1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN AF1318
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
4KPYA 1U2PA 3HSTB 1KRPA 1GOAA 1RXIA 3KG2A 1E6MA 3AVLA 2IS3A 4L85A 4LY7A 2IPMA 1ZH4A 3AA4A 3B6PA 1HQEA 4CF0A 1NATA 3NF9A 2HHQA 2XY8A 1MU2A 3QEWA 3O1JC 4F06A 3HK2A 1TJYA 4DTSA 3EDCA 2X6SA 1WSEA 2G8VA 2XY6A 4B9UA 4QAGA 4LRQA 2FVYA 5FBHA 3N0XA 1WSGA 1NXPA 2FBYA 3QLUC 5DCLA 4N41A 1REVA 2HPHA 3B2NA 4MQ3A 4FZXC 1VKRA 4CHQA 3OYJA 1MVOA 3NF6A 2A9QA 3K5NA 1T05A 1M2FA 5EWJA 5TQ2A 4FJLA 4MQEA 3R0JA 1ZYQA 3T95A 3V9SA 2D0CA 3K5MA 3L49A 4KHWA 3GYBA 1XWLA 1SRRA 3IDOA 4B9SA 4HCBA 1CYEA 1D5WA 4TSXA 1RBVA 3SQ1A 1Z18A 4UHJA 3KJXA 1IG9A 4DQRA 2HVIA 3L6UA 1RDDA 4RW9A 4CJQA 4JA2A 2H3HA 2G8UA 3LOPA 4EVQA 3TARA 1WSHA 1BDIA 3RVOA 2DFFA 4BDZA 3VA3A 4BDYA 1DC8A 4HVJA 1SL0A 1KCFA 4EYGA 4NCAA 3AO3A 4W5NA 1A2OA 4YRZA 2HJ9A 3RVPA 4CHOA 1JDNA 4FLVA 4DS4A 4FLYA 2LBPA 4IG0A 1WN7A 5KGXA 2CWDA 5EU7A 4Z4CA 3IRXA 1C0UA 1WAJA 2EHGA 4RSMA 4XAQA 5CZ1A 1DCFA 3MEGA 4DTXA 3AO2A 3QLVC 4BE0A 5TPWB 1JXBA 3PX0A 4O4GA 5KC9A 5C5EA 4G0OA 3H5IA 3OYAA 2ETJA 3HO1A 2FKAA 2ATQA 3NAEA 4KAZA 5C25A 4JS5A 2OQRA 3KSMA 4DSJA 4CF8A 1S1UA 2AJQA 4FZYA 1NK4A 4KI4A 4RKQA 4E7PA 3QIOA 1D2AA 1BQNA 4J2AA 1TVRA 4PA1A 4O5BA 4HNSA 3QELB 5IUKC 2ID7A 1D4ZA 1MIHA 2O20A 1RT5A 1R8JA 4O1IA 3HS3A 5KGWA 2E4XA 2RJNA 4CEOA 3H6GA 3MXMA 1KSPA 3IAYA 5KQMA 3DGEC 4PUOA 2CHFA 3ZT0A 2JLEA 4Q0BA 1LJUA 5TPZA 1ISSA 4I2PA 3HSYA 4FJ8A 4FM2A 1X9WA 4EYQA 3Q41A 3PO5A 5HBMA 4KK4A 4N76A 4RW7A 5D2CA 3RRHA 4Z0UA 2OZSA 3QLUA 3AV9A 3V81A 2RGYA 2MYTA 4DWIA 3GBVA 3VQ6A 3E3MA 3LFTA 4NCBA 4EZ9A 1ZDMA 4KV7A 4E1MA 4PZ0A 4I9QA 4HCCA 5BR1A 5ED4A 3VQEA 2GV9A 4DQQA 4XIUA 3VA0A 1EXQA 4XARA 1C0EA 4LE1A 4QPJC 3JTEA 3RVNA 1SV5A 5J2PA 1ZGZA 1USGA 1TM2A 1LBIA 1PNRA 2YHBA 1APBA 3DI6A 1RTIA 4Y9TA 3ULDA 2FC0A 1YMVA 2B5JA 1LWCA 2PE5A 4DTNA 4QYWA 3QERA 4DFPA 4PEVA 2FLWA 1UA1A 2RF2A 1U47A 4BE1A 2QZJA 3L8BA 1UOCA 1ZVVA 1S9GA 3DM2A 1KMIY 5KC8A 4XASA 3TAGA 3DRSA 4HNQA 3EZ5A 3VNAA 3AVGA 2JBAB 2JRLA 1FKPA 4KB1A 2B4AA 4DU4A 1TKXA 5IUNC 2I5JA 4DU1A 4FE7A 1JYFA 2F96A 4LE2A 3LUKA 1ABFA 4IG3A 4KMRA 3HPGA 4G0QA 4RXUA 5FRNA 2A1SA 4OGCA 1BVHA 3RRGA 2VG6A 5IEBA 4LZLA 3FFTA 1XWWA 5EWMA 4CJSA 2DFEA 2M1ZA 1PNTA 1P6UA 3DRRA 4YCSA 5KRTA 4B8CA 2E6LA 3LP3A 3QEPA 4B9TA 1BI4A 5SWMA 1SKSA 1PHRA 2JVJA 3RH0A 2AYXA 3JSMA 3O21A 2A9RA 4RU1A 1WAFA 4FW1A 3T19A 2KTQA 3HP6A 2V0NA 4CGDA 3GA5A 4CJ4A 4M3ZA 2WJWA 4I7FA 1Y1LA 4CJWA 1B9FA 1OXBB 5DTEA 4RY9A 1B9DA 4OKKA 4FLXA 1RDCA 5HSGA 3MIZA 1Q8IA 1LBHA 1JLFA 4F8JA 3H08A 2I6FA 4FLWA 1VSEA 4M45A 4FJ5A 5J2MA 3RVKA 3AVMA 5IUJC 3SQ4A 4BE2A 1BL3A 4QOZB 3AO4A 3OYDA 2QSJA 4M42A 2LPMA 2E4LA 4CEAA 3RMAA 2VUIB 4NV3A 2LP4Y 4IKFA 2DTUA 2RKIA 4E7JA 3TAPA 4EY3A 3LUCA 4CGIA 3AA5X 1U4BA 1NJYA 1HMVA 4GW6A 4CHYA 2F8SA 3QEVA 4F3OA 3ZSRA 3SM9A 2ZQBA 4DQSA 3CLKA 2RDMA 3EQZA 4CK2A 3OYMA 2PUCA 2PL1A 4YGXB 1K68A 3EAFA 1KLMA 3GV0A 1S9EA 1GCAA 3LZJA 4D6YA 2FN9A 4TMYA 5HRNA 4RK6A 6ABPA 1NJWA 3OMXA 4MPTA 4B09A 2QW1A 3LWLA 2A1RA 5JNWA 2YNHA 4B08A 2BGGA 1ZHHA 3ZT1A 3V9XA 1QMPA 3BRQA 3SZ2A 3K9CA 3H5TA 3V9WA 3K57A 3CM5A 2PUEA 3EQ2A 2VG7A 1PEAA 3ZSOA 3MEDA 1RTDA 4MRMA 3SUOA 4AHCA 4XLTA 2RPIA 2PKXA 3MXIA 3QEIA 4DQIA 5HLFA 2A9OA 1U49A 2P4UA 4CFDA 3NNDA 4KVFA 4WXEA 4DLEA 3OYGA 2QXFA 3Q9SA 4BWJA 4AH9A 4O44A 3MYYA 3OYKA 4CE9A 4Q7EA 5T3YA 1TK5A 2YHAA 3NHZA 2A9PA 1RPJA 4QYMA 3GRCA 1F4VA 2WJAA 4JS4A 1L5YA 2IDOA 2JB9A 4CIEA 1NJZA 1DCMA 1DBQA 3MAQA 1L3SA 1U48A 3IP5A 3NH1A 4PICA 3AVIA 3NBPA 5IEJA 4CHNA 2Y1JA 1QO0D 3I09A 1F51E 2Z1HA 1Z13A 4XXHA 1JFSA 4MQFB 3QX9A 4KFCA 3SNKA 1UAXA 4DSIA 1L5UA 4FJJA 2GWRA 5KQPA 4KHSA 1RZRD 1BQMA 1BHLA 4BWMA 4HYEA 4NCGA 4E19A 5BRJA 3HPOA 4OGEA 3DRPA 3AA2A 9ABPA 4FCYA 3VQ5A 3EODA 2J48A 2XY5A 3CNBA 1EFAA 3K4HA 2PUAA 2FBTA 2IOYA 1YT3A 4RY0A 3ITHA 3NGYA 5CNKA 1J56A 3MECA 5B3JA 4FJIA 3P9YA 2OPRA 1TV6A 4DSEA 1NKEA 3N0WA 1LAVA 3I45A 3VQAA 4DSFA 1LV5A 1NXXA 4KFBA 2FEPA 4E3SA 2X78A 3O2SB 3OJSA 1I3CA 1WNSA 1D5AA 5KI6A 3RMBA 1LW0A 4RK5A 3IPAA 2HNZA 3BDPA 3NGZA 4E7IA 2KZZA 3KTOA 2FSPA 1VRVA 1VRUA 1BGXT 3IG1A 4E89A 4DTRA 3A0UA 1J9AA 4CFAA 1KFDA 4MQEB 4B9NA 3LUGA 1EWTA 3K59A 3L3VA 1NK9A 4F3TA 3I0RA 5FDLA 3L2UA 4N5SA 3KK1A 1CEYA 1Z17A 1C1AA 3LKVA 4DTMA 4MQFA 4P1ZA 1D1PA 3EY1A 2E4UA 3T8YA 4DF4A 1NOZA 4MR7B 3LWMA 4ICLA 1D8YA 3HUUA 3RMDA 1GUDA 2IAJA 3QNOA 4OVLA 2PAFA 1I39A 1UDRA 4MGEA 2FQWA 4CJVA 3OS2A 4G0MA 4WWHA 5JNSA 4DG1A 1DJMA 2N9UA 1NTRA 3AVNA 4F11A 1RBRA 1RXEA 1YTUA 3F6PA 2HB5A 4OKEA 3OLZA 2D0AA 2FMHA 3DOKA 6CHYA 1U8TA 4HTUA 1KTQA 3NHGA 2ZAYA 4Z4HA 3DMJA 2QR3A 3OJUA 3CS3A 2CHEA 1RILA 4K8XA 1Q9YA 1DC7A 3N53A 3VQPA 4RV5A 4IMIB 3O75A 2OA8A 3OS1A 1PEYA 3O1HB 3JVDA 5TPWA 3U3YA 1L3UA 2O4IA 5CNIA 4RK4A 3S3NA 3NNNA 3QEMA 4M3YA 4ETNA 3O3HA 4N47A 4IGAA 1Z25A 4P98A 1XHZA 2M98A 3KYJB 3F6CA 3KLNA 4ZJPA 3HCWA 3SG0A 1M2EA 5TQ0B 2VK2A 5FRMA 1EWKA 2IPNA 4YV7A 2JVIA 2X7XA 3DLHA 3O2QB 3FFIA 4ELVA 2GBZA 1HYZA 3A0RB 2D5RA 4LH5A 5IBQA 4L8RB 3QELA 1IO2A 2MSKA 4M3RA 4N0QA 4CEDA 3OY9A 1B00A 3KLFA 1VSDA 3L3UA 1JL2A 3C3MA 5FWXB 5JNVA 4MR8A 3MQ4A 1ABEA 3TB6A 1WSIA 1AB6A 4GNRA 1NXOA 1UWBA 1JX6A 4OKJA 1P6QA 3M8RA 5KRSA 1TAQA 1ZN2A 3T6KA 1T8EA 1TK8A 4RWEA 2NT4A 2EX3A 3HVRA 1T7PA 3SPYA 1MAVA 2FBVA 1QSSA 2PUBA 4H60A 3HZHA 4M3WA 4CEBA 2FQXA 4CIFA 3H6HA 3WNFA 1BDHA 2NZVG 5IULC 3V6DA 3PV8A 4FJNA 5J1EA 1URPA 2P51A 3HPHA 1QQCA 1R0AA 1IH7A 2IOCA 3S9HA 3EGCA 3C6TA 3KS9A 1RT3A 3AVJA 1SXIA 1XHEA 4N03A 3VQQA 4DSKA 3QLVA 4YLEA 4DADA 5HRPA 3EYZA 1QHTA 5CHYA 3SUPA 4W5TA 4PWDA 4Z0NA 3RQIA 1RNHA 5PNTA 4AHSA 3TANA 2GUIA 1JYEA 3RVSA 3LDSA 2P5GA 4E1NA 5KTQA 3CFYA 4CERA 3RR8A 4RK1A 2WOMA 4DTJA 3OS0A 1SXGA 3K5LA 1OXKB 1NXSA 3TWHA 5DKFA 4JRPA 2VWJA 1RT4A 4O0IA 3CM6A 2X6NA 4IFVA 1JL1A 4IILA 4KQ9A 2ITGA 1BIUA 3V4IA 1QQBA 3H1FA 4C8KA 1YMUA 4CHPA 3C95A 2PUGA 1RCHA 4EUKA 2QVCA 1VRTA 1DCKA 2GBPA 1EKEA 2IPLA 1EP4A 3FGZA 2MYPA 3K2PA 4WZZA 2HHTA 3HP9A 3CU5A 1JLGA 1FFSA 3CYMA 5TQ0A 2HHVA 4FJHA 2LIVA 3O2JA 3VQ8A 1J53A 4OBBA 4YS6A 3Q7RA 2YKNA 4H8KA 3TAMA 3LP0A 1BCOA 3VQ7A 3JPWA 3V9ZA 4YFUA 4KO0A 2PUFA 2LUOA 2Q5CA 3AVBA 4PYRA 1FK9A 1ZESA 2FMIA 1IIBA 1P8AA 1NXTA 3W9SA 1HYVA 2B6AA 3QLHA 2XHBA 1VLZA 3HM9A 4OLBA 3BREA 3CRNA 4KNYA 1S5JA 3O4NA 3QIPA 4MFBA 4CEZA 4CFCA 1ZITA 1EETA 1NXWA 2VYCA 3SCXA 1CXUA 3C3KA 1JFVA 1D9FA 4PY5A 4MR9A 1ZBFA 5I42A 4DN6A 3MF4A 3L2VA 4E7KA 1LWFA 1A5XA 1VSJA 3K5OA 4Y1DA 4H3KB 3QNNA 2FW0A 3HYFA 1IKYA 4KV8A 3D8UA 3P1GA 2KQ2A 4KHUA 2B4JA 5DMRA 1UA0A 5F64A 4G97A 1RBSA 2G8IA 4KB0A 3JYTA 1NK7A 1HPZA 2IYNA 1JXEA 3SV3A 1TL1A 4L4UA 4FJ9A 4H3HB 1ISRA 4GVMA 1S1XA 2RJOA 4PQUA 1SUQA 3H5WA 5DGCA 3KD1E 3OM1A 1C0TA 2AYZA 4CF2A 3KLHA 4J2BA 4LDZA 5KQLA 4G1QA 3QLTA 4Z9AA 4MS1B 1NXVA 4MS3A 3QK7A 4D74A 1KGSA 2ID9A 3Q15C 1TVMA 1CZ9A 3ROFA 1M5TA 5CYQA 3CKMA 1H9CA 4Z4GA 4E0DA 1JLBA 3QEKA 1LK0A 3QX8A 3PUFA 1FQWA 4RZSA 1DBWA 1C0MA 3P83D 3TI0A 3ZSVA 5HM6A 4RXTA 1ZBHA 2OPPA 3S99A 4J2EA 3HT3A 3H5VA 3T1AA 3SJJA 4H4MA 3U3GA 4MYRA 4B3OA 5TQ2B 3EJWA 3C6QA 1O1WA 3K58A 3KLIA 1RBUA 1JLQA 4RK0A 3AO1A 2PJUA 2QK9A 4ZMSA 3HDVA 5SZTA 5TE9A 2HNYA 4FLUA 3U6FA 1VSIA 4O1HA 3SI6A 3ALYA 3QO9A 3QEXA 1JWLA 3HV2A 1VSFA 3LUDA 5TPZD 1ASWA 4KZKA 4Q6BA 2YNFA 4CJFA 4CF9A 3D0PA 2Q3SA 3OVNA 3O1IC 4G86A 3CFOA 2HQRA 4G0PA 2MYUA 3E01A 4AILC 4YR7A 2GX6A 1VSHA 1FSPA 5I3UA 1N5YA 3N8IA 3UUGA 3NH0A 3V1OA 2PMCA 1HNVA 1TKTA 4DTPA 2FN8A 3WNGA 4O55A 1U0SY 1NY5A 1U2QA 3TX6A 1G15A 5JNUA 4ID1A 3VNBA 2PLNA 3PO4A 3IPCA 3OYBA 5ABPA 2HVHA 2HW3A 1CHNA 3SPZA 2GKGA 4ML3A 4B9MA 3LKBA 2KW4A 1EAYA 1K66A 4PE5B 3ZSYA 1RBTA 3I0SA 3IS9A 5C5CA 3KKEA 1QO0A 3ZCMA 3KLGA 4DFKA 4RK7A 3MA0A 1LWEA 2DFHA 4HHTA 1JF8A 4N56A 2R47A 4I2QA 4KKOA 3LALA 4F8RA 4Z4EA 4ELUA 3QINA 1RZRA 3C97A 1FFWA 2FBXA 2PL9A 1Q9XA 3JS5A 3IP7A 3URMA 1CLQA 3MXJA 4IRXA 2P5OA 3V1RA 4FK4A 3CG0A 3OLWA 1DRJA 2JBAA 2RN2A 4CESA 1U04A 2OPQA 2YV0X 2FQYA 3AO5A 4I9LA 5JS1A 3ZSXA 1ZH2A 4CECA 2OYQA 5JNRA 1GOCA 3HJFA 3RVQA 3HDGA 3NHMA 4ZPJA 3RMCA 1KFSA 2BANA 2YNGA 3O3GA 1RT1A 3FMVA 1YVUA 4CGHA 4HUEA 4DQPA 2FMFA 4FB4A 1TAUA 3H1EA 1GOBA 1NOYA 3I42A 5HKOA 4F2SA 4Z4FA 4LD0A 1SL2A 4FVMA 1HEYA 2LSNA 4BACA 3T38A 3KKSA 3ILYA 3O4QA 4BDPA 2HHSA 3DBIA 4WE1A 3DLEA 1NK6A 2Z1IA 5CYMA 1QE1A 1XI1A 1PUXA 2JGUA 5JNTA 4FK0A 1USIA 1F21A 1HYSA 3OO1A 4HUFA 1LAWA 4OPJA 2QU7A 4FM0A 4QICA 4NYNA 3AVFA 4KRFA 1D1QA 3SAJA 5J2NA 4FJKA 2FMKA 1KRXA 5EWLB 1BDJA 2FXIA 1VPWA 3RVMA 2FLKA 3M9XA 4O5AA 4IFYA 3LUFA 4F12A 4ZMRA 4S05A 3CFRA 4E7HA 3HEBA 1L3TA 3KIOA 2G8WA 3OLVA 2W42A 1QKKA 4CJLA 1E2BA 4WT7A 1QQAA 4FLZA 4TLLB 1B92A 4TLMB 3HUTA 2IC3A 1DRKA 3LTEA 3F7NA 1RT6A 3KTQA 1JLCA 4HNRA 1QP0A 5FWYB 2X74A 4D6XA 3VQDA 3PX6A 3ISNC 4RW6A 3AVCA 1E6LA 3NF8A 3G1WA 5CNJA 1KLNA 4KHQA 5FWXA 3O3FA 1JH9A 4NQRA 1CXQA 3OQMA 2KZMA 4MAAA 2CD7A 4EVSA 3DOLA 1AB5A 5TQJA 3DLBA 1YS7A 1J54A 3M8SA 2R48A 3CG7A 1W25A 2HQOA 1JLKA 2IPAB 1JL3A 4OPKA 1D9DA 4RW4A 3LMKA 2IGIA 4N0PA 1YK1A 3N0RA 1YK0A 1WSJA 3SQ2A 1ZBIA 2GI4A 4W5QA 4B9VA 1IKXA 4RKRA 1L5ZA 5DLEA 4EGSA 3BBLA 1DG9A 3A2FA 1YTAA 3VN5A 5C42A 3H5LA 4Z99A 4KTWA 1KRWA 3LPUA 1QSYA 5I4CA 4E7OA 4RDCA 3LP1A 5CZ2A 2Z1JA 2HQBA 4WXMA 2E6MA 3LAKA 3B6OA 2BE2A 2YKMA 1NKCA 3FDFA 3LPTA 4CCHA 1BIZA 5FWYA 8ABPA 2HHUA 1CZBA 3OYHA 1USKA 4CJRA 4B9LA 3KLEA 4CK3A 1DLOA 2O4GA 5CY4A 1VK0A 3KKRA 1LW2A 4OG2A 1QPZA 1E6KA 1M5UA 2B1JA 1Z2DA 1BI4B 4FM1A 1RT2A 4M3XA 3AVAA 1S8NA 2JCGA 2FEKA 4JLHA 4CJTA 1DP4A 2XRIA 2TMYA 2FEWB 4C8MA 4ZTJA 4DU3A 4MS4B 4DF8A 3GL9A 2IKSA 4K8ZA 3NF7A 4RG8A 4DLGA 3G0ZA 4M3UA 2R7YA 3SV4A 4DFJA 3M6MD 4LH4A 3TAEA 3BILA 4FJMA 1A5WA 4OTZA 1EWVA 3A10A 2OPSA 3WNEA 2Y1IA 4DSLA 3RWUA 3DLRA 4DQDA 4FXDA 1U45A 3Q7TA 4IBNA 3ZSQA 3L2RA 4W5OA 5BQ3A 4CGJA 4FLTA 3S3OA 3T3FA 2Z1GA 1ASUA 4AHTA 3AA3A 3C3WA 2WB4A 1HRHA 3ZSZA 5T7BA 4CEFA 4M41A 3E61A 3DLKA 1LJLA 2R25B 1BA2A 4FE4A 1NK5A 1RT7A 4ZYLA 2E4YA 3CZCA 5HRSA 3NBMA 1NJXA 3NGIA 2KFNA 3ROTA 4EYOA 5B3JC 4ZTFA 3D45A 3JY6A 2YNIA 1J5OA 3OMWA 3TAQA 2PZSA 1Y97A 3KYIB 4CEQA 3S3MA 3G10A 2QV0A 3P5JA 1FXXA 3SUNA 3OYEA 4M3TA 2L17A 3VQ4A 4YWHA 2E4WA 4WUTA 5EWLA 3OYFA 4LX8A 1FFGA 3C6UA 4G0YA 1QS4A 1TK0A 3KD5E 4EZ6A 4H4OA 5IX8A 4HUGA 1TKZA 3C94A 4KHNA 1BAPA 4B8AB 2VG5A 1JBEA 3HL8A 4C8NA 2XDYA 4F2RA 1ZBUA 4W5RA 3OYCA 1YIOA 3RR7A 2E4VA 3F9KA 2NT3A 1RDAA 4FJGA 2QKBA 4LSLA 2P9HA 3RTVA 3PX4A 4FJXA 1A04A 1ASVA 2KYRA 2PY5A 3HXMA 4CBVA 4OATA 4RXMA 4IDKA 1JHZA 4CJPA 3RVLA 3OQNA 3A3KA 3JVIA 1JLAA 1ITGA 3UKJA 1Z16A 4RY8A 2MSLA 4G0XA 1DBPA 3L2WA 2BDPA 3KCNA 4MS1A 3SYZA 4TN5A 4MR7A 4DTUA 3M8QA 3FFXA 4O0JA 4CJUA 3F73A 4IF4A 2HMIA 2DRIA 2XY7A 2QKKA 3ZT2A 5FROA 2QVGA 1SXHA 4MR9B 4Y1CA 4KTQA 2OZMA 4YO7A 2WONA 2OENG 3N6VA 1VSLA 2G8KA 1FKOA 5HP1A 4LDAA 3IP6A 4ETMA 1GLGA 2ZWMA 4DTOA 5GQSA 1MB0A 4MS4A 1ZY2A 1A5VA 1XC9A 1S1VA 1SL1A 1RNLA 4OLAA 3DYAA 4CK1A 4ID5A 3ZSWA 3VQ9A 1WETA 3LUJA 4E7LA 5EWMB 2F8TA 2FTKE 4Z9BA 2DY4A 2PYJA 5FBKA 4OJRA 2ZD1A 5CNMA 4ZHRA 3QEMB 3NE6A 3O74A 3DGFC 4YNQA 4MLCA 4LE0A 1ZGGA 2KFZA 1Z26A 2ZE2A 4MS3B 1TLFA 3NH2A 3OO0A 1RTHA 3SUQA 3OQOA 4KTZA 1N6QA 2XO7A 3OYNA 1QSLA 1JFTA 3NNSA 5DK5A 3THVA 5KWSA 3TO5A 2L19A 4FZZA 2G8HA 4CJ5A 4EP5A 4XFKA 4AHRA 3TAFA 4CIGA 3BGRA 1VSKA 1MB3A 1GUBA 4ETIA 3M8PA 3RVRA 1P2FA 1DTQA 4S04A 3DLGA 3SNNA 5E41A 2IDMA 1S1WA 4KK3A 3G85A 4KREA 2WRZA 3OYIA 4EP4A 4CGGA 3SQNA 3M9WA 3IP9A 1YS6A 1C4WA 4RS3A 4CJEA 2E4ZA 2PYLA 3GT7A 4RW8A 4NYFA 4EVRA 3VQCA 3V9UA 1BCMA 2WWVD 2HSGA 3CQ8A 2WMYA 2NUBA 2HHXA 3I5AA 1DTTA 3TD9A 2HHWA 3CTPA 2L18A 3H5OA 1JLEA 1QP7A 1HQUA 1EHCA 1S6PA 5HRRA 4JAVC 1A0OA 1X1PA 4Q6WA 5K14A 1QP4A 1BISA 3KK2A 4R5PA 3OLXA 1C6VA 5C24A 1TGOA 3DZDA 3LANA 1SD5A 3ZT4A 3TMYA 1C1BA 3Q7SA 2WY2D 1WLJA 3JPYA 2QXYA 3OLYA 1SKRA 4MR8B 1I3AA 2NZUG 2PUDA 1K6YA 1DZ3A 1ZAYA 4AHVA 3UIQA 1IKWA 7ABPA 4GPAA 2VWKA 4FYDA 3LUHA 1KVCA 4M88A 1EX4A 3SY8A 4MRMB 4EYKA 3KHTA 4IMJB 4JB2A 3EULA 3LAMA 5D3GA 1S6QA 4C8LA 3NCIA 3BRSA 3CHYA 2MSWA 3WNHA 1TMYA 2JK1A 4FK2A 4Z4IA 3UK0A 3LP2A 4GMJB 1NK8A 4DMNA 2H0AA 4NICA 4CHZA 1GCGA 2L2QA 1JKHA 4F4KA 3VQBA 3ASMA 4QCLA 3FFWA 1JDPA 1Z2EA 3MEEA 4FJ7A 2HNDA 3AVKA 1WSFA 3LUAA 3CG4A 5IC5A 2R4QA 3I8DA 1KVAA 1TKDA 1SKWA 1IKVA 3OM0A 1HNIA 4KI6A 2MYNA 3MMNA 4YP9A 1W9HA 3N75A 3KK3A 1T03A 3KJVA 1XHFA 4JRQA 1XHXA 1X9SA 3H75A 1TL3A 5KQGA 5BRAA 3NDKA 3MM4A 3HVTA 1Z15A 1RDBA 3GBPA 4C8OA 4JASB 1KVBA 3QESA 1L3VA 5E3JA 5J2QA 1NKBA 4DFMA 2JVKA 3QETA 3OYLA 5JS2A 3KLOA 1X9MA 4JP1A 3ZT3A 4KQCA 4CJ3A 4KHYA 1VSMA 4J2DA 4AHUA 4CF1A 4MLDA 5EWJB 3CFPA 4G0ZA 3SQ0A 4CJKA 4DS5A 4ELTA 4Q5VA 5HQJA 1HJRA 4LSNA 3LZIA 3D02A 1Z12A 4JOQA 3TR8A 4CFBA 3CZ5A 2D0BA 3V1QA 4JB0A 4UHKA 3RVJA 2VUHB 3PY8A 1QNLA 1W0HA 3TABA 3ILHA 2P1JA 4CGFA 1NK0A 2G8FA 1T34A 3GWGA 1RTJA 4UQGA 4CEEA 1S1TA 3H1GA 1ZBLA 1QTMA 1C1CA 3NFAA 3L2QA 3AVHA 5HROA 4FW2A 5GOTA
chains in the Genus database with same CATH superfamily
4UQOA 5EP2A 5BR7A 3Q0TA 2VDJA 1SXJC 4J0JA 4TKZA 3CJ9A 2REQB 1SBTA 3PCTA 3A6LA 3O90A 3HU5A 3OWOA 3WL6A 3H83A 5HX7A 1MVLA 4OXKA 2IS3A 2LXNA 3L77A 1KO8A 4C0JA 3JWJA 1MJ5A 3X44A 2Y77A 2CH5A 3UCFA 4E2YA 3C3AA 3AA4A 5E6SA 2BDTA 1XNQB 3DZHA 5EXDA 2XY8A 3TIXB 2CMDA 3B8EA 1IJEA 4ZRNA 5JRZA 2FSJA 3O1JC 3VSAA 1KK0A 3KUCA 4MVXA 4TVSA 4Q1FA 4O8ZA 4EJSC 4DTSA 4L9AA 1DAMA 1HDGO 4HX2A 3F5QA 2D8MA 3FIUA 4GD3Q 3U4GA 2G8VA 4RPGA 4CKBA 2VYVA 1CUXA 1WZIA 3ANSA 3QUSA 1DPFA 1QH0A 2P6NA 4MKFA 1R64A 4BFWA 3AKCA 4XTCS 1GZVA 3DXKA 4J9UE 2DPGA 4PAMA 4U2FA 3QA3E 3RG8A 3VNRA 1W4CA 5HOEA 5ITZB 3H1AA 3PRYA 4NARA 5ALJA 3WMFA 4LN1A 4UMVA 4MUAA 3T1HK 4HPWA 3UB5A 1NT4A 3GLHA 1ST3A 3DFFA 1WSGA 2ZWHA 1VHJA 2HWWA 1KGDA 1WCV1 1X7WA 4PWYA 5F9MA 1XZPA 4J8PA 1IATA 3U7FB 2V58A 2PGNA 3EZGA 2FBYA 1ZXLA 1XN1A 2VHUA 3QLUC 3ELBA 4IH9A 2X0EA 4BNDA 1KBQA 2GESA 4N41A 3ROXA 3W2IA 1REVA 4FX2A 4CCYA 1XNQK 5IPFA 2XRZA 4OUKX 3AVYA 1JA1A 3CH5A 1QTRA 4FZXC 3SIRA 3W79A 4ZYTA 4ZTUB 1AOXA 1VL8A 4XOUA 3VU0A 1NX9A 2A9QA 3VR4A 2VJMB 3D2FA 1RYZA 1M6WA 4WK4B 2CJPA 4GW3A 1EJ2A 5EWJA 3ZU2A 1WPGA 3UPTA 1N7IA 3OPYI 4MUEA 2JGNA 1W0CA 1YIDA 3U40A 4EFKA 5AOCA 3V97A 1TGVA 5CFZA 4HMOA 2OGTA 2G6TA 4FWSA 3SD7A 2NUTB 3DM9B 4KLRA 2E1PA 5BRNA 4UMDA 4TOIA 1GTVA 4AFNA 3ZNPA 1WDKA 3X2FA 2LV8A 4Q9NA 4WKNA 5CIYA 1NSYA 1U2ZA 1GTRA 1SRRA 2PQ2A 1UBRS 4DDWA 1OA0A 2PGXA 3IDOA 3JAWA 3W5UA 1A9TA 3RYFA 3BWVA 1SUDA 3EXEA 3JR3A 1KVQA 1XDWA 3FOCA 3WV5A 1TGYA 5A9TA 5BSVA 2CBGA 1Y5NA 5G53C 3TLJA 5MN5A 1SG0A 3E15A 3EZYA 3LTNC 4KVAA 3KJXA 3B3QA 2JCBA 3U37A 2A5XA 3L84A 2WFLB 5FT9A 5K0NA 5B6IA 2ZR8A 1O6GA 3FSJX 4TRRA 5D86A 3GLFE 2H06A 4LF9K 3KLPX 5MDHA 4B40A 1ADCA 1FRZA 2YJNA 2E2PA 4JA2A 4LMRA 3SIXA 4B4OA 2SHKA 2H3HA 2WYWA 3RSGA 3H1VX 2E9SA 3REQA 3WRXA 1Z0UA 2DJ5A 4YWJA 5BR9A 4EVQA 3KVYA 5D5QA 3I56N 4M1QA 1BDIA 3FTEA 1EA7A 3NC0C 3QLEA 3AH8A 2HWYA 1DGKN 3VA3A 3H2KA 3PNOA 4BDYA 1G55A 4M1YA 4M49A 3TDKA 5IDWA 4ESVA 1MABA 2IYTA 2H4HA 2CCKA 3T0FA 1SXQA 1S3SA 2JFZA 2YICA 5J9FA 1YOVA 1SL0A 4LXIA 2QTZA 2YOHA 4EYGA 3AO3A 4INZA 1T3HA 1EM8A 1K73O 1EFVA 3C8MA 3QMWA 3UFXB 4DA7A 1YKSA 4KDRA 1AV7A 2XTJA 3S7ZA 1Y3IA 1CIPA 2X7HA 1A2OA 4NYJR 3ND9A 2FB9A 3WLMA 5KHLB 3N5KA 4J43A 1L3CA 2ZXFA 4PS0A 3C8ZA 3O7WA 4M9SA 1HWYA 4S2UA 1L6RA 2YQZA 3FYCA 4YRSA 2CL5A 4G65A 3NMUF 3D0OA 3T3OA 4G8DA 1PZGA 5LJWA 1RMYA 3AY6A 3E4DA 2Z8XA 5EZ6B 1DBIA 4BQNA 3FMIA 2EATA 5SY9A 1QVFM 3GVHA 1MQAA 4FLYA 5LBUA 1U28C 5AKKA 3LWNA 5TMPA 2X4DA 2VL7A 3I12A 2H3GX 1YR6A 1C7QA 1NQOA 2Q9UA 3A25A 3A4VA 5KGXA 3IOBA 3KYBA 5EZYF 5BUZA 4C6TB 4UBKA 4PNEA 2RHKA 5EU7A 4Z4CA 1O94D 2PS1A 3D4IA 4K8OA 4N5DA 1WW8A 1A76A 2P7HA 4B3HA 1YDHA 1XD2B 2YHIA 1T9KA 3EVBA 4AZSA 3IRXA 5I7EA 4F45A 4Z53A 3SXUB 5FOQA 4O2RA 4O2BA 3KZXA 4DR5K 2GXUA 2G0TA 4W63A 2RKOA 1QRSA 1VIAA 1OXXK 1J5EB 4BMVA 1NP6A 3QH4A 3RS9A 1SKMA 1VB3A 1DCFA 3TX2A 4L4YA 4X20B 5FDFA 1RAFA 1NSFA 2QTLA 1ONPA 1MFZA 2XT0A 4MX8A 2R79A 1JAHA 2YJ4A 1M2OA 3BEXA 4KACA 3C87A 4U7WA 4WDQA 4WX2B 2PXCA 3V4PB 2IWRA 5I3CA 1ZI6A 4QG7A 1C9MA 1JWBB 3WL4A 5JAHA 5KC9A 2QD1A 5KBYA 4MVWA 3B1XA 1K7YA 4AB1A 2IZ6A 3I3SR 3HO1A 2H0RA 2QM7A 4HEQA 4BX3A 2ATQA 3NAEA 1RWKA 2FXUA 2TYSB 4OP1A 5ADVA 1Y1PA 4WL0A 3X43A 1HFEL 2J33A 1AZWA 3IHTA 4HYYA 4E13A 4OF4A 2O8NA 1YCHA 3PPYA 2B4YA 5C25A 3V00A 1O5TA 2FETA 4JS5A 2YC4C 3I4FA 3KSMA 3ZWBA 3IPRA 3F4BA 2GHQA 1G6OA 3UAZA 5DBHX 2PAAA 4FFBB 2DQSA 1NRJB 4DSJA 2AJQA 1SOUA 2C5EA 2BIFA 4IGFA 4EECA 1T4MA 4HGPA 4JN6B 3EXEB 2R62A 4E7PA 3R6DA 5MN6A 4GI7A 4R9RA 3SXJA 4MA5A 3U4AA 1ZOOA 3PC8A 1JDSA 3SYNA 3WXMA 1TVRA 4Q47A 4EHAA 4O5BA 4HNSA 4M9UA 4HWKA 4OHOA 1C7EA 1NDHA 2P9LA 1XTPA 5FEUA 4JBGA 5IUKC 2ID7A 4PVCA 2FUG1 5HHTA 2DR3A 3J7AC 5DMXA 2Y1FA 4UXIA 1D4ZA 2PJRA 3KB1A 2BEWB 2O20A 5K8JB 1II8A 4M9ZA 1EQYA 5JDCC 5KGWA 3H5AA 3F3YA 3MERA 3P96A 5TVKA 2YIMA 4KXVA 2RJNA 4CEOA 5C3MA 2C8VA 5KQMA 1RYBA 1VI2A 1QGDA 3HJUA 4G5RA 2XVMA 1MEEA 5EP1A 4D9KA 1TKCA 2Q5OA 2CHFA 1I94K 1Q14A 3CT4A 1KZ1A 4K6FA 2G06A 4MAMA 1ZYUA 3RO7A 4A92A 1LPSA 1XPJA 2ECOA 2Q2RA 2IYLD 3ZEAA 1J42A 3M89A 1X7WB 4FJ8A 5DULA 4FM2A 1X9WA 2GN9A 2NNLD 2AD1A 4M99A 3FIJA 4QXMA 5H7XA 4CM4A 1ZR2A 2YOFA 4ERNA 4CI6A 4QSHA 1SZDA 1I14A 2V5AA 3C7CB 5GINA 4QL3A 5HBMA 4TV9A 3V7UA 3WZMA 2JJ1D 3EXG1 3SEAA 1WXFA 1I4TD 2Z1DA 2EKZA 1EZ1A 3KJIA 3QVVA 4G1BA 4Z0UA 4KN5A 1B41A 4WZBE 5CLHA 4B4VA 1TVKB 3P38A 1VKZA 1X39A 2OK7A 4QX6A 1MC5A 2UXDK 1DTSA 3NTUA 1U8AA 4Q9JA 2OFWA 1QHNA 5HK8A 2LIPA 3GBVA 4E07A 4YMGA 1YU6A 4CMKA 1ACJA 4NCBA 4ISGA 2GGSA 2JIBA 5BWBA 2ZW9A 4N6OA 2X6RA 3A1TA 2O0HA 4CZGA 4ZVMA 2WNSA 1LV8A 4KV7A 5DNUA 5J40A 1UMDA 2W0SA 4MITA 2UUBB 1U7TA 4FIZA 5DGHA 5K3DA 4QRDA 4CTKA 4IQ0A 3VQEA 5A5DA 4E6EA 1XFAA 3I6YA 2XMZA 2QWNA 2VH2A 4EY4A 4XIUA 4K8RB 5LB2A 5JJBA 4BMXA 2QTHA 3HI6A 3I23A 3QVGA 3W4JA 3IIKA 4C89A 2CL0X 4A7PA 2H31A 4IOMA 2ZBPA 4X3OA 3RROA 3OKAA 5BY2A 1GAXA 1QKJA 1SO8A 4EW6A 1BX3A 2MSNA 5DV9A 2D2VA 5C52B 1X9IA 2P6RA 2I7TA 4LE1A 4MDBA 1O9BA 2XLBA 4RANA 1T6DA 2AW3A 2RHWA 2WSMA 1VHXA 3AY9A 3JWPA 3N5CA 4LZZA 5BQPA 4MQ5A 4YLGA 4DV2K 3RVNA 4BKMA 5IHPA 5JJ5A 2FZ5A 4ASUA 3AWIA 4KOAA 4LRYA 2AE1A 1TL7C 5ED0A 4BVOA 2OFPA 2ZSJA 5FLKA 2B8WA 3WC4A 1KOGA 5B7GA 1M6YA 1J8YF 1LBIA 4KGVA 3L4EA 1XVTA 4H77A 5COBA 3HSKA 2QWQA 4MXDA 5FPTA 3VDQA 4JU8A 2VRBA 2B5JA 2CHVA 1ZCFA 2BWJA 4P54A 5AHRA 3LRXA 5DXAA 2WWWA 1ONSA 2QMUA 1NDQA 4HY3A 3VJLA 5HTOA 1N9GA 1F9EA 2P2LA 4HN2A 1UIRA 3GDFA 1GL7A 1PTJA 4PEVA 4XWKA 4RTMA 2FLWA 3QTBA 3V2GA 4JR2A 3KQNA 1G64A 2A5FA 4GPIB 3MWEA 2OBNA 2OXEA 2OHIA 1UOCA 1IY1A 1C9YA 4JC4A 1S01A 2Y93A 1S9GA 3DM2A 1QMGA 4OXYA 1CDOA 4L8WB 4XASA 3SNHA 2IEBA 4CLEA 5KTSA 4LPKA 4G9EA 1ZQ1A 3BHJA 3E0QA 4R2LA 3AUYA 5E7MA 1E1DA 1P2UA 5GZ6A 3UXMA 1FKPA 4M9XA 4V0OA 2B4AA 4PLPA 4MZXA 3WGQA 2IA5A 4B33A 1N3LA 2G4CA 4QU8A 1DQSA 5IABA 1Q0QA 1TKXA 1JMVA 3HR7A 4DU1A 4H7HA 4IVPA 4AJLA 3NM6B 3S8YA 2JS7A 4FE7A 2F96A 4V03A 3CTMA 1N5DA 3F78A 4O4JB 2IXFA 5EGNA 4BN0A 3AB7A 5DLDA 1ZX1A 4PRZA 2HWKA 2YS7A 3FUXA 1HI9A 3Q5DA 3N05A 3I73A 4EKGA 3A7DA 4UHFA 4HB2A 3RJ5A 4WHMA 4F8JA 4D43A 3SBGA 4N0DA 4G0QA 3IX7A 1I9GA 3ZWXA 3PCRB 3U7EB 5AVXA 4GZ6A 1BVHA 1ZO8A 2DY1A 2WYVA 3TAUA 2W2LD 4RENA 1I80A 1P4JA 3MN6A 2QPAA 2VYND 2WFLA 3C7AA 3FFTA 4JQOA 1ORRA 1XWWA 5U4QA 5A2GA 5IH7A 5LMZA 4TVOA 1P6UA 5KQRA 4MH0R 2ZB4A 5KRTA 1NUHA 4LTDA 4B8CA 3UJAA 1Y89A 3ZTYA 4AKTA 4C6RA 4CV1A 3QEPA 1QE0A 1BI4A 3D3EA 2I54A 1J9EA 1QX4A 1PHRA 2E5LB 4KHZA 4AVYA 2AYXA 5HKKD 3K0HA 2C0CA 2VHYA 5THQA 2PL5A 5SY6A 2A9RA 4RU1A 1N77A 4PYJA 3U9SA 1T4CA 4BNUA 1CB0A 3BF8A 3TECE 4HUQB 4FW1A 3T19A 2QGNA 3ZW7A 1UBLS 5E26A 2XA2A 1G0NA 3G79A 3MCAA 1E4GT 1OBFO 2O4CA 2DT8A 2V0NA 4Z8XA 2CXQA 3PTAA 1OX4A 4J0CA 1SUFA 1IZ7A 4FWIB 3GA5A 4CJ4A 2W70A 4EY6A 2ZIGA 2KW5A 1Y5MA 5M1KA 4I7FA 1WVIA 2IYUA 3I5UA 1P2VA 3JASB 4HDMA 1B9FA 5GONF 3HDJA 4KDCA 2X8AA 1B9DA 1FVXA 1X77A 3H2BA 4H3VA 2F1HA 1RDCA 4RABA 3C43A 1M74A 4GG1A 1M8KA 3D8SA 4XI9A 5AKXA 2I6FA 5D5HA 5BPNA 4OVKA 4FLWA 1H6DA 5B53A 2W71A 1O94A 4MWZA 3T7SA 4YA6A 3I83A 4HXGA 4WLUA 5J2MA 3ZJUA 4IEIA 3IAXA 3VNUA 4KR6A 3RVKA 1F3LA 3CPSA 1AJEA 2C4KA 4KTTE 1AURA 3ZIUA 1HFWA 4JX8A 4EX7A 3AI1A 4ZQBA 1BL3A 4QVIA 4QOZB 3DVQX 2A1TS 2W00A 4DIUA 5JDCA 4M42A 2LPMA 4C3OB 4CNQA 2GFQA 3BRCA 3MWTA 2GK4A 3ECSA 4HAXA 2ZEJA 3C3YA 2UYOA 621PA 2DERA 5F33A 3UATA 3EKUA 4FSVA 1N57A 2Z6VA 3V1MA 3E8SA 3ZCPA 4C7XA 3L0CA 2W2XA 1Z5WA 2ZAGA 3DMHA 3QUTA 4G1CA 3OAAD 4DWOA 1N8RO 1CQPA 3PI6A 4P3KA 4ZOAA 3HCNA 4QASA 1BJKA 1M2HA 2EXXA 3LIPA 4QOJA 1NJ1A 2FXVA 2E3JA 3G23A 3SX2A 3QF4B 2WI8A 2D4AA 1U2SA 2F8SA 4MVJM 4PX3A 4X8HA 4B34A 5FNVB 2ZQBA 4DQSA 3BTUA 3MBOA 2B82A 3AYXB 3CH7A 4O08A 3GIDA 1M1UA 3R3UA 1P1HA 3BIJA 1P74A 2O2EA 3U4DA 2BGUA 4PZAA 3EQZA 1E8DA 5GADl 1L4MA 2BC9A 4FQ7A 3F97A 2YQ5A 3KZMA 4I14A 2H1CA 3PNMA 4BAZA 1TEHA 4CI9A 3AL3A 1E2GA 4M1EA 3S29A 3PQ4A 3G9ZA 1M6VA 2PMKA 4PZEA 1QIMA 3I37X 1XRJA 1B93A 2C8KA 1KI2A 5E9JA 2AFHA 5BYBA 4DUZB 4TMYA 4RTLA 3PFBA 2FE4A 2H54A 2RAUA 4N7MA 2E7ZA 3ZWDA 3SWWA 1YSCA 4RK6A 1SCBA 2NMVA 1NJWA 2F4NA 3GT3A 3TKYA 2QMHA 3H05A 2Y66A 4B09A 4ZMBA 1YFJA 1V1MB 2Q5HA 1W29A 2OP1A 2P2GA 3GEHA 3IALA 4AL4A 4CIDA 2C5LA 2WZCA 3OF2A 5A0FA 4CKCA 1HDOA 5JNWA 5K09A 2FR8A 5L3SB 4DA9A 4B08A 3PXBA 4H1UA 2QTVB 3WISA 1DV1A 3IA2A 1EFTA 3P4XA 1FK8A 2Y3IA 3QNMA 3RG2A 2PVSA 4RSGA 3SZ2A 3CGGA 3CNNA 4FSXA 3W0LB 2I1LA 5DSZA 5EIWA 1FMJA 4RPJA 3G2LA 4NU6A 4A27A 3DV0A 4XJVA 4IH1A 2MDTA 2HIMA 1YI1A 1MH1A 4RDIA 1VBNA 1AX9A 1UPCA 1PEAA 2YN4A 3PITA 3UK1A 2I29A 4MRMA 3RKSA 4DQVA 1V26A 3AESB 4J0IA 3THWB 1OX4B 1COZA 3R0IA 3GGDA 4Z4QA 2V7GA 3L0BA 1DWOA 4DZZA 3MXIA 1QBKC 2DH5A 1IN8A 2ZSDA 3EA0A 3AKDA 3OQ1A 4JLVA 4J2OA 5LA6B 2MIIA 3TKLA 3VFDA 3VR0A 2Y0CA 1KMCA 4P83A 4CFDA 4B17A 1AQJA 3DMTA 3SBDA 4DBLC 3ND5A 3WHKA 4P80A 3VMFA 5JSZB 1U4NA 4D26A 1CUYA 1V37A 1Z62A 1DAPA 2Y05A 3IBTA 3M9LA 4XR9A 4DDHA 4EF6A 1SCJA 4NC9A 4QOGA 4BWJA 2O7RA 2PQ6A 3KX2A 1NI3A 3GEGA 4FZRA 4HWTA 1TK5A 2BMWA 4Q7EA 3NHZA 4IJUA 4QJ5A 2H2GA 5GP1A 2A9PA 4BQEA 3E23A 3TEMA 3WDKA 2OCAA 1F4VA 4PQFA 5CEJA 4OHYA 1X3NA 1CS4C 3O38A 5EI5A 5JIBA 4CIEA 1U5BA 1DCMA 5TEWA 1A9RA 4EMSA 3CCQN 1L7DA 2NZYA 2RMKA 2XOXA 3HP4A 3KVNA 5DWDA 1DBQA 5H80A 5BSKA 2UV8A 3JATA 3MTJA 1IC6A 3DEFA 3OKPA 2CFIA 4OK3A 1UKAA 1UT6A 4P4NA 3BD8A 5TSDA 1RS0A 2ZQ5A 3WGHA 4OAQA 3NHFA 4RTQA 4D9GA 5IEJA 3PX7A 3KQHA 3BCSA 4MIOA 2HF9A 4UDNA 4LMPA 4OAPA 3TOCA 4QZVA 3IFSA 4J7CA 4YXWD 3COYA 4ME6A 1UJCA 4Y0WA 4IINA 3FUWA 4JMPA 5TVGA 4HMPA 4HK4A 1I7SB 2WK1A 4B9EA 3CUTA 4OGKA 4EGAA 2CDAA 3LJKA 4WFQA 3SNKA 4B8WA 4C2BA 3RW9A 1UAXA 3ILSA 3RFFA 2YIVX 1VHLA 1VLVA 4HNGA 4R8MA 1NVTA 1P7YA 1U9IC 2RAVA 3L43A 1BQMA 1JILA 2J6IA 3D3JA 3W2EA 2X9VA 1CRWG 1IY9A 2MMGA 2XD4A 3CW9A 4X7PA 4EMTA 4BRCA 4GLJA 4N3GA 5BRJA 4FBMA 3RSEB 3KNZA 4A1FA 5C8YA 4EHKA 3UKRB 16PKA 3JQGA 3UWDA 4ZEVA 1WD5A 5BOSA 4GZLA 4OGEA 3DRPA 4U5XA 3TH5A 3UV7A 4WY5A 3D2AA 9ABPA 5IBPA 2HMWA 3MT9A 3ZE7A 4XUCA 5AQTA 2OBMA 2PSFA 2J30A 1JTEA 4D44A 1LDBA 3CNBA 4DDMA 4DR1K 1IJBA 5CFNA 2D4WA 1LLUA 3GGCA 5IXYA 2PUAA 3AVTA 1HFKA 1VC2A 3EW7A 5BPFA 3PDCA 2UXCB 1ZCZA 5EMHA 4WPGA 1NI4B 3ITHA 1Z06A 2E4AA 2VDPB 3BUSA 3IMKA 3OA0A 3QWIA 2ZWOA 4GLFA 4OHCA 5CNKA 4ZKEA 3RRBA 3MXOA 3V1YA 3MECA 2XOEA 1NVMB 3AKEA 1SU6A 4NAVA 3KOMA 3CETA 3O94A 4I5FA 1FDRA 4QU0A 4R3NA 5AW4A 5ITZA 1KI6A 1J7KA 4DSEA 1NKEA 3K5WA 4BJ6A 3NM5A 3I45A 4REMA 3HWX1 4RIEA 1GITA 4RZ3A 4OK6A 1LV5A 1NXXA 1Y6ZA 3H0EA 1ESVA 3I04A 3WA6A 4CQMD 5FBVB 2GA8A 2XCRB 1XHLA 2Z6AA 1OJ7A 3KAQA 4OJTA 2P2SA 4E3SA 1S2IA 1A4UA 1ZXOA 3G2KA 3WB9A 1JQ3A 2YZKA 1BWFO 1SCQA 3FLAA 1XU7A 1WNSA 3UFBA 2ZIXA 3I33A 4AY4A 3EZ2A 1QFSA 1PVDA 4E4RA 4ZI7F 3V32A 1HEUA 1T2DA 3IUEA 5B36A 2PKCA 1OVGA 1SVWA 2ODEA 2H4XA 2WHRA 3LDGA 3O9VA 2RE8A 4CEHA 1QFZA 3HH8A 3IPAA 3BDPA 1XDBA 1BU5A 3FRHA 2AC2A 3KD3A 4BJ1A 1PQWA 2QN8A 3FSEA 4UBOA 3CERA 2OZEA 3AETA 3QW2A 1O95A 4PKGA 2ZSBA 2ZYTX 2G9RA 3JQRA 1VRUA 2QX8A 3IB6A 4GR4A 2A6AA 4YI5A 1W85B 2XQIA 2CV2A 4KIGA 4DTRA 3MMXA 2WWIA 1Y4UA 1M2NA 3A0UA 3DE2X 3DOCA 4PYMA 4MB2A 5AJVB 1YQXA 5F98A 1MMFB 1Q5PA 4FM9A 3LVQE 1SIUA 3KEMA 4MQEB 2X8JA 4P2BA 4R2JA 5JC8A 4B9NA 3OZCA 3H9EO 1MDBA 2QE6A 5I45A 5J4HA 1KJQA 2QRVB 1DNPA 1GUAA 2Z3ZA 5DM70 3ENQA 2FPPA 1R6TA 1PZXA 3PQFA 4AY6A 4QHTA 2IHNA 5T4FA 4LAFA 3BPSA 2VF2A 3FKQA 3KC2A 3CUYA 3M5DA 4I2VA 2XF2A 5AHXA 1JVBA 3PJDA 5G4LA 3VO1A 1QIDA 3HN2A 4Y1FA 1KD1O 4AF6A 5JO0A 3WB0A 4NZ9A 4FZVA 1XDZA 1PQUA 2XMDA 2ZRFA 3DEIA 1IJFA 3IO3A 1Z17A 1CEYA 2HSZA 5TJHA 4LXXA 5ALNA 3TZQA 3ICEA 1G8SA 4JI5B 3HB1A 1THZA 2FPOA 3MG9A 1RCFA 4BKUA 1ATIA 4DF4A 4ARUA 1G17A 4MR7B 4DUGD 3LWMA 4P86A 3O2NA 4F5YA 2FW9A 2I71A 5EKXA 1QV7A 3M4ZA 5AQEA 5HYVA 4O4LF 4YJ2A 5A1TA 4JL6A 3Q7EA 2HBMA 5HFAA 1JYSA 4F2HA 4OVLA 1UDRA 4GMDA 2Q7OE 3ZOZA 4M53A 2FQWA 1TB4A 4IJAA 4I55F 3UFXA 1D0SA 2FK8A 1ZJWA 1KJIA 1M5RA 1EE2A 4P34A 3PA6A 3F5DA 1Z2OX 4G0MA 2V8BA 2A94A 3CN9A 4WWHA 1AKUA 1DJOA 2UUCB 2IGTA 5JDIA 1NTRA 1C0FA 3AVNA 3L5KA 1MCZA 3OU6A 4R79A 4C0KA 2WJJA 1HEIA 4NBKA 3E35A 4GOND 5JARA 4RTSA 1CXZA 3IT1A 2HB5A 3VMFB 4O59O 4RELA 3C70A 5D87A 2ACWA 5AI0A 4BNGA 4OKEA 1K7XB 1NJ6A 1E94E 2ODTX 2XRFA 4QQ8A 3T9CA 5KVSA 2EKLA 1UMBA 3HCDA 3LL7A 3N87A 3KYDA 3MFQA 4MKGA 1Z47A 4CHTA 5G2OA 5EOYA 2E5WA 2DAPA 6CHYA 2J1LA 1J90A 4HTUA 2R11A 1N34K 1VMDA 1HG0A 4B3SK 3NHGA 3IV6A 8GPBA 1H22A 1DUVG 3HC7A 3GEEA 3KQOA 5ESWA 1B8VA 4Z8YA 2WSLA 1TMOA 3GROA 3J7TA 1A77A 1ADGA 4D7AA 2CHEA 1RILA 4K8XA 1L0BA 4H7FA 1Q9YA 5CK4A 5K8VA 3N53A 5IKXA 4F1WA 1YJNN 5F12A 4IMIB 4K6GA 4QOEA 3EXIA 3QX7A 1JHPA 2OA8A 1ZRSA 5KX5F 3PFFA 3Q7QA 2GT1A 3NI2A 3PDHA 5DBIA 1QCZA 3KKMA 1JDVA 2IE8A 4TTJA 4OYRA 4GBJA 4E03A 4DTIA 4LNUB 1L3UA 1IZ8A 1M73E 3GW8A 1D9ZA 1M34A 3OCVA 3CNLA 4CEHB 1YE3A 2BY4A 3QEMA 2V6IA 1P3JA 1Z6PA 2ERYA 4M3YA 2XYQA 2EYQA 4HX5A 1U0OC 4CJ7A 4N47A 4IVQA 5E4FA 5B1HA 4ETNA 1AQLA 1XHZA 1XTTA 4J0HA 3C48A 3GR6A 4ZVVA 3KLNA 3ZLUA 3KDAA 4ZJPA 4TZ0A 2CLMB 3HCWA 3ZCTA 3T3NA 3FA2A 3KZKA 4AX4A 4L3QA 2BJWA 2WFMA 4DV0K 2Q4TA 3D7NA 3DUFA 4Q9KA 3UOWA 4DTCA 4NYIQ 3ZBQA 4YMUA 1EWKA 3GRVA 3P0JA 2ZI3A 1L1FA 1FFAA 3FZGA 2CJWA 2JGKA 1JAZA 3KO8A 1N2HA 1NVXQ 2UVPB 3PR3A 2XGSA 2HO4A 3ZETB 3IAHA 4LMAA 2A5DA 3TE7A 3HY6A 5SYAA 2DUUA 4YDRA 2VJYA 2J7PA 2C78A 2GBZA 1P77A 2WF6A 3D3WB 4LH5A 4EPYA 2WAYA 1EXDA 1IXKA 2BHTA 1INLA 1IONA 4YRKA 4DA4A 1D4FA 3DJFA 2HRQA 3O1WA 3FUUA 3OFSA 4D8XA 4KPUA 1AZLA 4C3ZA 1BA0A 4YRNA 4M3RA 4RLSA 2JEZA 1OXSC 3BDAA 5CAEB 5DNYB 4CEDA 1HOXA 3IP8A 1YAJA 2HMVA 3SS9X 4ZYUA 4A23A 4TZ6A 1XZNA 4TS4A 1OAOC 1NM1A 1HBJA 2ZJ2A 4BRMA 3TLGB 1FDSA 1CZUA 3DAHA 4C2AA 4WAUA 2XCSB 1JMKC 3VGLA 1UANA 4YCBA 3SS7X 1WPRA 4XFJA 1YB1A 3JYOA 3TB6A 2KB0A 5G1PA 3B6KA 3VO8A 3P2OA 3CURA 3EMVA 4OH1A 4Y2TA 1AXEA 1SB8A 4GNRA 4QBHA 5BOSB 3LLCA 3QTTA 1IZ9A 3D8TA 1GQYA 3BQNB 2MINA 2VJDA 4JROA 1VQPN 4RHFA 2ZUTA 1PJZA 1OXUA 2YJ5A 4MMYB 3M6VA 2O0KA 3IMGA 3RRXA 3WQRA 3FNHA 1X70A 2HCBA 2A1TR 4MV0A 4DV4B 3CVWA 5BRDA 3CF6R 1R0LA 1G60A 3FLBA 3SC6A 2ZCJA 3P1JA 1SMKA 1WXIA 3D4NA 3D4OA 3MD9A 1RE0A 2F9LA 1WSWA 2HHHB 2RHRA 5K3FB 4LYJA 2AXNA 4R1LA 2QXLA 3SBOA 4G9BA 3OFJA 3WQHA 5F7OA 2NT4A 1J39A 4GFDA 4IAOA 3RPEA 3COVA 1BD3A 2VZLA 5E1OA 4E1VA 5BSEA 5J59A 4YQZA 2O07A 3UTDA 5LIRA 3SPYA 5F76A 2FBVA 4BBPA 2PUBA 3KZCA 3HZHA 4M3WA 3S40A 3PPIA 2XVXA 2J3LA 5F4BA 3GFFA 4CEBA 2JI7A 4OQPA 3TLEA 5K99A 1T2EA 5HCUA 4RA6B 2IRWA 1L3BA 2YNMC 3EMKA 1N2GA 4ZT7A 5C8YB 4ARIA 3OICA 2AIRA 2XUGA 3NIWA 5CX1B 1XX6A 1NI5A 1WBDA 4DQKA 2AMVA 4TXJA 2HTFA 1SURA 1RBMA 2V7WA 1FFXB 5CH8A 1YR8A 3CX7A 4BRLA 1C9JA 1DINA 1PGNA 1Q1NA 2PWBA 2YHWA 3NYRA 2DHRA 3BE8A 1ST2A 4IDEA 4IYJA 4Y2GA 4YASA 4YP6A 4HVLA 3G8YA 3C6TA 1YB7A 5C1BA 3CCLN 3KS9A 4C4OA 2DBRA 4HTAA 2JNWA 4CMJA 4MI9A 2I6QA 2R8PA 5HEKA 1ZHOA 1Y34E 4OQFA 1OKJA 3AVJA 4K5QA 3G0GA 5J23A 1QZ5A 1YZGA 1FYFA 2SKEA 3VPGA 3KJQA 4ALMA 4ZGBA 4DV6B 4YLEA 2NTNA 1BWSA 3DAPA 4PHCA 1GPH1 4H59A 3N8DA 1C7RA 3SLRA 2PLWA 3NHBA 3TSAA 2CYBA 3EYZA 1QHTA 5CHYA 5TMBA 4AKIA 4D0LB 3ML1A 2NRWA 1TC1A 3LF2A 1XXHB 1PX2A 2P0AA 4JA0A 2YZGA 3ZD6A 3QMPA 1GV1A 3GUYA 4X64K 4DUYK 5PNTA 4N65A 4TKMA 2VS1A 1E20A 5I51A 4TS3A 3BXXA 5HIAA 2ZJ7A 1JYEA 1K6MA 3LDSA 2EYUA 3GD5A 4LJRA 4W1QA 2ZKIA 2RI6A 5KVCA 4KYUA 2P5GA 1VAZA 4QXQA 1PYDA 3DAOA 3S28A 4EB8A 5F5LA 1VYHA 4CERA 3MXTA 1W0KA 4TLAA 3UXEA 4RK1A 1RXSA 1E92A 1JE1A 4UUOA 5L6LB 3K5LA 1PSZA 2CXHA 5KREA 5L3VA 4NXMB 4E21A 1T9HA 1Z7GA 3V8VA 2O0JA 1Q18A 3SHQA 2C99A 5AJTA 4YBZA 2ZR0A 5IHXA 2HXSA 1OXVA 5LMUB 1UP7A 3DVSX 4WOBA 4O4LB 5CXUA 5LWQA 3WHPA 2NVWA 3IUNA 4HEA6 4ZHSA 2Z4TA 3NX4A 4HNVA 3HUDA 4YOTA 4QXOA 4RTOA 4JJ4A 5LR6A 2R5FA 2ZZKA 1N0UA 3L3BA 3U44A 1V6SA 3PQEA 1GYRA 2ITGA 3V4IA 3GMIA 3LGAA 5HFJA 1E0JA 4N01A 3SC2B 1QQBA 2D0OA 1E60A 2GUWA 4C8KA 1NW8A 3H1FA 4YYZA 4UMEA 1II9A 1ZA1A 4KMOA 1AS0A 4D8TA 4CETA 4DNXA 3IVXA 1DCKA 2GBPA 4KIWA 1EKEA 5AJUA 1EUDA 1GILA 1RYEA 2R1VA 3INYA 1F20A 3PL1A 2GM5A 3INNA 2A42A 1ULUA 1Y7IA 2FJ0A 3F6EX 1ZLYA 2MYPA 3FGZA 5BW6B 2HHTA 4A6PA 4Z1MD 5JHHB 3L1VA 1WUIS 3IOYA 3IH5A 3LW8A 5CB4F 4CQMB 1LVGA 1XKXA 3U1BA 1GKIA 3CNOA 2O1XA 2JIQA 2Z6UA 1PFQA 2VAPA 2VP3A 2VCYA 3PUIA 3JD1A 2NUTA 4FJHA 4LFAB 3GFSA 3OZAA 3TFQA 4B6GA 1ZD1A 3E9PA 2ETXA 1M8GA 1NBWB 4HYQA 4KXYA 4MQMA 4RORA 4LF5B 2XF8A 3LXMA 3LPLA 1F17A 1TFRA 1FZQA 1WKCA 3B5EA 4RM2A 4YS6A 1NW5A 4H8KA 1O9GA 3LP0A 1F5SA 2DSTA 1Y48E 5AXBA 1H1TA 1FPQA 1BCOA 5CYGA 3QLJA 3TL2A 4EFDA 5JY1A 3VQ7A 5ISMA 4FR2A 1E1KA 4OB8A 4Q1DA 4FEEA 2BTFA 3PFWO 1ABBA 4OGFA 2PUFA 3TB4A 3V4LA 3TR6A 2LUOA 4C6SA 2DY0A 1GWNA 2Q5CA 3DL0A 1SFRA 3JQEA 2CK3D 2YY5A 3MS2A 1Y9DA 1ISJA 4A62A 4FGLA 4IMRA 4N9QA 1LNQA 4I50F 4PYRA 5DT9A 1FK9A 3CF4G 4ZOBA 1PI3A 5A71A 4LXTA 3GEIA 2WE7A 3GGSA 2AA3A 3K5HA 2FMIA 5DTQA 1PJ3A 5HMLA 4I3GA 1KR5A 1P8AA 4LJAA 4R2MA 4OMUA 5T4EA 3UT6A 1DT9A 3QLHA 1EM6A 1X7XA 2ONKA 3M6UA 4FFNA 1VSBA 4Q93A 1XLWA 4ZEXA 3T3GA 2A40A 3HADA 3HM9A 3BREA 2VNHA 1WZ2A 4LPSA 3WYGA 4BRKA 4IL5A 4INJA 2A3ZA 3QIPA 3EVGA 1VJRA 2AG8A 2C77A 2IY8A 2R1TA 1JRLA 5DEIA 4CFCA 3EXIB 4KL8S 3TW4A 4LSZA 4EG5A 3SCXA 1CXUA 4C29A 4A10A 1V4TA 2B9EA 1KJ9A 4ZQCB 1KEUA 1QH8B 2J6HA 1JFVA 3C3KA 4X1KB 3RJ9A 3TQHA 4B83A 2YR0A 4CKWB 5IT4A 1QYIA 1Z6XA 1USUA 4MV6A 1TEVA 1ZBFA 3G1TA 4I6GA 4DN6A 4XGQA 3BUZB 1HTWA 3K3PA 5KSWB 3L2VA 2PGJA 4BVKA 4CT4B 2FE1A 2ZCVA 2WSBA 4V1CI 2F1RA 4EHUA 1FU4A 1VSJA 3O9QA 1V3TA 2C8LA 1PTJC 5KPRA 2QD2A 1J5XA 4JVNA 4CKZA 5CDHA 3LS2A 4LCJA 1E89A 4CYMA 1K7EB 5DI3B 4KV8A 1PZHA 5K0JA 1SZPA 1XZHA 1NPDA 4NESA 2BRUC 2G6BA 5DMRA 1UA0A 2NQTA 3ZLJA 4G97A 2F1KA 3FPSA 5F64A 3HP7A 1KYTA 4ARCA 4KQMA 5KAMA 3SFZA 1FZTA 1NK7A 3SQWA 4ZO7A 3RBZA 1VE7A 3E05A 3LK6A 1DB3A 4D0GA 1N2CE 2R2GA 1JXEA 5B58T 2ZQZA 5DNVA 4BQOA 2G9VA 5FPHA 5LOVF 3D5QA 1S3XA 1TF2A 4CLOB 2LDBA 1ATNA 1IV0A 1A7UA 2H0QA 3GZJA 3K0SA 2HCRA 1S9DA 2ZWAA 4I8XA 1WOYA 4AUNA 4DM4A 5FQNA 2NRTA 3FPCA 3OJ0A 4MQUA 4OHPA 4R84A 3ZY3A 4P31A 2WTEA 1SUQA 4DR7K 1Z5VA 3MUFA 4R8RA 1H94A 1O8CA 3ZV6A 2AE2A 5EJ6A 1JG4A 4EA7A 2AEMA 2FPGA 2GPWA 2IIVA 3A9TA 1MW9X 2OM2A 2ZROA 4MV1A 3QKIA 4LDZA 3RF6A 5BN4A 1Y8QA 5DHFA 3LT5A 2IVNA 3NHKA 4CPDA 3MW8A 5FPQA 1KERA 4G1QA 2DHEA 2JAXA 2VP0A 3L04A 3QLTA 4ZREA 3TBHA 2Q1TA 1WE2A 4Z9AA 3JD4A 3I5MA 5FUWA 1NXVA 2UYTA 2WSYB 1ODKA 3P0HA 3IBCA 1KNXA 1NW9B 2A9FA 3ISVA 5HJ7A 2PL3A 4D74A 2R66A 3GLIA 1KGSA 4IR7A 3QWBA 4TT3A 1GPNA 3Q15C 4KYTA 3EDMA 1T8TA 2P9KB 3OECA 1KAEA 5F4ZA 2MINB 4FDUA 5L3RA 4RWTA 1FXWF 2ZJ3A 1J8MF 5A6SB 3HHPA 3P7MA 5P21A 3LUPA 1R8YA 3E48A 4EUNA 3L0DA 4I66A 4O4HB 2NXNA 4J75A 4J1QA 5I9MA 1JDBC 3ZBUA 3ZGYA 1M9NA 1W6UA 1WIWA 5DNEA 3AF6A 3OM9A 3TSWA 2PWZA 4WOPA 1Y4AE 1BG6A 3KWLA 1R66A 1XAGA 2B25A 3QX8A 2DJIA 1LY1A 1YJQA 1PT6A 2ZRPA 2BLLA 3PFHA 4QT0A 3V9PA 5EFOA 4AP5A 2F17A 4PM4A 3TPZA 1KH1A 2PH1A 4P82A 1EFDN 3GAAA 4RZSA 1QV6A 5IJ9B 3QRWA 4DJEC 3OJWA 2HGZA 3BSWA 4LZAA 1BFUA 4RH1A 2VNIA 4ZO8A 3GUHA 4PG5A 3HT3A 3S99A 1DAKA 4A91A 3T1AA 5B8HA 2ZRAA 4H4MA 3SZ3A 2ZZNA 2YJFA 1E4YA 1OBHA 4LBVA 4LJLA 2E8AA 5GV8A 5TQ2B 2OYSA 3L6QA 2H92A 1NDUA 3TG8A 2Y92A 2YOGA 5BPMA 4L15A 4IIJB 3FWYA 4KQKA 2FMTA 1WXDA 2FJUA 4XTRA 4XYBA 5FNZA 3V6MA 4GSKA 3V8PA 5LP6F 3KLIA 3V2IA 5M7EA 1JLQA 1F0PA 4RVOA 3UAVA 4Q7MB 4NYMR 5K0BA 2BTOA 2C4VA 3X1JA 2QPLA 2WPDD 3H2HA 5A3RA 3J81A 3P5SA 3LBNA 1L5NA 4GO1A 1HNWK 1RHMA 5BMVF 1WPQA 1GYQA 3LQRA 3MT7A 1E7WA 4DG9A 3F9RA 3YASA 4UQPA 1KDTA 2SECE 4L73A 4CN8A 2Q49A 1EGHA 3HYTA 3DMRA 1IY0A 1D4AA 1UAGA 3QEXA 1P9RA 3C45A 2JATA 2QK4A 1JWLA 1VSFA 3NBYC 2AJ8A 1UM9A 3BKWA 3QPUA 1H0HA 5CEFA 1ASWA 3H1BA 2HRCA 4GM4A 3K6SA 2YHXA 1RAHA 2YNFA 1Y5IA 4CF9A 3D0PA 1VFNA 1DARA 2G5TA 2ZR7A 4EO7A 1BW9A 3EVTA 4QC2A 2IT1A 4YMIA 1I6MA 3R3LA 2J3IA 3A5NC 3ME5A 1BU8A 3SZLA 3A7EA 4TYNA 1OVYA 4CCWA 1S02A 2EW8A 5FL7A 1JT2A 2X0DA 1AGRA 3DV0B 4UM7A 4UNSA 2GX6A 1T2VA 4HPJB 1SKBA 2JD0A 1VSHA 4FS3A 1MPXA 2HPZA 3NP7A 5K51A 4TTVA 3TLAA 1K97A 2FF6A 3CD6N 3GDWA 2FOIA 4GMHA 4R81A 5CDFA 2Y6VA 2Q2QA 3NH0A 4I9HA 3SYRA 1M1NB 1GKUB 2GZSA 1MJHA 1T4GA 4IIEA 4MW4A 1KIAA 2ZSIA 4WN9A 5BN1A 1M0EA 3UOGA 4HUJA 3RV4A 5AZIB 1NFRA 3VNSA 5FP0A 3QOYA 1TKTA 4JQYA 2EG9A 3RYHB 1H85A 3C5WP 1JG6A 2FN8A 2O2JA 3ZX2A 4FQ8A 4UE3S 1NY5A 3QKSA 3TX6A 1HDZA 2JRCA 2OCLA 3DHYA 5CXXA 3WXMB 3PSFA 1JA0A 1SBZA 2YINC 5CDSA 1NQWA 1GHTA 1ZJ4A 5JSZA 4DV5B 2YJGA 2GBLC 3L8EA 3MJ4A 1CHNA 1XWFA 5IAKA 1POWA 4DY4A 4WESB 4YJ2B 4RJTA 4ZCRA 3RUFA 3KALA 1CY6A 1II8B 3WGLA 5BP7A 5LZ4A 2QI9C 1RBTA 2NLXA 4FWKA 4GGOA 5AKIA 3IS9A 3BFKA 4CLRB 1SQSA 4R1OA 2XW6A 3WLTA 5DHQA 1NMNA 5AQQA 3G6WA 1JHYA 4KIFA 4XEHA 2JFGA 2G28A 2AF4C 4YO8A 2N0SA 4M1TA 1NHGA 4IGKA 5EC8A 4RK7A 3MA0A 2VSQA 3DBOB 2VG8A 4N56A 4IOJA 2QN9A 2YX6A 4FWQA 1NR1A 3PXXA 4O33A 2N3ZA 4KKOA 4YRLA 4YRDA 4YRQA 1N5OX 5BNTA 2J9FA 1CY7A 1AHIA 2CLSA 3V46A 4D57A 5L4SA 1U2VA 3BWEA 4L9SA 4EATA 2YHUA 1XVLA 1FFWA 3L6OO 1LRLA 4CF7A 3PNYA 2AQKA 4WK2B 4M8KA 1B0ZA 1D7AA 2YJEA 3A4MA 5T6MA 2QV7A 4BC0A 3JS5A 3LQYA 5ALOA 3W9BA 4ASUD 4AX8A 1CLQA 1K5GA 3H4TA 4L07A 3WJAA 2ISCA 4FK4A 5FYQA 2Z9BA 4QSMA 1J4AA 1DEOA 1YB5A 1BMFA 1C1YA 5CM9C 5DYIA 5FBLB 2OCPA 3B1KA 3QZUA 5C3UA 3JYLA 5T8KA 3UT0A 4REQA 2JH8A 4JR1A 1UBNA 4BLQA 1K6IA 5K8TA 3WGIA 4DHEA 5CP8A 1F14A 1E5TA 1XZEA 4I46A 2WDZA 3K8ZA 3OTIA 2FQYA 1EK1A 2YWEA 3GCXA 3QWFA 1VCHA 1ZIPA 3QHPA 4I9LA 2F8LA 1J70A 5C18A 5JS1A 2P67A 1BHQ1 1TYCA 2ET6A 5ICCA 1E3QA 1KI4A 3I2YX 2YZNA 1W2BM 1NW7A 3MJSA 2RC6A 1IHOA 4ZAYA 2NV2B 4HO1X 4M8LA 3RSEA 2WFAA 3Q87B 1MHTA 4AS1A 3BFVA 3BZUA 2XUZA 1GOCA 3Q3HA 3RVQA 1KBZA 1PD1A 5AVRA 3ZDEA 3OY2A 3UC5A 2O9JA 3H2IA 4C04A 2JGEA 3NHMA 1P7CA 4BE7B 2PPLA 4LS3A 1WUYA 2R4UA 4JMLA 3AEUA 2YNGA 4HQNA 5EJ2A 1RWNA 3MTBA 2W6PA 4B44A 4L3WA 3GEMA 1ODFA 3L6DA 3ADCA 2ONZA 3AW9A 3DOEA 1N5LA 3PI7A 7REQB 4O4JF 4V0KA 1NMSA 2IHZA 4FVUA 2V7VA 4Y9UA 3ZWKA 1W76A 5J3JA 4H4CA 1T8RA 3UVEA 1L5KA 5JXGA 4R5HA 1NUTA 1NW6A 1DKNA 1BFDA 3AM1A 2FZCA 1PIWA 4UOEA 1UOEA 4NNPA 1GPKA 4KTVE 2YZ2A 4K87A 3T52A 4JJKA 3TLYA 4LUCA 4WE3A 4JXKA 2VQDA 2C7PA 5FWYA 2JI8A 3O83A 3L6CA 5KYGA 5AQMA 5AK6A 5F7XA 4YAKA 1Q81O 1NK6A 2Z1IA 1WV0A 2CZGA 3CUEF 4WN9B 5U1PA 3RSLA 1PUXA 5CDYA 1WEHA 4HDKA 2I65A 2JGUA 1RMTA 4AM6A 2G9ZA 2ASEA 4GKVA 2B2XA 3AC0A 4MEJA 5E0KB 4ABYA 2AP1A 1C9DB 3IA7A 1F21A 1VCNA 5HNKA 1G3MA 4BC2A 1RACA 3IEPA 4WQ4C 4OPJA 3VZRA 1SY7A 3NUZA 3GCGA 4K6CA 2EIXA 5ADHA 4FM0A 4F7DA 3CQXA 2ZT5A 3B52X 4BBAA 1QIFA 3HCAA 3ANYB 1ZBQA 4O5OA 2HADA 1QFYA 4YUWA 3DWGA 2HMAA 2PGAA 4WKBA 1D1QA 1JG7A 4UEJA 2AOWA 3O91A 1Q1EA 1YFLA 4CEIA 4FJKA 4LEIA 4JKGB 1P5FA 3LDQA 5EWLB 3GQBA 4DCNA 1X80B 1PL6A 2IQIA 1TUEA 3AGQA 1KE2A 4LJ8A 4QPNA 1Z6RA 3QYJA 5MFZA 5AI8A 1CBUA 1Z34A 2A84A 4LHVA 3QVGB 5HF8A 1LS6A 1TOAA 1RLTA 1NQUA 2NADA 2XE8A 1PT5A 5GV7A 2VPWA 4RD3A 3VR5D 3ZHRA 3F96A 3LNCA 3EEIA 3OHSX 4NYJQ 5FAXA 2M6KA 1GGEA 2E2QA 3EFBA 3S1AB 4EW2A 2OXFA 4X64B 3W5DA 1J2JA 2H3EA 1WBBA 1M54A 4FLZA 4D9EA 1C9KA 1T9GR 3LCRA 4GX1A 4MCHA 3PXEA 5K0CA 2IC3A 4D3ZA 2R7MA 4MVJA 4QUHA 3NEAA 5DXJA 3OSZA 3TDNA 4BKPA 3EA5A 3KTQA 1JLCA 4HNRA 1QP0A 3QPCA 6REQB 1MJGM 2FWRA 1EJ0A 4LRSB 4DT1A 1YE8A 1YFZA 1O6CA 1A4XA 1T5HX 2C0QA 3HXLA 3W6OA 4ZT4A 5KNBH 3P31A 3GOHA 3MJDA 2PS0A 2Z08A 1YJ9N 1G8AA 2HPAA 3HKCA 1E6LA 1OT5A 3OE1A 2ALJA 1HKBA 1SC1A 1WKBA 3GCDA 4HAWA 3VVBA 4D9BA 3G1WA 2VSXA 3PHGA 4F1JA 4BQZA 2XKAA 2NO4A 1R5JA 2XQFA 3PHCA 1E7RA 2HIAA 3EWNA 4R98A 3PX3A 4GI3A 4D45A 4EBBA 2DR0A 4FK8A 2CXXA 3CE9A 3LY9A 2AH5A 2QRPA 4N8DA 4UZFA 3GLSA 3ZW9A 5H70A 4ZXPA 3PU6A 1SWWA 4LQCA 1JH9A 3PF8A 3E2PA 1EFHA 2G09A 4F2PA 3UWPA 1EQAA 1CUDA 1QHAA 3HEAA 3TTTA 1E2NA 3EZLA 2CVZA 3HYLA 5LU8A 1XZQA 2JW5A 3ZHCA 2FRXA 4JLKA 3SKVA 4DS3A 4V0QA 4KSCA 5FA6A 3I9MA 4TS9A 3PFKA 3GN1A 4HWGA 1R4ZA 1AB5A 2UXBK 1VA5A 1ZCJA 3DE3X 1E6WA 3P9PA 3ICCA 3W6ZA 4F96A 2OKGA 2O50A 2W37A 3EDYA 2KSQA 3I58A 2B35A 2H5LA 3SSOA 3QJGA 1E4EA 1E18A 1QYVA 2R48A 1J9ZA 2MWMA 4X90A 5LQDA 3L7OA 3A1CA 1W25A 1WBJB 2CJXA 2H5IA 3T06B 2XKKA 2XE4A 4EKDA 3U49A 4ENQA 3ABQB 1T8YA 5EERA 4RW4A 4QVGA 3LMKA 4LRWA 4AJ2A 4BRNA 2Q46A 1VBKA 3X1KA 4C88A 4H5TA 1QTNA 1BO5O 2CE7A 3SMPA 2BMAA 2I6XA 3KQTA 1HY3A 3PIOL 1P62B 1YK0A 1QF7A 1EBBA 3A14A 3N0RA 5CB4B 1P1JA 5ALQA 3LL4A 3B1ZA 3T3EA 1BDBA 3OE4A 4DIDA 4CG0A 2RGGA 1Q44A 3IAS1 4EIWA 3AFNA 3HJGA 5IFLA 1UKVY 4DFDA 4E12A 4MO5A 3W9YA 1A5AB 1RWVA 1SUPA 2E2NA 2R8ZA 4FN4A 1A9YA 4J6FA 2AZXA 1J8VA 5G41A 1HDXA 3A2FA 3Q1KA 4HAUA 3MRSA 4CKEB 4OI0A 2J5BA 1HX7A 3FAZA 4G5XA 4DDUA 4IY1A 1RLIA 4Z99A 1FTNA 1KHHA 5LA6F 3MSCA 3SX0A 4AN1A 3VTIA 4UNNA 4RQBA 3CC2N 5E6SB 2RJ3A 4DIMA 1PK7A 1K89A 2AZMA 3ON5A 2B30A 3BX1A 3ETDA 3TF5A 5JQGB 1LA2A 2C04A 5BQ5A 3LC1O 2XNJA 2OXIA 3TBFA 3ZQ6A 1YS9A 4YB8A 1Q7YO 4IOXA 2OXCA 3MGAA 3N0VA 4EK9A 3A05A 2HQBA 3SBTA 1PDOA 3CJCA 2FW7A 2IYRA 5KJCA 1D4XA 1OHHA 2O2ZA 1HF3A 5BSMA 3RCBA 2CGKA 1HUXA 2Q45A 5BN3B 3UHPA 3C5EA 5KYYB 1OKKD 1NKTA 4F86A 4M6WB 5ITVA 3MEQA 1E3WB 2VJAA 3CCJN 1F1BA 3HEMA 4WK0B 4PL7A 1PZMA 3O4RA 1SC4A 1EDEA 3HJHA 4G23A 3FPAA 3TW8B 1Y9JA 3BA6A 4Y98A 5TT1A 3RFUA 4DMKA 3FDFA 2V7BA 5F23A 1B8PA 4CCHA 1BIZA 3NH6A 5K20A 1YRQA 1QRAA 1S2MA 3GY0A 3CJ1A 2NO5A 4FGKA 4QBIA 2ZB2A 2X0FA 1Q0ZA 3VKUA 3VMMA 3JWGA 1BGWA 3CR3C 3ZE1B 2BFFA 1TCBA 4B9LA 1VTKA 1XGKA 1WV1A 4EY8A 3H2JA 4YXWA 4AT1A 4BMPB 4BS9A 2XXAA 2Q2NA 1VK0A 4MUMA 2BGIA 1S0UA 1GGFA 1V7ZA 3FZYA 1GO2A 4WNYA 4OG2A 4V02A 2IY9A 1QPZA 2FX3A 1CJUC 2X8BA 1DIBA 2X1MA 5HDBB 3SHOA 1W87A 5HUQA 4FR0A 3MN1A 3ZW8A 1SULA 5K8UA 4KG7A 1DLJA 2OYRA 2FPLA 1F6BA 4FM1A 1XMPA 3BDVA 3N28A 4ER0A 1Z35A 4S1WA 2Z83A 3NASA 1JHDA 3OURA 4BQPA 4DABA 5F9HA 1S8NA 1TVEA 4HZUA 1VMAA 4PZYA 2O2GA 1E2IA 3UE5A 4JLHA 1JIUA 2OSVA 5EP4A 1NRWA 1DP4A 2XRIA 1E1CB 2FEWB 2OBLA 3D6HA 4DF3A 1QS0A 4C8MA 3AO0B 5J2TB 4PG8A 1DXQA 1JNXX 1CE8B 1SHKA 4YDUA 2ZT7A 3V4SA 4C4SA 4X8LA 2LVBA 4M3UA 4F2DA 2IYPA 3UWKA 1W5AA 4I99A 1NMXA 3CINA 4GOJA 4NCJA 5FWAA 3CNEA 3UMJA 1DFIA 1YC5A 4ZOQI 2I9KA 5AI4A 1UJBA 1PLLA 3DEHA 3PFNA 2Q0RA 1CULC 2VP5A 2WD8A 2Q62A 3EISA 2E5FA 2B92A 4D2IA 4TSFD 1O96A 4I4TF 4CGZA 2XUKA 2ZRJA 3A10A 4Y9DA 3W6PA 3SVTA 2Y1IA 1MGPA 1OMOA 3DLRA 1K08A 1UM8A 3P9NA 2DLNA 5F5NA 2HOEA 1JJFA 2WUSA 3TW6A 4GEKA 2JLXA 1U45A 2VHVA 4PCAA 4IBNA 1AM4D 3IQDB 3IYLW 3BSFA 4LJ6A 4M8SA 5F2OA 2WWFA 4ZO9A 3BBPA 4YMWA 1H4SA 3PE6A 2ZFUA 4AU1A 3LXXA 3S3OA 1KETA 1DAGA 4BGBA 5MLCQ 5JVHL 4UCFA 1KC3A 4FMDF 1ASUA 4AHTA 3HM8A 1UFQA 3C3WA 4DCMA 2IODA 3VR6D 2MJLA 2WB4A 3ICPA 4IZOA 2CFCA 3A5MC 1AN0A 1WJGA 2CLCX 2GD6A 4G24A 1N2ZA 3E9OA 4RAQA 4AMUA 1CRQA 1LPOA 2XXBA 2N1MA 3FOWA 4GC5A 1R0CA 3C7NA 1SVMA 4DSTA 2EGGA 5H82A 1DIGA 1DEHA 4ZI5A 3TSOA 3VVLA 1GPLA 2WF7A 3H99A 3OESA 3D59A 4COKA 5BW5A 5KJEA 1OILA 1OFIA 1YBMA 2FQQA 1GNSA 3O08A 1E1RD 4HF7A 1WP9A 2Q5EA 2PPVA 4L4XA 1LPAB 2UXDB 3HFRA 1QQNA 3H9QA 4F8EA 4KQXA 2I67A 3VEYA 3NBMA 4EYOA 1Y6FA 2KFNA 5HG0A 2QGFA 4L9WA 1QGYA 3AAQA 1R37A 4ZTFA 1O95D 2YNIA 3C0BA 5AQVA 2B7BA 3QFSA 4CG3A 3RREA 3BXPA 3OMWA 2EFDB 2TMGA 1Y1QA 4Q37A 3C3EA 1Y97A 1JIQA 4IOCL 4L5AA 3IAM1 1K75A 4HLDA 3RNLA 1NF3A 4B3IA 2PSSA 4IDAA 3OYEA 2CNKA 1AV6A 2XB9A 3R8EA 4JJFA 2E4WA 5EWLA 2AI2A 3GCZA 1LRJA 3KSZO 2XNDD 4TXNA 1Z83A 4PO1A 1R6AA 5BWMA 4LX8A 1POXA 3Q0IA 2HBKA 1PN3A 3C6UA 5DTMA 1H1DA 1EI9A 3FNBA 2FRDC 1IB6A 3HCFA 3HCCA 4QGGA 4TT8A 1QS4A 1U02A 3VF6A 4EZ6A 1Z4KA 2IVOA 4U7DA 1J22A 2I6SA 5KPJA 5IX8A 4LFCB 4WQ4A 1P2DA 1WCYA 2QE7A 9LDTA 3DNFA 2F55A 1G2OA 4RNCA 2XUJA 5FI1B 1AD2A 4RMIA 2PKYX 3FYTA 1G20A 4B8AB 1U4OA 3KUXA 3WYFA 4JJGA 4AMGA 3RYCB 1R0ZA 2AR9A 3PXCX 5P8WA 1JBEA 3PP8A 1BJTA 3U7IA 1RRPA 3DVAB 3WNDA 4WN3A 3T9AA 2H2HA 3DR3A 3HB0A 5FO0A 3MDQA 3FJ1A 3VNQA 3WADA 2JDID 4D3FA 3CRQA 1CZLA 3OZUA 4ON9A 5JFTA 3RR7A 3KSBC 4NU8X 4ABTA 4PYQA 3F8TA 3VO2A 2YWDA 1YQTA 2GEJA 4FHDA 2HLPA 2PVPA 5G0UA 3THOA 3O8CA 1AT1A 2BFBA 3MK31 1R5OA 4LSLA 3RTVA 2QYSA 3EE6A 3FYUA 5JCJA 4EB6B 5JSUA 3ZS9A 2CNNA 1XQ1A 2ZSAA 3WAKA 4EY5A 1XMSA 1U3TA 3A11A 5BN4B 4QTXA 2Y1DA 3FHOA 4IVRA 5HTKA 3TBKA 2QRLA 4ARVA 4CBVA 4JEHA 1H5NA 1JCEA 1YDEA 1NY6A 2ATCA 4IDKA 4CF5A 2ZDQA 4FCCA 1YC2A 5HFNA 2CFRA 2E2W