1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN AF1318
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
1ASVA 1FKOA 3LUFA 4E7LA 4B09A 3VQCA 4Z4EA 3LUDA 3SQNA 4CJWA 1M5UA 1RTHA 3AA5X 1RDBA 1MAVA 1URPA 3JVDA 3NH1A 3V9ZA 1C1AA 4CE9A 3PO5A 3KLNA 2P51A 2QSJA 1MVOA 4CF1A 1DBPA 4D6XA 5D2CA 4F4KA 3SJJA 1K66A 4BDZA 2IS3A 2HSGA 2DRIA 3OYNA 1IIBA 3I45A 3LUGA 4CF0A 3OS0A 2O4IA 4FJHA 4N47A 1W9HA 4JASB 4EYQA 4RKRA 1ITGA 2VWJA 1RDCA 3NH2A 2FW0A 3FMVA 3TX6A 3M8QA 3B6OA 2HQBA 3M6MD 3S99A 5DTEA 4CJLA 3E61A 3ZT1A 2BE2A 5KQMA 1WSJA 3C3MA 3PUFA 3KK2A 3RTVA 3O4QA 3CG7A 1USIA 2PE5A 4DTJA 1RT2A 1D2AA 3CG4A 2WOMA 4DTNA 4CGDA 3O3HA 3UK0A 5C5CA 4E89A 1RILA 1QNLA 1QO0D 3IP7A 1KCFA 3LAKA 3OS1A 3KLOA 2Q3SA 4CFDA 3H5VA 3V6DA 3HSTB 2ID7A 1XHZA 3L2QA 3QERA 3O1JC 1EXQA 2QV0A 3VQPA 2HHSA 4FLTA 4CESA 3KS9A 4KQ9A 1FQWA 4B9NA 3ZSOA 4PYRA 2YNGA 3IS9A 4YFUA 4ZYLA 2E4LA 1A5VA 3H5IA 2XDYA 2ZE2A 2OPPA 3LPUA 4IRXA 3TMYA 4CEBA 1NK6A 2D5RA 3CZCA 3V9WA 5HRSA 4DS5A 3TR8A 2Q5CA 3QNNA 1XC9A 1ZBLA 3GRCA 2RJOA 4Q6WA 3T38A 2JRLA 1TKDA 3PY8A 1GLGA 1YS7A 1QE1A 2H3HA 4WXMA 4CEDA 2P1JA 3JVIA 5TPWA 1JYEA 4KI4A 2LPMA 4JRPA 2KZZA 4O0IA 4GPAA 3QINA 4CJVA 1BA2A 1GOBA 3OYMA 4MR8B 3KTQA 2IDMA 3QLTA 1ZVVA 1RPJA 3A10A 3KG2A 4OTZA 3SQ0A 4JB2A 4D6YA 1DTTA 1CXQA 3LAMA 4BE2A 2QK9A 1RBRA 4KZKA 1PEAA 4N41A 3AVFA 1FK9A 1P8AA 4FCYA 5SWMA 7ABPA 2IDOA 3VNBA 2MSWA 5FRNA 3RWUA 1YK0A 5J2QA 4OKKA 4DTUA 1OXBB 1HJRA 2X74A 1RCHA 4RK5A 1UWBA 2H0AA 4LD0A 2FXIA 3H5WA 3IRXA 2G8VA 2WB4A 3CFYA 3S3NA 4KHSA 5C24A 3QLVC 4C8NA 5CZ1A 4RW9A 1XHEA 2Z1GA 1K6YA 1Q8IA 1W0HA 1NATA 3ZCMA 2OENG 1S1XA 4AHTA 4MQEB 5KC9A 4KVFA 4YLEA 3MEEA 4FJ5A 2HVIA 3VQ5A 2HQRA 4ELUA 4CK3A 4Z4CA 2OYQA 1EWKA 5HP1A 2LIVA 5KTQA 4ML3A 2WY2D 1TL1A 3KLIA 4LZLA 1Z16A 3IP5A 4NYFA 4E1MA 3K5OA 5D3GA 1ZY2A 1J5OA 5EWLB 3L2RA 2RKIA 4AHVA 1U04A 3OYDA 1ZBHA 2PUDA 3SNNA 1GUDA 4CEAA 4J2DA 3N0WA 1KFSA 4TSXA 4RK7A 1CZBA 3DLEA 4FJ9A 1LJLA 1CYEA 1BDJA 4WZZA 3C6TA 3HPGA 2VUIB 4CECA 3QK7A 4DG1A 2RDMA 4EP5A 2FBYA 2JGUA 3RVKA 2Y1IA 1ISSA 1ZAYA 4J2AA 3NFAA 3DLRA 3CQ8A 3HV2A 3EGCA 4F12A 3QLVA 5HRNA 1B00A 4FLXA 1RXIA 3HSYA 4PY5A 3AVBA 3OYJA 1BVHA 3H08A 1NOYA 1ZH2A 2PUCA 4RK6A 2VG6A 2GKGA 2GV9A 3VQAA 4JS5A 3OYAA 4XASA 6ABPA 3HXMA 3CNBA 3SY8A 3ZSYA 3H1GA 5TQ0A 2IPMA 1T8EA 4KTZA 2XY7A 4DN6A 1L3SA 3TABA 4FLVA 5FRMA 3RVNA 2RPIA 4HUGA 4MLCA 4MR7B 3HZHA 3CHYA 3VQ6A 1KVBA 1JL1A 4B9UA 2BDPA 1R0AA 4LDZA 4WWHA 1ZESA 2NUBA 3S9HA 3AVCA 3O1HB 2DFFA 4B8AB 3KYIB 3SG0A 2RF2A 4FJNA 2HHTA 3NF6A 1BGXT 3T8YA 2O4GA 3MXIA 4MQ3A 4FW2A 3NH0A 5ABPA 3G1WA 1TV6A 4QYWA 3BRQA 1U47A 4DLGA 2W42A 2MSLA 2MSKA 4CCHA 4KREA 5DCLA 2E4ZA 4MQFB 3BBLA 3LALA 2ITGA 5IUNC 3RVMA 3V9XA 4KMRA 3O3GA 2B6AA 4HNSA 3CM6A 4NV3A 3RR8A 2L18A 1XWLA 4O0JA 2CHFA 2FBXA 4RY8A 1ZH4A 3OQMA 4CJ5A 4M45A 4FK4A 1ZDMA 2E4WA 4Y1DA 1WSHA 4PUOA 1CLQA 4DQQA 1VKRA 1MIHA 1BISA 3JS5A 4W5TA 4CEOA 4OVLA 4XFKA 4MS3A 2IAJA 1S8NA 5CNMA 1L3VA 4TLMB 4HUEA 4PWDA 2R25B 1NK5A 3C3KA 4JB0A 2Y1JA 2B4AA 3RRGA 3AO5A 3VQBA 1T7PA 2FBTA 4N56A 4LSLA 2F8TA 2FEWB 3WNEA 1WAJA 5HBMA 2E4YA 5I42A 3HPOA 1TK8A 1BI4B 1LWCA 2L17A 3O2QB 3E3MA 3N53A 4AILC 4RZSA 1GOAA 2IPAB 4RW7A 1BIZA 3O4NA 5FROA 4FE4A 3B6PA 1U45A 5HROA 1EAYA 1C1CA 4KB1A 1RBSA 2X78A 4FM1A 2ETJA 4KAZA 3ZSQA 4D74A 3CYMA 4B9MA 3OJUA 4BWMA 3AO3A 1WSGA 5CYQA 1P6QA 1WSEA 4BE0A 3MAQA 3OVNA 4DMNA 1WLJA 3VQQA 3KJXA 1ZBUA 4M3XA 1D8YA 3DGEC 1F21A 2YNIA 2E6LA 5FWXB 1DG9A 8ABPA 3WNHA 1HQEA 2YNHA 2FMFA 4DQPA 2A9QA 4DU1A 4I2PA 4M3TA 1NXWA 5J2PA 5CZ2A 1KGSA 2WONA 4YCSA 3A0UA 3OYHA 2KYRA 4DFMA 3QEIA 4CJEA 4DQIA 1M2FA 2OZSA 4IFVA 1KLMA 1U4BA 4CGGA 3Q7TA 3AA3A 1VSFA 2FN8A 4HNRA 1JX6A 3MQ4A 4DQSA 1NKEA 3OYIA 1IKVA 3OYBA 3JSMA 1DCKA 4C8MA 3FFWA 3N0XA 3DLBA 5GQSA 4CF9A 2ZD1A 3VQEA 4FJ7A 3CFPA 4O5BA 3TWHA 3N8IA 4RXMA 3G85A 2GBZA 2QXYA 4LDAA 2CD7A 5GOTA 4YWHA 1GCGA 2DTUA 4G0ZA 3GWGA 4DTRA 3I5AA 3V4IA 3OLZA 1JLCA 4FJGA 3M9XA 1LJUA 5HQJA 4CHNA 3LP1A 4L8RB 4CGFA 1HMVA 2FKAA 3M8SA 5T3YA 1X9MA 4C8OA 1TMYA 3R0JA 1ZBFA 1YIOA 3QLUC 1EWTA 1XI1A 3HEBA 4AHUA 4ZPJA 3H75A 3G0ZA 5TQ2A 1S1WA 1D1QA 3PV8A 1JLQA 3KKEA 5DK5A 3L3VA 2G8UA 2JLEA 4Y9TA 4DU3A 1P2FA 1R8JA 1RT6A 2IC3A 1RZRA 4DF4A 4NYNA 1HPZA 1TM2A 4O5AA 4WE1A 3OS2A 1HRHA 4EP4A 3MM4A 3M9WA 3HVTA 1USGA 4KKOA 3HCWA 4O44A 1L3UA 1JLAA 3CFRA 1ISRA 4F11A 2XRIA 4CIFA 4YNQA 2OPSA 1MB0A 2LSNA 3KIOA 4DTMA 4ETIA 3Q9SA 3QLHA 1RXEA 3O75A 5HRRA 4DSIA 2PUGA 2HHQA 2NT4A 3HP6A 4XAQA 3K5MA 2G8HA 1UDRA 2IGIA 1T03A 1APBA 3SZ2A 4H4MA 4DFJA 4DSFA 5BR1A 1ZGGA 3RQIA 4QCLA 1SL1A 3QLUA 5JNTA 2PLNA 4LE1A 2LUOA 1TGOA 3HT3A 5KGXA 4FZYA 4M3UA 2E6MA 4KB0A 3GBPA 4RK0A 1F51E 4CFBA 3AVLA 3DMJA 1W25A 2KW4A 2G8IA 4W5QA 3TAPA 3HUUA 3F6PA 4H60A 5J1EA 4CJ3A 3OM0A 4MS4B 4YS6A 5IUJC 1LV5A 3NF9A 1NXTA 3FFXA 4KTQA 3GYBA 1TVMA 2PZSA 2O20A 1I39A 4WUTA 4LX8A 3SPYA 4JS4A 1LW2A 3SYZA 1BCMA 3QESA 2KFNA 3SPZA 4IMIB 4OKJA 2ID9A 4H8KA 3VQ7A 1RT5A 4HUFA 2AJQA 1KVCA 4FLYA 4RY0A 4N76A 5BRAA 3UUGA 3BGRA 1UAXA 2L19A 4MR9A 3QX8A 1LWEA 4FLWA 5IEBA 3NHGA 3LPTA 3SI6A 4KTWA 3H5LA 1VK0A 3NGYA 4MR7A 4Q5VA 4M88A 4RS3A 2TMYA 1DTQA 3QEMB 1DC8A 1SXIA 2PUEA 3TAFA 3F73A 5EWJB 4DSKA 1NK9A 1S6PA 5C25A 2JVJA 4FXDA 1I3CA 2FQWA 4FVMA 4LSNA 5CNKA 3SQ2A 3OYEA 1FFSA 3GA5A 3KK3A 3RMDA 1SD5A 3K9CA 4FJ8A 1JLGA 3PX0A 2D0BA 3OO0A 1G15A 4RY9A 4B9VA 2P4UA 4I2QA 1NJZA 1JL3A 3SAJA 3PX4A 4ELVA 1J53A 5C5EA 4NCGA 1B9DA 3SCXA 1M2EA 5JNVA 4EYGA 1N5YA 4ZMRA 2RGYA 1EFAA 1NJWA 1L5YA 3QX9A 2R47A 5HSGA 4HCBA 5HM6A 5KQLA 2Z1IA 5CY4A 3K5NA 4HNQA 1J54A 1QP7A 1EX4A 3D02A 3LUCA 4KNYA 3KD5E 1NKBA 4FJJA 4YR7A 1ZBIA 3C6QA 3QELB 4DWIA 1JYFA 1DLOA 4E7OA 1ZGZA 4AHSA 1U49A 2E4UA 5HRPA 1JLKA 5ED4A 4XARA 4FZXC 1BQMA 4RV5A 3LP2A 2XHBA 3RVQA 3V9UA 4MFBA 3QEKA 1WAFA 4IG3A 2HNZA 5E41A 3TAGA 3QIPA 4EZ9A 2DFHA 3V9SA 4GNRA 3C3WA 3AO4A 4RSMA 2G8FA 4PEVA 1NK7A 4C8LA 1KMIY 3LMKA 1KRWA 4FK0A 3TB6A 2XY8A 1D1PA 4Y1CA 3TAMA 4JP1A 4DF8A 4TN5A 2HHXA 4FE7A 2KZMA 1PHRA 2FN9A 4OJRA 4MGEA 4DTPA 4IFYA 2IPNA 1REVA 4KV7A 5EWMA 3KHTA 1CEYA 4Z4IA 3H5OA 1JLFA 2YV0X 3VNAA 4M3WA 4MPTA 3FDFA 3VQ8A 1U8TA 2ZWMA 3OYLA 5TQJA 3K2PA 2JBAB 6CHYA 3ZSZA 4KHNA 1VSDA 1IH7A 4RXUA 3KD1E 3AVKA 2BANA 4FK2A 1VSHA 3DRPA 4UHJA 1QQBA 3CM5A 3HM9A 3HL8A 4FJMA 3HDGA 3ALYA 3L2VA 3P83D 1KFDA 4MRMA 3EJWA 2EX3A 3CFOA 3QEWA 3TAQA 1RNLA 4OBBA 3OYFA 1L5UA 3V1QA 3CKMA 1JHZA 3TAEA 3N0RA 3S3OA 2G8KA 1Z12A 3P5JA 1DC7A 4OKEA 1YMVA 1S5JA 2F8SA 2IKSA 1GUBA 1EKEA 3UKJA 3BDPA 1U0SY 4H4OA 3LTEA 3LUJA 1SKSA 1BCOA 1RT7A 4JRQA 2WRZA 1TAQA 3LUAA 3MYYA 4CGJA 1U48A 1SRRA 4CF2A 3H6GA 3L8BA 1C0MA 2PMCA 1RNHA 2P5GA 3EDCA 3RMCA 1DP4A 3NHMA 3RVRA 1OXKB 2MYNA 2RJNA 4G1QA 3AV9A 4NCAA 3DM2A 3CU5A 3L6UA 3DYAA 1CZ9A 4J2EA 3JPWA 3MIZA 3OLWA 4BE1A 3EYZA 4CJQA 3E01A 1U2PA 4CGHA 3LWMA 2NZVG 3A2FA 4JAVC 2HNYA 4M42A 3RH0A 1WSIA 3TANA 3QETA 4R5PA 2JVIA 1DZ3A 1HYSA 3NF7A 2PKXA 2EHGA 1VRVA 5KRSA 4EY3A 4E7HA 1GCAA 3V81A 3TD9A 1Z18A 1ZYQA 5FWYA 2OQRA 1ABEA 5KQPA 3LP0A 1SV5A 3I8DA 2GUIA 3EY1A 4LE2A 1MU2A 4DQDA 4Z99A 3AA2A 4G0YA 4CJ4A 3C95A 1J9AA 1SL2A 1SXGA 4CHPA 3MF4A 1CHNA 1A5XA 4N5SA 3LUKA 4YRZA 4C8KA 3TARA 1HEYA 3AVJA 3GV0A 2R48A 3MEGA 2FSPA 2HB5A 2CWDA 4LRQA 3D0PA 3DI6A 2HHUA 2QKKA 1VLZA 2NZUG 1A2OA 1JLBA 4G0PA 1SUQA 4I7FA 3OJSA 1Q9XA 3MA0A 5KI6A 1QS4A 2FLKA 4CK2A 1XHXA 4DS4A 1NXXA 1PEYA 3HO1A 1KTQA 3MEDA 2YNFA 4FB4A 1X9SA 3ULDA 3MECA 1VSMA 5JS2A 4MS4A 1USKA 3L3UA 3DOLA 1S6QA 4RW8A 4CGIA 3NE6A 4HHTA 2YHBA 1YK1A 4FJIA 4F2SA 5DGCA 1WN7A 3FFIA 1P6UA 9ABPA 3RVSA 1LWFA 4BACA 2E4XA 1F4VA 2I5JA 4MLDA 1TK0A 4DTXA 1VSKA 1Y1LA 1NXVA 3C97A 4I9LA 3EAFA 3I09A 3EQZA 3LANA 1BL3A 3JTEA 4L85A 3THVA 4KQCA 3NBMA 3I0RA 1QP4A 4Z9AA 4P1ZA 4XIUA 1QKKA 3JY6A 3VA3A 1NKCA 1IO2A 3HP9A 3NNDA 3WNFA 1EP4A 3U3YA 5IUKC 5FBHA 1TK5A 3LZIA 4QICA 5EWJA 3Q7SA 1DJMA 3IPCA 2LP4Y 1TAUA 4W5RA 2OZMA 1T34A 3LFTA 4O1IA 3VN5A 4F3TA 5JS1A 1FFWA 2MYPA 1RZRD 4JOQA 4GMJB 4CEZA 4ZJPA 2G8WA 4KFBA 5TPZA 1O1WA 4TLLB 3G10A 1JL2A 3IAYA 1QTMA 1UA1A 3NHZA 4CK1A 2X6SA 2HW3A 2IYNA 2ATQA 2A1RA 3JPYA 3O2SB 4MR8A 2QZJA 4PA1A 1KRPA 2OPQA 4YGXB 4DU4A 3PX6A 1QQCA 4CJSA 2N9UA 5TQ0B 3SM9A 2AYXA 5I4CA 4B9TA 3RVPA 4PE5B 3IPAA 1JFSA 1IKWA 1NOZA 5FBKA 3CRNA 3KJVA 1NXOA 2PUAA 4EZ6A 4OATA 4KRFA 3DRRA 1C0EA 4KI6A 1JWLA 4EYKA 2VG7A 5B3JC 1Z26A 2QVGA 1LK0A 3LKBA 1Z2DA 5BQ3A 1D5AA 1YMUA 1Q9YA 3H6HA 2BGGA 1WSFA 2OPRA 3T19A 2FQYA 3AVMA 1E6MA 3VQ9A 4J2BA 1LAWA 3B2NA 4YO7A 4WXEA 3RRHA 4RDCA 1FSPA 3V1OA 3TI0A 2QXFA 4S04A 2R7YA 3O3FA 1PNTA 3LDSA 4MQEA 4F06A 4Q0BA 1JFVA 1JH9A 5PNTA 2E4VA 1BIUA 1JDNA 2PL1A 3A0RB 2PUFA 3T3FA 3MXJA 1D4ZA 3QEXA 1Z25A 2FTKE 1SKWA 1TLFA 1Y97A 5DMRA 3HUTA 3VA0A 2FQXA 3TO5A 4IG0A 3EZ5A 4FLZA 4LE0A 5J2MA 2JBAA 2B4JA 3IDOA 3KYJB 1DRJA 3KSMA 1YT3A 3KLGA 4IMJB 4IF4A 5EWLA 3NBPA 5CYMA 4KHWA 1E2BA 3T1AA 1YTAA 4CHYA 4EYOA 3ROTA 2GWRA 3QO9A 4CF8A 4O4GA 3DLHA 3MMNA 3QIOA 4JLHA 4Z0UA 1JLEA 2I6FA 4CIGA 1IKYA 2FEPA 5B3JA 2PYLA 1QSSA 4F8RA 3AVNA 4MS3B 4G0MA 4FYDA 2NT3A 4Z4HA 4TMYA 2PAFA 3M8RA 1DBQA 1GOCA 4ID5A 3NNSA 1NXSA 4HVJA 3OY9A 4QOZB 3IG1A 4ZHRA 3GBVA 5CNIA 3PO4A 4K8ZA 4E0DA 4E1NA 3SNKA 4LY7A 3RR7A 3EQ2A 3ISNC 3S3MA 1BHLA 3HYFA 4MYRA 1RBTA 5K14A 1B9FA 4CEQA 3O2JA 4CJKA 3L2WA 2M1ZA 3K57A 1WETA 4OG2A 3LZJA 1QMPA 1D9DA 3NAEA 3F6CA 1DCMA 4OGEA 4IDKA 3CS3A 3KTOA 4DADA 3BREA 3NF8A 3QNOA 4DLEA 2QR3A 3EODA 2LBPA 2PYJA 4MS1B 1JF8A 4P98A 2B1JA 4M41A 4DTSA 3H1EA 3DBIA 3KLFA 4F2RA 3O21A 3K59A 4G0QA 2ZAYA 1IKXA 2P9HA 4CFAA 4K8XA 4QAGA 1L5ZA 3DRSA 4L4UA 2OA8A 3I42A 5DKFA 3DZDA 1A04A 1S1VA 4ZMSA 5E3JA 2GI4A 2MYTA 3AVGA 3SUPA 4CFCA 3MXMA 3OLXA 3HPHA 4RW4A 4PICA 1UOCA 4FJXA 1L3TA 5TE9A 3L2UA 2JB9A 4KO0A 1PNRA 3ITHA 3ZT0A 4YV7A 3LUHA 3ZT2A 3BRSA 3N75A 4CJPA 2DY4A 4UHKA 3KLEA 4MQFA 3RMBA 4CHOA 3WNGA 1TJYA 1QP0A 5SZTA 2F96A 2FLWA 1UA0A 5KRTA 3ZSWA 4RXTA 1IG9A 1C6VA 2PJUA 2KQ2A 1QO0A 1EETA 1AB5A 2J48A 2JCGA 4CHQA 3IP9A 3NCIA 1CXUA 1RBUA 3AA4A 3AVIA 4N03A 1U2QA 4ELTA 3Q7RA 4O1HA 1VSIA 3EULA 3K4HA 1Z2EA 2P5OA 3L49A 1MB3A 5JNRA 3HJFA 5TQ2B 4MAAA 5JNUA 1VSLA 5EU7A 2XY6A 3RVJA 5IEJA 4NQRA 1BI4A 1RT1A 1TVRA 4Q6BA 5DLEA 1C0UA 1RT4A 2CHEA 2MYUA 3ZSXA 2QW1A 4FM0A 1FKPA 4QYMA 1DRKA 2QVCA 4DFKA 3ILYA 1A5WA 4EVQA 3DLGA 4KHUA 2QU7A 4E19A 4FM2A 3NNNA 2IOCA 4EUKA 2HNDA 4S05A 4HYEA 1KVAA 2GX6A 5CHYA 3NDKA 3CZ5A 2PUBA 1KRXA 5FWXA 1BDIA 4RG8A 3BILA 1BAPA 4RW6A 1RBVA 4DQRA 4CEEA 1NJXA 1I3AA 3NGZA 4CEFA 4OLBA 4CJFA 1X9WA 1ZITA 2Z1JA 1QSYA 1C4WA 4H3KB 1S1UA 1VPWA 4CJUA 2WMYA 4DSLA 4CJTA 1T05A 1DBWA 3N6VA 4E7KA 1PUXA 2L2QA 4NICA 4KK4A 4O55A 2A9OA 3C6UA 2JVKA 2V0NA 3OMWA 1JFTA 1YTUA 1NXPA 5FDLA 3DLKA 3ILHA 4YP9A 1KSPA 2HHVA 1RTIA 4UQGA 1QPZA 4DSJA 3A3KA 5IULC 1Z15A 5HLFA 3ZSRA 3OQOA 1VRUA 3ZT4A 4IGAA 1DCFA 1AB6A 3C94A 4WT7A 4Q7EA 5IX8A 1JKHA 4Z9BA 3P1GA 4EVRA 1RDAA 4CHZA 1JDPA 5KGWA 3T6KA 3ZT3A 1S9EA 2X6NA 3IP6A 4AHCA 4IILA 4B9SA 4DTOA 4MR9B 2Z1HA 3CLKA 1EHCA 4LH4A 5JNSA 2YHAA 2XY5A 4HTUA 3T95A 3NGIA 3O1IC 3KK1A 4BDYA 4IKFA 2M98A 2HJ9A 3HK2A 4ZTFA 4ETNA 1C0TA 3KKSA 2A1SA 1YVUA 3HS3A 3D8UA 4QPJC 1RTDA 2FBVA 1YS6A 4NCBA 1ASWA 4E3SA 3W9SA 2WJAA 4IBNA 3LOPA 1J56A 5BRJA 2D0CA 1JBEA 2HHWA 2R4QA 4N0PA 3V1RA 4OPJA 4CIEA 4ID1A 4FJLA 4G0OA 3SUQA 4F3OA 2HPHA 4CJRA 2HVHA 1D5WA 4ETMA 1H9CA 1HNIA 4OPKA 2PY5A 2JK1A 1ZN2A 1JXEA 5TPWB 3ASMA 1TKXA 1TL3A 1NJYA 3AVHA 4Z4FA 1E6KA 2YKMA 3HDVA 4RKQA 4JA2A 1C1BA 4AH9A 4E7JA 4ZTJA 4FLUA 4RWEA 4HCCA 4G86A 4XLTA 3VQDA 3K5LA 2FC0A 4OLAA 3DOKA 4RU1A 2FMHA 4KK3A 2B5JA 1NK4A 5J2NA 2XO7A 4XXHA 1HNVA 5JNWA 4W5OA 2FMIA 3Q41A 1BQNA 2D0AA 1JXBA 4RK1A 3OYCA 1HYVA 1RTJA 2A9RA 3LKVA 2HMIA 1HYZA 4GVMA 1RDDA 1KLNA 1VSEA 5TPZD 3GL9A 1TKTA 3SUNA 2X7XA 3FFTA 2AYZA 4EGSA 1D9FA 4B3OA 5EWMB 4KFCA 2FEKA 1RT3A 2VK2A 4RK4A 5F64A 3AO1A 3QEVA 1SL0A 4G97A 1BDHA 3F9KA 1Z17A 1QSLA 5T7BA 4W5NA 3F7NA 3OYGA 1S1TA 4M3YA 1QQAA 1TKZA 2FVYA 1SXHA 3AO2A 3O74A 3OLVA 4LH5A 4MS1A 1Z13A 3QEPA 2DFEA 3QEMA 4H3HB 2VUHB 1NK8A 1N6QA 3RMAA 1QHTA 2WWVD 5KQGA 1ASUA 3JYTA 5CNJA 1NTRA 4I9QA 4FZZA 4EVSA 2FMKA 2PL9A 2VG5A 1NK0A 4MRMB 1LW0A 3I0SA 3ROFA 3K58A 2WJWA 1A0OA 2VYCA 3OO1A 5I3UA 4ICLA 3OLYA 1K68A 3H1FA 3M8PA 3OMXA 3URMA 5KWSA 1XHFA 3U3GA 4Z0NA 3CG0A 3SQ1A 1FXXA 2IOYA 1XWWA 1WNSA 4BDPA 1SKRA 4B9LA 4N0QA 4FJKA 1VSJA 1S9GA 4GW6A 4CERA 2ZQBA 4F8JA 1B92A 3Q15C 3RVOA 4KV8A 5HKOA 4M3ZA 3D45A 1FFGA 1ZHHA 5KC8A 3U6FA 1X1PA 1VRTA 2KTQA 2QKBA 2IPLA 3KCNA 3QELA 3AVAA 3VQ4A 3GT7A 4KPYA 4KHQA 4KHYA 4B8CA 1LBHA 2A9PA 4DSEA 3OYKA 3FGZA 1HQUA 4DFPA 3CTPA 4B08A 2HQOA 3KLHA 1NY5A 3HVRA 4Z4GA 3LP3A 3P9YA 3SV4A 3SQ4A 5C42A 1M5TA 4AHRA 2GBPA 3KKRA 1EWVA 1E6LA 1ABFA 5IC5A 2YKNA 2VWKA 4PZ0A 3OM1A 2KFZA 3DGFC 4CBVA 4PQUA 3SUOA 3RVLA 1LAVA 4OGCA 3H5TA 3LWLA 3UIQA 5IBQA 4BWJA 4G0XA 3SV3A 5FWYB 4M3RA 4E7PA 4E7IA 1LBIA 3ZSVA 3OQNA 2RN2A 4FW1A
chains in the Genus database with same CATH superfamily
4XM0A 4XI9A 2FSVA 3PQ7A 4BVPA 4KJZA 1BRMA 1UBJS 1M5UA 4O29A 5IXYA 1MAVA 4ZU3A 2X0FA 5ITZA 3K2BA 5KVAA 3FLMA 4HGNA 2HLHA 4J03A 1L1EA 4QIHA 4DMRA 4JKHA 1BFUA 1W52X 2WMNB 1O6FA 4X5OA 3M1FA 2AUMA 2IEYA 4C4ZA 4LZZA 4IY1A 2CMGA 3CRQA 3KELA 1DELA 1WUYA 2BRUA 4U5QA 1YJCA 5G41A 2EEZA 3TX6A 1XRNA 4AI6A 3OFND 1IULA 1CRQA 5GAEP 3PUFA 2X86A 2JW5A 1QB7A 1I94B 4J4TA 4OCZA 2R68A 3C6KA 2BTEA 3WIEA 3IP7A 3CH5A 4L5AA 2BGWA 1KVRA 4EW2A 5HIJA 5C9ZA 1LFAA 2X5JO 4DSOA 2A1TR 1L4NA 5DGIA 5BSMA 2D5CA 4B82A 2HHHK 4LBYA 4CM4A 4ZYLA 3TQRA 1PJSA 4FC7A 4HH3C 1QMGA 1G18A 2D5RA 4A27A 3V9WA 1T5DX 2CMDA 1NBEA 3QNNA 4DWWA 3GRCA 3BEXA 5C2JB 4YAWA 3FSRA 2B6HA 3PY8A 2IBMA 4ZCMA 3KK0A 1GN9A 4BFZA 2JAUA 1WO8A 3ESAA 4YR9A 3M70A 5LQKA 4GPAA 3FROA 1KRHA 4NU8X 3SKYA 3G9UA 1OXVA 3CW9A 3CUSA 4US0R 5LR6A 1A4RA 4ENUA 4QATA 2AN4A 1FK9A 1MJHA 1W19A 2GXSA 5SWMA 5ECWA 3QKSB 1KC8O 4MKZA 1J8DA 3RWUA 5J2QA 5JVGL 3SC2A 1R0XA 3PYMA 5AFUH 2NRHA 3A05A 5KEIA 3W6NA 2WWGA 2VP3A 1TC2A 4KUEA 3BXGA 4ZICA 1Y3HA 2QX4A 4KPUA 2H2AA 3WGJA 3FYSA 1ST2A 5I7SA 4ZVPA 4DQ0A 1S1XA 1X1AA 1XMQB 1NM5A 1ZK0A 4C0AC 4YLEA 4QNMA 1UP6A 4FJ5A 2FWRA 2HVIA 3VQ5A 5LBUA 1K5PA 3L8DA 2OYQA 1C5KA 3JTMA 2NXNA 2ZIXB 5KHAA 1D4OA 2WY2D 3FHCB 1KZHA 4JEUA 2O4CA 3MWEB 5EWLB 1C0KA 1EA5A 2QSZA 4BRDA 2BEVA 1XDWA 2W90A 2RB4A 4TSXA 5B7QA 5IDWA 1Z2OX 5AQTA 4B8ZA 3OH8A 4MVXA 2WINI 4H5WA 4RHUA 3T4XA 4Z1MD 5DNYB 2HYIC 3HV2A 1TEVA 3IMGA 1VQ4N 3HNPA 1M2OB 4AUKA 1HKHA 5EKUA 1MR3F 2G70A 5FLXA 1VPVA 4OFXA 2PUCA 2ZWHA 1HLFA 2H0RA 4XASA 3SY8A 3ZSYA 2JFOA 1C7RA 5BUCA 2GVNA 3QVTA 3G17A 4IG4A 1OZ0A 2Z2XA 4BP9A 1UEJA 5HS6A 1Z3IX 4GDFA 4DV4B 3UMVA 4F60A 1ZK3A 3X43A 2XVYA 1HT0A 3KSZO 2QPTA 2H7VA 2BY4A 2D0OA 2JARA 3MXOA 1P0IA 1F3OA 2YXPX 5HIAA 1ACLA 1GUYA 4MQ3A 4IDOA 1JH8A 3NOVA 3LNCA 3L6EA 5D3MB 1QKJA 1ISHA 2ST1A 2WMOB 3QUTA 4MO2A 2QNRA 3WLLA 4CMAA 3O84A 4EQ6B 4K43A 1JHOA 2E4ZA 1C7FA 4QTTB 2B6AA 3SNHA 3CM6A 1JI0A 1Z0UA 1N33B 1FE8A 4CODB 3SC6A 3I30X 1SOVA 5JSQA 5E0KB 3IAS1 4FGKA 5LLSA 3GMTA 4ZDWA 2YZGA 3QUAA 1XZKA 2Q4TA 4NABA 4MS3A 2QSUA 1JSXA 1WKBA 3VC3A 1NK5A 4NFLA 3SZ3A 5GZ6A 3N2ZB 2FBTA 1K1EA 5HBMA 2YN4A 1T1SA 3CIFA 5GV7A 1Z0JA 4FE4A 1U45A 2PWBA 4L28A 1H3FA 1N3IA 4MRAA 3WDSA 5JJBA 4BRPA 3VR6A 1QH8B 2E0IA 1ECLA 1ZA1A 3KYCA 3LV8A 1ANKA 3G79A 1IY9A 4JI0K 2NZTA 2YNHA 1FTWA 3AINA 3DEIA 3OIYA 5JJIA 3OPMA 2O3RA 4JVSB 3THRA 3VENA 5T6BA 4QUBA 2OMEA 4ZIRB 4YCSA 5D5PA 3P2MA 1JA1A 4M60A 3SKXA 2GCPA 4HN2A 2NSJA 1M2FA 4Q15A 3CEAA 4DLXA 2VUTA 3AETB 2W71A 4ZO4A 1QO9A 5JFOA 1IB6A 3ECSA 3ZIDA 4NPHA 1CS0A 4QQ8A 2QP9X 3OYBA 3O8BA 1AT1A 3FGPA 1QGUA 2V7PA 4CF9A 3WV5A 3CNQS 3ZWKA 2OWEA 1EMDA 4LDAA 1JJFA 4DOMA 5KJFA 4U5XA 3PX7A 5HQJA 3U3JA 2UUBK 3WIOA 4GR5A 1QG0A 1TMYA 5BN3A 1XI1A 4YCJA 1J06A 1A9YA 1IZZA 3INTA 3BTUA 1C1YA 5JG7A 5ELLA 3HL0A 4LOKA 5C4GB 4DU3A 1X38A 5AHXA 1QFZA 1YQ9A 4GSYA 2JFHA 2NYVA 1HNZK 2R1VB 3MCUA 1E5XA 4KPFC 3B82A 1UK6A 1WXEA 3H11A 4ZEOA 1E99A 1RAAA 2LSNA 5LNK1 4PSKA 2BL4A 2HWWA 1R3DA 4XQEA 5C52B 4ZDJA 3FTNA 4L0DA 4DA6A 1XBTA 4M55A 5CCDA 2Y1WA 1BEEA 2OR3A 1D6SA 1NVBA 4MUIA 2XADA 1HLGA 2G5CA 4EYEA 1FDTA 4Q5IA 3K96A 4DFJA 4M6WA 3HJUA 3WYBA 2GOYA 4M9UA 1EUDB 4WBNF 4D8XA 3ZHZA 3T3NA 3IBYA 2Q9CA 3K8ZA 1J00A 1YD7A 2SKCA 3OQVA 2O05A 1NF8A 4KLCA 3MCPA 5TS2A 1LV5A 2J30A 5DPMA 4KTQA 1NW5A 4QXQA 4ZT4A 1TYCA 1Y5MA 4WUTA 2PU7A 3EGEA 1LW2A 3SYZA 3A6EA 4K6HA 1U9IC 4G24A 4XVHA 3WXBA 3ENVA 3EARA 3GGGA 4MR9A 2GLXA 3QZUA 5H59A 2ORVA 1WLYA 3UG7A 3QEMB 5K3EA 1O0BA 3QFHA 1OFTA 2EP7A 5BV2P 1ZAKA 2PRJA 4IJVA 4HDAA 5H70A 1IPFA 4MO4A 2DFVA 3MJTA 4I1PA 4I6MB 2D0BA 3CX7A 1GV1A 1P2GA 2Z4TA 3ZVKA 4AB1A 3PV0A 2H1LA 4N3CA 3ADOA 3F5QA 3LL7A 2E89A 4IAOA 1PJAA 1A9OA 1BX3A 2FA9A 1V7PC 1NBAA 3DFKA 3K5NA 3ZE0B 3AXSA 3A1WA 4UNRA 1B0PA 1KE1A 2HHAA 2GN9A 3C6QA 3R6DA 4UE6A 3D4PA 4ZKDA 2IEZA 3QKRA 2V7QA 1W5AA 1XHLA 5CU7A 3DBHA 3SJAA 5IAEA 2ZI6A 1Z35A 1XZJA 1DKNA 1WPQA 3QIPA 3NIGB 1MV5A 2CJXA 4WJKB 2RK6A 3FCEA 1ISIA 3LMKA 2BFDA 4FK0A 4FLEA 1O6ZA 3TYXA 5EJ2A 1CEYA 2W0MA 5A7HA 1COWA 4ERXA 4QG3A 1C41A 4RPJA 3VR5H 2I65A 1A82A 4MDFA 4KHNA 2PX3A 4FI3F 4EHBA 4P22A 1T6YA 3RIEA 1W5FA 2XB2A 3GGSA 4D42A 3UC9A 1TF5A 4KFUA 2QBYB 1UM8A 3X1XA 3U56A 3GL1A 1RNLA 3U3MA 4Q93A 4BR7A 4FFWA 4RS4A 4KWTA 4LCJA 1PNQA 2HCRA 2W2LD 3NVKA 1N0VC 3UHAA 2JFNA 4TWZA 1T5HX 1KXJA 2PMCA 3IR5A 2P5GA 2NUPB 2NNWB 3KJIA 4LGVA 3JD4A 1DP4A 2A5XA 3WGIA 1CUUA 4OXRA 3BFKA 3MIZA 4ROTA 4FOIA 3DO5A 1PDOA 2ZU6A 1CVLA 2OVBA 2Y71A 3F8WA 1EFRD 4IOJA 4JV5K 3HJCA 4B3HA 1NE7A 2BZGA 2FP3A 2CNWA 3H19A 3TTCA 1TEXA 3DB1A 5JMPA 4JU8A 4AZ3A 4YAIA 5KQPA 3B89A 3FKJA 2DY1A 2JRCA 4I19A 2GGSA 4DLUA 4TT8A 4AW9A 3I61A 4JYCA 1Z0SA 3HGMA 3ZV3A 4ES6A 1UK7A 3TGWA 2YC2C 5LZ9A 2OV1A 1G20A 3THYA 1RRMA 3EEBA 3OZSA 2IUYA 5C8ZA 1PNVA 1MT3A 4UNQA 3IL2A 4DS4A 4HS9A 3TZEA 2CUNA 2V3WA 4KE8A 5FYQA 4MYDA 5JS2A 2Q28A 2RH4A 1S6QA 4LOHA 1JJBA 4BWFB 4FJIA 4BX2A 1P6UA 2YWBA 4HAOA 2E4XA 4WE3A 4CZMA 5JBIA 1JLRA 1NXVA 3TNYA 4JI5K 3EQZA 1J9ZA 3SJHA 1QC5A 3CC7N 3GLFB 4FWPA 2O7NA 3N8HA 2UVDA 2VT3A 3NNDA 2FW9A 3U3YA 4MV7A 2QL6A 3HI4A 5EC8A 4EHKA 1TAUA 2OSVA 1XLUA 4P7KA 4JI6K 5DBEX 1G8FA 3EZFA 4E11A 5JS1A 1RZRD 4L08A 2GO1A 1E1RD 3NT5A 1IEWA 5D6OA 1QZXA 3QNWA 1WHSB 2QS9A 2XA1A 4L16A 1IHPA 4TLLB 3MN5A 2AKEA 3M6WA 2IYNA 3I9V1 4KQXA 3LZCA 2FPGB 4JLUA 4LJSA 4X6XA 1E64A 5K2MA 4LS3A 3INNA 2PBRA 3D1JA 4BEJA 2EW8A 4EZEA 1HNWK 3BF3A 4XJXA 1UQTA 3GZ4A 5FTNA 1I1OA 1TZCA 3FB4A 4AULA 5A02A 1TIBA 2HWUA 2QVGA 4H0XB 5BQ3A 4TYNA 1NLYA 2HYDA 2PUHA 3ISTA 3K0FB 4N1AA 2E6UX 3DKRA 3CC8A 1TECE 2OEPA 1EX6A 4WZAB 1A76A 1PFWA 4L4SA 3ZTTA 4F7WA 4EHUA 2G25A 1JRLA 3FCSB 3ZOZA 4PFJA 5KAPA 4CZLA 2VLIA 2GEDA 4ZI7F 1ONBA 1SKYE 4BX9A 2W6LA 1P3DA 3FPGA 1YVNA 4GXQA 1BHSA 2XNCA 3B7PA 1E2BA 3IXLA 4JVMA 1T3ZA 1YBFA 3I83A 1KI6A 4Z0UA 1E69A 3OZTA 2RGRA 2QM0A 1S01A 2J3DA 4P2GA 2PAFA 4DSTA 5GAJA 4UBMA 3T1HB 2GSDA 3HLKA 4DBLC 1NUAA 5JISA 1HLDA 4MB0A 1TA4A 1CT9A 3AR7A 1K27A 2ILTA 1LLFA 4PV7A 3VZSA 4N0EA 2ZI5A 1FEZA 1DCMA 1MGOA 3O08A 4E5KA 3D7EO 4CT5A 3DVAB 4YAEA 1ACJA 5LSAA 3CH4B 3WEEA 3OF5A 3KOWA 3GUCA 4G0QA 2XUHA 3ZCQA 5KSPA 5IVKA 1A9XA 3I42A 4YJFB 2MYTA 3I9JA 1SB9A 4N6GA 3F7MA 3GBTA 2V6BA 5TE9A 2F2TA 4JEMA 3C74A 3P2JA 4FQ8A 2ZRNA 5EMKA 3LUHA 4PLZA 2ZJRL 4OGGA 3ZT2A 2GAIA 1WEHA 4V0OA 4RFSA 3WNGA 4IIJF 4GKBA 1U9IA 2RKBA 2ICAA 2OV2A 4B6GA 4U3JA 4IIYA 1A98A 5AIAA 5EZ6B 4I08A 4LY3A 3M1YA 2XCTB 1AB5A 2JCGA 2NU7A 4MRVA 2R1TB 4RLFA 4MLZA 4L9AA 3CKLA 4RACA 4S1VA 3Q7EA 1TMKA 3RVBA 5CRIA 1DAKA 1RKXA 3L49A 1XTSA 1EE9A 2XNKA 1M6VB 4MYUA 2EWSA 2D2IA 4HUQB 1UPFA 2BELA 5AFUA 4NOMA 4E30A 4CKCB 1PVOA 4FEGA 1HE5A 3VNUA 2ZBUA 2DG2A 3RVDA 4Z7OB 4OJTA 3ETGA 1SXPA 2CHEA 1AGRA 4QUAA 5J2UF 1JZSA 5ALUA 2PDAA 5I8PA 5JANA 1OF1A 4WV3A 5A4DA 3OSUA 1H69A 2RGBA 4IJMA 1F8YA 2BKAA 3TZKA 4URXR 3VJKA 4LYHA 1FDUA 1O8BA 4YJ2A 4DRYA 3NGZA 4OLBA 3OHSX 1ILEA 4K9NA 2ZRCA 3RUEA 1X8JA 3PHBE 4JJIA 3B6ZA 5ELXA 5AO9A 4I6EA 4CJTA 2PTGA 3AEKB 2ATVA 3WO0A 4HNUA 2QEXN 3RU9A 2CBXA 4UQGA 4MQ6A 3GOIA 2FPUA 4ZAZA 3JQEA 3CMEN 4NS4A 3SZRA 5EZYF 1ZUD1 3QWFA 3ZSRA 3UAOA 1OWOA 4UVIA 4XB1A 5ARCA 4L4YA 4L6IA 3F8SA 5CIQA 2PA3A 3AVPA 3M3PA 1YBMA 1E5QA 2JGIA 1G3UA 5LQMA 4P7FA 4BNZA 2PKYX 3S5JA 3PWSA 3V7UA 4HB2A 4RH3A 1L4EA 2FUEA 4HXGA 1WW3A 1EI9A 3KK1A 2GM5A 2ORYA 4CMHA 4JAXA 5DI3B 3HVJA 2XMRA 1YVUA 3D8UA 3EY4A 4JJKA 1RTDA 2WJAA 4MH0R 1MN6A 4ZCTA 4K3VA 4PLVA 3W9BA 4W6ZA 4ADSG 1WUAA 2WW8A 4XGRA 5LCXA 1KMCA 4LF6B 1G4AE 3VGJA 3CO0S 4Z4FA 3UBMA 4YRAA 1W6UA 3H1VX 1Z74A 4BLOA 1GGNA 4RUKA 2P8SA 1G5FA 4RA9A 4Y2HA 3IHLA 2J4FA 3KDSE 2B7CA 4P3NA 3SGLA 3VQDA 2FC0A 3FKSA 3BX1A 1ODTC 4KK3A 2B5JA 5EE1A 3A0IX 2ZJBA 2YTZA 2FMIA 4FYMA 4MUYA 4JI3B 4AF7A 5T57A 2ZBQA 1QXSA 1YOVA 2NSLA 1H6AA 1VSUA 5DGHA 2NRTA 2CKDA 2EDAA 3NDIA 5D3ZA 3LFUA 4RKYA 1RDDA 1RTKA 1KLNA 3CEPB 3C6YA 2YIVX 2JEOA 4QUDA 5J2TB 1NJ8A 2GJSA 3G13A 4OGWA 3ZJTA 4RK4A 3OHRA 2BFAA 3U7QB 1LU9A 2R00C 3A6GA 4QGHA 1EXMA 1GTRA 3F9KA 5EQTA 3F7NA 4LF5K 4DUGA 2ZE7A 4IGIA 3ZDRA 4FW9A 2IFTA 1W29A 3G5AA 1QOPB 1V1RB 2B30A 1M74A 1L4HA 3K05A 4HEA1 4JQCA 4UCFA 1GKUB 4ZGGA 4PC1A 1N3BA 2X3UA 5L7WA 3D3JA 4HC4A 4AZ0B 4YAJA 3NFYA 5JFTA 5CFZA 1VG1A 3LU1A 1RABA 3HGTA 3A32A 2Q0QA 2RHRA 4E03A 1MW9X 3WGMA 5KJEA 4AJEA 3K9KA 1O5IA 3SLKA 1FP2A 1VE7A 1GPWB 3GQBA 2QP4A 3HYRA 2PFSA 2QKBA 3ZZTA 3IX7A 3X1JA 1FYVA 5BWOA 1LS6A 2HF9A 2X40A 4WSOA 2JANA 3WMXA 4CI9A 1Z4OA 4X97A 4N0MA 1N77A 3OQIA 5CYOA 4OBEA 4C29A 1QWSA 1XZGA 2HQOA 3L0YA 1A3CA 1MFPA 1V3QE 4HQ6A 3LBYA 2W7TA 3UTDA 1NLZA 1E6LA 5FI0B 3GJ8A 1GQFA 2G6TA 4WMLA 3I2JA 3PFNA 2VCHA 1CB7A 4GS5A 4HZUB 5LWHA 3ZE2B 1KK3A 4F6LA 3V4VB 3G59A 2B92A 3CH6A 4B9AA 1E79A 2GN2A 5GJBA 3RTCA 4EH1A 2O06A 1J5EB 3AHGA 4AKIA 1RTHA 1SHTX 3F96A 3QLJA 2QTVA 4B3CA 1U11A 4IINA 4BV8A 4RORA 1QFSA 1XCLA 4N01A 3CCVN 2VPWA 3CSUA 2IS3A 3C6XA 3K30A 4NVRA 2P5TB 1Y8RB 5B36A 3NZEA 5T6MA 1IJJA 2V7YA 3VDNB 2AE1A 1ZRHA 4M87A 3E61A 5KQMA 4KXVA 4CKYA 1USIA 2PAVA 3CG4A 1KMHB 4CGDA 5E1BA 4MPRA 1BMFD 4CR7A 3KXIA 1KCFA 4A61A 3KLOA 3J7AP 2Q3SA 1VIAA 3NGLA 2ID7A 2H1IA 1J5XA 3ZGLA 5M7EA 5FNZA 3S7ZA 1IUKA 4U2FA 5AK5A 4GL2A 1P39A 4H17A 2B6NA 4PC3A 1C8BA 5KYVA 1FRFS 4CQLA 2GTHA 2YBEA 2RJOA 3MT8A 5HHTA 1I4TD 1HX7A 1Q18A 3K1ZA 3UF0A 2DECA 4P7JA 2P1JA 3CWQA 3Q3HA 4UOZA 4BFLA 1B16A 1IWBB 4XPIA 3C3AA 3WRYA 4B9EA 5BSEA 4PLHA 4A0HA 2KMLA 4BGAA 1YS9A 1L3IA 4X1KB 1J24A 3AQ4A 4R1LA 1I30A 3IOYA 1M2HA 4YDHB 4ZYYA 3IRXA 4H18A 5KKNB 3GHYA 4JWTA 5CZ1A 1UOOA 4RW9A 3R5KA 3K0SA 3MBOA 4HVAA 4YCDA 1VG0B 4LXTA 1W0HA 1NATA 1EK5A 1ULTA 1T0JB 1TYAE 2ZXUA 5KC9A 2I2WA 4YPFA 3R40A 2G06A 5ILOA 2HQRA 2WIGA 1NT4A 1YS1X 4AO8A 1FVOA 2OHVA 1F06A 3T5PA 1MA0A 2FPKA 3RRNA 1QNFA 3NTVA 5BSWA 3OZXA 1P0PA 3K5OA 3EPJA 4JHLA 4O4HF 3HA2A 1JIJA 4G8DA 2W6JD 4PNPA 4D82A 1U04A 5FUXA 1K0UA 3KT8A 1X8LA 2IZOA 3R0IA 5D86A 3KPJA 1CTQA 3FOAA 2YFQA 3R77A 4MTCA 3NFAA 4U4AA 4CTMA 5L9AA 4F12A 2FLVA 5GGXA 4DMHA 1PVVA 3WICA 2PZGA 1JMYA 4XD7D 1R4ZA 5A9SA 1P7YA 2FEAA 2OV4A 4MCJA 3CJRA 3SDBA 4NQZA 1RWMA 4DR5K 5IYZA 4Q39A 2XE6A 4YJHA 3Q8MA 1RPAA 2Y66A 1R0AA 5AUPB 2ZDHA 4Y1FA 4CQMB 1J22A 1YVDA 2IELA 2YL2A 3B3FA 4CW7A 1E4OA 4F2PA 2CH5A 1XJCA 4FW2A 1SWWA 4XIYA 2IITA 3STVA 1N2OA 2AG8A 1B4DA 4V1CB 2HHJA 2DFTA 3K1AB 3QUCA 4XCQA 3JQBA 3O3GA 3ZZ0A 3WQQA 2QY9A 1EHIA 2VSYA 3E8MA 3IA2A 1X7XA 1N1GA 4NO7A 2QRPA 1FFAA 1L4KA 1IXZA 2UXDK 3JS5A 1VKRA 4BNMA 5AKIA 1V8PA 4OVLA 1BW9B 5DYYA 4F92B 1L8LA 1MOPA 4B40A 1QGDA 2BEWB 4DR6K 4HUEA 1ZN8A 2R25B 4JB0A 1NTOA 1XVVA 3QBWA 3UK1A 2YFHA 3DO6A 3IBCA 5EKSA 2Z3ZA 3AI7A 1YZTA 2ERYA 5AW7A 5GOZA 3VR6H 5BWCA 2NUTB 3KKOA 1QKIA 2O3SA 4IOAL 5FEUA 5CB6A 4OM8A 3U5ZB 2DHCA 2DSTA 4R68A 3Q5EA 3OCCA 1D8YA 2I99A 2YNIA 1OWMA 1KKUA 4BVBA 1U1FA 2H18A 2PT9A 4MUHA 2NADA 4KH6A 4TV9B 3BXFA 5CZ2A 1YUBA 2FY8A 4RTRA 4D2IA 1NV9A 2V6IA 1MH9A 1Q44A 4CJXA 2WTAA 2O52A 1UJMA 5K8LA 3L0DA 4CJEA 5CA0A 4DIKA 4CGGA 2FN8A 1JX6A 2R8BA 4B75A 5EMJA 2FHSA 1QR2A 2WPNA 5KO2A 2R5NA 3DOCA 3I2KA 4F3YA 4EATA 3WFIA 2JKVA 4JXZA 5CEEA 3H04A 4RMJA 5CJJA 4JK7A 1UBHS 4TXMA 3ER9A 2WNSA 2R00A 2IBSA 4DXHA 4AYXA 3GWGA 4KW7A 4W8OA 5KX5F 1XJWA 1Q84A 1QTIA 2FKAA 4UZEA 4G4IA 4J6FA 3R0JA 2MSEB 5AKYA 5DEIA 5EIFA 1BQ4A 1L5VA 4CHGA 1YIAA 6PFKA 2CHQA 2JGEA 2PBFA 1NMYA 1L4YA 4Y6GB 3PQFA 2XNDD 3OOEA 2Q1NA 5IT9A 1YC2A 5HKKD 4B6PA 2XPCA 1DKLA 3L7KA 4EP4A 2EVWX 3MM4A 3FCOA 3EDMA 1IHOA 2QR2A 5AQRA 1TA9A 4KR7A 1ISRA 1FPMA 3KIOA 2POCA 4V0KA 1VG8A 3UO8B 2V4UA 1AKNA 3ELWA 2VHQA 1V71A 1J8YF 4RLQA 5AR1A 3E9MA 1NI5A 1I2MA 1APBA 3VH1A 4JR0A 1HI9A 3UMBA 2Q2WA 1TPZA 2I3GA 4TUYB 4A6EA 2JLWA 4FZYA 2AFIE 4YOXA 4FO0A 4DMCA 5F12A 1KFEB 5JAOA 3EFOA 3M1AA 2KW4A 4W5QA 5G1OA 2FWJA 3OCXA 5DTIA 3HUUA 2DKNA 2PMDA 4ZJUA 4YQYA 4KN9S 4DAEA 2VCYA 1F4LA 4INJA 2COEA 4BYGA 1ZR4A 2DTXA 2PZSA 3ORQA 3R7WA 1YGYA 1UM9B 2HOQA 2CEKA 1EBUA 3BJZA 3VQ7A 1XF1A 4CZ2A 4ZDKA 4FLYA 4LK2A 1Q6ZA 2JC3A 5BRAA 3MUOA 1UAXA 2R7NA 1QIJA 3E9QA 2I1LA 3LVFO 3L82B 3DXMB 4FFNA 2MINA 5DI9A 2JWLA 3REQA 4F4FA 2A1TS 5DXFA 4MYCA 1Y3AA 3IUEA 5B30A 4LSNA 5H81A 3RMDA 2YIJA 5EX5A 3G1TA 3K9CA 5G4KB 3LIPA 2O4UX 3V55A 4GZ5A 2PJZA 4H9GA 4I2QA 1Y8QB 5KYWB 5AOVA 3COZA 1SAYA 1ULSA 1BA0A 3HJRA 1E7YA 2QU8A 1BDBA 1OT3A 5IXSA 2GM9A 5EKDA 3Q87B 2X3FA 1KDOA 2QWQA 2R47A 1HEIA 4BVJA 3MD9A 2H2FA 3DE7X 4WF9L 3LYLA 2DP4E 1DIOB 4YR7A 1JYFA 4QEKA 1DLOA 1XVLA 3GRVA 4FZXC 4FDMA 1U0EA 4MI1A 3HCCA 3AU8A 4MK4A 1EX7A 1S4QA 3A1NA 3GP3A 1E98A 3RJ5A 3HDYA 4JJ6A 3HU2A 4D46A 4E1AA 2ZITA 3MTBA 1XT6A 2EF1A 5ENDA 4FE7A 2KZMA 4R8LA 4OJRA 2VPZA 8AT1A 5EWMA 3KHTA 3IQXA 3UG6A 3JQ9A 1B26A 3H3NO 2Q3MA 4BFYA 1V9LA 4KE7A 2HF7A 1K8YB 2R6AA 2X0IA 1R10A 3TR6A 4ENPA 1PJZA 5L3ZA 5BSKA 4GYKA 5LYJB 2J1LA 3OE7A 1E1CA 4UHJA 3HM9A 1JG6A 3HDGA 2B8WA 3P83D 2NQ2C 5MFPA 3DYIA 1ICIA 2J3HA 3A9WA 3P71T 2X9NA 2YR0A 1FP4B 1RC0A 1G19A 1T15A 1S96A 3K16A 4BX8A 4ZYUA 4MMXB 4TQAA 4KRYA 5F98A 3NMUF 2HBZA 3COYA 3THOA 4UREA 3WIVA 3JQ6A 2A88A 4DDMA 5KAMA 2RK4A 5EIXA 4BJ5A 3GO4A 1ECFA 5GADl 3ZR4B 3E18A 1Z8HA 2ZYIA 4GMFA 3ZHOA 1DS6A 2KBEA 3O3OB 5EI5A 1W76A 4CGHA 2NZVG 1ZKDA 2XBLA 4DCPA 2VR1A 4JAVC 2EJBA 3WHIA 3W7AA 1PKXA 1U6IA 2DC1A 3IP3A 3CY6A 2OLKA 3V81A 3GFPA 4JJGA 4FX5A 3LC0A 3RSZA 1VMEA 3D0RA 1RI3A 4TS1A 3RAPR 4F97A 2Y9MB 2GAAA 4YIHA 3BYZA 4FGJA 1FXWA 1UXJA 4IV5A 2BEKA 1QIKA 5EP1A 3CH7A 2HB5A 2GKSA 1R0KA 2FN4A 2SKDA 3I64A 3FHOA 1EUYA 3E9PA 4C76A 1NGFA 2J3LA 1H93A 4CK2A 4MPJA 2HZBA 4RD1A 4F6CA 2HEIA 4L8LA 4QAJA 2B1IA 1RXUA 1Y5LA 4Q4JB 3SDZA 3KQNA 1ULBA 4MVJF 1FXUA 4LAFA 3CCRN 3GD7A 3CD6N 4XUCA 2H9IA 4R6WA 3GNQA 4DTXA 2Y9PB 4UTZA 4ZO9A 1Y1LA 4K0KB 3X1WA 3P9SA 3PVZA 5C0YA 2QE7D 2HK7A 1UBUS 4CG0A 5C5IA 3JTEA 1C0LA 4J0IA 4OJYA 2IY7A 3WL5A 3DL0A 3VYVA 4ZGBA 2DUNA 4LVOA 3TOZA 13PKA 4ILJA 2ESRA 4KI0A 1DJMA 3FZQA 5B1IA 2DY0A 4M9ZA 5AIBA 4W5RA 4JUCA 5F5XA 4P83A 3H2GA 2H2DA 2GWJA 2FPPB 1JJIA 4AJOA 1SM4A 5TPZA 3K0HA 2J9FB 1EP2B 3I04A 3WISA 2EAUA 1ISGA 2XE7A 4CK1A 4OSEA 2GPBA 2ATQA 3JPYA 3IAS6 2ZIWB 4H7IA 1II0A 2OPQA 1LC0A 4RIIA 4YUZA 2X1LA 2ZSEA 4BV9A 4B9TA 3PYXA 3NHAA 3VC7A 3EW7A 5FPQA 1NOZA 5LB4A 3QVXA 4HWOA 2V1XA 3H5RA 2IYPA 2Y92A 1ODKA 5CT9A 3EXEA 4MWBA 4H5TA 4IDNA 4YO7A 2QMHA 4COKA 1FSPA 4I66A 1GLBG 5EE3A 2QWNA 3N2GB 1PNTA 3LDSA 2OAEA 3TVYA 2PUFA 2BGTA 3ZBUA 1CZUA 4G2NA 1M1ZA 4F21A 3BA1A 3VDXA 2PLFA 1SKQA 4YRRA 5JCOC 3MJVA 1BDGA 1UZUA 1Z8NA 4ZVLA 2I2DA 3KAKA 4DUZK 3LA6A 4FUQA 2P27A 3MMNA 5GAGP 4BP1A 1AGYA 4X93A 4D25A 5M1NA 1IKYA 4TTTS 4GBMA 5BMVF 2I4IA 1GZHB 2X4IA 1UDWA 2O2IA 3D7MA 1XCJA 4XYMA 1F2UA 5I4BA 2OVFA 2BPOA 1Q12A 5LBIA 1M0SA 2VGMA 3TXAA 1K88A 1WBDA 3HYFA 1RBTA 5FWDA 4GNKA 1I6MA 4NJOA 5C2DA 2QL5A 1GGVA 1Y4UA 2M1ZA 4X3OA 1QMPA 2IRWA 5DT2A 1QHNA 2HBYA 3GEDA 1Y63A 3RBAA 1H2XA 4DLEA 2FPIA 4DTSA 3KYBA 4F2RA 2FFRA 2WHEA 4DCJA 3KKQA 4C2UA 3GRUA 4HUTA 2PEZA 4ZCPA 1VTKA 2OO3A 1JYSA 4BNIA 3O6WA 2FSFA 2QXTA 1L8QA 1XO1A 5IKEA 3M3DA 2Y0DA 5I48A 5J9FA 2WTBA 3L8ZA 1YI8A 4D9HA 3CC4N 2PJRA 3QWBA 4P5DA 1L3TA 1T1IA 1FSFA 5LNK6 1JEEA 2JB9A 1PFQA 3KZNA 4BVEA 1ZD9A 3GZNB 4M9CA 3WTCA 2SCUA 2WF8A 4ZOLA 1GKIA 4TMWA 4CHQA 2HA4A 3K9QO 1O54A 3HTXA 4X64K 3ZDQA 1C80A 5KSOA 3EULA 1GO2A 4E33A 2P5OA 4BY9C 3BKXA 2UZ4A 2ZM6B 1XQ9A 4ZOBA 5I5GA 2W2VA 4NONA 4M76B 2JD2A 4LYYA 4HKTA 3BL5A 2QUBA 3JYHA 5FL7D 2DU8A 1D7AA 3ITNA 2V9CA 3DLPX 3ZTWA 4FOLA 2FR8C 3SJBA 1NT2A 4KTVE 3UWMA 1DAIA 4JKFA 4MTLA 2ZTMA 2PGDA 4G81A 4UAJA 4G5QA 4HGRA 1S2DA 4R54A 4ZALA 2GUPA 1K8KB 1P8JA 4O2BA 1JALA 1U28A 1QHHA 5HZGA 1K98A 1WU8A 3B3JA 2PBZA 2OAQ1 4J7CA 4RHEA 3ID8A 4PIMA 3AO0B 4OHKA 3N6VA 3LK6A 1V4SA 3D7LA 2JVKA 1TU4A 2IQIA 3OMWA 5FDLA 1E4EB 1QPZA 2I5PO 3M5CA 2ZJ2A 1HSOA 3P26A 4Q7EA 1JQ5A 1JKHA 2YHYA 3P1GA 2R79A 3ZT3A 3PR1A 1US8A 1YL5A 3EXG1 1AMUA 3E70C 2X6NA 4HFJA 3LOUA 3VPSA 1AK9A 1AUPA 3BHJA 4PQFA 3IQZA 5FORA 4JXKA 2AEEA 1VL0A 2QGNA 1VSBA 1QDUA 2A1SA 4QPJC 3CQ9A 4OQ4A 2XCSB 4EHLA 4J0HA 4QQFA 3D7KA 3VTHA 2HHWA 4M0PA 1CP3A 1NW8A 4OPJA 4I4NA 4LMRA 4IDBA 1JB9A 2I66A 4F3OA 2D1YA 2B61A 4ETMA 3PKZA 4N6NA 3V32A 4CLRA 4NB4A 3LDLA 3UXMA 1CZAN 1E18A 1SUFA 3NHJA 1W7AA 4BROA 4R01A 5IDQA 4IXWA 3TL2A 3FWNA 3KQOA 3O7MA 1P0MA 3AJ8A 1RRPA 4G86A 1JG2A 4QXRA 2FMHA 3UKRB 1ZJ4A 2QLMA 4QXPA 5FHRA 2HT6A 1Y1QA 1I4EB 4W5OA 3HBFA 4MW5A 2VQSA 4S3MA 2AUNA 2PQMA 1Y6QA 4GZ3A 2HMIA 1ZJWA 4F2GA 1SUEA 3RKUA 1HLPA 2WBLC 3SUNA 5HIIA 2MOKA 2AYZA 3NVAA 1GFZA 4D1YA 4AJ1A 4YRMA 1FS4A 4B34A 1RT3A 3GEEA 3NH9A 4UPDA 2B2NA 4PFQA 4S2UA 5JAIA 3EGDA 3CRVA 3PB3A 5K09A 2N1BA 4ZQGA 1QQAA 2BZ1A 1E77A 3EEFA 4BNJA 1OZFA 2G71A 3GX1A 4W1RA 3QJYA 4ENWA 3L7DA 4EI8A 1NK0A 3HM8A 1A0OA 4IYJA 1GY8A 3V8BA 3BUZB 5JC8A 5J40A 3DV2A 1SKRA 3S4YA 3ND6A 4MEJA 4Q1DA 1ND5A 1NMDA 1QIHA 1VJDA 2O0JA 3CURA 3S68A 2PKQO 2ZDGA 3VPDA 1WPXA 2V98A 3T7AA 3QV2A 5K8JB 3DD5A 3QELA 3PGLA 3GRFA 4K6GA 3GT7A 1KHHA 1E4FT 1DAOA 4TV8B 3AB7A 3R6LA 4EJ0A 2NV2B 2ATXA 4YUVA 3FCAA 2XMPA 4NTZA 1XJ5A 3G9TA 4KQKA 3ZBTA 7GPBA 2KE5A 5AYVA 3UCFA 4B6SA 5LQAA 4DG8A 3F3SA 4IOLA 1YHZA 4WXPA 1JXOA 1ODCA 1FKOA 3V4OA 3EX7C 4IBOA 4CJWA 4P3KA 3U4IA 2D1KA 1WMSA 5EXSA 2QEQA 4DWJA 2C78A 2CNOA 4L72A 1NMZA 4FR0A 2B0CA 4JJFA 2GJ4A 3P2KA 3SJJA 3VYRB 1XMOK 1A97A 1R6VA 5IPFA 2GFIA 1PDVA 1PS0A 3IXQA 3OS0A 2VBGA 1CJTC 2D2FA 4Y0VA 5FA5A 5FUQA 3ZYCA 5M1QA 3I9V6 3IESA 3B6OA 2IHBA 3IOMA 1RI5A 5GADP 1RT2A 4JI2K 2CDBA 2ATEA 3OEHA 3PDIA 4MKRA 1VP9A 4ZZ2A 4NS1A 4AUNA 3TK1A 5ESRA 3T3PB 2VJMB 4CFDA 3V6DA 3CVXA 2IZZA 3S2YA 1EZZA 3T15A 1IATA 3MZ0A 3PQEA 3UJAA 3EXG2 5FPHA 2MMGA 4MQUA 2AI3A 3GLTA 2XGMA 4FZJA 3FPEA 5B64A 5DLQC 1P9RA 4IRXA 3WA7A 3TMYA 5C3MA 1FFBA 3AR5A 4L8WB 2I54A 3MS2A 2Q5CA 4F1JA 3DWEX 1LK7A 1DHTA 1TKDA 4UXHA 2IZ7A 2AL7A 5FULA 3PTAA 4IWXA 3TSAA 4DC0A 4O0IA 1ZU4A 4NIMA 1MEEA 1XTJA 1KK1A 1DTTA 5GTDA 4KZKA 3R3VA 1A1SA 4H7JA 4MVJE 4ZZIA 4N39A 5JYEA 2GFQA 1T8RA 4LQ4A 4B3DA 4L3WA 3QQ5A 1JSRA 4J3FA 4HNAA 2GHRA 3PFWO 1UWBA 2WUSA 1HDCA 4C87A 2G8VA 2Y68A 4OUDA 2WB4A 3TR5A 3ZU6A 1K5DA 5C8YB 5FUYA 2O2XA 1R00A 5C31A 5IAGA 1QE0A 2QWPA 4QWMA 1O0CA 1JAHA 5ALMA 1DINA 4Q0MA 5C5DA 2EKLA 3IP5A 3IIJA 3AK4A 1V5FA 1RQNA 1PT8A 3GLGB 2Q7XA 1CY4A 1K9SA 3L5KA 1GPLA 3FWYA 1NNI1 1GUDA 4CEAA 4EY6A 1GR1A 2CVZA 4RTQA 1YNOA 4BUZA 1IXRC 1K92A 4WNAB 1S6YA 4Q82A 1NNEA 2P9JA 3QVLA 4B6EA 5FTWA 4LWPA 3ETDA 1NI4B 2QM7A 1B00A 2Z2YA 1U5BB 3K6SB 5KWJA 5REQA 5LDGA 1N4AA 1HETA 1U2SA 1ZH2A 2JFGA 5I9EB 4D4LA 3VQAA 2QQEA 2WG2A 4Q4HA 2GK6A 3ESZA 4XGIA 1R8QA 1N2BA 3PIDA 3HZRA 2QX6A 2XY7A 1CR1A 3D3QA 4OI4A 5HDBB 1Q1NA 3DFFA 3RVNA 4BGBA 1QPGA 4MULA 3OC0A 3CPHA 4OB7A 1CC1S 4LF4B 2XMSA 3Q7QA 2XUJA 4U7DA 3WL3A 4JMLA 3IHTA 1LUAA 1L5NA 4JBGA 1TGVA 4E2ZA 4Z7QB 3R6TA 1X70A 1N36K 3OKFA 1OGJA 1R64A 2OO7A 2C5LA 4NXMK 1IN4A 4CCHA 5C12A 3PWKA 1EWYA 3RVMA 3SFTA 2CBZA 3NAGA 3LRPA 1HL7A 1E3QA 3R09A 3COPA 3QXJA 4O0JA 2NV6A 1OTHA 1ZH4A 4Y9DA 3OPQA 2BYTA 4C4YA 4PUOA 4DQQA 2OXFA 1MIHA 4LYFA 2Q9AA 4BVGA 1Q82O 3ACDA 3U9DA 4JL5A 5JR3A 1S8NA 1X0XA 1AGXA 4PWDA 2FHPA 3VPCA 4CDNA 4IIUA 2P9BA 1NIPA 3LLSA 2JAHA 3MOIA 1BH2A 3K5IA 5C18A 4FDUA 4LNAA 1B1AA 3B13B 1MIOA 5HROA 1EAYA 1Y8AA 4ZVKA 1QRDA 3STYA 2QTDA 4B43A 3IV7A 2NVBA 3NIDB 5K3FA 3WZMA 2PZKA 3FZKA 4PGAA 1E61A 1M83A 1DG9A 1XRSB 1HQEA 3PHHA 2J32A 1DOAA 1CR6A 2ZVPX 4WLFA 5E3IA 4BRNA 3SFZA 2RBGA 4L0CA 2HLPA 1RS0A 1YJQA 3DFMA 1IVNA 4PLCA 3RGGA 2XTNA 1K97A 1XE3A 4RGVA 4CIXA 1EUCA 1IKVA 2XF2A 3N0XA 3IAUA 4BTEA 3EWNA 1KI7A 3VQEA 4N82A 4R1PA 1BXGB 4EFHA 4E32A 3VFDA 5GOTA 1DPGA 3JAKB 4P4NA 1O5OA 4N49A 4IXNA 1B8PA 4TWBA 1KR5A 1P7VA 1DMSA 4R69A 3ZHRA 4PINA 1BIFA 2G6BA 2V8BA 1QUFA 1EWTA 1PJ8A 4X92A 4AY3A 2UUAK 1KH3A 1MJFA 1RHRA 3R3UA 5LXTF 3JALB 3ZJ5A 1VQ1A 4BNGA 2G88A 3U3ZA 3PUHA 3X2EA 1DIBA 2YWHA 3MTJA 4WESB 4EKYA 2IHKA 3ZVNA 4E14A 1JEDA 2P4HX 3NGXA 1H23A 1USGA 5KYNA 3UMRA 3RTAA 1KKMA 2DULA 4DABA 1QG2A 4YNQA 1MB0A 3SYNA 3MRSA 4HEA6 1SOUA 1ZIPA 3OIGA 2GCNA 3ZWDA 3F97A 4IHJB 4L3VA 1T03A 3KHUA 4EX7A 3ZI7A 5BR1A 3RQIA 2QMZA 4KI7A 1FTNA 4D4MA 1MLDA 1SL1A 2AFVA 2CLFB 2XEDA 2ENWA 2OHXA 3SQWA 4L6AA 4KB0A 3K15A 4G5RA 1OYVA 4C0XA 4LY0A 2H4HA 2KBFA 3K2IA 3OM0A 4HVLA 2V51B 4MS4B 1SBHA 4NATA 3D8TA 1W34A 1EFPA 1RHJA 3SPYA 2R8ZA 3K0CC 2UU9K 3OUZA 3OTHA 3DYBA 3K31A 2VNAA 5L51A 3E05A 1XN1A 2L19A 4KPGA 5FV7A 5BV8A 2DQ4A 3I2FA 4DJAA 1FW6A 4EJSB 4M88A 1PDWA 1U0LA 3ATUA 3LXMA 3TMAA 2WJVA 5BWNA 3F73A 5K01A 1E9VA 1I3CA 5DHSA 2C2XA 3NJ4A 2HRBA 3L02A 4KRXA 3RTEA 4HXEB 2XODA 4O4IB 3OO0A 5AVRA 4BVFA 1EG7A 3ON5A 4UBLA 2Z2JA 3M1LA 3QMLA 4R2XA 5FX2A 1MX9A 1KYWA 3ASVA 3VR2A 4BLWA 1L2TA 3FLEA 2VP0A 5HM6A 1AQ6A 3GPLA 3DAGA 1ZK4A 3EZGA 1N0WA 1E2EA 3FR0A 4FJJA 1GA1A 3JD1A 2N46A 3LVQE 2YVLA 4X7BA 3DZIA 2IVZA 1NQ5A 4MWDA 3UMMA 1WAFA 5GVSA 4OK6A 5A2GA 2JPDA 1V48A 1DJNA 4LSWA 1B43A 3DEZA 1XPUA 3MTQA 3NM4A 2WUWE 3SSAA 3FVTA 1P8ZA 4PANA 4MP8A 3QENA 3RC1A 3H9BA 1BOTO 4HZGA 1TYQA 1B1CA 4MPTA 1XTVA 3ZY5A 2EZTA 4OFZA 3OYLA 5FPSA 1RPNA 4RXUA 1Z0KA 2BANA 4HSGA 1E0AA 4HMOA 5JI3E 5FEMA 1VCHA 3FUUA 2OYRA 4JLWA 3L2VA 1KAZA 3JQGB 3GJSA 3EJWA 3G7NA 4FFLA 1VIMA 2CHUA 3I3SR 1YL6A 3VNVA 1CJVC 3R5TA 1P4RA 4G6ZA 1ACMA 2FKNA 1U0SY 1ZSVA 2YWFA 3DOFA 5K7SA 3MHTA 1UJ6A 4JRQA 4QLOA 1D1SA 2ZM5A 1JLHA 1ML4A 3ZGXA 3AOGA 3ZHCA 3W5DA 3BRWA 2C8JA 4XGQA 1BMDA 1A88A 1SMKA 3PXGA 4J0CA 4DR3K 2YHIB 3GJ4A 3JQ8A 5BN5A 5LP6B 5A7FA 3QPDA 3DOEA 3T0IA 5JWOA 2J0SA 3E01A 4K8OA 3ZQUA 1AN0A 4FOSA 4BAZA 1Y8CA 2DERA 3ICPA 5D1HA 3A2FA 3AESA 4FFSA 2WB2A 1TMOA 3O9QA 3TANA 1K8XB 3TIVA 4EG0A 5JHHB 1RADA 3U3OA 2IE0A 2EHGA 5I9MA 1DVRA 1R4NB 3SSMA 4KXQA 2X4DA 5KBYA 4NG4A 1E2QA 3ZGVA 3OW2M 2JLQA 3EISA 1YVEI 1OUMA 3NEJA 3MTAA 4NPCA 1JSZA 2X9GA 4RPKA 3JZFA 2IYZA 2P40A 2BFCA 1A50B 4WDRA 3Q3JB 4ENRA 5IJAA 2Q6OA 3C3DA 1N32K 3F3YA 3S70A 4RZUA 1Y82A 1UMBA 3PQDA 5I9IA 4U6QA 4BNTA 2AS0A 4LGMA 2H2GA 4M2LA 2KLBA 4EHJA 4QLAA 2PFUA 1I14A 1DWPA 5EE5B 1EX9A 1UFKA 2QM8A 4TTRA 1W1UA 3KV1A 1DO0A 1TW2A 4P0QB 5LQUA 3EZ2A 4Y9SA 1UK8A 2W4MA 3RS9A 3W04A 2BFFB 4GZ6A 1OTXA 2FUCA 2I2FA 3NS7A 4RW8A 2GZSA 4V3CA 1F17A 3GN1A 3ND5A 1EM6A 2ZB7A 1Q2XA 4ZAYA 1EVJA 2LGJA 4OO3A 3CT6A 2WD7A 3G9QA 3HHEA 1D0SA 1NJSA 5E1DA 2LTAA 5BR4A 2FP4A 5DTRA 2HRRA 4DIDA 4LYAA 4JITA 1IUPA 1IN6A 2FJ0A 1FSZA 2ZR9A 1Y81A 4XWKA 3ESRA 2NTEA 3OCWA 1SZPA 3BFXA 3CBGA 3GCDA 2ZJ4A 2H1VA 2XWSA 4YMSA 5CR9A 2MYPA 3HBAA 3KTDA 4QJ4A 2JDID 5KVVA 3KHKA 1KOFA 4HHEA 1VECA 1VHLA 2IIRA 2QKYA 3RSGA 4R4JA 2P9KA 2AI2A 2WWTA 3EFBA 1CUZA 2TECE 4BO9A 3VNQA 4UZFA 3ABQB 5IC4A 4CEHA 2CF5A 2JLVA 1N2CE 5ANRB 3KU1A 1Y6JA 3DRRA 3ZCXA 4BLSA 1GGKA 2D1FA 1ORTA 2IUFA 1Q9YA 2FQYA 3A28A 4LTMA 1XTRA 3PR2B 1II8B 2OLEA 3RYHB 1ZRMA 3BE8A 5DNAA 1FP7A 3GRZA 1CQPA 3R8EA 1JFVA 3PEFA 3O9TA 1D4ZA 3BMNA 2IE8A 1TLFA 2DBZA 5LUBA 4C4OA 3CPSA 1Z5OA 3TW6A 1Z4LA 4CLOA 1YT3A 2X8LA 2CHGA 4IMJB 4IF4A 1RWPA 2XOKD 2UXCB 4FT4A 621PA 1JHDA 1X86B 3LM9A 4RGQA 1A9ZA 4YA6A 2BJWA 3QO9A 3UNXA 3WQRA 4OQZA 1DEKA 2PR2A 2IXFA 4G1FA 3F78A 3TXYA 3J80A 1WRBA 4CQMD 2UYTA 4F8RA 2R3SA 1IHYA 4FYDA 3AC0A 4AWBA 4X44A 1BN6A 4JFRA 3WNCA 3OY9A 2O8EA 5L3QA 1DQRA 3PO4A 4KGVA 1BHLA 2FX3A 4Q9AA 3CYFA 3KJGA 3NDRA 3KB1A 4M89A 2O07A 4CEQA 3RS0A 2WYVA 4FWRA 1WETA 4Q4CA 4K9SA 1AQJA 1GVNB 2B1JA 2I7NA 1RWXA 4QASA 3CVWA 3K9GA 4BC1A 3RU3A 3DBIA 3QE3A 3U4CA 4L8GA 2ON6A 2AK3A 1ISFA 4QBKA 4DDHA 1T4GA 1L5ZA 2YYZA 1T13A 2I6GA 1VLHA 3MB8A 5AQUA 4FFVA 5AQLA 3SUPA 5KOJB 3CJ7A 3QU2A 5IDYA 5A1JA 4BU1A 2P2SA 4E51A 1UINA 5HF5A 1W1WA 2VQFB 2GX9A 3BRSA 1S02A 3W0LB 3HL4A 4KR0A 3A3YA 5IJ0A 1EFVB 1AOXA 4YVFA 2G5TA 3FTPA 4RXTA 4RCZA 5A2QA 1C6VA 2HBMA 3A58B 1DBRA 3LKZA 5HR5A 4DLAA 3E9LA 2OP0A 5LOVF 1C0IA 3NQ41 2EBHX 3EDQA 3HJFA 1KI1A 4TTSA 1F0KA 4ECAA 1NVEA 4KYUA 3VKWA 3RFXA 3G7UA 2OLJA 4RVNA 2GASA 4RF4A 4M8SA 2EQAA 4C89A 1RDUA 4GRIA 5DSXA 2WM8A 2E6KA 2YOGA 4LC0A 4E5VA 3IT1A 3QJ5A 4IIGA 3EGXA 3EVAA 2DLNA 2ZJ8A 4LJ9A 1OXUA 2B9EA 3FNRA 1YITN 4P0PB 3KD2A 3I58A 3ZD6A 5DFAA 4M7XA 1X9WA 3QPUA 1R7RA 3E5HA 3BK2A 4BMSA 3O9ZA 2L2QA 1L3CA 2EHDA 2IS2A 4FEAA 5AQFA 4I4TB 2HSTA 1S8AA 1T4DA 4FSDA 3HXQA 3BVPA 3GGPA 4ACBA 1S3XA 5IULC 1UOEA 2EZ9A 1T91A 1PT5A 2OHHA 4CF5A 1JEJA 3P4IA 1OX4A 1HNXB 1TZMA 3P1JA 4KKVA 3DTVD 4B80A 1Y34E 3X1ZA 5TEVA 4QOJA 2EC5A 1N5OX 3O4IA 2XY5A 3T95A 3NX4A 2JHGA 4CEJB 3VEWA 1P2DA 4GMHA 2LZ0A 1WDLA 4REOA 1PSZA 2PX8A 4DB2A 3GVHA 3I73A 1UPCA 4R1QA 4BCCA 1J7JA 1Z73A 4MWCA 3B1JA 1XQVA 4BDTA 2P91A 3ILSA 1H9CA 4CD3A 2IH4A 3J7ZO 2OHOA 2P9FA 2WU0A 1L1QA 4F8YA 4MW6A 5F1XA 4RKQA 4BFVA 3IUBA 3QXHA 1E3WB 3V34A 1JB1A 3RC9A 3GGDA 4ZTJA 2BE7A 3PDJA 4OGLA 3C7CB 3OBIA 1TUBB 4DV6K 4CIBA 1KQNA 4RMGA 4DC9A 4XIFA 3U7GA 2AR7A 2JBHA 4HTFA 1Z8FA 3THXA 3CWCA 1EB9A 5JNWA 5KQ8A 1YCDA 3ZHTA 2EZUA 3VSAA 1WSWA 4MV9A 1S22A 1I0LA 1HYZA 1BDMA 3DMRA 3JVUA 3FFTA 4JLJA 4BC5A 1P2SA 3ME5A 4B3OA 3LO8A 1NNUA 4RM2A 1EIWA 5B3LA 4M1TA 3LBIA 2CLLB 4PLGA 5K6AC 4WKPA 1BDHA 4Y2PA 3MQFA 3OYGA 4PG7A 3I6MA 3ZETA 5U1PA 3VO8A 3WK6A 4M0MA 1S3SA 5F23A 3I0MA 5JD6A 1Q57A 3FNGA 1NOIA 3JYTA 3I5MA 4FZZA 2PL9A 1H2ZA 2J7PD 4PLFA 4Z9XA 2EFGA 2VYCA 3L07A 2H6EA 2KHZA 3JAWB 5BYBA 1PU2A 4E6PA 1X80A 2W6KA 1LV7A 1S9GA 2NZ8A 1VIYA 2E87A 3KKNA 5A4KA 4BV3A 2WNHA 2PUTA 2O48X 1ESEA 2O5EA 1TF7A 2Y1EA 3R7NA 4FM9A 3T94A 3L4QA 4CMIA 4B5KA 1GLLO 3LRTA 3FF1A 4G23A 4PO1A 1KYYA 4BEBA 4BNXA 4OQFA 3I1FA 3LP3A 521PA 1L8XA 3AM1A 4F8EA 3FH0A 2GBPA 3GA0A 4J9UE 2F59A 2WUFA 2P9IA 4IRMA 1TUGA 5FUMA 3OCZA 2XCQA 4UMVA 4GPEA 5M1PA 4RJLA 2WT9A 4CF3A 1O5TA 2R84A 3SZUA 2YV1A 1H4VB 3EVNA 2R9VA 2IYFA 3GJYA 2R6HA 1E9FA 1RJGA 1NGGA 4DUYB 3RPEA 3P32A 4HO1X 1Q0UA 3B6KA 3DTVB 3L8FA 1H1TA 5KTSA 2QN6A 1XC3A 2D5LA 1MVOA 1YIDA 2Q46A 1D6MA 1HUQA 4N7BA 2IVNA 3DS8A 1TFUA 1GEEA 2H2HA 1KZ1A 1ABBA 1JJAA 4ARBA 2JGFA 3BKWA 4UULA 4KWIA 1GJRA 1TPYA 4IV8A 1YQQA 1T10A 1M6NA 3W7BA 4ZT2A 2JFXA 2UUCB 3M6MD 1ZIXA 3GRYA 4C6TB 5KSWB 5JS6A 4KH5A 4RVGA 1V25A 1P5FA 2H08A 3RTVA 2BTQB 4TTVA 4BC0A 3UE5A 1Z6TA 3KUUA 1F4PA 1KR2A 2O2ZA 4A5BA 3EWSA 1JEQB 3H5VA 3B8EA 5AVZA 3R8CA 1XHZA 3IPLA 1K73O 1KU0A 3O1JC 1EXQA 4Q47A 4EEZA 2GXAA 1X1TA 1VPTA 2PEYA 5JADA 5JO9A 2FN7A 5FL3A 3Q2OA 1PQPA 4R3WA 3PNQA 1P1RA 4FFOA 2OC9A 4PZDA 3AVVA 1NK6A 1N9GB 4WK6A 1P62B 1Z5VA 3B78A 2J07A 2JRLA 3D1LA 1FJHA 1GLGA 5BN9A 4FVTA 4CEDA 4QPNA 1P1BA 4BL5A 5DNWA 3ONEA 2NO1A 4UBJA 5IK2D 4GKKB 1KJYA 2WYIA 3CW8X 1NZJA 4JR1A 3S3TA 1AF7A 5KYUA 2LKCA 4QU0A 3AVFA 1Z0AA 4L9RA 2AEMA 3FA2A 4CDRA 1UADA 1YWGO 3S55A 1K4KA 2GCOB 4TROA 1HJRA 3TE7A 2P3OA 4I2VA 1EO1A 4PZUA 4X20A 4DV2B 4I9NA 1V16A 3KT6A 1M90O 5HK8A 1U5AA 4K41A 1Q8IA 3MJ4A 3UC5A 2MCFA 4ZRNA 1Y0BA 5HJ7A 2BCGY 4KVFA 1SZJG 3W2TA 1XJQA 5J5AA 4Z4CA 4BB6A 3ZQ6A 4L3QA 2WJYA 1DHRA 2HL6A 1UMCB 4EBFA 4Y2UA 5EUBA 5AVUA 3E53A 3FDZB 1ATSA 4KX5A 4ZDIA 2E48A 4XJVA 4A57A 1NDQA 2EWVA 4I55B 3UAYA 1LJLA 1X87A 3WZ2A 3C6TA 3A1VA 1YGPA 4O8KA 1TA0A 3QG1A 3CQ8A 3LRXA 3N5KA 6REQA 2HLDD 3SJZA 3N70A 4ZZ3A 3OCJA 2VG6A 3SK3A 3EZ9A 3R5XA 4TZKA 3ZKWB 3HP4A 4CM9A 1JMVA 4IVPA 2X5OA 4G2TA 4FLVA 1NW4A 3NP9A 2DETA 2O19A 2Q6TA 3V4LA 3RSFA 3FOBA 2W22A 4YBZA 2QRHA 3THWA 2X4GA 4DLVA 4LQCA 3R3HA 3T1NA 4GWLA 5KOIA 1ZFNA 2BSXA 1DQPA 1VE3A 3CWZA 4WINA 1SOAA 1Y80A 2HF4A 1H22A 3W2EA 5A05A 4IRUB 3MJHA 3KXPA 3FRIA 4G0VA 5HCNA 2A1IA 4ZGWA 2QYHA 1NSTA 2GYYA 3T4UA 1CNMA 4L8FA 4PU0A 2IJGX 2Q0SA 2J0VA 2ZZKA 4A6DA 1RHMA 2QA5A 1ARZA 1WCIB 3U3KA 5H82A 2BFOA 1HRDA 4LZOA 2J41A 4FMDF 1Q50A 4UCWA 1Z05A 5I42A 2FDCA 2Q1UA 3OIDA 1M6HA 1KXPA 3LX8A 3NVMA 1I32A 4MXDA 2ASPA 2ZJ0A 3GP5A 4KAZA 3OJUA 3ESXA 1P6QA 5EHIA 3MAQA 5KYTA 5M1OA 4OVKA 1SIBE 2YICA 3UB3A 1BMQA 5K0BA 3BSWA 1A8SA 3R3JA 5CCBA 4O4LA 3G68A 1O03A 3T5BA 3HFRA 5E7QA 4FK8A 1QQNA 3IJEB 1XPOA 3JRWA 2YOHA 3D6TB 1YHYA 1EUZA 4Q1CA 1SQKA 3T7EA 1DT3A 3LWBA 4B0OA 5CVCA 5LD2B 3LCCA 1NKEA 5CFMA 5BSTA 1E2PA 3DLBA 3WNZA 3MW8A 1JIQA 2CWWA 3HJAA 3ZZUA 3RLFA 3VR4H 5J58A 2CFOA 2CNLA 3H05A 2JJQA 4DT1B 1YQDA 3IEXA 4EWLA 1FSGA 1SKBA 4TYMA 5DSTA 4EMBA 2ZJ6A 3QGMA 3PSAA 1OLUA 4DQUA 3FIUA 1JPVA 1PSWA 1JNXX 4NEGA 4BCDA 5KPTA 5DHFA 3QVMA 4HT3B 1ZBFA 1XMJA 2HZ7A 3HEBA 3IMKA 4PQGA