 4BDYA 3G7NA 1NN1A 3VR3A 1H6CA 5G0WA 3HADA 3W8NA 1QC5B 3NNNA 3R8CA 1LZKA 1YR1A 4GRDA 3JR7A 1BU5A 4Y1RA 3CF0A 3NV9A 5EIBC 5LDDC 2OFOA 3WS7A 2V45A 1E3IA 3ROMA 1C50A 3FRJA 4RPKA 1K86A 1NJYA 3S4YA 4UVDA 1II8A 4I6MA 3GLFB 1CW2B 3A7EA 2MT9A 1I3MA 4TN5A 2YHUA 4G56A 3OJLA 1S6QA 2B4QA 4OHOA 4WFBL 2Y1XA 3PX7A 4YV0A 4KZPA 3JARB 5HRNA 1K0UA 1QXSA 1W73A 3E5NA 4XYGA 3P9NA 4JZYA 3UC9A 1IJJA 2H2WA 5GZ6A 2O59A 2JK0A 2IS1A 5J2UF 4H17A 3E0XA 2E9SA 1GLJO 2V6JA 3P52A 5AFUH 4FGJA 5D3QA 1BWRA 3U7JA 4CV2A 2XEXA 4FOEA 5DLPA 1VQMN 4M49A 4DZZA 2PS1A 2O8FA 3E9MA 1NK0A 4H5VA 1ZWKA 2JLZA 4HEJA 2JFVA 1KZGB 3ETCA 1CJVC 4H1UA 3V1UA 5JRZA 3JWGA 4PF1A 3R09A 3AVGA 1N9ZA 1QNLA 5HUJA 2XODA 4QJ4A 2E2OA 3L0ZA 2QTVB 3HKDA 4ZQIA 2P65A 5FPSA 4CFCA 2PZLA 3C5CA 3NHFA 2VAPA 5I9MA 2BELA 4XSHA 1EA7A 1P2GA 1CD5A 3ZVRA 4JUBA 1BU6O 1OX4A 2Q1NA 3L8BA 9LDBA 2IYEA 1YJ9N 2JDID 3KQLA 3DMTA 3QPAA 3LVBA 1Z0AA 2W6KA 5A6SB 3CHWA 4PPQA 2IYTA 4GBED 4D8TA 3NONA 2I7CA 3DE1X 4BJ1A 4V24A 1C9KA 3C6TA 3CTPA 4OGFA 1NA5A 4J0QA 2WQZA 4YQYA 1BCSA 4HF7A 5SY4A 3TZCA 5J4KA 3A4TA 3T5CA 4NPAA 1DGQA 1MZPA 3WISA 5MFPA 4OL9A 4JWTA 4ALNA 3F8SA 4K05A 2UZ4A 1RYEA 5LP6F 1P4HA 1MORA 4R6XA 3BXFA 4DZTA 3VEWA 2YCLA 3QOYA 5KVCA 2YFKA 4WGGA 2C9DA 4QXOA 3C6ZA 4Y1CA 5DGIA 1G60A 3WA6A 5MGNA 1XCMA 3N1UA 1TJ3A 3HDHA 1G8PA 4D3XA 2QMYA 3UK6A 4BRSA 5B7PA 4IBOA 3DXKA 4IL5A 2ZRGA 2O1SA 4WAUA 4J7AA 4H9GA 4ZO8A 1DMRA 2X5OA 2I8CA 3GJ7A 3GRAA 4JELA 4HNQA 5KQLA 3IEXA 5E84A 1W4CA 1I8TA 5AJWA 4RWTA 4H0FA 4MUHA 4KHPB 3PJFA 5DM70 3O03A 3QUTA 2UUOA 4M8IA 4MVJF 1ZH2A 5DE3A 4G81A 2XMQA 1DARA 5IPFA 2E20A 3PR1A 3GFSA 1P80A 3JQCA 3IAUA 1FDRA 4XDYA 4IQGA 2JW5A 2CT8A 1PWYE 3H05A 1FF9A 4ER0A 1DO0A 3H1VX 4MCJA 2ZRPA 5IKEA 2SCUB 1RBTA 1FFDA 2OAQ1 4FLTA 3EMVA 3AVQA 1TQ6A 2ZWPA 3CFYA 4TLDA 3OLYA 5I9LA 1KP3A 4G41A 3RVOA 4UARA 2FZKA 2H51A 2PUBA 2PWBA 4JKGB 1V8ZA 5CU7A 3H1BA 5HUQA 3V4VB 4FSVA 2OFPA 3U6KA 4DLSA 4URUR 1NGJA 2ZJAA 4CQMA 3P27A 2C9BA 5CVCA 5AKXA 2P41A 4PZ9A 4KE6A 1JSLA 3JW8A 1X3MA 4B1FA 3LX4A 3GR6A 1IAQA 1A4UA 1PGPA 3WT0A 1H69A 1TD1A 4HGPA 3GZNB 4Q1BA 1NJXA 1W1IA 4XDGA 3U7HB 1NVFA 3F6PA 3GW8A 1VI6A 1KI6A 1XVTA 3F90A 2Q31A 3WE7A 1KQSM 5K4HA 1JVNA 5IAEA 1GOAA 1T1RA 1CY4A 1E9DA 3QQPA 3EG5A 3ZKWB 4H8KA 2JEYA 3LYLA 2EF1A 1VJ5A 1J0DA 2I76A 2D0PB 3RU7A 2F3TA 3UHFA 3DBLB 1CE8A 4JB3A 1H3FA 2I4NA 2FEXA 2AVDA 1E18A 3VJMA 3KQHA 4ON9A 4B34A 5AW3A 2IS2A 4NCBA 4LCBA 1CEEA 4TL6A 3ZE2B 1A1SA 3I61A 5AQOA 1EFTA 1YMVA 4RA6A 2B4RO 5KC8A 1V1JA 2QX6A 2HPVA 4BTLA 4I1IA 1RWVA 2E4AA 2HCFA 3ZD9A 4MRVA 1AT1A 4IINA 4C4RA 4KHQA 2NUTB 3IUSA 4XWYA 3QHAA 4CNQA 2PV0A 2QPAA 4ZC8A 5JADA 1GDHA 4LYGA 2KZZA 5EP1A 5IDYA 2VSQA 4QPJC 4B3XA 4C2AA 3OEHA 4EKIA 2WKSA 4FPBA 2EBFX 5I7OA 3MMPA 4CIGA 1PL7A 1O5OA 3AA3A 1EDDA 3L8GA 2P9FA 4NNOA 5IM5A 3EVTA 3PIDA 4KXWA 2XWSA 1IQ0A 4ZVLA 2LBPA 2JRLA 1PUIA 4RH1A 3I0NA 3T1HK 1J00A 5KOHA 1QFMA 4E22A 3S41A 3L1HA 4FEAA 2AJCA 3TI0A 1VE7A 1L5OA 1RP1A 5EUBA 1V1RB 1HRDA 1SIUA 3S3TA 1I2ZA 2PVPA 2AG8A 3D0PA 1UMBB 2WTAA 2GJKA 3QBWA 3ESXA 3F4BA 1NRJB 3G5UA 3S81A 1WUAA 1T9GS 3K8QA 3N6VA 1XHEA 2GETA 5K0NA 4EG4A 1D2RA 4IKFA 1X1PA 1CZHA 1XZAA 2PX4A 4ND4A 3GJYA 5HPYB 4CF0A 4EFLA 3CUSA 2VJKA 3C6MA 3CZQA 1QH9A 2IU4A 1R4MA 1XWIA 2M6SA 2Y93A 1DT3A 4B3SB 2FN9A 1GPUA 3RSCA 5IWAK 2G9VA 3L4EA 4GKBA 6ABPA 1QQOA 2L2QA 5BSMA 4PG4A 1C30A 4B85A 3HVUA 4D3FA 2NYVA 5BPNA 3B1JA 3TB4A 4B1XB 3O1HB 3I72A 3I2YX 4NB4A 3PWZA 3SSAA 2EKZA 1D9ZA 4Q7JB 2HBMA 3A58B 5KPDA 1FXWA 1RILA 1CUWA 3HI0A 3A6LA 4UCWA 1JFFA 4QYWA 5LNK1 2KLBA 5G1OA 5AI8A 2XCUA 3WHLA 4EL5A 4MPTA 4PLZA 4FILA 3DMFA 3RHTA 1TEVA 4QEDA 1N33K 3BXOA 3H4TA 2G8UA 2AZDA 3G71N 4RV4A 2FUCA 4E33A 1Q19A 1H8ED 5LBUA 4EYEA 2C58A 5ILOA 4YJ3F 1I36A 4DV1K 4JJIA 1ZSNA 4B3TB 1IH7A 3P4UA 5CEJA 4EUSA 4OIMA 1NUQA 2FG5A 2TSYB 4LBYA 4E7HA 4Z0PA 1BN6A 2VNKA 1QRUA 3C6YA 4NCAA 1J6UA 4F9EA 3F9KA 1UZLA 2OPPA 4S0ZA 1M1YB 1AXRA 2DTDA 3EXFB 1VHTA 4Q03A 3F6BX 4BACA 2DFLA 3ADCA 3FVWA 1OFHA 4RY8A 3JQ8A 1CFZA 4HZUB 1WZCA 3TVDA 3BERA 3PUHA 3VX3A 4QFDA 4W9RA 1HNNA 5B7QA 3STUA 2IP4A 4YRSA 1LPAB 3I9JA 1JR2A 4KPFC 3QG1A 1ZBDA 5FNVF 2OWEA 3OBBA 1C4WA 3R6DA 2ET6A 4XX0B 3RTVA 2QQEA 4Q3OA 3QLUC 4JUFA 3KE9A 2MCFA 5AQ1A 4UM9B 3HKEB 3U3YA 3CFPA 2KLAA 4AY2A 3EMBA 2BKLA 1Z4LA 4KP7A 2RIRA 5JR3A 1YJ5A 1T0IA 1Y4ZA 2VG7A 2VF2A 4OGEA 4F46A 2OCYC 4GHWA 3H6KA 3ONDA 2YHAA 3OIWA 3ECCA 4ZZ1A 4J4BA 1MC1A 4GXRA 5EP3A 5DLEA 5LWQA 1QFSA 4RZIA 2HQ1A 1NBAA 1BMQA 1NXWA 2NU6A 4PHTA 2P3LA 2X2PA 3DMYA 3S8MA 4B0OA 4Y0VA 4QBIA 4JLJA 5IK2D 5AHKA 4I5EA 3DRSA 3UB3A 1I51A 1N6KA 4RNCA 3QEPA 4GPZA 3B60A 1YVDA 4FX5A 2VWBA 3OYGA 2B92A 3C70A 3UTDA 1KOGA 1N34K 1RBZA 1TIBA 2V6BA 4L73A 2HSTA 3ZHBA 4OBBA 4MHOA 1ZD3A 1UODA 4LQCA 3RVDA 1ZAKA 4X92A 5LYJF 4CKXA 1VE1A 4IUBS 4ZHRA 3MTBA 1V5IA 2ZS8A 3CF6R 1B15A 4MV7A 4N47A 3TPQA 1EVIA 1ESEA 4Q01A 1YCHA 2AR9A 1EK6A 3E3OA 1F8FA 3KR1A 1U0JA 2AXEA 5K0SA 1PEDA 4LHZA 2J9YB 3U81A 4H0OA 2P30A 1JDZA 1UXIA 2VL7A 1Y37A 1MAHA 4LYJA 3UK1A 3Q0EA 4FYPA 5KVQA 4DBLC 4QQNA 4R9UC 2VDLB 4KV9A 1YNSA 1T6ZA 3O3GA 1DC7A 1IJBA 4CHQA 3FFXA 1BJKA 1C3LA 4RQUA 3ZGLA 4ASUD 3VQQA 1UEXC 4G25A 4KFCA 1XZHA 3RSSA 3B1XA 3T19A 3CCEN 2FETA 3OY2A 2I91A 1GKKA 4UEKA 4FYVA 2PBLA 5A3VA 5C7YA 3MB8A 4O4LB 1Y4DE 5CAEA 2VYPA 2B20A 4P86A 4MUMA 4AY5A 1XOIA 5ERXA 4QBTA 3QENA 2QWNA 2ONZA 3FWYA 3WJ7A 4LFAK 1X9GA 4BTVA 4GNKA 1B16A 2QROA 2ZRQA 5L7YA 1NG9A 4LX8A 2FDRA 1EXDA 5EWMA 1E66A 3K2IA 1UKBA 3HU1A 4WY8A 2JHAA 2REXB 3L7DA 3DL0A 3SDBA 4HOYA 3L4BC 1KDTA 4BNJA 3Q5GA 4CETA 4HGQA 3JAWB 2I1WA 4GQAA 2DQ4A 4WZBE 2ZWOA 3EC1A 2R8ZA 2VJQA 1SKUA 2JJYA 4IUDS 1M67A 3H2JA 3U61B 4U39A 3AJ8A 2VRBA 4PGAA 5FPPA 4IJNA 4LE1A 5B4UA 2ZRMA 2ZR0A 5EUCA 5LIRA 3PLAA 4D26A 4LWZA 3F5QA 4IS2A 3M1AA 2Z2KA 3WYFA 2WF5A 4F3TA 2D06A 4LA4A 1YCGA 2BFDB 2LXNA 2GKGA 5J2NA 1Z18A 4DC0A 1UH5A 3K4PA 3MFYA 4HUQB 1Z2CA 4YJHB 4F3KA 4CFYA 1Z8HA 3DJYA 2D3TA 3CYFA 5D7BA 4CM8B 3VR5H 2DMRA 2A0KA 3UENA 1OT3A 4X0EA 3O1WA 4WK4B 2YVKA 4D8WA 3JALB 3AVBA 2V0NA 3AI1A 1G21E 3HPQA 1GDTA 5CXXA 4FSHA 3UHPA 3QJYA 4JEIA 4HXFB 5DGXA 4E12A 4B9EA 2AZTA 1FNDA 3DNMA 3EGDA 3DDUA 1RXEA 4HLUC 5CVEA 1DBPA 4HGRA 4IXDA 2G1KA 2B2CA 2XDQA 2HBLA 1KAGA 2BGWA 4DQKA 2VHEA 4PWDA 5K6AC 3RO7A 2I7PA 2E8AA 1XRNA 1D8YA 2H4ZA 4MV5A 3KR0A 1ISGA 4ID3A 3UWMA 2ADMA 1HDYA 3ONNA 3BAFA 4M1WA 1KXPA 4WFKA 4QNNA 2HHWA 2X9LA 1UXGA 3VVBA 5KZMB 2Y3IA 4W7IA 3DZCA 5K0LA 4HCCA 3E81A 5D1HA 2QN3A 3ND9A 2BM9A 2QJFA 2AR7A 2ZUCA 3N8NA 1Q18A 1JB9A 2EZ8A 5AHRA 3C0KA 3PCXA 1ZRSA 2G1PA 2RHLA 3R6WA 4NNJA 4ND6A 3T4EA 1AS3A 4IMRA 3TL3A 2WBNA 4P0TA 1XPRA 1MRZA 4MQBA 3QYJA 1KLNA 3STYA 3U9ZA 4N5NA 3UGQA 1XRJA 3NH6A 3RJMA 4GI1A 5JC1A 1YE8A 3S29A 2EC5A 2PGLA 4C6RA 2Z9BA 3AVFA 4UNPA 3B38A 5JYCA 2PYLA 2OHIA 3DM9B 5AOVA 4MQMA 1PGOA 2GEJA 1S8AA 4CKCA 3OJFA 3NTLA 1T5LA 1K73O 4PC2A 3DV9A 4RFSA 2I2DA 1P0QA 1WF6A 1LPBB 2I7NA 4G1MB 2HO4A 1NKTA 2IT1A 1N77A 3JQEA 3R6LA 5BSUA 3ITEA 1APBA 4KWTA 1KI3A 2E1YA 2IUSA 4X3PA 1AZSC 4G8DA 1LF0A 1NONA 3BTSA 3QEMA 2YWCA 3MFQA 1K75A 3DWFA 3HFSA 4FPAA 1DAKA 5F64A 2JFPA 3D4IA 3TI9A 1G59A 5I9TA 2Z0MA 1NQ5A 1BCRA 1H0RA 4HLCA 3G6KA 3N0RA 1QIMA 2YZNA 2PEYA 2QIPA 1CJUC 3RTBA 2JCBA 1Z6XA 5TEWA 1O94D 2PKRA 3DDHA 1VLMA 1YJBA 4MYCA 3HL4A 3GJ4A 4JDUA 1U48A 1YS1X 3KQPA 1W96A 2Q0SA 4K1LA 3ZC3A 2O7QA 2ZQ5A 1XO1A 1ZRNA 2V6GA 5CH5A 5JAPA 2QB5A 4IBNA 1ECGA 1A95A 4YQZA 3EA0A 5BW6B 4HFRA 4EP5A 2AMVA 3PQ2A 3PX6A 3DOCA 1KEUA 3E2MA 3ZU2A 4AUEA 1RDCA 1KIFA 4AN1A 4BY9C 4JXKA 1CLUA 1Z5ZA 1R6VA 1E5QA 1NVVQ 2R8OA 2P9QA 4RKWA 1W1UA 3WXKA 4M22A 1DWPA 5TX7A 4J91A 3EB9A 1SGWA 1XZEA 2XQKA 1YQTA 1SL0A 1UJ4A 2RK3A 1XNRK 2CVFA 1ZHFA 1ZBFA 3N7AA 2RARA 4YRJA 5LB2A 2ZSHA 1FDIA 4JBYA 4A5AA 4YDRA 4ZJYA 4P4NA 5KWJA 1SUPA 3WXIA 5DYTA 1PYGA 2JLQA 4C0LA 3KS9A 4AMGA 1YNOA 3QBDA 4DU4A 3FB1A 3G7UA 3PDCA 1P7VA 1YQWA 2QEQA 1OAAA 4BUZA 5F23A 3D7NA 4MGYR 3NHGA 1I4EB 4HZGA 1XZBA 4ZO9A 2QMEA 4HNHA 2IEBA 5LZ7A 1YTAA 4N49A 1TUEA 2ZIXA 4FZRA 1M6YA 4IOXA 4S1OA 4HXEB 1V41E 4RK0A 3QY9A 1LQUA 3S8EA 1C14A 1QGOA 2VTBA 2POCA 3E4CA 2PJRA 1I1OA 4MP8A 5HIIA 3IDAA 3O4RA 2VSFA 3T1OA 1ONPA 4MV0A 1EH5A 2CXQA 4TS3A 4G84A 3QEBZ 3AK4A 1EE9A 3SHQA 1BE6A 1VSDA 4E14A 4FCVA 3UB4A 3ZHYA 1IBCA 4UUAA 2H5EA 4CIDA 4S35A 3T1HB 3DE0X 4FOLA 4TLAA 4G5OA 4RTLA 5F9MA 1IU9A 4DXDA 4TSFA 1A9ZA 3BTOA 5BYBA 3AUFA 1ZVKA 3ZDZB 4DB4A 4FD3A 3DTVA 1PWXA 4RJJA 2AXQA 4EJ6A 2WMYA 5C0OE 1QVGM 5BO5A 4Q24A 2IVOA 1N3BA 1QS0A 2P0AA 3A6PC 5I5EA 4R0VA 1FLVA 5CE3A 4OLJA 3ATVA 4BVLA 3OD1A 2PEZA 5BUCA 1Y1SA 4X1IB 2JB9A 3K0HA 3BWVA 1FX0A 5DSZA 4CF8A 2FW6A 3HY4A 2C9YA 1OV6A 1TM4E 4EHHA 4PC3A 4BEBA 3BVPA 4ZV7A 1LU9A 2FW1A 5IWAB 4EJ2A 1X1EA 3OTIA 1XRMA 3ZJUA 4I81A 2P9PA 2RG7A 3EZNA 3R7WA 5CH8A 1T4GA 3THYB 1MJGM 4PGGA 2H00A 3K73O 1U7TA 4R7GA 1TCCA 2PMDA 1NK5A 4CUZA 3LBHA 1NMZA 1LV8A 2CNLA 4IIJA 4KN9S 1B76A 3UJNA 1ODJA 2C4HA 1JKXA 3TCKA 2QWQA 3V4SA 3NG1A 3IPCA 1N33B 4DUPA 2G72A 2O57A 1SVLA 3CH6A 5D3GA 3VPDA 4DV1B 3AQ4A 2QBYB 4GLBA 3DGFC 4YOVA 2BKXA 3KPJA 1BDMA 1P4GA 2BJHA 3KOYA 1N1GA 4RH0A 5BVHB 2ZRIA 3UJ9A 3ZXSA 1MA9B 3OSZA 1S1VA 1KY4A 5D51S 3H04A 3H17A 2ZJ8A 3U0BA 2I6SA 3PGKA 4OATA 3FUCA 3AERB 4CGYA 4N7JA 2HDNB 3KX2A 1ETHA 4ZA2A 2ASOA 1EHIA 3NYQA 3HA5A 3THVA 1CS4C 1HQDA 1N2EA 1PFYA 5C4MA 4U9HS 2CWDA 3D5QA 2N1MA 3MIIA 1X9MA 4B9MA 1MAWA 2WU1A 2HSJA 1G5HA 3OP4A 2RCYA 2LCFA 4L3WA 3GBSA 4R8KA 2ILVA 2D1YA 4BKMA 2ODNA 5KYXA 3H3FA 4I5FA 2QVBA 3UJAA 3ZGXA 2XT9A 5JS7A 5ES3A 4KR2A 1DXHA 2RGWA 2PKQO 4KXYA 5DB4A 4G9GA 4QDUA 4ALKA 1CIPA 1DXYA 3NH0A 5DV9A 4IIEA 1W5EA 2Q7DA 4RWEA 4TMYA 3QVUA 3KDAA 3R4CA 3ILYA 2H5LA 3MSXA 3A28A 1KJIA 2EHJA 1TX4B 2FQYA 3ISTA 1LJLA 2HMIA 3PITA 3TSWA 3D2FA 4DA7A 1AMOA 5MHTA 4WI1A 3AVVA 1N34B 4MDAA 4DQQA 2ECFA 4X1KB 1BIZA 1H42A 3IHWA 3Q72A 1Z7BA 3ZTYA 1CDZA 1F6BA 1YTLA 2XIQA 3SFZA 3ULDA 3C0BA 3PDJA 4TWRA 3HSCA 4NRDA 4OPHA 4QTZA 3LCRA 3VSCA 1OC2A 5C9ZA 2ZJ6A 5ECGC 2EKQA 3QMWA 1RQ2A 1C0GA 2Z6VA 2WZDA 4AROA 5FYDA 1GHTA 4II2A 4CEOA 4IFVA 4GVEA 4MUJA 5J1TB 1W6UA 3CM6A 3DQQA 1QZXA 3ZWAA 3EEOA 3TAFA 3A2LA 2VNIA 5LP1A 3EDMA 3EG9B 2ZTUA 4IUCS 4KAZA 2PUHA 4D0NA 1YAGA 2CNNA 2PLFA 2JHPA 2W71A 1T2DA 1G8HA 4KSYA 4C0HA 3LP8A 2VLBA 4IGIA 3LT1A 3EVZA 3Q11A 1KBQA 1PV4A 1W75A 3UUWA 4MW4A 2HV8A 4JQZA 1CR4A 1EVKA 2GKOA 4EO4A 2NRHA 4FXDA 4YJ2B 4B3IA 1NTRA 1E7RA 2IPXA 2CXOA 4GI3A 4KPUB 5K03A 2PH1A 4UDOA 4LFAB 4M4SA 2DFTA 2ONJA 1HPZA 4FMDF 3G82C 1ZD4A 4R31A 4CMCA 1ACLA 2FBYA 1LJ8A 2UV8A 1S4MA 1LS6A 5AQWA 3KLOA 1OGJA 4P98A 2YX1A 3DDCA 2YVAA 3E5HA 3U9SA 2HNAA 3CG0A 2UYOA 4TSXA 1MIHA 4BMDA 4KTVE 4QAQA 4YWJA 2X5KO 4RMJA 2GQ0A 4CK2A 1SG0A 4W8OA 4I55B 4X8OA 4IJWA 2BKUA 3LQFA 3ZW9A 5CNIA 1DC6A 5KTPA 4MI1A 2DETA 3LUBA 3UZUA 4CKWA 4DDKA 2XJ4A 1ZISA 3FZMA 4HATA 4U2KA 4HSEA 2D1KA 1DKNA 4D46A 4PYOA 1KFJB 1KO1A 1A9OA 2AD5A 3REGA 1Z62A 2FJ0A 2KBEA 2O7RA 4LGYA 1XMIA 3SG0A 3P2IA 3LO5A 3BEDA 3COJA 4GXNA 1L5ZA 1TQ8A 3OZ7A 5AVVA 4HV4A 4PX3A 1JTVA 4QGHA 5COBA 3EIWA 1ETUA 5TMBA 1FC0A 1J22A 3H8JA 2VK1A 2E6LA 1GGHA 1B41A 4DSOA 2V65A 2NT3A 1GL7A 1Q7GA 3VDMA 3I34X 1N5RA 3GA5A 2C7PA 4UE6A 3DKIA 2JS7A 1SQ0A 5JO9A 3W6NA 3PICA 1Z0FA 3EVCA 2QRHA 1AMUA 2IEDA 3GDQA 4TRMA 2BCGY 4XKJA 4FJXA 2XNSA 1E4GT 3TFQA 4OSPA 2R62A 4B73A 1OTXA 1TNDA 2IQ5A 10MHA 1ZZGA 4JYAK 5KX5B 4RW9A 4X8LA 2J3MA 4J0IA 5CA1A 3LDOA 2H2DA 5AW6A 5TKWA 5SV2A 3L4IA 3OX1A 3UOAB 1E2FA 5LCXA 3ANMA 1P8AA 4P5PA 5KPJA 3DB1A 4UHFA 2JC3A 4NQZA 1OPXA 4P54A 1YH3A 4Y9TA 1HWYA 4EF4A 4NJEA 2NRWA 1YUWA 1DAEA 2RGNA 1KMHB 2EU8A 4PFQA 3MG9A 1GG5A 3R44A 1CJTC 3F2IA 4MGZR 1SCUA 1S8FA 3GT0A 3C24A 3VH1A 1K2VN 1RYNA 4UOQA 2Z5VA 3DOIA 5AXAA 4JGGA 3KWMA 1B23P 2IOHA 4QLOA 1BDHA 4YRFA 5HWSA 3GEDA 3IQXA 1L5KA 1V47A 3HL8A 1Y8AA 5CVDA 4BLPA 4GKJB 2ZYGA 4ISGA 1IOVA 4CIBA 3SHFA 1TI7A 4WJKB 2KW5A 3EPKA 4K88A 2C5AA 3QVSA 1TUBB 4RK4A 1J0XO 1Y42X 4HDMA 4EI8A 2HHHK 2EG9A 3F4LA 4MQLA 4KAXA 3GNSA 3CE9A 4GNIA 4TWJA 1T7PA 1T6XA 2O48X 2WJJA 3MBKA 2JAWA 1FDVA 1KK0A 4BMVA 1BYIA 2WVGA 4EKDA 1SXGA 2E7ZA 3FCEA 4YRAA 4HFMA 2WG0A 3HV0A 5H80A 3USZA 5TSDA 4AMVA 1LW7A 4NYJR 1T5IA 1DEKA 8MHTA 1Z5GA 1FUUA 3OWXA 1L6RA 4XWWA 1GPAA 2REOA 1QOQB 2HF7A 2KKZA 3VQTA 2PKQP 2VQ6A 4GPBA 2D8MA 2WIFA 1YDFA 1OFUA 3OQJA 3GGOA 4OHCA 1EX6A 1E92A 5FHRA 4E94A 1L5MA 1R5JA 3OM8A 1W29A 4P6VF 3VZQA 1N5DA 4L0DA 2WSIA 3HGTA 4PC7A 4FWTA 3TG2A 3TPCA 3VGJA 2E82A 3G2HA 4V39A 2UVDA 3VBCA 5IG2A 1E3WA 5MDHA 4LNHA 2JLAA 4C6SA 2JD0A 4R1MA 5JXHA 4A8PA 1PQYA 3FW1A 1Z2PX 1S1WA 1PFUA 3RVRA 5KINB 1ZM7A 3E1KA 2YHIA 4BRUA 3NEAA 4M9CA 3NR2A 4UBKA 3FLEA 1N4AA 1FW6A 4A03A 3CX8A 2XCTB 2FGKA 1KD1O 1Y34E 3DVLA 3NIFB 4Z8XA 1C1YA 2GTPA 4UTOA 1A2OA 3CZPA 3P9PA 4UQOA 4M1OA 2OFFA 1NM5C 2VJNA 4IH9A 1V8PA 1Q7TA 2BEWB 1XNRB 1NPYA 1P5ZB 3AA5X 4U67L 1PFGA 2E4ZA 3PWTA 1P0MA 4BFLA 2E2QA 3VQDA 4HEHA 4BB9A 1EP9A 2R8XA 3WWEA 4NENA 5TGZA 2BH1A 4DCSA 1JH9A 2Y0DA 3P9CA 2H1LA 2R2GA 3ONWA 1H4QA 3EZ2A 1DCTA 4TX1A 3T3HA 1RRFA 2BISA 5CFOA 2JBAB 3FFTA 1U90A 3ENVA 1WNSA 5HKKD 5M1QA 2HGZA 4RDCA 2C4UA 3V8VA 3VR6H 1F5SA 1ZD8A 4RZHA 1FYFA 3DUFA 1OIWA 3QX9A 3FG9A 4TT3A 5LJIA 1EM8B 4HWIA 1LK0A 3BH6A 4E3WA 1QHXA 4O1MA 4G1FA 2VQFK 4XD2A 5K5EA 1SU8A 2BTFA 2QGFA 4JDPA 3TLKA 1JA9A 4JCOA 3S44A 3KB6A 5LQUA 1L5NA 2PG3A 3UMGA 2YYSA 3N6RA 2ZI5A 3H8SA 4JLWA 4COKA 3ZX0A 1YOVA 4DY4A 4O0JA 3QWHA 1VP9A 2F4NA 2P0EA 4I4LA 2P51A 2AXNA 4K0KK 5JH7A 1OZAA 3M4ZA 1WD5A 2QUIA 3IP8A 3TLAA 2P9ZA 2J5RA 5FWXB 2CV0A 1JI3A 1T6BY 3AW9A 2ADFA 1E0AA 4MPJA 3RFXA 4EQZA 3IUYA 2QN6A 1UIMA 5HP1A 1QCCA 4ZAZA 2WDPA 3LHSA 4W82A 4JNKA 3U2QA 4LOKA 1QHIA 1W5AA 1N5MA 3GLGE 2YASA 2NG1A 3OECA 5DRYA 5FPTA 1LRLA 2E1ZA 3W2HA 2I7VA 4DREA 1KI1A 4EARA 5L40A 1UEJA 3K5WA 3UNXA 3QU2A 4L28A 4E5KA 1A9XB 1XLTA 4HJRA 3CU5A 4RS4A 1PS9A 2HREA 2VF4X 4OK6A 5JPDA 2YVQA 3F9CA 2PUGA 3B78A 4K46A 4MWDA 1WY5A 5F0XA 1NZFA 4DABA 2X0JA 5E3IA 4Z51A 1RXSA 2OOSA 3FFWA 4G1BA 1W88A 4O1IA 4GWGA 2C00A 3OC6A 1KA9H 4HDSB 1H22A 4GIBA 2IU6A 1SVOA 1P3JA 3T94A 4WFIA 5U4XA 3QWIA 2AC2A 3KTAA 3AUXA 4XDZA 3DUWA 1XA3A 1ZS9A 1RXYA 4CHYA 1F48A 4FONA 4W5QA 3VR4H 2BF7A 2H7YA 1VQON 1TU0A 4A61A 1WDTA 2QVLA 4XOIA 5AICA 4ZOEA 3R76A 2JWLA 3EY4A 2ESRA 3C4VA 3V4ZA 3TTDA 5DLDA 1KYWA 3E9ZA 4KJXA 3C1UA 1D1SA 1G5RA 5DXAA 4DCVA 3QBJA 2IYAA 2AJTA 5LQCA 2RONA 2LWIA 2EYUA 1XF1A 4J3JA 1UBUS 3JYTA 1M7BA 4CR7A 3CV3A 5EG5A 3WL3A 4CLXA 3FUXA 4QDZA 5KSWB 4E5DA 4JKCA 3CC2N 3EFEA 1YRBA 2C2MA 5AI4A 4IIYA 1XTZA 2PD3A 4KXQA 4QUEA 1C7EA 4CZ2A 4IEIA 4LBVA 2AW3A 1PKEA 3UKJA 4R5PA 5FV7A 3N2ZB 3Q3CA 5FEUA 1AJEA 3ZLJA 1GA4A 4QE3A 3F5TA 1LOTB 2C98A 2O1WA 3VEOA 2JAUA 3IG1A 1ZUNA 4BRZA 3A37A 4RD0A 4D9KA 4UAVA 1NMNA 1XXHE 3NGZA 3TNJA 5C8ZA 3EMKA 4C7VA 1V1MB 1LEHA 3F9IA 3GJZA 3JSAA 1EFRA 3A1EA 2R6DA 2WJ4A 2FQXA 3FPKA 3LANA 1NG1A 2FN3A 3ULEA 4LZOA 1DBWA 5K3DA 4FT2A 1O8BA 1VECA 2BI7A 1T8TA 1NQWA 1GZ3A 5ELLA 4ZT3A 1CF9A 3WHPA 1B73A 4W1PA 1Z26A 2IH4A 2O2XA 2BT4A 4ZYTA 3DXFA 2O8VA 2VN8A 1P4RA 3MGKA 4EW1A 2BE9A 2PWZA 3OT1B 3LRXA 4HEA6 4TLMB 2ZITA 2C7GA 4XTCS 4BVFA 4A59A 4INAA 2X4IA 3CJTA 4L02A 1BVYF 4ANFA 9MHTA 4ZOBA 2ZS9A 4LXUA 1IRIA 4JOQA 1Z5OA 1Z88A 2D0OA 4QASA 3WFZA 1HTTA 2GR9A 1Z6AA 2ORVA 1X7YA 2XYQA 3M8QA 2LE0A 1RHRA 1U80A 4FWMA 3QMLA 3R74A 3VR6A 1I5RA 3FLBA 2ANBA 4EJMA 4M7PA 3EUEA 3OYNA 5JW6A 4R7TA 1TLFA 4UMVA 1FXXA 1XXLA 3IJEB 3A4VA 1QRRA 3U31A 1ZI6A 2A57A 5JWRA 1DEHA 4ESHA 2D0BA 5ICEA 3T5PA 3IAEA 4MJ3A 4UMEA 4ONEA 1DAFA 1I6KA 4IDAA 4O2RA 4ZEOA 1YVRA 3HCDA 4QS7A 2ZSFA 3X1DA 5AVXA 3Q8MA 1F2TB 4NR0A 1Y6FA 5TNXA 4MGEA 4Z54A 1Y8QA 2VRCA 3AB8A 4DY6A 4DMCA 4KREA 7MHTA 4LZZA 5HIAA 3LYAA 4DR3K 1NK9A 2JNWA 1BCOA 3VYRB 3FSJX 1XYYA 4H03B 2W4QA 5LZ4A 1S96A 4ZOLB 1K97A 4JENA 2A9PA 2VTKA 2XCQA 1YBAA 2YWXA 3CSSA 3BX1A 3A6ZA 3LSTA 4RULA 1YI0A 3DE4X 5CEFA 1XZMA 1IN8A 3STHA 4UAJA 4DTJA 3K59A 1HZZC 4K9PA 4HX5A 4NVRA 1RQNA 1P1BA 3S5UA 3OURA 3PDHA 4O2AF 3MWTA 1OBVA 1A77A 4BB0A 1JHVA 1I2DA 1W48A 2J1LA 2G4LA 3HYTA 4DILA 1DIAA 3FOBA 1SZJG 1VPVA 4FWIB 2OPRA 2QX7A 3GC6A 2CNBA 5FPYA 4QT0A 2BP7A 1KI4A 5DYYA 1NDHA 4Q82A 4E4TA 4F5EA 4PR3A 3LL7A 3AL2A 5IM4A 1Z8DA 4RH3A 3TCXB 4C4AA 3O1LA 4TUYA 1OFVA 2MSEB 4JYAB 1E77A 1IEXA 3TRFA 1O97C 1A1VA 2Y99A 1QK5A 2R00C 1BXRB 3TR5A 4CM4A 2C54A 4JNCA 2ZJ5A 4Y9UA 4JP1A 1KSHA 2IHJA 4KLNA 1W7AA 3VR4A 1VPLA 1RT1A 3F9RA 3BA1A 3BDIA 1BJRE 5CA0B 3COSA 1EX4A 4N41A 4Q0BA 3RAEC 4RD1A 1FDSA 2J3IA 2Y68A 3BXEA 2GEMA 3QMMA 4O0LA 2ZB7A 1GA6A 5JPCA 1E3EA 5E3JA 5EE5B 4QTYA 1TKXA 4BP9A 2J3LA 2QRQA 4R1TA 3AESB 2P1DA 3KB8A 5LZ9A 4TN1A 5DF1A 1CIJA 4MW7A 2QZ4A 3PTLA 1TTPB 1XDBA 2IHYA 4JR2A 4B08A 2HU7A 3TTUA 4ECAA 3IESA 1YIAA 2V74B 1Q17A 2BFMA 1C0EA 4ERNA 4O4JB 1EX7A 2HHHB 1JXOA 1D0VA 1CUDA 5DIFA 2HA6A 3MXTA 4IVPA 4EFHA 4M9QA 2E85A 1RYBA 3FYDA 4OXRA 3F7TA 2YBEA 4D4HA 1GL6A 2DZDA 4CZLA 4IO1A 4AX4A 2YYZA 2NADA 5FBKA 2C7VA 2WJYA 2NU9B 5T64A 5CIWA 4EG5A 3UN1A 4WMLA 1VYVA 4ZREA 4A7PA 1R4NB 4HX9A 2HBYA 4DIDA 4OPJA 2IVPA 5ITZB 2FHPA 2FSPA 4Z53A 4XM1A 4IJ5A 5HZHA 1PR6A 5EIFA 4MHSA 5T5QA 1FX1A 3EGIA 4BV8A 4RGBA 2OZLB 1NBMD 1ATZA 2BHTA 4N0DA 4BGUA 4AJJA 2PO7A 2DSTA 5EP2A 2ZSJA 1T3SA 1ZGBA 4D81A 1A8PA 1XCPA 4C5BA 3IKVA 1DTQA 2PZKA 2J09A 1B3BA 1TD9A 3HUDA 1WNTA 1KQOA 3W6ZA 5K3AA 3WGTA 4FVUA 4HWPA 3WGNA 2GJ9A 4MWGA 4H27A 1TEZA 3P4XA 2WQ6A 4Q48A 5HL7L 3TECE 3UWPA 4R1NA 5JMOA 4O8ZA 2CXSA 2D1FA 3H2ZA 3G8BA 5FBLB 4TSKA 4EPYA 3WGJA 4HLQB 4WLFA 3QPCA 1ZIXA 2P9GA 3BJEA 2WM9B 3NBZC 1IKXA 3BFVA 3LQYA 3SP1A 4CZHA 1JJBA 1HDCA 3W2IA 1ECCA 3EZWA 1U0HC 2Y2VA 2KS6A 1BGXT 3QXJA 3LKBA 1YI2N 3PTZA 4JLSA 5IU6A 2E18A 5FA6A 2XMSA 3MC1A 1NZJA 5H3LA 1JVSA 2JJ1D 4D4MA 3VV2A 3CNBA 2KZMA 1G1AA 2RHWA 5CT9A 3FTQA 2DFKB 1AMNA 2B4JA 1MO3A 4BQFA 1JGTA 3ZKAA 1SELA 1NWCA 2B8NA 1MWKA 3IDSA 5BNZA 3OZEA 3BULA 3MX5A 5IT4A 1C2TA 1GDDA 5CHIA 4KWEA 3HLTA 1O08A 5FBHA 2Q49A 1Z7WA 1KAEA 3SBXA 4E30A 3CGGA 1Y8ZA 1T36B 3OCWA 2BGJA 5C1DA 5GAJA 4QICA 1V4TA 2N46A 4UUQA 2O0LA 1WNFA 4TMZA 3LDSA 3M1IA 1R00A 1BGWA 1Y64A 3K05A 2QV0A 3WVNA 4HB2A 4KVGA 1WQ3A 4KV8A 5HKBA 4PV7A 3C48A 1RDWX 2LP4Y 1VOTA 4J1NA 2HT1A 1XRSB 2VHYA 4FCCA 2VQFB 1LS1A 4Z99A 1E2IA 3W7BA 6REQB 3H1TA 1GUBA 3O3FA 3I42A 4KO0A 3VO1A 4DUYK 2RH5A 4E7KA 4GGPA 2FQ1A 2FPXA 2A1TS 5FIUA 1JHZA 1KNXA 3ZU4A 1XA4A 4KH4A 3TO5A 4KYUA 3VRHA 2VS1A 4M60A 1X42A 4K9OA 2H3EA 5J2TA 2PNFA 1Z5WA 5GJCA 3HSTB 3VKUA 1FBTA 1LK7A 2RK4A 2QE6A 2PFKA 2OMEA 4BE2A 2LR0A 3REQA 4RIFA 4KAFA 1QUEA 1T0HB 2FVYA 4K0KB 3I23A 3L8CA 4N56A 4JA2A 2I67A 3ZK9A 2PSDA 4I50A 2O07A 1W97L 2WVHA 3KQNA 3SZMA 3SUNA 1BHSA 3NHUA 1IONA 5B30A 5L3SB 1J9ZA 4ZVKA 4EK9A 1YRAA 3GU3A 4WOKA 1VJCA 2G9NA 1TL7C 2Q9AA 2CFIA 2HRQA 1Z16A 3OFVA 3FLCO 4CKEA 5BW5A 1E0SA 3COYA 4UD2A 3IAAA 1ZXXA 2WT8A 5B8HA 2JKYA 4IV8A 3I0SA 2IOCA 3UW1A 1KARA 5HZKA 1ZGZA 3L1IA 5YASA 2AEEA 3H5RA 3LNTA 1WV1A 3LPCA 2QTCA 1X9SA 2R7MA 4CJKA 4W6ZA 3GT7A 5FTNA 3JWJA 1PLLA 1XD2B 4OD0A 3CBGA 4FI3C 5HRCA 3CMCO 4J16A 4JBWA 2OV8A 1ML3A 2A4KA 2CJFA 3EIXA 3B1VA 1F1JA 3QH4A 4G4JA 1DBVO 1YHNA 3LUDA 2OCXA 2OBMA 1YC5A 2TMKA 5KC9A 4BREA 4IXWA 5DJ5A 3T1QA 3WNCA 3PKZA 5P8WA 2I5JA 4YPVA 2C31A 4Q3EA 3WB1A 2AVNA 3IDQA 1WSEA 3LIIA 3VUFA 2XXAB 4L2IA 2QUBA 4QAJA 3DEIA 3J80O 4PFJA 2X19A 1L2TA 1XDWA 4HMOA 5K01A 5CLGA 5DT2A 4CMIA 2G40A 2GVDC 4FOPA 3SMSA 1B9DA 4PW0A 2RMKA 4RORA 1MOZA 5DNUA 4WIAA 3ZNPA 1XJQA 2GN8A 1PT7A 2QM3A 3CCRN 3KKPA 2QEXN 5H9VA 1WWKA 1HH4A 3PD0A 421PA 2Y05A 2NT4A 5C12A 3DVSX 1JWLA 4II3A 4WK0B 3E3AA 5EMHA 2YJ6A 3VA3A 5KQDA 3NHLA 2QZ9A 3VNRA 5DHUA 1T91A 3HYNA 2PLNA 1VKOA 1S6PA 1C3VA 4QREA 2NVBA 1USVA 3O3HA 3BK2A 4HR7A 5HS6A 4WUTA 3HHEA 5ALPA 3KLNA 4QPZA 3LKVA 1HYSA 4MQ5A 1ZD2P 3UPUA 2IV3A 3FVVA 3I01M 2QR5A 3D2EA 1HT3A 2R6AA 3VUEA 2B5OA 1W0JA 2V7YA 3HCNA 3FE2A 2X0IA 2J5KA 5JQWA 1JQAA 3SYRA 2BGKA 5CZ1A 5LOVF 4YUZA 2W41A 1K8RA 3F7OA 3FMFA 4WXYB 4D42A 4GP6A 5DGDA 4FW9A 3BFKA 4QHSA 3VZSA 4C4OA 3W2GA 4Y3UA 1JPJA 3ZCMA 1GXSB 1J1ZA 1J2JA 4JUDX 2CBXA 3WYAA 3JRNA 4AN0A 1WABA 1JLCA 4I99A 2PR7A 1JPUA 2HQOA 3COPA 3FCSB 4F38A 5IAOA 1XG5A 3EDYA 3OCXA 3NWJA 4GH5A 2C5GA 3U6FA 3IKJA 1N2ZA 5EXWA 2OC4A 2HJ9A 3CB2A 4E4RA 3DMPA 3RT1A 1ECPA 2V9CA 3AQIA 3TRJA 4ZTZB 3L4KA 1GKYA 4XQCA 3HUTA 4EG3A 4QFMA 4WLVA 3CJRA 1RMTA 2P5SA 1MQSA 4Z5XA 2FWPA 2ZBUA 3BFXA 4E88A 3H18A 2Q0UA 2WD9A 1R0BA 4Z7QB 2YFHA 2ACEA 4L9WA 3LSYA 4ZI5A 1N5YA 4AWXA 4BROA 2COKA 5G02A 2Q2NA 2SNIE 1ZH8A 2ZULA 2C82A 4DJJA 3BCSA 1KTVA 1TV6A 2PUFA 4DLKA 1VBKA 4LF8K 2HRDA 2XTJA 2I2BA 2GD0A 2YDXA 2HJGA 4GYKA 2RH8A 3PI7A 5DTRA 2KLHA 4AHVA 3B13B 4O02B 1D04A 5M04A 3EZYA 2FPGA 1C1BA 3R5FA 1VXOA 1U0SY 4QUAA 4G0YA 3WMFA 4MH0R 3GLTA 2HB5A 1MJFA 1WBDA 1CY8A 2Q0XA 2ZJ3A 2JVKA 3B51X 4U6NA 1L3BA 3EDCA 3IQFA 1JG4A 3FSEA 4DVGA 5G41A 2PXHA 5TMEA 1OJ7A 2IYOA 3LW7A 3T3OA 2A0FA 1G5TA 3FNEA 3RWOA 1DADA 4DR3B 5BRFA 4LVCA 3FBWA 1CETA 4YORA 3MRVA 1HNVA 1T5DX 3J7YP 3V81A 5ARCA 2VQSA 4BGDA 3BMOA 4PNEA 3DOJA 5HKLA 3RRNA 1NC3A 5J47A 1Z33A 1D07A 1ONNA 3JQFA 4U0JA 3LKDA 1XCOA 3TW8B 3IVCA 2XYRA 2WUGA 4HEA1 2CYAA 2D5BA 3M8KA 2QDXA 3IUQA 2WJPA 1EETA 4YT2A 3T15A 1EBFA 3M1YA 1ZJWA 3AM5A 2QG4A 4X64K 1K68A 4PWYA 3SJBA 5IDWA 5HQ3A 4Y2QA 3CO5A 3CE6A 3WNEA 3CZCA 1IKYA 1KSFX 2A3ZA 3K0CC 3ER6A 3Q3VA 3TAEA 1WP4A 3HY3A 4DLLA 3RIGA 1Q2XA 2DPMA 2VT2A 3WL8A 3CRNA 2A9KA 4AZ0B 2DLCX 4ISFA 5J2UB 3NOOA 1T5OA 4TLEA 3P2YA 5ECWA 3T7DA 3ZGYA 4QBHA 3OG9A 4BC5A 1VBFA 5K09A 1WIWA 3VC2A 3R9XB 2Q27A 5FL7D 1UZNA 1G5PA 4PLPA 5BYKA 4UPDA 3I4FA 3SHWA 2LUOA 2G76A 2FLKA 4NS1A 2PUEA 1YS4A 1QLHA 2R44A 3C3XA 1ZJ6A 4DQVA 4NF2A 1HZJA 4JK3A 1SMKA 3PZBA 2NV6A 2YY6A 3V7YA 5CCBA 1EUDB 1DHRA 1J25A 4LRYA 2IXFA 3WYGA 2YZ7A 2UZ3A 4D82A 1CZRA 3E9LA 1MT3A 5KGXA 3EGVA 5JATA 1REQA 1XU4A 4P38A 3D02A 3VPBA 3GJ0A 2YY5A 3BRSA 4NOKA 2YXNA 2CLKB 3EF1A 4L7QA 5IH3A 1QE3A 5AI0A 4F2HA 1L5VA 4LV8B 1LWEA 5DN6D 3NVMB 1Z6TA 5DI3A 2J7PA 1A5SB 2ZIZA 1CZAN 1KTQA 3BQ9A 1JG3A 4WACA 3EULA 3HLKA 5AW1A 4JK8A 3KV3O 4PL8A 4YRZA 1OH8A 3NGIA 4AWAA 1PX2A 1NOIA 2IHZA 4FS8A 1V5EA 5LP6B 1PBTA 1EU1A 2G83A 6NULA 3AIKA 4CIFA 3MJSA 4CPDA 3A0IX 1N92A 4YBZA 3OA0A 5ITVA 3NIWA 1IXYA 5ABPA 4WBNA 2ZJ7A 4TZKA 1X7ZB 1RRCA 3EK2A 2FZWA 3L7BA 4CG0A 1BI4A 1QTIA 2NQ8A 5FTMA 3LVQE 4YOXA 4CLRA 2AK2A 4MO2A 1KO5A 2C84A 3NOQA 3HZ6A 2D0AA 1R0YA 4XYBA 3I1YA 8GPBA 4OSEA 5F76A 3ELUA 3HTVA 3KOXA 4J9UE 1O1WA 5FTKA 2G67A 3ZE6A 2RKWA 1NPDA 3BK7A 3Q6NA 5ETJA 5AK0A 4CODB 1C0KA 3WKAA 1IE3A 1WLSA 4ZU1X 4PKHA 1ZVJA 2PKXA 3VF2A 3UV7A 5A3QA 2FP3A 1MB3A 1QO7A 2XITA 4IG0A 3TLXA 1MX5A 1SHUX 4LD0A 4F92B 3QP9A 4WZBA 2Q8NA 3TSYA 2H7XA 1DKPA 1LI4A 1WXWA 5EYPA 3IMEA 3DEYX 5BQFA 3JQ7B 4FZVA 9LDTA 1VHLA 2XUOA 3V55A 5JZVA 2ID4A 1EO1A 2HJVA 4HMQA 4YCCA 1YZ3A 4E2FA 2H4HA 2DHRA 1W8DA 3W5BA 5SWMA 1EQUA 1Q7CA 4BGVA 1LW2A 4KQ1A 1CUZA 3FBTA 1EE1A 1SKQA 2WLSA 4KC0A 3SM3A 3FI0A 3JYNA 4DC1A 1L5QA 1CKEA 1U9JA 1FUIA 1ZFNA 5E1OA 5DX1A 2AK3A 2VZLA 2IJGX 5CXQA 3TUIC 4DQUA 5TEVA 3OPMA 3DFFA 5JSZA 5KGWA 1G21A 3ON5A 1MJGA 1E79D 2PFSA 3ZJ5A 4X90A 3LV8A 1CZNA 2W7TA 3OM0A 1MUUA 1Y3BE 2XUGA 2BEUA 1MO5A 3KEQA 4GNRA 4B9UA 4MAMA 1YS9A 1TYQB 1BS1A 2KJQA 2VT7A 4ZGWA 2FR0A 3JD4A 3KKZA 4FNAA 2RH4A 1MZVA 1VSFA 1OA0A 1Z13A 3SAHA 1E98A 4DUYB 1I7QB 2QM1A 4ISBA 4BRKA 5IC6A 5TGDA 1MCZA 2OBBA 4E5NA 4QDOA 3PWSA 1GV1A 2WDZA 1AZLA 2QY9A 4A36A 3O38A 5I7HA 2ZYTX 1PZEA 1UBHS 3HCRA 5AQZA 3H4VA 1YI1A 4FWOA 1U7ZA 2H2IA 4ZYYA 3IBSA 2ZJBA 5AK5A 4XH9B 3P4IA 1GN9A 4XH4A 2SICE 1KO4A 1SJ9A 3STWA 4P2GA 1LI7A 2FN8A 1S02A 2IZ1A 3LGXA 4M8KA 4BFZA 1UOQA 4PPYA 5TJHA 4ZDIA 5BMOA 3P5SA 2FEMA 2GS9A 5ELMA 3I3OA 1SXJC 3S1SA 3BA6A 3LYUA 1FS4A 2J4FA 3ST7A 5FX2A 4CBXA 2OAP1 5A2QO 3N58A 3VKHA 3THXB 4XIJA 3NANA 4BZXA 1ZYUA 4N6NA 4OJYA 3X2FA 1LFAA 1P6QA 3AA4A 3VGMA 1C7IA 2C2YA 3PO5A 1P39A 2DFDA 4GPIB 2YCHA 1EWTA 2Q5EA 4N7BA 3TM5A 3TGLA 2AFIE 1RI5A 4QEZA 2AYZA 1UPTA 2PBRA 5ALYA 4FMBB 1LNZA 1W5TA 2C96A 1PBNA 2FCRA 3ESAA 4ZCPA 1JMVA 2WNIA 4F2PA 3CETA 4GP7A 1DBIA 4L7VA 4AF6A 4JOCA 1DDGA 1HG1A 4OV6B 1MDFA 1U0FA 4YV7A 2BMAA 3GDHA 2H11A 3OJUA 5DN9A 3CN7A 4IXCA 3QRWA 5C37A 3M7IA 1LDMA 3NP7A 5F9FA 1ORVA 2VK4A 1YDHA 2YV3A 3PQ6A 2Z3ZA 3BE6A 4K40A 3IH5A 1AF7A 4PM4A 2PMKA 1P31A 1NXTA 1D2GA 4H1TA 1DS6A 4CJ3A 4IMJB 2EZUA 1J56A 5KYKA 2ZI3A 1E69A 3RC7A 2D6FA 2DHQA 3WIOA 3WYBA 3N87A 3ZGZA 1AG9A 2I1LA 1V2GA 1XZQA 4YJ3B 3TE6A 1BMFA 2VJYA 4I4NA 1NP7A 2W2LA 4CMAA 4AJ4A 3TPFA 2FRDC 2XE4A 4ER3A 5K99A 1LRKA 1KDYA 4KQIA 3UKOA 3DL7A 4BNWA 4GSLA 1MDUB 1NATA 2WSLA 2VDUE 2WVAA 5B2ZA 4WESB 1OFUX 1HKGA 3IAS6 2HI0A 3WZ2A 121PA 4BBZA 1GTRA 4CEEA 4BAZA 4BVGA 5C51B 3TSUA 1COWD 4E03A 4CIEA 5HZGA 4OQNA 2KX7A 5BREA 4RZ3A 5AK3A 1GWNA 2PZEA 3PO4A 3PHGA 4IGEA 2Y0CA 3H6GA 4U00A 3INNA 5FNVB 1BFDA 1YA4A 2D2IA 5F7ZA 4JEPA 1YJAA 5HS4A 3QU9A 1KFDA 3D8BA 2WJZB 3E7FA 3T7KA 3L82B 1FVHA 1JLSA 3RYHA 1ZWLA 2VJLA 2ZYSA 1RI1A 2X2OA 4UAUA 2H48A 2QTGA 2ZR7A 4GZ3A 4G26A 3HYRA 1JA0A 4P7BA 1LPOA 2RGUA 5EJ2A 5ILQA 3KKSA 2UDPA 1X7WB 1HYQA 4OHFA 2BBTA 4B4UA 1H2YA 1UQUA 2O2CA 1NT4A 4BO7A 1R6TA 1M2WA 2NNWB 2OGWA 1P2BA 4UXJA 4FDAA 3I0MA 1NBME 3WJ2A 2JIZD 2Z3WA 1NUHA 5EIWA 1RMYA 4KR7A 5AKLA 4JR0A 3O21A 3HC7A 3SKYA 1WZUA 3EZ7A 4BX2A 3V1NA 2BFWA 1BCMA 1M76A 3K0AA 4R01A 1JIXA 3MCAB 4YCJA 4V0ME 5I3UA 3D3NA 1W2BM 1J20A 1U7PA 2DR3A 1DTSA 5HM6A 4AY4A 2W8BA 3TNYA 1KC8O 4G65A 1U0EA 2W6ID 5IMBA 4DUZK 1J0EA 5LYJB 1RKXA 3CCLN 3QUSA 4RCVA 4NU0A 1E2PA 4FR2A 1ITGA 3D6NB 5B6IA 4KITB 3KJXA 2FWIA 5GOZA 2IOFA 2ECOA 3OYJA 4LF8B 1EI9A 3UV6A 1J0BA 2WAOA 4PZLA 4MEJA 3RTAA 2AG6A 2Q3FA 3KUKA 3V7WA 4GVXA 1OLXB 2AX3A 4AULA 4M0PA 5JLFA 3QNUA 3CVXA 3I4LA 3CLSD 3F6RA 2UUCK 1Q9XA 4RIGA 4QRHA 4D0GA 1P1FA 2QYTA 5E0OA 3HJGA 3DD1A 3HEMA 4H3SA 4JC4A 3RPEA 2GUIA 4E89A 5IC5A 1OVMA 2BZSA 1R8SA 1CX9B 3V9XA 2FKAA 2YRFA 3LCMA 3GBTA 3K70B 2FZGA 3NNSA 2D1TA 5BSHA 1HSZA 1TCUA 4KQWA 1QQNA 3L2UA 3SR3A 1Y8RA 5F3WB 4I3HA 3AETB 4DAEA 3IS3A 4MDBA 1E6EA 1MENA 2RE8A 3TM4A 3OD5A 4DMKA 2P9IA 5KYNA 3UMSA 5C18A 1WR8A 1YBMA 5FV4A 4F93B 1P1JA 1HO3A 1L4GA 2DECA 1QRDA 1X8KA 4UHHA 4KX5A 4OHYA 4BN5A 3MEQA 4JQSA 3NH2A 3T5AA 2GPWA 1D6MA 4X95A 3UFBA 2Y4OA 4XGRA 3RVKA 3OZXA 1IB0A 2O20A 4EQ6B 2FEKA 2NAPA 3LQQA 4X64B 3DFKA 4O63O 3N75A 4L6CA 3DMTC 4J7UA 4G1QA 2OM2A 1VSUA 3ZIUA 1UM9B 3A1WA 4HHEA 1XYVA 3LD9A 2GYYA 3MGAA 4GF5A 2QRUA 3T7JA 2FZEA 1ADFA 2RHDA 3M1FA 3WIBA 1Y5RA 1V4NA 4UUMA 4EHFA 2J6IA 4FZ3A 1U02A 2IYXA 1O58A 4ZV4A 2X5JO 1JLLA 1RU3A 3OQBA 1LBQA 2VF8A 1HA3A 1HPMA 4J0EA 2P91A 4FHCA 3DP7A 4RAOA 2TMYA 5BR9A 2OXFA 5CUQA 1JQKA 1YR8A 4GL2A 5M29A 4L8VA 3G5AA 4KOEC 1NNLA 5FUWA 1DCMA 4B40A 1IBLK 3PA8A 2XB2A 3M6GA 3DXMB 3OTOK 4F12A 4PE5B 4OMUA 5G0TA 3U19A 5KSPA 2IDJA 3JCZA 1DO2A 3N2GB 2VXOA 2WZQA 2HCTA 3KD2A 3MM4A 4WXHA 2SBTA 1XTUA 1AXEA 5JYEA 1E8DA 3D59A 5GONA 5FADA 4NFHA 4NYNA 1D2CA 1MV5A 4DTIA 3TABA 3IJPA 2ABWA 4GY2B 2OK8A 1QU3A 1TC2A 3UK0A 4M42A 4KAJA 4XYMA 3G10A 1D4ZA 2IH2A 1NVUQ 2DWQA 3JWHA 2ZYVX 1W5FA 1KJNA 3U4QB 5AZJA 2ZU6A 2H1SA 1OVQA 4AD8A 5CDHA 2FRXA 1I7SB 4A0SA 4QUDA 4G5HA 3Q87B 5IX8A 1NN0A 4CL0A 3SS8A 5M5BA 1O77A