1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN AF1318
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
5EWLA 2QVGA 1LWFA 3KS9A 4M3RA 4CGIA 4JS4A 2FN8A 5C5EA 3UUGA 3AA3A 2A9QA 1WSEA 2JK1A 3O1IC 4HCBA 1DTTA 5CHYA 3H5WA 1NKBA 3DZDA 4FJNA 3QEMB 4FLVA 1WSGA 3GBPA 1FFWA 3HP6A 4C8OA 1Z15A 3OLZA 2HMIA 3VA3A 3MEGA 4DSKA 3QLHA 2PMCA 3D45A 3GBVA 8ABPA 3CZCA 2O20A 4CCHA 2JLEA 1A2OA 3HDGA 4O1HA 1JLAA 1DLOA 3ZSXA 2XO7A 1IKVA 4LE1A 2KW4A 3TR8A 5K14A 3TAFA 5TPWA 3DLGA 2AJQA 5HRPA 4Y1CA 2M1ZA 3AVNA 1HMVA 4HHTA 3OVNA 1C0MA 3D0PA 3B6OA 3VQ8A 4Y9TA 1P6UA 3QO9A 3KLNA 3QNOA 4L8RB 3EGCA 1UDRA 4ML3A 3DOLA 3PUFA 5TQJA 2VUIB 3H6GA 4RG8A 4ELTA 1RTHA 4GW6A 3KLOA 2OYQA 4RDCA 4MS1B 4DFKA 4OATA 4FK2A 3L6UA 3N8IA 5TQ0B 1VLZA 1S9EA 2FXIA 3RMCA 3KKRA 4OKJA 5BRAA 5FROA 1QTMA 3ZT0A 4IFVA 4N0QA 3EY1A 4FJLA 3CM5A 3FMVA 1SKSA 4KHSA 3DGFC 3QIPA 4W5RA 3GRCA 1TKTA 4FM2A 3FFIA 4MS1A 3F6CA 4UHKA 3LPTA 3OJUA 1NK7A 1I3CA 4DFJA 3K4HA 5TQ0A 2IOCA 3THVA 4PZ0A 3IG1A 3Q7SA 3CNBA 3LZIA 4DQQA 2L18A 3K5MA 4EZ6A 1DRJA 4OBBA 3OLXA 3CG7A 2Q5CA 4BDZA 1S9GA 4YNQA 2QK9A 4H3HB 3HSYA 1VSHA 4N5SA 1PEAA 1L5ZA 4CF2A 3LKBA 3AVIA 1RTDA 2FVYA 1I39A 4IG3A 1XI1A 1L5YA 1SUQA 4DFMA 2QKBA 2J48A 2L2QA 3Q15C 5IULC 1VK0A 3OO1A 1IKXA 2MSLA 3MECA 1EKEA 4LY7A 1CXUA 1P8AA 1KVAA 1BI4A 4O5BA 1DCKA 1TL1A 4KV7A 2ETJA 3MAQA 1JXEA 1U2QA 4M3UA 1FK9A 3F9KA 2D0CA 1ASWA 2MYNA 1D9FA 1YK1A 1WN7A 1HJRA 1EWKA 1NATA 4NICA 3TX6A 1LWEA 4KFBA 2KQ2A 2RF2A 4DTNA 4M88A 3RRGA 4G0ZA 1VSFA 4B9SA 3M8RA 4N76A 1WLJA 1QSLA 5CYQA 2RN2A 4RKRA 3HL8A 1VSEA 1FQWA 4OVLA 1PHRA 4IBNA 3KYJB 4GPAA 2JBAA 4B3OA 1E6MA 4FLUA 1GOAA 1JYEA 3NBPA 2XRIA 4DS4A 3D02A 2HSGA 4ELUA 4B9NA 1U45A 2G8IA 3C3MA 4CIEA 4CE9A 1L5UA 1X9SA 3BRQA 3IP9A 3LP3A 1NXTA 2ZWMA 4IMIB 3ZSZA 1WSJA 1NKCA 1TKDA 1JKHA 3G10A 2O4IA 3IP5A 4FZZA 2VG5A 3DI6A 3SPZA 4DSJA 5IEBA 4CJSA 4EGSA 1F21A 3IAYA 1FKOA 4E7IA 3HVRA 3S3MA 2LP4Y 4H4MA 4NQRA 4KTZA 1RT6A 1NXSA 4E1NA 1F51E 1WETA 1S1WA 4DQPA 4MR7A 4DLEA 2XDYA 3ILYA 3IPCA 4I9LA 3KK2A 4KPYA 4CHQA 3MA0A 3O21A 3C6TA 3PX6A 4IGAA 4D6XA 3K5OA 3T19A 3QERA 3F7NA 2FMIA 4CGGA 3IS9A 3VQ4A 4FLXA 4XFKA 1P6QA 3RVJA 4OTZA 3HPOA 2KTQA 5KQGA 3P83D 4CEFA 2PE5A 5HP1A 2ZE2A 1U04A 3ZCMA 1Q9XA 4FM1A 3HSTB 4CF0A 5B3JC 1ASVA 1LW2A 3HT3A 5KRSA 3H5LA 1RILA 5EWLB 1BCOA 1TVMA 2EHGA 4FZYA 1B00A 3DLKA 1WSFA 1M2FA 2KZZA 3HPHA 4CJRA 3V9ZA 1Y1LA 5B3JA 3KYIB 2FBYA 4CF9A 3DRPA 3RVSA 4O0JA 3LPUA 4MQEA 1XWWA 4ETIA 2B6AA 3L49A 2XY6A 2NUBA 1NXWA 3AVAA 4ZMRA 4CGJA 4H60A 3KTOA 3AVMA 1U49A 3RVOA 4ZHRA 5EU7A 3HS3A 5PNTA 3V9SA 2NT4A 2WMYA 5JS2A 3QEVA 1APBA 3NGIA 1W0HA 3ZSVA 3WNFA 4TMYA 5CZ2A 4RKQA 3MF4A 4KFCA 2RJOA 4MQ3A 2BE2A 3P9YA 4AHCA 3ASMA 4AH9A 2HPHA 4E1MA 2NZVG 3TD9A 3NNNA 3ROTA 3KLFA 4KI6A 1BQNA 3BILA 4JB2A 4EYOA 1RT1A 2A9RA 4E7PA 1ZAYA 6ABPA 3O3GA 1S1UA 5CNJA 3DLRA 2GKGA 3U3YA 4OJRA 4M3ZA 1IH7A 3G0ZA 4W5QA 4CK3A 4OLBA 1RDDA 4DTSA 4WWHA 1HQEA 1MU2A 4H3KB 3OYDA 2PKXA 1SL0A 2JCGA 1KVCA 3SNNA 1RDAA 1RCHA 1T05A 4AHSA 2B4AA 4B9UA 3T1AA 4B8CA 1ZBIA 1K68A 4C8LA 1QP4A 4KB1A 4F11A 4F12A 4CEZA 4F3OA 1A5XA 3OYNA 4J2EA 4KTQA 3KHTA 3CZ5A 3S3NA 3K5NA 4LDAA 4LH4A 3L2VA 1MAVA 5D3GA 4M3XA 2FTKE 1XHFA 3EYZA 4FE4A 4B08A 2R47A 1GCAA 3QLVA 1D5AA 4KZKA 3EJWA 1JXBA 4MRMB 1Z12A 1JH9A 3NDKA 4CJ3A 2KZMA 3CTPA 3MEEA 4LSLA 4I7FA 4DSEA 4HVJA 2VUHB 1WAJA 4BDYA 1SXIA 4RXMA 4EY3A 4CFAA 1SKRA 3OYJA 1BI4B 3SQ4A 1BAPA 3OYMA 4PA1A 3ILHA 3NAEA 1XC9A 4DQSA 1KRWA 2G8HA 4KB0A 4PUOA 4G1QA 4PQUA 1P2FA 3EQZA 3OYBA 2VYCA 5HKOA 1J56A 3RVQA 2FQWA 4RV5A 3O1JC 3MEDA 3NF8A 1AB6A 4KAZA 5IUKC 1XHXA 4DQRA 5C25A 3OYEA 2Z1JA 3NGZA 1I3AA 1SKWA 4CBVA 1JFTA 5GOTA 3TO5A 1KFSA 1BISA 3H1FA 1DRKA 4RW8A 2DY4A 3CFOA 4C8MA 3VQQA 2QU7A 1WAFA 3AVLA 3CFRA 4DSFA 2P9HA 2R7YA 4FJMA 4RK7A 2XY8A 5CY4A 1DBWA 1USKA 1RXIA 3NNDA 1EP4A 3LP2A 4ZJPA 3AVBA 1L3UA 3FFTA 4DMNA 4JRQA 2PUCA 3CS3A 4L85A 1WSIA 3AVJA 4RW6A 4MR7B 3CFPA 1XWLA 2Y1JA 2JBAB 5J1EA 1E6LA 1BQMA 1K6YA 3G85A 3T38A 4CIGA 7ABPA 4XARA 5CZ1A 1FKPA 1S1TA 3N0XA 1U2PA 5E3JA 1L3TA 1NKEA 4E7HA 5DKFA 3TWHA 2KFNA 2FN9A 1C1AA 3SYZA 4O44A 4KHQA 5HM6A 4FJ8A 3AO1A 2E4VA 2DFEA 3HDVA 1CZBA 3H5IA 2HHSA 2NZUG 1HEYA 1SL2A 4Z9AA 3SUPA 1SRRA 1QSSA 5KWSA 4B9VA 4ZMSA 4E7JA 4CIFA 4J2BA 4FW1A 3H6HA 4CK2A 2X6SA 4F2RA 3AVHA 4RW9A 3PO4A 5KQMA 3CG0A 1U8TA 3EAFA 1U0SY 5FRMA 3V1QA 4MLDA 1K66A 4TLLB 2OA8A 1NJYA 4BWJA 3AO5A 3IP7A 4G0MA 1HPZA 1RT4A 5C42A 3PV8A 3QINA 1NK9A 3BBLA 1KTQA 4Q5VA 2FEWB 3D8UA 5D2CA 2OZSA 2D0AA 4DLGA 4OKKA 2FBVA 2W42A 1B9DA 4D74A 3SV3A 3RMAA 4WT7A 2HJ9A 3KJXA 3QEMA 3AO2A 3HV2A 4YCSA 3QIOA 3DBIA 4FW2A 3OS0A 4LRQA 2MYPA 3VQ7A 2WOMA 2L19A 3OO0A 1IKWA 2WB4A 1YIOA 3T8YA 1PEYA 4Z4EA 4G0XA 4ZYLA 4G0QA 4PE5B 4PYRA 3LOPA 3ULDA 4CJ4A 3BRSA 1YT3A 3V9UA 4FLTA 1KFDA 1GUBA 1JL1A 4Z99A 3JYTA 3CG4A 4MQEB 2FLKA 5TPZD 4FLZA 2B5JA 4DFPA 3JVDA 2YNHA 3TI0A 5HLFA 3TAMA 3AO3A 4CFBA 1U47A 3A2FA 1KLNA 1PNTA 3RR7A 1LJUA 2VWKA 1RBSA 2Z1IA 3VA0A 3LALA 4G97A 2FW0A 3RVPA 3SY8A 4H8KA 3QX8A 4O1IA 3OQOA 3NHZA 1ASUA 2YNFA 3RVKA 4MR9B 3I8DA 3LP0A 2YKMA 5DGCA 4KQ9A 1RBTA 2PYLA 3HVTA 1ZGZA 1RBUA 2HNDA 4QPJC 1USIA 4CECA 2ZQBA 1Z16A 3ZSOA 1M5UA 3DYAA 3RVMA 4EP5A 2X6NA 3ZSWA 1ZH4A 4KK3A 4BE0A 3S3OA 4G0PA 1J54A 4RXUA 4LD0A 3KIOA 1Q9YA 4DWIA 2HHWA 5KC8A 2PL1A 4CERA 3P1GA 4MRMA 2HVIA 1C0TA 3AA2A 4CHNA 3IRXA 3ZT1A 3E61A 2HHXA 3V6DA 3RMDA 5JNWA 3T6KA 1D8YA 3OYHA 1YMUA 1JDPA 4KO0A 2G8UA 3QX9A 2HQRA 4MPTA 4FK4A 1ZITA 3NCIA 3L8BA 3H1GA 1NY5A 2QV0A 3HYFA 1TGOA 1ZBUA 3GA5A 2JGUA 1ZYQA 5TQ2A 2QR3A 3Q7TA 4JLHA 4PY5A 3WNGA 4KQCA 2CWDA 2MYUA 3K2PA 5DMRA 1IG9A 3SNKA 2AYZA 4RK0A 3QNNA 4HNQA 3O4QA 3TMYA 4BDPA 3QEXA 3NNSA 4JP1A 3OYIA 5C5CA 5I3UA 3VQCA 1FFSA 4NV3A 2DFHA 1S1XA 4DQDA 3JPYA 3GWGA 1QQBA 4HNRA 3UK0A 5ED4A 1F4VA 3OLYA 3SZ2A 2ZAYA 5HROA 4N56A 3EZ5A 3V9WA 1RT7A 3L3VA 3MXJA 5IUNC 3HXMA 4M45A 4TSXA 4O0IA 3L2WA 1HYSA 2GX6A 2E6MA 2RKIA 2A1RA 1DC8A 3A0RB 3PY8A 4CK1A 3VQAA 2IYNA 1QHTA 4YRZA 5C24A 1Y97A 2HHQA 3HCWA 2HQBA 1EWTA 3KKSA 1L3VA 4E19A 1JLGA 3LUFA 2IOYA 3L2QA 1NK4A 1S8NA 3N53A 1QQCA 2QXFA 5TE9A 4EVQA 1Z2DA 4QOZB 1RXEA 4CEQA 1HRHA 4YGXB 1JX6A 1JLKA 1Z13A 4IILA 1WNSA 4CHPA 1UA0A 2GI4A 2E4XA 1T8EA 2YNIA 2LPMA 2LSNA 4EZ9A 1TL3A 4RK1A 3CHYA 2YV0X 4KREA 2EX3A 4TN5A 4DTRA 3M9WA 3KCNA 5EWJA 4CJPA 3MMNA 3QLVC 3DLEA 4B9TA 4KHWA 5FWXB 3KLGA 4ZPJA 3ZT2A 3LUAA 3NE6A 3MXMA 1URPA 3K58A 1JBEA 3K9CA 4M42A 1RZRD 4CEBA 1RBRA 3A3KA 3HO1A 4E89A 2WONA 4S04A 4JRPA 3M8PA 1TK8A 1R8JA 3JVIA 1ZH2A 3KLIA 3H75A 3LUHA 1QO0A 2ZD1A 1VSKA 1J9AA 3CYMA 4RWEA 5FWXA 2FQYA 4EYQA 2P4UA 3B6PA 4DF4A 4Q0BA 1FXXA 3LANA 1JFVA 1C0EA 5KGXA 1D2AA 4WXEA 4CEOA 2Z1GA 3HPGA 3F6PA 2D5RA 4Z4CA 1QO0D 1M2EA 2CHEA 2HHUA 1JLEA 5FDLA 1B9FA 4MLCA 1ISRA 4Z4HA 4CGFA 3C3KA 4F3TA 3KLEA 1QS4A 3FDFA 3B2NA 1B92A 2E4ZA 2E4YA 4GVMA 3ZSRA 1X9MA 3RVNA 1UWBA 1PUXA 3O2SB 3T3FA 3SQ0A 1TK5A 3LFTA 1MB0A 4FVMA 1S6QA 3AA4A 1OXBB 1CZ9A 3LWMA 3V4IA 4FK0A 2DTUA 4ETMA 4HYEA 2FEPA 2YNGA 3ZSYA 4OG2A 3OY9A 2IPMA 3TARA 3N0WA 2PAFA 1BHLA 1KSPA 2CHFA 5KQPA 3SQ1A 4O55A 2AYXA 5CNKA 1BDIA 3CU5A 3NH0A 3OS2A 3RMBA 4CJVA 3RTVA 1SXHA 4R5PA 2HVHA 1TV6A 2F8SA 1CHNA 1UAXA 3C6UA 1LK0A 3Q7RA 4Y1DA 2PLNA 5CYMA 1ZBHA 3SG0A 4ELVA 1D4ZA 1D1QA 3VNBA 4C8NA 3FFWA 2ID9A 4MR9A 1OXKB 2R25B 3RVLA 3SQNA 1TAQA 4UHJA 2IS3A 1NK0A 3F73A 3PO5A 4B9LA 2F8TA 2FBXA 4I2PA 4KNYA 4FJ5A 5DLEA 3GT7A 1Z25A 3QEIA 2QZJA 3H08A 3V9XA 1QE1A 1LJLA 5J2QA 1JF8A 3NF7A 2FEKA 5T7BA 2ATQA 3LUCA 1KRXA 1N5YA 3ITHA 3SM9A 1CXQA 3DLBA 4FLYA 1Z26A 1RDBA 4CJLA 2FC0A 3I0SA 3NF6A 2OENG 4I2QA 1EWVA 4CESA 1VPWA 3SAJA 3I42A 1WSHA 1YS7A 2QSJA 3OMXA 4NCAA 4FM0A 2FLWA 3KKEA 1DP4A 1BDJA 3OYKA 3FGZA 4DTXA 3AA5X 4CJ5A 1YVUA 4CJFA 3MIZA 4MGEA 5FWYB 2PUFA 1JDNA 4EYGA 2VWJA 3SI6A 4J2AA 1TJYA 4MFBA 2VK2A 3IP6A 2OZMA 9ABPA 1ZVVA 4KVFA 2D0BA 4BE1A 5KI6A 4HUGA 4WXMA 3LAKA 3G1WA 3SPYA 1M5TA 4FCYA 4W5TA 4RK5A 4W5OA 1IIBA 3HP9A 1SD5A 2L17A 4CGDA 3MM4A 3OM0A 4IFYA 1T03A 4LSNA 4F8RA 1Z18A 3PX0A 3M8QA 3RWUA 4FXDA 2OQRA 1MB3A 1TM2A 1YS6A 5HQJA 3M9XA 4TLMB 4W5NA 4WE1A 2JB9A 4RK6A 4AHTA 2E6LA 2IKSA 1GOCA 4ETNA 5J2MA 5JNUA 2DFFA 3E3MA 2YHBA 3LUKA 3VQ9A 3DRRA 5J2NA 4DF8A 1KGSA 5I4CA 3MQ4A 3VQ6A 4HTUA 3OLVA 3O3HA 1RNLA 4OLAA 2FMKA 2X7XA 1TMYA 1BCMA 4DSLA 4IDKA 3N75A 2JVJA 3MXIA 1UA1A 3QEWA 1Q8IA 3S99A 3O3FA 4NCGA 4MR8B 1A0OA 3O1HB 2BDPA 5TQ2B 1ZBFA 4N0PA 4YLEA 2QKKA 1YK0A 2G8VA 1EX4A 1DTQA 1H9CA 4KKOA 4KHNA 1RNHA 3NGYA 1RT2A 2P5GA 4BWMA 1LBHA 4Z4IA 4KMRA 1C1BA 3H1EA 1CYEA 1JWLA 1QPZA 4F4KA 2I5JA 2R48A 1TK0A 4LDZA 4P1ZA 4J2DA 1ZBLA 3VQEA 3UIQA 2E4LA 5EWJB 1LWCA 1O1WA 3QEPA 4CEEA 2B4JA 4AHRA 5DCLA 5HRNA 1NXOA 1XHEA 2JVIA 1IKYA 2PJUA 4K8XA 1REVA 4RS3A 3U3GA 2WRZA 4CJQA 4ZTJA 4OPKA 3U6FA 2E4WA 1TKXA 1U48A 1VRVA 4MS4A 1RT5A 3LWLA 4RY0A 2WY2D 5IUJC 2P51A 3W9SA 4LE0A 2BANA 2H0AA 4BE2A 5BQ3A 3K57A 5JS1A 4LH5A 1NOZA 1T7PA 5FBHA 2HNZA 1KLMA 3CM6A 3CLKA 3JTEA 3TABA 5JNRA 5ABPA 2QXYA 3ISNC 4N03A 3TAQA 4RZSA 1R0AA 4HUEA 4O5AA 4HNSA 4OPJA 3VQBA 3TB6A 2WJAA 5DTEA 4OKEA 1JLCA 3VQDA 4ID5A 1DG9A 2IPLA 4RSMA 4RXTA 3HJFA 2ID7A 4XIUA 2OPPA 3EDCA 3HUTA 4DU1A 4NCBA 3C97A 1A5VA 3H5VA 4Z0UA 4O4GA 1HYVA 4CJTA 4BACA 1DBPA 2GUIA 1RPJA 4RK4A 4H4OA 3IDOA 1D5WA 3M6MD 1ITGA 4FJIA 1XHZA 4B09A 3O2QB 4CEDA 3KJVA 4FZXC 4FJXA 5BR1A 2HNYA 3SUNA 3DGEC 1J53A 4L4UA 2ITGA 4DTMA 1KMIY 4QYWA 2LUOA 1ZDMA 5JNVA 3KD5E 3JY6A 3ZSQA 3EULA 3V81A 3S9HA 2G8KA 4MQFA 2PUAA 1JFSA 2IAJA 1BA2A 3NHGA 4C8KA 4DTUA 3O74A 1SXGA 4RY8A 3FFXA 4EP4A 1DCMA 4FJ7A 3HEBA 3M8SA 2I6FA 4MYRA 2RGYA 1GUDA 3IPAA 4KI4A 2NT3A 3O75A 2PUBA 1USGA 1ZY2A 4LX8A 4MS3A 4IRXA 2IGIA 2IDMA 3SUOA 3NFAA 4ICLA 2TMYA 1MIHA 2FMFA 3H5OA 1S6PA 4G86A 1EXQA 3DOKA 1DBQA 1YTUA 2YKNA 3OYLA 1NJZA 1JLFA 2GBPA 1RZRA 4I9QA 3LKVA 1QP0A 3L2UA 3TAPA 1U4BA 3LUGA 4Z0NA 3Q41A 4CHYA 1NXXA 4YV7A 3L2RA 1TLFA 1IO2A 2WWVD 3C94A 1X1PA 4YO7A 1SV5A 1VRUA 5HRSA 3Q9SA 3KK1A 5JNTA 2A1SA 1EAYA 2V0NA 4OGEA 3DRSA 5SWMA 1VSMA 1QSYA 2OPRA 2LIVA 2XY7A 4E7KA 1NXVA 2G8WA 2LBPA 1E2BA 4CFDA 3TANA 4DU3A 3CFYA 4F2SA 4LZLA 4QYMA 2FSPA 3QETA 1JLBA 3OYAA 2IPAB 2QVCA 3OM1A 1BIZA 4M3YA 1RDCA 1ABEA 4KRFA 1YTAA 2M98A 4Z9BA 4UQGA 1ABFA 3JS5A 2E4UA 4D6YA 1YMVA 1RBVA 3OJSA 3I5AA 3NF9A 3O2JA 1EETA 2DRIA 2XY5A 4DS5A 4KHYA 1ISSA 4G0OA 5IC5A 4JS5A 2OPSA 1X9WA 5EWMA 4QCLA 4ID1A 1HNVA 4DU4A 4KV8A 1GCGA 2PL9A 1NK6A 3HZHA 1LW0A 4QAGA 2Z1HA 4M41A 2XHBA 2FBTA 3A10A 4AHVA 2P5OA 3KK3A 4E3SA 1LAWA 3OQNA 3QELB 4JB0A 4NYFA 2GWRA 2FQXA 1G15A 4CEAA 1QP7A 2RPIA 3KG2A 3HK2A 1L3SA 3N6VA 1LBIA 4PEVA 3QLTA 4Q7EA 3LAMA 1DC7A 1RTJA 4YWHA 1RTIA 1VSJA 4NYNA 3DLHA 4DTPA 1EHCA 4DSIA 3QELA 3OMWA 3AVKA 2O4GA 5TPZA 5DK5A 5FWYA 3AVCA 3PX4A 3AO4A 5I42A 4MR8A 2HW3A 4DADA 5TPWB 3OS1A 3OQMA 5FBKA 1TAUA 2G8FA 4FB4A 3I45A 4FJ9A 4RY9A 3NH1A 2Q3SA 1J5OA 2RJNA 3CQ8A 3T95A 5GQSA 3C6QA 2JRLA 4CF1A 1QMPA 3JSMA 2PUEA 4M3TA 1DCFA 4M3WA 1BL3A 2FMHA 3R0JA 1C6VA 3C95A 4IMJB 5T3YA 5KC9A 5KGWA 4CJKA 3LP1A 4KHUA 3VQ5A 3EODA 3BDPA 4EUKA 2PUGA 1ZN2A 4YFUA 1NOYA 2QW1A 4FJGA 3BREA 2PZSA 3DMJA 4JASB 3SV4A 1VSDA 4G0YA 3LTEA 4YS6A 5KTQA 3RRHA 3GV0A 2PUDA 2PY5A 2CD7A 1QKKA 4XLTA 4ZTFA 4N47A 3SQ2A 4RW4A 1QNLA 3RQIA 3NBMA 3ZT4A 1Z17A 4FYDA 4PICA 2MSKA 1EFAA 2IC3A 2BGGA 1CEYA 1W25A 1A5WA 2VG7A 1RT3A 1JLQA 1S1VA 3HM9A 4KK4A 4E7OA 1C1CA 4CHZA 4YP9A 1S5JA 2KFZA 5SZTA 4CFCA 4S05A 1NJWA 4WUTA 3ZT3A 4DG1A 4EVRA 1FSPA 4P98A 1QQAA 4WZZA 1JL3A 4CJEA 4MAAA 3LUDA 4CJWA 2HQOA 1HNIA 1C0UA 2HB5A 3OLWA 4MS4B 4B9MA 1TKZA 4HCCA 5IBQA 3P5JA 2X78A 3OYFA 4FJJA 2B1JA 3EQ2A 2GV9A 1LV5A 3HUUA 3VNAA 4F06A 2PYJA 3NHMA 1VKRA 1NTRA 3QK7A 6CHYA 3I09A 1KVBA 3TAGA 1DZ3A 4QICA 4KTWA 2HHVA 4DTOA 5E41A 1DJMA 1NK8A 3O4NA 1PNRA 3QESA 4FLWA 3SUQA 3V1RA 3K5LA 3H5TA 3WNEA 5J2PA 1SL1A 4PWDA 3QLUA 2Y1IA 5CNIA 1BVHA 4E0DA 4EVSA 4MS3B 2FKAA 3AVFA 3LDSA 4FE7A 3V1OA 1VSLA 2KYRA 1GOBA 1W9HA 3ALYA 2R4QA 4DN6A 5F64A 5HBMA 3RH0A 2YHAA 3OYCA 4JOQA 1ZHHA 4FJHA 5FRNA 3TAEA 1AB5A 3N0RA 3VQPA 4B8AB 4Z4GA 4CJUA 3NH2A 3CKMA 3KTQA 3I0RA 3SCXA 1NK5A 4JA2A 1E6KA 4CF8A 1KRPA 1C4WA 4RW7A 3WNHA 3K59A 4RU1A 1BDHA 1VRTA 3URMA 4MQFB 3JPWA 4Q6WA 3QLUC 3KLHA 1N6QA 4HUFA 5KQLA 4YR7A 2OPQA 4N41A 2IDOA 1UOCA 3AVGA 4DTJA 5IX8A 3AV9A 1JYFA 3GL9A 3VN5A 2WJWA 4LE2A 1ZESA 1JL2A 3LZJA 4CGHA 3GYBA 3QEKA 1TVRA 3ROFA 3E01A 3MYYA 3LMKA 1A04A 2MYTA 4FJKA 2VG6A 1NXPA 3KSMA 4AHUA 2IPNA 4GMJB 2MSWA 1VSIA 4XXHA 1NJXA 4F8JA 4Z4FA 4OGCA 1CLQA 3A0UA 3L3UA 1KCFA 5HRRA 4E7LA 4IKFA 4IF4A 2JVKA 1LAVA 1ZGGA 2GBZA 4Q6BA 4IG0A 3SJJA 5HSGA 3DM2A 1MVOA 1Z2EA 4CHOA 1D1PA 1T34A 4JAVC 3RVRA 3C3WA 4GNRA 2N9UA 1HYZA 3KD1E 5KRTA 3BGRA 4XAQA 2RDMA 5IEJA 1JHZA 4K8ZA 5JNSA 3RR8A 5BRJA 2X74A 2A9OA 3OYGA 3CRNA 1BIUA 1D9DA 3UKJA 4EYKA 1GLGA 5CNMA 4DQIA 4AILC 5EWMB 2F96A 2HHTA 4XASA 1BGXT 1HQUA 3LUJA 2H3HA 1FFGA 2P1JA 2A9PA
chains in the Genus database with same CATH superfamily
5EWLA 1CUFA 3ETEA 5IF3A 2R00A 4DRZA 4LF7K 3PUWA 4PBRA 3SX2A 2G5TA 2WAOA 4ZPXA 1FQJA 4QWWA 2Z1NA 4CEIB 1LWFA 3W5JA 4F5YA 1NKSA 4M3RA 3VOBA 2F8LA 3WRXC 2ZRBA 2QW9A 1TK9A 4TRMA 3FTFA 5E6SA 3M81A 1GAWA 2KWIA 4KHPB 2IVZA 1J39A 5C5EA 1HNXB 2HWKA 3HZZA 2C2XA 3AA3A 2BFDB 1J0EA 2CC2A 3OM9A 3ZK8A 2MR5A 1Z0IA 1WSEA 2JK1A 2HA4A 3GLIE 4BR2A 1S1CA 1UWKA 1BGVA 5T4EA 4HCBA 3WRYA 1NW9B 4UVDA 2AI1A 5BSEA 5LOVB 1UWLA 4FCTA 4IICA 2WFMA 1IMOA 3QEMB 1R50A 1EE9A 5M1KA 4FLVA 1QTNA 1WSGA 3W2TA 4CKBB 5KOHA 3SSMA 1NGAA 1FFWA 1L3IA 5EFZA 3BMCB 3WLSA 4C8OA 4C23A 1L5HB 1X14A 3OLZA 3R0VA 1NG1A 2CJXA 2C8VA 2ODBA 1E9BA 4IZ9A 3DLLL 5ELZA 1RI2A 2C04A 2QLJA 1E8NA 1IG0A 2W6PA 3SJ7A 4M1MA 2PJRA 3FGOA 4JX8A 3GLIA 4LWZA 4UFPA 4PYMA 2AMYA 4CCHA 4X1IB 3CPHA 1YA4A 4EW1A 4YYEA 2PH1A 2JLEA 2FN7A 3B6ZA 4B8WA 4OHWA 5LP6A 1W36D 1A2OA 3CX6A 2K6GA 3HCCA 3HDGA 3NEAA 5MFZA 4YDQA 1M2WA 2ZIZA 3FPAA 3NC4A 4LE1A 4ZYVA 2KW4A 3TR8A 5K14A 4KR2A 1T5IA 3L5KA 4AULA 2CVZA 1MDFA 2P0EA 2TSYB 4C04A 2FPXA 3LQFA 4GBED 4Y1CA 3JYLA 3MWYW 3QYFA 1DKRA 3DDCA 2F1HA 4HHTA 1Z6ZA 1P17A 2CKDA 5GY7A 3VNVA 4XX0B 3QUSA 1C0MA 3D0PA 1UFOA 4QTYA 3OIFA 4C6RA 4PTZA 4BB5A 4JI7K 2P1RA 3FBGA 1PLJA 4D8YA 1Q15A 1P6UA 2GBIA 3KLNA 4YMVA 2ZE6A 4HYTA 4EY7A 4L8RB 2ZJPL 5KOIA 2GXSA 5HNKA 1EFLA 2CW5A 5FNVF 5LLTA 5CLFA 2UYCA 3UC9A 3PUFA 2VP0A 5I7VA 2AP1A 1NIPA 4GD3Q 1Z3IX 4PC6A 3N87A 5EMLA 3MCAB 2NRTA 2NU7A 5FBWB 3H6GA 4X1YB 2QMUA 2DTDA 2O1EA 2WWGA 5FOUA 3BKXA 2OK8A 3UCEA 4ELTA 2H48A 3KWMA 3KLOA 2ZYTX 3GJ7A 5ALMA 5HE9A 1CU1A 2OYQA 4RDCA 2VHZA 2FP4B 5A3SA 4W7HA 5HA5A 4J7UA 1N4DA 2C5BA 3EZFA 1R27A 1U11A 3PI7A 3WYFA 3NHYA 4DFKA 4MP6A 4QASA 3N7AA 2PSHA 4A8TA 4FCWA 4IWVA 4MVJM 3DMFA 3WLOA 2WSBA 1R6BX 4DKJA 3L01A 3N8IA 4NFLA 3TLKA 4DR4B 3HU5A 2EW1A 2FXIA 3GA7A 1E2FA 4PVDA 3RMCA 2CLLB 3FDIA 4OKJA 1QB8A 4RAOA 4RKFA 4TMTA 3WLRA 5FROA 3VGKA 2GH1A 3I2GA 2ZAOA 3DE4X 3C6MA 3LQKA 3VU3A 2AKAB 4KRGA 3DLAA 1TK3A 3VQTA 4Q3EA 3ICQB 2YMPA 5AI5A 3OW2M 1T8YA 2J0VA 5JEEA 4KHSA 5EZYF 5FF9A 2RHHA 4WN9A 3DGFC 3GO4A 3QIPA 3ZBTA 2NV0A 3GRCA 3NX4A 4B83A 4D3XA 1FFDA 5G0TA 2MIIA 1TKTA 2H5EA 3EH1A 5AW4A 1XQSC 5K0FA 3FFIA 4RTSA 3F6CA 2A5YB 5KTTA 1YE3A 4JU9A 1V5GA 1R0WA 2HCTA 2QAIA 3IJRA 3R3VA 4DFJA 3IRVA 5AD1A 5TQ0A 4EO4A 2A4MA 1OBCA 3AARA 1ZGBA 2JFPA 2AX4A 2HPVA 3EGEA 3RREA 1DELA 1PWZA 3Q7SA 3RWMB 3NPAA 4C20A 4DQQA 3EN9A 2AG6A 2L18A 3I0MA 3KIPA 3PYXA 3Q3EA 3QV1A 4LOKA 3B7GA 1SUAA 1SQGA 1VBFA 3U4CA 3THSA 3T34A 1SC9A 2I3GA 2N42A 3ED1A 5HQTA 3OLXA 4HEJA 3SGLA 1JECA 3F98A 2FN4A 3IMGA 2GZDA 2XQGA 4EL0A 4JEPA 3CEAA 5FA8A 4OOEA 4BDZA 3L6CA 4PBTA 3ZLTA 4YNQA 2R1VB 4M46A 3QKTA 5H3HA 3RYHB 4JEIA 4CCYB 3KT8A 1L5ZA 1T2EA 3VISA 1T1IA 3X44A 2W8BB 4IH1A 1KYQA 4WADA 3ZGNA 1U3TA 4AS1A 1AQ6A 4Q0MA 1N2EA 5KSPA 2IYEA 4H0CA 1Z73A 2O8CB 2FVYA 4OL9A 2CUTA 4MLHA 4K40A 1D5CA 2CL0X 1L5YA 2ISCA 1SUQA 4DPMA 1QOQB 5CFNA 2GETA 1OH6A 3GN1A 3Q15C 1NSFA 1IKXA 1IK4A 1CZLA 1NW6A 1TO6A 1QGOA 1XNRK 5KDOA 4Q39A 2ZSKA 3KOUA 2OV4A 4GR4A 3CJ7A 4II2A 5HS6A 3NRCA 4A59A 1WUAA 1WB4A 4M38A 3KK0A 3T9BA 4O8KA 4K9KA 2UUCK 3TTTA 3NRBA 4TLCA 3F7MA 4ZOBA 1BI4A 2E7ZA 1X3SA 3BQ9A 4CGYA 1YBMA 4G4IA 3T1HK 2BHSA 1CF4A 3CPSA 3MT7A 5KYKA 4Q9AA 4K6HA 1E6WA 3U56A 1JXEA 1S72N 1JWBB 1Y3BE 4JFAA 4HAWA 1FK9A 3GAAA 6REQA 1S2OA 1ASWA 1WXHA 2GLTA 3FNHA 4QYIB 2MYNA 1D9FA 2ACWA 2CSUA 5A05A 1HJRA 3VYWA 4EUNA 1XHLA 4RTKA 2IHNA 3I6MA 4J91A 4BRQA 1NATA 1PWHA 4MW9A 2XWJI 1D2GA 3HKDB 4JGGA 4RGBA 5K3FB 4QU5A 4LF4K 4DTNA 5TS3A 2WQ7A 1ZNXA 3WK7A 1C0PA 4F9OA 1M9NA 4Z8YA 1K92A 1FTWA 3FLBA 4IDQA 4IHAA 2UXCB 4B9SA 3M8RA 1XRNA 3GRAA 1EJ2A 3KZNA 1QSLA 3O38A 4OK3A 3AHJA 1JQLB 2RN2A 3N2IA 2Y68A 2WM2A 3P96A 2CJPA 3Q7QA 4BMOB 1LH0A 3AETB 3PT5A 3ZWYA 2FJUA 4GQBA 4BVFA 4A73A 2GWHA 3M1YA 1YO6A 5C1IA 3KALA 2YQZA 1D03A 1R0KA 2P9SA 2O8EB 4UTZA 2OBBA 3ZGLA 3PYMA 3K2BA 1K6IA 1NMYA 2CD9A 2XT6A 4WCFB 1OCEA 2BFAA 1ATNA 1PUIA 2YY5A 1P29A 2VRWA 4NC9A 3ZU3A 1RDUA 4L3QA 3KOOA 1FFEA 3VENA 1HT2E 2F3TA 1T5TA 1PYOA 2VJMB 2A84A 4AECA 4CM8A 3W4JA 4Z1OA 4RVOA 2G8IA 4KHZA 3C3MA 1A9QA 1ZIPA 4CIEA 3GRUA 2CJYA 4OH1A 1AKTA 4PPFA 3BMOA 5EEHA 4C0HA 4HWRA 5EZYB 2NU8A 1X9SA 3O90A 4KJZA 3I61A 5LMUK 3X1KA 1ECLA 1SMKA 3R4VA 1YZLA 4Z5XA 2ZWMA 3GEHA 4UJ3A 5CBPA 3VEZA 3ZSZA 4PKHA 1E9SA 1T24A 2P5UA 4IJQA 4KH5A 2HI0A 1JKHA 3KD2A 3KEMA 5F4ZA 1JAHA 4H7DA 4JOBA 2PMBA 4P34A 1CZAN 5LLDA 2H4YA 2ONKA 1JA1A 1ZCJA 1OGYA 1AGNA 3B3JA 5H59A 3D6UA 5M29A 4BLRA 4CJSA 2OAP1 2PGDA 2VJBA 3IAYA 4Y6LA 4B2PA 4MUKA 1XU7A 1ZMRA 3ZKWB 2P6MA 4OHUA 1NBAA 2QLBA 4LBYA 1BFDA 3MB8A 1IEVA 3NVAA 2FKNA 5AI9A 2WIBA 1KWKA 4NQRA 2IRWA 5I7HA 2VK8A 3GNTA 1T0HB 4TRNA 4KTZA 1KDVA 3TFWA 4AN1A 2C2HA 3CVXA 3QUAA 4E1NA 1TTTA 4U39A 1H2XA 2N46A 1WETA 4LDNA 4WZBA 1YQUA 2CFTA 3BTUA 3LCUA 3AIIA 1Q1ZA 3LLMA 4MEBA 4ZALA 4NMHA 2YHIB 1A50B 2BTQA 4AY2A 4XPIB 4LVOA 1ODFA 1HMPA 4F2HA 5E8JA 3VR4A 4YRDA 3SE7A 3CINA 3KWGA 4RZUA 4BRWA 1MGOA 3ILYA 3STXA 1H4QA 2AI3A 2A3ZA 4B1YB 1C4OA 2WZQA 3P9CA 5KJEA 3MA0A 3KUCA 2Q1NA 1A9PA 2XQJA 3PX6A 1DXOA 4EHKA 1P60A 3RSHA 4DG5A 4TMXA 3FZLA 3G13A 3T19A 1CIPA 3QERA 3THWB 3B9PA 1A5AB 1QGYA 3OG9A 3IAUA 3QWBA 4BY9E 1KEWA 1MJGM 2FV8A 2LCFA 4CQMD 3QPDA 4K0KB 4RHXA 4K6CA 3CLTD 3N7UA 3ID8A 3R9PA 4CIBA 4V19S 3RYTC 1QF7A 1XEXA 1P6QA 3EXFA 4XFKA 5BQOA 1FNMA 1QLWA 1SVIA 1XAIA 3OA9A 4L3WA 1U04A 3ORHA 4RGVA 2PCLA 5E7JA 1Q9XA 2YHIA 4JXKA 3HSTB 2WIDA 4RELA 2OYRA 4CF0A 1N32K 4NFHA 4EOGA 1EWQA 3KKPA 5E9AA 3U1VA 1RWVA 2FQ1A 1P7WA 4ILKA 3TUJC 3HT3A 5BQ5A 1JXQA 2H1VA 1PQ4A 3OHPA 5UKDA 2VA9A 2I1QA 4D81A 2QT0A 4PS1A 3DFMA 1TVMA 4DLVA 1U2DC 2X6QA 1G66A 1QUEA 2MMCA 4ZEMA 4NPHA 1GPWB 5L45A 2WKPA 1Y4DE 4MXDA 2Z6AA 1E98A 2P9YA 1WSFA 2CBZA 5AQYA 2P2LA 3ZY5A 3DXKA 3IJ5A 2J5XA 2KZZA 1FS6A 1BHO1 4FUQA 1RS0A 4CDGA 1CETA 2PXCA 1Y1LA 2RBGA 1QRDA 1J09A 4FZ3A 3IO5A 4B3IA 2W2OA 3HLKA 4AICA 8ADHA 4JKCA 5I51A 5NULA 4F4DA 4N5MA 5ICMA 2AK2A 3C3PA 3OFSA 4ZI2A 1JIIA 3OF5A 3AZOA 2WA2A 3THYB 4R7GA 2GWKA 3FCAA 1XWWA 4XDYA 5HFAA 4ETIA 4Y7CA 2BSQA 4AYWA 2MMGA 4K87A 4CM6A 2I4RA 3AV0B 2NUBA 3GZNA 1NI4A 4JNEA 1RMQA 2XZPA 4C1NK 3COSA 1MB9A 4H60A 3ADOA 4B2LA 4AVYA 2RHDA 4Q3AA 4ZHRA 2DUMA 3CQXA 5JASA 3FHOA 5C3UA 4PF1A 2I03A 5HTOA 3ZEUB 2SBTA 4IKPA 2R6AA 5A6SA 5EU7A 4YQEA 3E9EA 3C6AA 2NRWA 1TGYA 1VECA 2ADOA 2HXYA 4FOIA 1H6DA 1JQJC 2V9PA 2PT9A 3DD5A 3DONA 3VH4A 3OOJA 1FBNA 3A4TA 3TAHA 4EHDA 3COZA 4FDLA 1V7QA 2PZFA 3JQBC 2ZGVA 4WINA 1NY6A 1WOYA 2HU2A 3UXEA 5F9HA 2GT1A 3CT6A 1J24A 1QHHA 3NM5A 3H11B 4M1OA 1VKOA 4JHXA 5EYPB 1JQEA 3TPQA 1FMCA 3MB5A 4Q1EA 3R6GA 3WEEA 5WRFA 4F86A 4MARA 2Q6VA 3PS9A 1VMDA 5CZ2A 1MC8A 4RKQA 1M67A 4NH0A 4CCWA 3MF4A 1F0PA 2HRRA 4MVJP 4LCBA 2ZTVA 4OFZA 4WCFC 4LSWA 5DFAA 2QTNA 2RJOA 4FNGA 3R7LA 1NNI1 1QRSA 4MQ3A 1GN8A 3M4ZA 4DWWA 1TA9A 4OQQA 3I1JA 4KSBA 4B3JA 1SHKA 2C9BA 3P9YA 4XRGA 4M0CA 4E5SA 1TM7E 1ADYA 4DLSA 5E1MA 3MXOA 3H3NO 1VJDA 3OHSX 3R23A 4FR2A 3ATVA 1FRZA 1RHUA 5AOAA 5H9WA 3C87A 5FJJA 2OLJA 3OEEA 1GTSA 5CLJA 1TUBA 4QTTB 1T2FA 3ASMA 4R81A 4EMBA 1XAHA 3P8ZA 3PQDA 4C30A 2C8LA 1LZLA 1Z74A 3JQQA 3LXMA 1TVKB 4RIHA 3ROTA 2E1PA 4DQVA 5FORA 3MX5A 3R5XA 4AJHA 4FPXA 4KI6A 2PH7A 3D2LA 3FETA 5CR9A 5CB0A 1CQIA 1IY0A 1OOEA 4NQZA 4UBOA 2VEOA 1J00A 4ROTA 4Y2PA 3TZHA 3RVDA 2ATEA 1WXEA 2FUKA 1WOQA 1PJRA 3UGTA 4I3FA 5A9RA 4M7XA 4JYAK 2X3YA 5LBUA 3KQMA 4CLXA 4R5HA 2BDEA 1ZU5A 3R74A 1JE1A 3PNLA 5ELMA 1N2OA 2WJVA 3U62A 4NBLA 3QITA 2XCOA 3HGTA 3I5MA 5HGJA 3NS7A 1FMLA 2UZ3A 3IOCA 4BCDA 1A5BB 1W49A 2BH9A 2RD2A 2GEFA 1F9EA 5T41A 2PUTA 3VHXA 2CJWB 3PWKA 3PX2A 1Q7EA 2NU9B 4KYTA 1V37A 1XTJA 2IZ0A 3ANMA 3NVMB 4J7XA 1WHTA 2Z08A 1HL3A 3JQFC 4E5UA 2IWRA 1AKEA 2VAPA 4MOWA 1NVUQ 2CMKA 3LQYA 1TVKA 4UBNA 5FTWA 1U63A 3SNNA 1RDAA 5BYAA 4O4IF 4QXOA 3TQTA 2PR2A 3B2EA 1A8HA 1YZYA 3AUSA 4N65A 3ZK7A 3A6JA 1YZUA 3G0HA 1P5RA 2DT8A 2YS6A 3Q3HA 1K0FA 1XA0A 4I5DA 3WI7A 2Z2XA 5B7PA 4DRXB 4XI9A 3O26A 2PKYX 3DUFA 2EL7A 3R09A 1HKGA 4F71A 4B8CA 4YFVA 1UT5A 1ZBIA 5AQLA 1NLYA 3JD3A 2QL5A 2V59A 4BMPB 4KXVA 2Y1XA 3K16A 2BONA 3CH6A 2NU7B 2WHRA 2ONCA 4UVHA 2XB2A 4EX7A 3MS2A 5M5BA 1F4LA 1U3FA 1A5XA 2OHXA 5DB4A 3KHTA 3LGAA 2ZRGA 1DQSA 2KM1A 3TAUA 3G0DA 1ML4A 2K5UA 3CZ5A 5JYBA 1HUXA 4LDAA 3T41A 5KYGA 4LH4A 4K9MA 3TSUA 1RAHA 4GFDA 1PR4A 4NPAA 5K03A 5KMGA 1ODLA 2YMMA 3U7EB 3EMDA 2R0QC 1KJNA 4G0WA 3WLHA 5IJ9B 2CXUA 3W1EA 1SK9A 1RDFA 2J4RA 1JPVA 1KJJA 2H1RA 1Z0FA 2B69A 2O8CA 4G84A 4RL6A 2EOAA 4FYXA 4B08A 2CH6A 2R47A 4U6NA 3P4XA 3FCYA 3FMFA 3EJWA 4MRMB 521PA 1KE1A 5LFAA 5KVSA 4TMVA 2OLKA 3STWA 2CXNA 4CJ3A 2GD1O 2JFGA 3Q1KA 2O6HA 2BMJA 4JLAA 4R01A 4RVFA 3VM6A 5C2DA 2EBWA 2PYZA 1IXYA 1FJ2A 5J2TA 2NWQA 5A02A 2XMCA 4IMPA 2DPXA 3RC8A 4HVJA 2GXUA 2EIXA 1WAJA 2BTEA 1W46A 4RXMA 4DJDC 1TX4B 1TYQA 4E1VA 4O29A 1BI4B 1I32A 4V3BA 4GNKA 1C3OA 2VAXA 4IQ0A 4R3NA 1XOIA 2GK7A 4OGFA 4F5DA 1CNEA 5C5DA 3AC0A 2PUVA 3L8HA 1PDWA 3I9OA 1FDRA 1UT8A 3NAEA 3HP7A 2QRVA 2XUAA 1X87A 3L05A 3LCCA 4IDFA 2ZWOA 4OU4A 1UP4A 5FB3A 5AQZA 1T8TA 3M8KA 4NABA 4PUOA 3EAGA 3T9CA 5EP2A 1L7DA 2J59A 5EXPA 3GJ6A 2HF3A 1Y82A 1M2VB 3ANSA 1L5RA 2I1WA 4HGNA 1Y34E 3R7BA 4C4SA 4URXR 5HKOA 2R9VA 3WLQA 2OQIA 2QMOA 4I1SA 5BMVA 3LZCA 1EKXA 4HD8A 3FDJA 1U2RA 1VYUA 4U7PB 2WWYA 1LLUA 2CXPA 2DF8A 3IELA 4RV5A 3ST7A 4MO9A 3DMTA 3C43A 3ECSA 4B3CA 4PFJA 5AJWA 1AB6A 2Q3EA 4MGKR 1KY5A 4KAZA 1T25A 2GRAA 2RHGB 3L7NA 4PO3X 5IUKC 5A4MS 1RLMA 1PT5A 2AOTB 3I52A 3HWSA 1NN0A 3GJ4A 3K8QA 4IJVA 4MIYA 4GM1A 5C25A 1QVRA 4QOEA 5EMJA 4IWYA 3CCUN 4DV2B 1H22A 2BFFB 5KWIA 1J0XO 1FX1A 3IFSA 3GRZA 2V6MA 3TJRA 3GB9A 4JJ8A 3ESCA 3OYEA 4QULA 5CA1A 1ULHA 2ADMA 4V3CA 2ZYSA 2Z1JA 3NGZA 1BN6A 3IT0A 2RI1A 3ZHZA 5HKBA 4ZQFA 1QTIA 2MINA 1I3AA 5AI4A 3PJDA 4CIVA 5B30A 3M7IA 1JP7A 3I2KA 4I1PA 1BISA 3WB1A 1QLHA 3O9VA 1JA9A 4ZCSA 1B4DA 3O8BA 5J1TB 1UPUA 3AVQA 3X1JA 1M2GA 4B4DA 2P9PB 3A7EA 1ZD9A 2W90A 1LTHR 4QOIA 1E7MA 4WZAE 4YAJA 3RANA 3RI3A 5BSFA 3F6BX 1UWCA 4QUHA 2V7PA 5E1OA 1VPLA 5FTLA 1IYZA 1NU6A 1WY7A 1JFFA 4TRJA 1L5LA 1NTOA 2AOTA 4HQFA 5HDBB 1QP7A 3G0OA 4CXMA 5I47A 3IJEB 1WAFA 2RHKA 2QPAA 1UC9A 4FWOA 4GPD1 1FDTA 1G64A 2TS1A 2UYHA 5HCNA 3L1UA 1V26A 4WN3A 3D59A 2HMAA 2GN2A 5A1JA 1SO8A 1YR3A 1J5EK 1TVEA 2QE7D 4EI8A 3HABA 1HFWA 1MENA 3PZRA 2W6OA 1JG6A 2OC4A 3O5AA 5EPOA 4AF7A 4JN4A 1KQGA 1DBWA 5GAEP 1USKA 1IXKA 5IAOA 3HVIA 4QGAA 1HFKA 3SF8A 4O63O 1BC5A 2BMDA 4C0KA 2I7NA 3LP2A 1JBKA 3D1VA 2YZ7A 4ZJPA 3R4CA 2OGWA 1L3UA 2C99A 3NVKA 3PNMA 4JRQA 1XTKA 4C4PA 1FL9A 2DEUA 1ESZA 2HOQA 3H3JA 4M89A 4Q1FA 2BVNA 1GIAA 1J8MF 2QYOA 3SQMA 4F4HA 2ZBQA 1W75A 3DOOA 3UKUA 1G7RA 1Y8QA 4WLOA 5TEVA 3FCUB 3TNJA 2XD9A 1K89A 2Y1JA 1SS6A 4LYDA 3ZHVA 2D7DA 4TWAA 2IS2A 3DYBA 3MCWA 4RACA 5CYPA 2QRQA 4LRYA 2PTGA 2JBAB 1YCGA 4GE0A 4NIMA 4BVGA 3T1NA 3MWDB 1K6YA 4II7A 4W5HA 2Q9UA 3CM0A 3T38A 4CIGA 5ALVA 5C7OO 7ABPA 5IJZA 5K0CA 2ZT6A 1ORIA 1Y5RA 1FKPA 2IEIA 1W52X 4M7RA 1W5FA 1E4OA 4RZHA 1KZ4A 2ZM6K 4JVMA 4G2TA 4J8FA 1XQ6A 3RJZA 3TQHA 5IAAA 1U2PA 4IW3B 5BYBA 3UKRA 2D8AA 3W4IA 2LZ0A 2JLYA 4BMYA 1Y4UA 2CHQA 2NVBA 2ZZMA 4BRHA 3C7DB 4JSRA 2V54A 4Q9JA 2PO7A 4O44A 1J99A 5C18A 5AM2A 3CEHA 5B36A 1FRNA 4BR9A 3C1OA 4DBZA 4EG8A 4QFBA 1YTLA 2E4VA 3OY7A 4ZQGA 3RTGA 4B8YA 2J9RA 5TJ9A 2JPDA 2AOXA 3PPWA 5EIHA 2L0XA 3ZDFA 2FRDA 2B6HA 3GMIA 1YQEA 3R8CA 4L08A 4UTPA 1RCTE 3WIVA 2ZIVB 1SL2A 2J3EA 1BXKA 2I7XA 4HTAA 4K81B 1SWVA 4ZVPA 1SRRA 1YBFA 4TWBA 2VF4X 4FYPA 5FNZA 5GONF 3ZZUA 3ZD7A 4B9VA 1KL7A 4WOCA 5LP6C 3WIBA 4D79A 3W5UA 5JATA 3MLEA 1LPSA 5G1OA 3NDJA 4PYIA 4MITA 5BVHB 1GYPA 4IWNA 2HWUA 1SOUA 1X70A 2HZ7A 4CK2A 1JHMA 1O8CA 1RFQA 3M49A 4M1WA 4QJ4A 2WKWA 3AOGA 3LUPA 4FFPA 3R20A 4BZXA 1EXDA 1ZN9A 3UW3A 2QYSA 1PE0A 3ANTA 3HU2A 2VQFK 3H86A 3DXYA 4LJLA 4RY2A 4J0HA 3ZLBA 4TYYA 5KQMA 5JZMA 3NOXA 2BHLA 3S0JA 4XUGB 1IY1A 1JXMA 1MCZA 4KBYA 1U0SY 1WMBA 4HZGA 5FRMA 3V1QA 3TLGB 3K71B 1D1TA 1TO2E 4YWJA 2ZU0C 3NXKA 3JX9A 4BLOA 6LDHA 2HF4A 1NJYA 3IE2A 3LGXA 3U4IA 3L04A 1O96A 3FSJX 4I1OA 5A7FA 5JO0A 3JATA 1HPZA 1VFPA 1F2VA 2VPZA 5JWRA 1Z0JA 1Z7GA 5K3DA 4ADSG 2DY0A 4X1OA 3RK4A 1Y4AE 2FFJA 2SKEA 3FZHA 5GV7A 3RFXA 4YAFA 4UAGA 1NK9A 5I9NA 1G4AE 2YFKA 1VJGA 2H9YA 4MA0A 3HA5A 1D4FA 2AWNA 4Q5VA 3OOWA 4JKOA 4Q3NA 4A03A 5KIAA 3AINA 2IXAA 3D4OA 3D8UA 5JPCA 1UWVA 2OZSA 4HTFB 4JK9A 4DLGA 4LYGA 5FUQA 4GI5A 1EXNA 3KOWA 3DHWC 2FBVA 5KO2A 3I55N 1UINA 5DYIA 3V33A 5LDDC 4QVIA 1BN7A 1CC1S 3H3FA 2GOYA 3K9HA 1EZ4A 1G3QA 3K0HA 4HAXA 3HL0A 1B9DA 3BVPA 3I1YA 3IO3A 3MN5A 4J2HA 4D74A 3SV3A 1UKBA 1QTRA 4X41A 1ECCA 1WUYA 4XQ0A 3CPWM 1BCSB 1F1BA 3S44A 4O5OA 5AP9A 1JQ3A 2HJ9A 3SSNA 5DGIA 3PENA 1TYCA 3AI2A 3RDPA 4X62K 2OFFA 3L4SO 3N2LA 3PNSA 3BSWA 3D8RA 1ZOSA 1MEEA 3BQMB 4NOMA 5ALLA 3OS0A 5F3DA 3NDRA 5TKYA 4GYWA 4ZDWA 1L5HA 3W5AA 1QLJA 3I6BA 4V1CI 1WKVA 2L19A 4GU5A 2OSBA 1XD9A 2PE5A 4M86A 4GXQA 3JVEA 5F73A 4EWLA 2V3CC 1IKWA 5FRDA 1EAMA 1VPDA 2D54A 4TWZA 1FDSA 1YIOA 1U7DA 1UOEA 5FWAA 3SNHA 1XKXA 4KE8A 4Q9IA 4Y1RB 1QGUB 4GW3A 3H84A 4ZYLA 4G0QA 4Q4CA 1TMKA 4PE5B 4M9RA 4G25A 1N6LA 3GJ3A 1XI2A 3LOPA 2DX7A 2QTRA 1XT6A 3RAGA 3W9YA 1MU0A 5IN4A 2HHHK 4CJ4A 3CJ9A 1N2CB 1YT3A 3V9UA 1JG1A 3BRSA 4XD7D 3BBPA 5DMHA 4F3RA 5L3SB 4PANA 2R96A 4PG7A 4MDEA 1MX9A 4MQEB 4P3PA 4ZQBA 1SHLA 5AUQA 5TPZD 4UQOA 1IBLB 1KARA 2H8GA 1YFJA 3JVDA 2B5JA 4DFPA 3KFXA 3LH5A 2XCRB 2VYVD 4YCCA 2YNHA 3PWZA 1HQYE 2A0YA 1GU1A 3GZNB 1VC2A 2P62A 5AQJA 1XCGB 2C8KA 4X64K 2P1DA 1U47A 2HV8A 2YDYA 3ETLA 3SEZA 4D3FA 5EJ4A 3ERCA 1N2CE 2IA5A 5HS4A 3ZEUA 3NTVA 1QGUA 3CUUA 3QPCA 2NO5A 1JALA 3KYCA 3WR5A 1E92A 1NLUA 2H4WA 1RBSA 1PKEA 4BVLA 2ZREA 3HJBA 3RVPA 3SY8A 1BKDR 3K8ZA 1KJZA 3PGA1 1T3ZA 4ZQEA 4EB8A 2W2MA 4L95C 4L50A 1ASUA 5AQGA 1MDBA 4JBLA 3H9UA 4PQGA 1SOWA 3BCRA 4XSHA 1Q86O 1XYGA 3CO5A 3GJSA 2QM7A 4MRNA 1U7TA 4MR9B 1NGEA 2BFOA 2QM3A 3EXHA 2YKMA 1EEXB 1R0ZA 1QDLB 3JQ8B 2G5GX 3IE0A 4GLOA 2ZSUA 2R85A 1RBTA 2NYRA 1SOVA 2W58A 1E1NA 3CLUC 1ZJZA 3LBAA 5F7ZA 2VATA 1RBUA 4MWBA 4KFUA 4L9WA 1YULA 4MRSA 1QIGA 3E3OA 1UMBB 4MUJA 5LLSA 1USIA 4B4KA 3VETA 2VPXA 3DUWA 4OSEA 2JAOA 2G72A 2I29A 4QDUA 1CS0B 4CI9A 2C88A 2ZQBA 2XH8A 1Z16A 2CL6X 3VYRB 3PUIA 5IJWA 4ALLA 3CXUA 2G1AA 1V11B 1EVYA 1YIDA 4JSTA 1VB3A 4Y18A 3ZNPA 3L8FA 2WIGA 1BJRE 3S2SA 2VPQA 4YX9A 1PWYE 3ZIUA 5LMCA 2FLVA 3S3OA 5THQA 1SVSA 3B53X 3OZSA 4LD0A 1L9XA 3V8NA 1GG8A 3MMXA 3ZNOA 3UWSA 1AG9A 1WCIB 3SIPA 5IABA 3AEZA 1G55A 5KYWB 3FLCO 1RQXA 5BSTA 4CERA 4J4BA 1Q7GA 1NGIA 2OCIA 2PAVA 1OD6A 1SHTX 4WCVA 2O7VA 2ZT7A 3KQYA 4IOJA 5EGNA 3JAKA 3QBVA 1IWPB 1I2DA 2H9IA 3R8EA 1BNCA 1O94A 1V5WA 2Q2WA 3LS2A 3LX5A 4CV2A 3AVXA 1S2GA 4Y8VA 3PICA 1ZAKA 4P92A 4DSTA 5BRNA 2PANA 2V58A 3AM1A 2CVQA 3GZ4A 1LPBB 4N40A 3DL0A 4DR7K 3Q0TA 3K7EA 2YN0A 2OGSA 2XJ9A 4UM9B 3K2QA 3V6DA 2NU9A 3O4RA 4HDKA 3JU3A 1VDMA 3PPYA 1DPGA 3RMDA 1ML3A 3FMIA 2YMQA 3A2MA 1O95A 2EWVA 3I04A 4MULA 5F3RA 3SI7A 3T6KA 2ZYWX 5JNWA 5BXQC 1VQPN 1H6AA 3ONNA 2P9UA 3QM1A 5AWFC 4ZZ1A 1OILA 4K3VA 4H7EA 2QHXA 3NUGA 2X5NA 4IO8A 1WDKA 4LZPA 4S3MA 5EJEA 1MC4A 2HQRA 3SBEA 1H2BA 1G21E 3BP8A 3QJ5A 4GVPA 1IHPA 1NGSA 1WLSA 3HBMA 3EE9A 5AJZA 2BF7A 3JWPA 3N58A 3HYFA 3OHMA 1ZBUA 1U6IA 3H19A 3Q72A 4QRDA 5AJUA 5GIPE 4MV7A 1RHRA 3KL4A 4DDWA 1RM3A 3Q2IA 3QENA 3FUWA 2BGRA 4YOUA 4CLEA 3K2PA 4QGHA 1E7RA 1JDBC 2YYSA 1ZOOA 2RC5A 3LDOA 4Q1BA 4XX1A 3WJ1A 5CBKA 3E9CA 4RK0A 3JQFA 4AD8A 3VAYA 2FN3A 1OFVA 4HNQA 4KAAA 4ZU3A 2BKEA 1B8PA 4BDPA 3QEXA 1AHHA 3ZOZA 3OD5A 4DMFA 1W48A 3GNSA 3MAAC 1TQHA 4XYBA 4R05A 4BUZA 1Y5NA 3NBFA 4XCQA 4GGMX 3TX2A 3OYIA 3EPRA 1KU6A 3JSAA 4BO7A 4CCAA 5B4TA 1HDYA 4BUJA 4UOZA 2Z3ZA 3UM9A 3PEUA 2Q29A 2C42A 1YNSA 2DKFA 1E9AA 3JQ7B 5E7QA 3DLCA 1KQFA 3MK6A 4CMCA 1NYRA 4PZZA 1QQBA 1VL6A 2CZQA 4HWPA 4GOXA 4HDRA 2HC9A 2O2DA 2V6JA 4JMPA 3AVOA 2W8ZA 3RUDA 3WKDA 5ED4A 1KK2A 4RMNA 3WX0A 2WD9A 3E4CA 4XQEA 3RCBA 5AW2A 2AR7A 3QBTA 3IHWA 2Q9AA 4OYRA 1H2RS 2ZAYA 2NX2A 2VSNA 4FLEA 2QN6A 2NPIA 2RGUA 3EZ5A 2O5VA 2D4AA 1RT7A 2GYWA 1E63A 1VYVA 3EF3A 3R5KA 4CMGA 5KWJA 5J2TB 4V2IA 1L4BA 2C3MA 3D3EA 1QYIA 2PPLA 1T9AA 3MBOA 4GXNA 5AHOA 4M45A 1FPMA 5LQJA 4UXIA 3L2WA 4DA6A 2GX6A 1LB1B 2G9UA 2A1RA 1DC8A 2C7OA 2IBSA 3CC2N 2BTOA 1WWKA 3I3SR 1QZ5A 1BE8A 4K46A 1Z4PX 3RKSA 2OB2A 2IYWA 2RHMA 3VFDA 3MXTA 1AK1A 3PC4A 5TMPA 4YRZA 2JWLA 4I5FA 3G8YA 5F5NA 4RTNA 3QMLA 2O8EA 5I3CA 1DIAA 4LF8K 2IHJA 1JLGA 1P90A 1RCFA 2FI1A 2IOYA 3LUFA 4OMUA 1BE1A 4CIDA 1GU7A 4OH7A 3D2EB 1MH1A 1T4CA 1BE0A 3CH7A 3HDJA 1MEJA 4QOJA 1X80B 4V0ME 3LL4A 3RHTA 1S8NA 3TL2A 1JPJA 1G8MA 1RADA 1HLDA 4G5OA 1Q7CA 3DE5X 5D00A 5A9SA 4WFAL 4RE6A 1T2VA 3K0KA 1X77A 2DWPA 3KR1A 1KZ6A 2OMEA 2PTHA 4TMWA 1C9YA 1I9GA 1N9GA 2D5CA 2ZIFA 3O3CA 1JHQA 3P2OA 3D6VA 1Q7TA 5IN5A 3ROQA 1DEXA 2PX2A 3SYLA 1EYZA 5FUMA 2ZJ7A 5A7GA 4WJKB 2QENA 3BF7A 1RWMA 2HLNA 4TMKA 2BFFA 4F9FA 2E55A 1JLKA 1IEWA 1NP7A 2XNDA 4V2UA 4TKVA 3C7CB 2AD1A 5K2MA 2DWQA 4PC2A 2ISQA 2OVBA 3L1JA 1T8EA 2OILA 3OOHA 3RG8A 5CPBA 4I9UA 3VGMA 1U0GA 2XT0A 1FVFA 1XPJA 2PU5A 4RKWA 1TL3A 2OGZA 3DDHA 1ZC4A 2W2QA 3ZKWA 2VEDA 2YV0X 4YUZA 5K6AC 5CA1F 4TN5A 4Q9LA 1P6XA 3M9WA 4HQRA 4X7PA 3W7AA 1PLKA 4TV8A 4HNTA 2X2PA 4JD5A 3A1EA 3BWMA 4PS0A 4JUBA 1E4EA 4KHWA 1H0KA 3KLGA 2VJKA 2I4OA 5K8JB 2D1SA 1D4OA 3PC6A 1TOAA 3BFPA 1U8ZA 3NJ8A 5FPTA 3DCJA 1GPBA 4TTIA 3PXEA 1GCUA 3L4KA 1ZC6A 1QCDA 3WWOA 4R2KA 4CEBA 1ZH8A 1MVNA 1YBHA 2DQSA 4H0NA 1QFZA 3EPKA 1WL8A 1KC3A 2YYZA 2V4UA 3RK0A 4HN4B 4EHHA 1E2EA 1G6Q1 4XUDA 2ZRNA 1P1RA 3E6AA 3FD8A 1SR8A 1TQ4A 2WV7A 4UEKA 3V3KA 2QLLA 1CUZA 2WONA 1D3AA 4XYGA 2EKZA 4Y6PA 4B7XA 3HJUA 5K5EA 4NBKA 2I9PA 4BZPA 1J7JA 2OM6A 2HWXA 2P79A 4NK4A 1YZGA 3H16A 4OD0A 1R8JA 2YX6A 1VGVA 3WBFA 2GS9A 3WGJA 2F59A 5CX1A 1FS5A 2ZD1A 1F2TA 1T3SA 1J9AA 1T26A 2XB6A 3QF7A 4FYWA 5FWXA 5JZVA 2FQYA 3M1LA 3VDRA 1EINA 1TZJA 2PMWB 1DMSA 2BGIA 3D7SA 3TLGA 3WBJA 4EYQA 5KINB 2PZ8A 3P97A 4DF4A 4Q0BA 3LANA 4ISCA 4LOAA 1KY3A 1ZJJA 3SJHA 5KGXA 3ZIAD 1KH3A 1UFRA 4LYAA 3ESYA 3GUCA 3OZWA 4ZI3A 2IPOA 4JV5B 2DG2A 4HPXB 2Z1GA 1CFJA 1JQBA 2HJGA 1VGQA 1NVWQ 1RMTA 3WGZA 2QRMA 4IIYA 3WL7A 2Q1XA 2B7CA 1G3UA 4K0KK 4PKGA 1AN9A 4ND5A 1ZOPA 2WJIA 3PRHA 4BEWA 1GNSA 1NN5A 1Q3HA 4MKIA 4WOJA 2OBLA 3H87A 1AA6A 4CV1A 7MHTA 1ATZA 1GEGA 2J5KA 4BR0A 2IDZA 2KBEA 4MP3A 4UTXA 4BFVA 4G81A 4PGFA 1UJMA 3TIXB 4YRIA 3P9KA 2W4QA 4R9VA 2XNKA 4KDCA 2HIHA 3BG5A 3ASYA 3C3KA 1ZJWA 4MVJA 1SUIA 4NLCA 3GP3A 3I4FA 3BXOA 3KLEA 1I3OA 1NZFA 1CFZA 3HB1A 3PFHA 2GEDA 3JYNA 4IOXA 3AB3A 5FUBA 2NZYA 4KTVE 4MV8A 1JDTA 3DW3X 3EMVA 3B2NA 2QWPA 2B30A 3Q3GE 5H4HA 1ZRNA 4KU4A 1NDHA 3KB1A 5EIAA 2O59A 5IWCA 1XTVA 1F20A 2I4IA 3OCXA 1NL3A 2CXRA 2YOGA 3G88A 1K8AO 3AB8A 3HDYA 3O2SB 3Q7IA 4M3NA 4P4GA 1J25A 1G3IA 3AK4A 3T3FA 3SQ0A 5CAEA 1PRYA 1XZIA 4EG1A 3DE7X 2F9FA 4FR0A 3RU2A 1XQYA 4PGAA 5LDHA 1YXQA 4FVMA 5FHRA 4R1LA 2O7SA 2DBYA 1K8YB 3Q0IA 3C98A 1TZ2A 4ETMA 2VJQA 5KHLB 1U7XA 2P1ZA 2PKQO 3AVWA 1F0KA 1S3GA 5E95A 3IKMA 3HCFA 1W47A 2IYVA 5BW5A 1XLTC 2Q4DA 4GKVA 1JEAA 3NTRA 2JFNA 3N0WA 3RJMA 4I8XA 3TVTA 2IW3A 3HPQA 2WBNA 3IR6A 4B5LA 2IH5A 2R6JA 4FU0A 1K75A 3KQHA 1PK8A 4IOCL 4MKHA 1HURA 1WG8A 3OJFA 2QUIA 2UV8A 3QWAA 4WGGA 5DTJA 3U1TA 3M4YA 2WZBA 1W85A 5IMBA 3AHEA 1BDIA 2ZW9A 3TKYA 1VZ2A 1FNNA 1J4AA 2BFEB 2IDJA 4R5PA 3BE6A 1CIVA 2EARA 1ZL0A 2O2HA 4C3UA 4M0FA 1Z0KA 1BDBA 2MHCA 5HUJA 4DB4A 3CN9A 2AKYA 1ADBA 1CHNA 1QF9A 3ZVKA 1DADA 1D2RA 4CTOA 3ICCA 3GLQA 1Q0UA 4IV5A 3A4NA 1FTSA 4NCJA 3TL3A 5KTPA 2F3UA 1ZBHA 2P9EA 2D0OA 3NIGB 2Q3CA 3SQXA 5CEFA 1G20E 4JKEA 1OAAA 4FC6A 2E49A 1H2AS 3VNBA 2F17A 1R9JA 3VSDA 3X0DA 2XE6A 5FAXA 2BHRA 2R25B 2E5WA 4HQ6A 3UAWA 3RROA 1N3YA 1O5TA 4NYIQ 2HM7A 4R1MA 1TAQA 4AZ0B 3VDXA 2H3GX 4UHJA 3NDPA 3ZN2A 3LYUA 2VHXA 4LZNA 5JAUA 1NK0A 1FFCA 1D2CA 2FSIA 1B7GO 1E3JA 2FG7C 2WWRA 5JE8A 4I2PA 1PSDA 5KAMA 1MRZA 2AH5A 4IFIA 1CQXA 1Z25A 2QZJA 3HFSA 2R87A 1EX6A 2B8JA 1S2NA 5FPSA 3R7WA 3URMA 3F2VA 1ISMA 1NQOA 2YV2A 3ZCRA 4B3DA 1LJLA 1VL8A 3FTCA 1B76A 2G08A 2C4TA 2DR0A 3QVKA 4NNOA 3WLJA 3U7HB 1FW6A 2WD8A 2B4RO 1Q18A 3AR5A 4OA8A 3VSAA 3ZVRA 3HCEA 4LPSA 1RXCA 1LI7A 2CCGA 3DLBA 2AXQA 2WP0A 1J22A 2J3IA 4H6XA 4QELA 4WKCA 1YDHA 2UXBB 2WYHA 2D5BA 5FLEX 2V6FA 3THRA 4DW8A 3I0SA 4YOWA 3OQHA 5LB4A 3RC9A 2OENG 2VN8A 3I42A 4N9QA 4V03A 3T7JA 4M1ZA 1BEUB 2YIDA 2B99A 4R9RA 3PHHA 3BWDD 2P3QA 4Y6SA 4BO9A 4OPHA 1E7QA 3E9YA 1OUMA 4JP3A 4DXHA 2RAVA 4TTVA 4BPBA 3V6MA 3QVGA 1SURA 1FZQA 2HHJA 3KKEA 3WBKA 3WYCA 1E18A 1LPOA 4JI6B 1JDZA 3OFVA 1BDJA 2ONZA 1DGQA 3GFOA 2PBFA 1BHSA 4OYYA 5JYCA 3I8SA 3RV4A 4DV1K 2WWHA 3NUZA 3L0DA 4UUOA 5GP1A 1SAZA 4DTXA 2YZKA 4M49A 1T91A 3C4JA 3QXJA 4Y2UA 1JHAA 3UYKA 2FZWA 1HTWA 1YVUA 2E1ZA 2ETXA 3D6HA 4N6NA 5A3QA 5JVDA 2IPXA 3EQ9A 3UMYA 2IXFA 3ZDRA 2IVPA 3R40A 2IYTA 1V2HE 3MHPA 5KTSA 4F72A 4O4JB 1WEKA 2V96A 2WMNB 4HATA 4JQCA 3RUPA 4UHEA 2WF9A 3QE4A 4DQXA 1E3LA 4NAVA 4PLVA 3PR1A 3K6SB 3CZ4A 3ZJUA 3O6VA 3QZUA 2VWJA 4L4ZA 4W6ZA 4NE7A 5H81A 3SFZA 4C21A 2AA3A 5B64A 2D0PB 1TJYA 4PLFA 3IP6A 4XUEA 4A3SA 5I7SA 2GLXA 3WRVA 3J7AC 2WSIA 2R1TB 3D5QA 4EJSC 3TDKA 2PNFA 1ZR2A 4EFDA 1YE8A 4RETA 5KI6A 3U4MA 1TQ2A 1M2NA 1ADFA 2DSNA 3GW8A 4I36A 2P3LA 4LBVA 1SC1A 1WR8A 3DEYX 3GIWA 4I2VA 4WXMA 2GZMA 3SPYA 2GZ3A 3PGMA 4W5TA 4YREA 3VR6D 4P2BA 4W5OA 2L17A 4ZKDA 2HT1A 4TL8A 1LC0A 3BCSA 4EQ6A 4PZDA 3J80A 1IJJA 2H7CA 4LSNA 2V5AA 1Z18A 3BA6A 4KDFA 4GVEA 3PX0A 4H1UA 4Y1FA 4YROA 3U6KA 1YL6A 1PK7A 3EVNA 3VMFA 1NU0A 4FXDA 2I1VB 1SUWA 2VT3A 3GDHA 3LLUA 3BB4A 3RTAA 3GPBA 3OAAD 3PFWO 3U17A 4ESOA 5IFKA 1C8BA 2Q4EA 1YZFA 1G38A 1J49A 4RK6A 4UVEA 5E8RA 3BEOA 4WQ4A 2CDRA 1MTOA 3HDTA 2FSSA 3LVFO 2ZSEA 3BIOA 1YAJA 3E3MA 3OU6A 4KLAA 3AVYA 3ND5A 1QHEA 3TBHA 4EKIA 1CUWA 3DV0B 3IMCA 2NRZA 3DRRA 3B85A 4FS3A 5IARA 5J2NA 3DDNA 4K88A 2WTXA 4NESA 5BN1A 2LKCA 1Y6GA 4WKGA 3OPXA 4OAQA 2O3UA 1KGSA 1JKJB 2PDAA 2WJZB 3RSLA 3VH2A 4FYJA 3ZG6A 3VQ6A 2IHTA 3MTIA 3R3UA 3OLVA 2EKQA 2P0YA 4TLBA 5HCUA 3SJCA 4ZGBA 5I8WA 4OLAA 1E2KA 5AKLA 3ZWNA 4BX3A 2FMKA 3S29A 2GERA 3B78A 2X7XA 2ZPTX 1WUKS 2L42A 1BCMA 3NH9A 3G4SN 5BN5B 2PY6A 1TCCA 4C1NI 4IDKA 1RTTA 1UA1A 1SAYA 2D1RA 2JVJA 3QEWA 1XU4A 3BMNB 3KBBA 3U40A 3LT2A 1X1DA 4Q4DA 2PGAA 3QWFA 3WZMA 1QTQA 4F04A 3ESBA 1K2VN 2Q45A 4S0XA 5TQ2B 4B80A 1THZA 3OOSA 5AW6A 5EUBA 1ZBFA 4D4IA 3T3OA 2VXCA 3ULEB 1GA6A 1RJGA 3DDUA 3T3GA 1F6WA 1DTQA 4KN9S 1ZHOA 1R6TA 2RK6A 5G41A 2NUAB 3NEJA 3D64A 4HNAA 3C3EA 4LFCK 2CF6A 1PG5A 1P31A 2CNWA 4F38A 1FUYB 1RRCA 4KHNA 3WIDA 1AHIA 4LSGA 2X5OA 5HPYB 3HBAA 4FGKA 4I1UA 5AVKA 3I6YA 1RT2A 3DFZA 1A95A 4GMXA 4ME6A 4A6PA 3EIQA 3CZRA 4L72A 2JKZA 5KQ8A 2HYDA 3A8TA 1WQ1R 2BKLA 2PKQP 3H1EA 2QGZA 4PFSA 4DLWA 1FU4A 3QKUA 3VTZA 4YP5A 2I5JA 4C07A 5L6MB 1JWLA 2VNSA 1T6BY 3ZU5A 3HYSA 1T2DA 2BM0A 4L5BA 1TK0A 4LDZA 5H02A 1B43A 1R9MA 3O2NA 3FKQA 3EGVA 4WFNL 1NYQA 1ZK3A 3AQIA 5MGBA 3ZETA 2BFCA 4WOPA 3VQEA 5FXMA 3UUEA 4R0VA 5EWJB 2YINC 3WYNA 3QEPA 2PT5A 4TV8B 1ZEJA 2JDID 1EA7A 3DBHB 3G8AA 5HRNA 1NXOA 3IHLA 3NT5A 1IKYA 4HR7A 4QTXA 4RNCA 3QVUA 2FG6C 3ZJ5A 4K8XA 4OKIA 1CJMA 1GQSA 1P7PA 3B6EA 3CH4B 3KKQA 1K9SA 1QH1A 3KAKA 3U3GA 2REBA 2WRZA 2XOXA 3O3MB 4EA9A 4ETWA 4ZTJA 1X42A 4P54A 5F5LA 4QJ3A 4OPKA 1SBTA 1T29A 1K7XB 2UAGA 1TKXA 3EA0A 1T3TA 1KO7A 4Q66C 3V7YA 5KNCD 3H46O 1JH8A 1RT5A 1SUSA 5DTQA 1TLTA 1IUNA 3LWLA 1YRYE 2C96A 5KQRA 4AFNA 2XYHA 1OFGA 1A7KA 2EAUA 1XXHE 1U02A 3JQGB 1WSDA 2NTVA 3O8NA 4IINA 4XGNA 2WY2D 2NPFA 5IDXA 4PCVA 1KJQA 4KH6A 2GRJA 4C78A 3HCPA 5A71A 1OB2A 4BQFA 1N9ZA 5EJ7A 4ZAYA 4H3VA 1A8QA 3K57A 1P80A 4QYXA 2FJPA 1JHXA 2VJPA 3FR0A 3LYAA 4U9IS 2J0UA 4CQJA 4HDNA 1S3FA 2BEKA 3RRMA 2OXCA 1H3EA 3ZHYA 3GG4A 1W4CA 4RHTA 1Z6QA 3CM6A 2WPDA 3JTEA 4KX3A 4X64B 1N5KA 2E2QA 1MO5A 2RKWA 3WG9A 3A4YA 2OYCA 2VHEA 3NJRA 3DKVA 5HIKA 1R0AA 2OXFA 4HUEA 5IAJA 1RJFA 5HIJA 3FTPA 4CPDA 5JIBA 1JKMA 3KJQA 4O5AA 4C5AA 3HBNA 3EK2A 4LCJA 5SZIA 3IPRA 1NNSA 2WJAA 4INOA 5DTEA 4OKEA 2IPLA 3FDZB 4PNZA 3KKOA 5FTKA 4EG3A 1V3UA 3NTOA 5IBCA 5M34A 5AQNA 3HJFA 1EWYA 1KI6A 2RGWA 3WWZA 4G56A 3AKEA 3EDCA 2J33A 3RLFA 3HUTA 4QIHA 4DU1A 4NCBA 3O8QB 4L74A 1C8KA 1VE1A 2EX0A 1JNYA 1T1SA 1TA0A 2WI8A 4DZZA 1T13A 4G5HA 5AK4A 4H17A 4ZA2A 2BZ1A 2LD4A 3W06A 3UJPA 1XA4A 4AF8A 1NVMB 3AJ9A 4FCVA 1RPJA 2GM9A 3TW6A 4CIWA 4H4OA 2XUPA 2ATCA 3H8SA 1F60A 1Q0HA 4L5JA 4PW0A 3DULA 3PHGA 4JP5A 5IAKA 3A9UA 3WMGA 5FL7A 3NH6A 1ITGA 1T1RA 1UC5B 3OIYA 2H07A 1XHZA 4LJ4A 4BKUA 4MEJA 1OI3A 4BMNA 4FZXC 4ZVQA 2P6NA 5HVNA 1E4VA 2HNYA 1RJDA 2AQIA 4OHXA 4RUKA 4L4UA 1U8AA 2ITGA 4DA0A 2IYYA 3AI3A 4AM6A 2B8TA 1NBWA 2J6HA 2AWOA 1KMIY 2X0JA 3RJ9A 4RTQA 3OQOA 4PC7A 5JQGB 4L9RA 3WXMA 4BP3A 4I8IA 2IF0A 2O19A 2GEKA 3E18A 1KFEB 4I19A 1E6UA 1OTYA 1COZA 2LUOA 3B20A 1O1YA 4KEAA 1Z8FA 5JNVA 3O1WA 3JY6A 2GTDA 2YJFA 3ENOA 1U7UA 2FVXA 3HL4A 3LIPA 5DI9A 4EKYA 1N78A 3J7YP 3ZTWA 1CZOA 3GQBA 1M3SA 3WL6A 4ZK6A 4F4JA 3OFNA 5K0JA 3F4LA 1JIVA 3RKRA 4ZHQA 2G5CA 2W9XA 4G8CA 4C8KA 1OBFO 5DU2A 3VR2D 4UPEA 5IHXA 2XOEA 4MB6A 3IURA 5HRCA 4MVJE 5CLIA 1SXGA 5AVYA 1Y3CE 4CKEA 5LNK1 4NBVA 5GADl 3CKYA 2FFRA 3HEBA 4FHDA 3QWHA 3ZIDA 4AX8A 4F1WA 3COJA 1KO8A 3NVKI 3I2JA 4CG1A 3AUFA 3BJZA 3IEIA 4DDMA 2C4HA 4M8LA 2G67A 3IPAA 4OL0A 4RORA 4JFRA 2FPLA 3HYTA 4DVGA 5IC4A 4CM4A 3AHCA 2D4HA 5KTNA 3HH8A 1JQ5A 3GAFA 3O7WA 2JIQA 3WL5A 2FFHA 4Q7LA 3GVCA 4YCBA 1MWKA 5B4UA 2BRUC 1WW2A 3WV4A 5AM3A 3NFAA 2BR5A 4CZLA 3FM9A 2TMYA 5ED0A 3Q4GA 1U6KA 2ZRMA 1JI3A 4CKXA 3DW1X 4OGLA 4HAUA 4QEDA 3CVVA 4IIEA 3TIVA 3NALA 1TUIA 3LQQA 4NXMK 4G1FA 5K3FA 4LJSA 2Z9DA 1T2UA 3ONVA 1EXQA 4WFQA 3UK1A 4QLBA 2VYPA 1U2EA 3IAAA 3JRNA 4QG7A 3MNFA 1RWKA 4GECA 1WP9A 4ZFNA 4ZCMA 5B7GA 1NURA 3TNLA 1BKYA 2YKNA 1NJZA 1JLFA 1RZ3A 2XCIA 4I9QA 1E1RD 1Z8NA 2QR2A 3KVRA 3OPQA 4L27A 3WTBA 1QP0A 2FZKA 2Y2VA 1GZUA 3LXXA 4NL4H 2ODPA 2F1OA 4RFVA 4XYEA 3MCPA 4JHDA 5JXGA 2XTZA 1Q7YO 3M83A 4HQ0A 4M1TA 4PR3A 2XKKA 2HBYA 5BSKA 1U31A 1OTHA 1KRXA 3H8VA 1SCUB 3G5UA 1NMEA 1TLFA 2JFBA 4I55A 2WWVD 5DSTA 4S1VA 3UJ7A 4DEVA 1X1PA 4YO7A 2JDIA 5CB4F 4EG4A 3FPEA 3Q85A 4DY6A 2ZYDA 5HM8A 1KU0A 3ELYA 3NLLA 3VMMA 4MA4A 1EAYA 4B75A 4BTLA 2V0NA 1UH5A 3ZPXA 4OGEA 4GBJA 4E30A 1N77A 1VYHA 5B12A 1LSUA 4M99A 4YCJA 5AW1A 1L4GA 3GGDA 3SJAA 1BWPA 3LRXA 2HHHB 1EP3B 4S1WA 1II8B 2DFPA 1NXVA 4URVR 1V7PC 3U5ZB 1GTRA 3TANA 2DM6A 4E2ZA 4TXLA 5CB6A 1LSSA 4LZLA 3OETA 2XCTB 1LLCA 3NHUA 3GDGA 4P3OA 3USES 4JI8K 1WBJB 1E5TA 2V7XA 4G41A 1B93A 3KDPA 4JIMA 4XH1A 4KC0A 1T8WA 5DNAA 1X9GA 2FSPA 2JH9A 3ZLUA 3GVPA 2D0IA 5DHUA 4O02B 3E9PA 4CI0B 4ZI7F 3AEXA 1O5IA 2X15A 3A5OC 4O6VA 1KTIA 3DTVD 3T1YB 1IJEA 5HZMA 1NM1A 2B83A 2JEZA 2Z8XA 4EGCB 2XWSA 3OM1A 3BOSA 3RAPR 4M3YA 3A9CA 4KIGA 3OF2A 4KRFA 1Z6RA 2M98A 2VOJA 3OESA 4E5NA 1WRBA 1ABFA 1TT7A 2MDTA 4GAEA 5G0UA 2CKMA 1X15A 2IZ1A 3TTUA 3K9GA 1EGQA 1ILYA 1RBVA 2IHYA 1BOTO 1E7SA 3W8EA 3GFSA 2NNLD 3I5AA 3G2NA 1OI2A 3M6FA 3NHBA 4ENRA 1E1LA 1NBMD 4CVNA 4UZFA 1XZEA 1U65A 4PRYA 5LA6A 5F23A 1NN1A 2Y9MB 1T5BA 3WFZA 4KHYA 4DS5A 5P8WA 4UY8O 2XVAA 4AJ4A 2ZULA 3JAKB 4D02A 4EELA 4FGUA 4IDGA 4YRMA 2E2PA 1T6DA 2OPSA 2NZTA 2P41A 2QQEA 2QPTA 4GI3A 5EWMA 1CQWA 3ESZA 4A5AA 1HE4A 1JZSA 2CE7A 3JALA 1HNVA 2CUKA 3GUHA 4J7AA 4DU4A 4FFMA 5DHPA 5DNCA 4WKPA 1GCGA 1GTL1 4EUSA 1Z5OA 3JVUA 1MX3A 3HZHA 4QAGA 5HE8A 4M41A 3K0AA 2XHBA 4I55F 5A62A 1FFHA 4LZOA 5F76A 1RAFA 4NU5A 2IYPA 3IDHA 1TYEB 3W6OA 3SBDA 4Q3CA 3OTHA 4ARZB 1GRQA 2J9FA 1SCQA 1A77A 1WU8A 3QG5A 4E3SA 1PJ2A 4MKGA 2NVWA 5JT1A 5JCJD 1C30B 2XMPA 3CX3A 3KVGA 4Q19A 5DEOA 3MSCA 1MQAA 3NZEA 3N8KA 4HVCA 4FXOA 1WBDA 2ASVA 4AUNA 2V7BA 2W2LA 4FGSA 1E1DA 1A7UA 1KO4A 3WVNA 2ZIXB 3ZNNA 5GVSA 5IDQA 2FQXA 4YCDA 4CM1A 2FZCA 1SBNE 4KI0A 1G15A 1PJZA 1GRNA 2QVBA 1KMHA 3FUXA 4WPGA 4LHVA 4QJBA 4RCZA 3BDAA 2IV3A 1VJTA 4AN4A 3KHSA 2J5RA 4OIFA 4PL8A 3RIEA 4EPXA 3T4UA 4QBGB 2OZVA 3UK6A 1IL0A 1TL7C 4PEVA 3OFJA 4O5FA 4Q7EA 2ZQYA 4S12A 4NPCA 3UMRA 4GMGA 5ALHA 3DZJA 3K1YA 1TGVA 5BYKA 3P45A 4J0EA 1RTJA 2JEOA 4J7CA 4RD1A 4X97A 3WGKA 4D26A 2K7FA 4UEJA 1L7XA 3M0EA 4FFOA 3V4VB 2YFQA 3D6JA 2BJHA 1VSJA 3UHOA 4NYNA 3DLHA 1IVNA 4DTPA 1EHCA 2V4ZA 3VUE