1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN AF1318
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
2E4VA 4KPYA 4B08A 1RZRD 4HTUA 5TPWA 3QETA 1T34A 3DLHA 1EHCA 3TI0A 4Y1DA 1LAVA 1EP4A 3Q7SA 5DK5A 1QMPA 4I2QA 1BDHA 1HMVA 3L2WA 1K6YA 1AB5A 2B5JA 3TAPA 4N03A 5TPWB 2G8WA 2JRLA 3HUUA 4W5RA 4FJ5A 4LD0A 4NCGA 3S3OA 4LDAA 5IBQA 4Z4FA 3ZT1A 1ZY2A 1JWLA 4CEZA 3U6FA 2ZAYA 4E7LA 3BILA 5JS2A 3ISNC 3H5OA 2FEPA 4RW9A 4F2RA 5D3GA 1NXTA 1LWCA 4OVLA 4DSFA 3TARA 1SL0A 1DCFA 2YNHA 3T1AA 4E89A 1C0TA 4B9LA 3OYBA 4KHYA 2E4ZA 4ZTFA 4HVJA 1JDPA 2VYCA 5HP1A 1BCOA 3RR8A 2HHTA 4NCBA 4LH4A 1Q9YA 1RDDA 1YTAA 2DFFA 4Q0BA 3ALYA 2XY5A 4B8CA 2PYJA 2EHGA 2RJOA 1IKXA 4DLGA 5C24A 2XDYA 5HBMA 3SM9A 4J2AA 3HXMA 4FLTA 2PUEA 2A9PA 1DRJA 4O1IA 2PUFA 4JB2A 2E4WA 1GUDA 4CJFA 1SXGA 4MS1B 3KK1A 4KK3A 3GWGA 2HHQA 2P5OA 2A1SA 1NK8A 4MRMA 4LY7A 2VG6A 3ROFA 2X7XA 3OLWA 4DADA 1QQCA 3HVTA 3VQEA 3GYBA 4O0IA 1TKDA 4ETNA 1KRPA 4FE7A 2DY4A 1Z16A 4CFBA 5DKFA 4WXEA 2TMYA 2NZUG 2IPLA 1QE1A 1NXXA 1JXEA 4RXTA 3NDKA 4Z4EA 2HQRA 2HNZA 4HUFA 8ABPA 1JLBA 1I3AA 4AHTA 3KD5E 5KWSA 5KQGA 3OYAA 1XHFA 2I5JA 3EQ2A 1CYEA 3DLBA 5JNRA 4H3KB 4RK0A 4FLXA 4CJ3A 2PL1A 4G0OA 3HSTB 3SG0A 3HDGA 5IUNC 5CNMA 2E4LA 3LALA 1D1QA 3PUFA 4MR9A 5IEBA 4GPAA 3QEMA 2LSNA 3TAEA 2MSWA 2OA8A 4FLVA 3O1JC 3FMVA 4LH5A 1QS4A 3KKEA 3PO4A 1T7PA 3RMBA 2KZZA 4O0JA 4FXDA 2FLKA 2QSJA 4XXHA 1KVCA 2Q5CA 1S9EA 4KHWA 3QEVA 3SZ2A 2H0AA 4DQIA 3VQCA 3LDSA 4CJEA 4FM0A 1VRVA 5HM6A 1P8AA 3RVKA 5CZ2A 3FFWA 2E4XA 1A0OA 3T3FA 3C95A 3QEWA 1ZYQA 5BR1A 3OQOA 1BISA 3LKVA 3QLVC 1Q9XA 4DTNA 4KNYA 3ZT3A 1VLZA 1LAWA 1TVMA 3DOLA 3F6CA 5FWXA 2FBXA 3I0SA 5IEJA 3Q15C 1VSMA 3F9KA 3RMDA 4FJKA 5KQPA 1E6MA 4ELVA 2IPNA 4C8OA 1U0SY 2WJWA 1CHNA 1YS7A 4IGAA 4CJVA 3IAYA 1NK7A 3V9XA 3TABA 3SQ1A 1QP0A 2GV9A 4Z9AA 4Y1CA 1C1BA 3Q41A 4OKEA 3BRSA 3OQNA 1RT1A 4F8JA 2OENG 4L85A 1Z2DA 4CGHA 4CEOA 1IKWA 1JLKA 3DGFC 1PEAA 3THVA 3F7NA 3H1EA 2ATQA 3VNBA 1D9FA 1ZH4A 4CEDA 1Z15A 4LE0A 1YK0A 1S5JA 3CU5A 3ASMA 4QPJC 1DBWA 1N6QA 1QO0A 3CFPA 3LUAA 3IDOA 1TJYA 4OG2A 1U48A 4NCAA 4NICA 1NXOA 1ZBLA 3LP2A 4MQFB 3AVMA 3ZT2A 3IP6A 3AO3A 2R7YA 2IS3A 4FM1A 4CK3A 4CIEA 5CNJA 3I5AA 4EZ6A 2RGYA 1USKA 4FK0A 1WSHA 4DSJA 3LZIA 4FK2A 3DMJA 3WNGA 4IG0A 1QTMA 1YIOA 4KZKA 3RVJA 4MR7B 2IPMA 3N0RA 3V9WA 1NJXA 3N0XA 3TAQA 1KCFA 3PV8A 2VWKA 2B6AA 5KRSA 3O3FA 1A5VA 4ZPJA 4JASB 2VG7A 3NGZA 3MEEA 4GVMA 5T3YA 1HNVA 1U2PA 5FDLA 4B09A 3T8YA 1F51E 4W5OA 2JK1A 1GOBA 3VQQA 3A0UA 4KTZA 1HJRA 2Z1GA 1L5YA 3RMAA 1JLEA 4S05A 4CF1A 4N47A 4E0DA 4OLAA 1QP7A 4Q5VA 1Z18A 2KFNA 3JTEA 5HRNA 1RT3A 4OGEA 4B9UA 3H1FA 5BRJA 3G1WA 3CG4A 4JLHA 4KQCA 9ABPA 2J48A 4TLLB 4MR9B 4KB0A 1NOZA 1FKOA 1D5AA 2X78A 3NHZA 1C0EA 3CM6A 3O4NA 4KI4A 1CLQA 3QIPA 4EVSA 3SUQA 1I3CA 3SQNA 1WLJA 3O1HB 1TK8A 3FDFA 2HHXA 3NBMA 5HLFA 3NH2A 4M88A 4CJ5A 3HVRA 3OM1A 3KKRA 2QXFA 4EY3A 3GA5A 4CIFA 4ZMRA 2P9HA 1M2EA 4MFBA 5HROA 2ID9A 1WSEA 4RK1A 3P9YA 4IG3A 3PX0A 4LE2A 3P1GA 1MB3A 1BVHA 1NTRA 4M3WA 4F8RA 1QQBA 1XWLA 4FJLA 2VK2A 3CHYA 4DTRA 4PEVA 1APBA 3UUGA 4G0XA 4RK6A 1JYEA 4J2EA 1F4VA 4IILA 1U04A 4RY8A 3NHMA 4EYKA 4JA2A 3CQ8A 4EVQA 3QX8A 4KTQA 3JSMA 4CF9A 3UIQA 2QV0A 2XRIA 1NJZA 4KI6A 4QOZB 4G86A 2G8VA 5B3JA 4BE0A 2PZSA 2KW4A 3HV2A 3ZT4A 4DSLA 4XASA 4DMNA 2MSLA 3OYCA 4O44A 4AH9A 1NOYA 4OKKA 4XARA 1LBIA 5C25A 2IC3A 4DFPA 5TQ0A 4PWDA 3Q7TA 2FEKA 4Z4GA 4DTMA 3VA3A 5J2MA 4CEFA 3QEMB 4BE1A 3PX4A 2XY6A 3QLTA 2G8KA 5PNTA 4RG8A 3C6UA 2GX6A 3LWMA 3SV4A 2NUBA 1HNIA 5JS1A 3KLFA 3MEGA 1S1XA 4CHPA 3MXIA 4YFUA 2F96A 4DSKA 1L3SA 5C5EA 7ABPA 4CGGA 1Z26A 4FJJA 1SKRA 2FMFA 4RW8A 3QEKA 3KLIA 3V81A 1VSKA 1D1PA 3A10A 4EYOA 1U2QA 4RS3A 2AYXA 1YS6A 4RU1A 1HYSA 4M45A 4FJ8A 3LFTA 4JOQA 1RBVA 1VSLA 4QAGA 1OXBB 2PKXA 1SL1A 1RILA 4MS1A 3DYAA 3ZCMA 4HUEA 4UQGA 3SUPA 3O2SB 3OYMA 1EETA 1IIBA 3SQ0A 4BWJA 4E7IA 1S8NA 5C5CA 1KFDA 5KRTA 1D5WA 2D5RA 3ZSWA 3OYEA 1ZH2A 3LAMA 2QW1A 3HPHA 3AVCA 4KVFA 3QESA 4NYNA 4DTSA 3H5LA 1TKXA 5KGWA 4FW1A 1VSEA 5SWMA 2MYTA 4KKOA 4DU1A 4L4UA 2CD7A 4B8AB 3EY1A 2O4IA 4C8MA 3MA0A 4E19A 1JL1A 5T7BA 3I45A 4B9MA 1USIA 1J9AA 5CNIA 2RF2A 1ZGGA 3NCIA 1XWWA 1XHEA 1N5YA 2N9UA 3KG2A 3H5WA 4EVRA 3OO1A 1BIZA 2ZD1A 2JLEA 4PZ0A 4M3UA 4N0PA 4KK4A 1T05A 1ZGZA 4CIGA 3T38A 1GLGA 5J2PA 4F4KA 4IKFA 2M1ZA 3RVNA 4OKJA 3L3UA 4BDPA 2YNIA 3CRNA 4G0MA 4IRXA 3LANA 1QSLA 4RK5A 3HDVA 4NV3A 3E01A 3OMXA 5TE9A 3Q7RA 3KLHA 1D8YA 4H4OA 1XC9A 1SL2A 2JB9A 3L2RA 4Z0NA 3OJUA 4HYEA 5IX8A 3OYJA 3EAFA 2OYQA 3QNOA 1U45A 3SQ2A 3QK7A 5IUKC 1TM2A 3LPUA 4KTWA 2E4YA 3GBVA 3R0JA 4PICA 3SJJA 2Y1JA 4EP4A 4RZSA 3ZSZA 3L3VA 3O75A 3V6DA 1D9DA 1HYZA 5C42A 4YCSA 4KO0A 1VSFA 4DF4A 3VQ6A 2BDPA 3OYLA 2V0NA 1DC7A 3ULDA 3DLKA 2B4JA 2Z1JA 3G10A 5TQ0B 3ILYA 4DQRA 2MYNA 3T95A 1X1PA 3OLZA 4WWHA 3N8IA 4FK4A 3DOKA 3L6UA 3KCNA 2YHAA 1YK1A 3LP0A 4CK1A 4KFBA 3V9SA 1UA0A 4N41A 3A2FA 3TB6A 3WNHA 4JS4A 3CM5A 4ZJPA 3V4IA 1BA2A 4ZHRA 3IPAA 1NK6A 2QR3A 1BIUA 1CZ9A 3MECA 2KYRA 1TLFA 1LW2A 4DQDA 5FWYA 3S99A 2FSPA 4CJUA 4IFVA 4BACA 3MIZA 3K58A 1URPA 1B9FA 1ZVVA 3NH1A 1JKHA 2FXIA 2GWRA 2PE5A 1LWFA 4EGSA 2FW0A 2HB5A 4XFKA 4RSMA 2CWDA 4Q6WA 1M5TA 1RTHA 3SAJA 4KHSA 3N75A 4CJQA 1J5OA 4M41A 4NQRA 2KTQA 5GQSA 3HPGA 4LSNA 3AA5X 4LSLA 2KZMA 4CEEA 2VWJA 3KD1E 3HSYA 1Z2EA 3HK2A 4E3SA 1ASVA 1QSYA 4CJPA 2F8TA 3NF8A 3H1GA 3SI6A 3P83D 2Z1HA 1IO2A 2ZQBA 5IC5A 4AHCA 1E6KA 2OPQA 2BE2A 4CJRA 3AA2A 3FFXA 3KLNA 1R0AA 2R4QA 1FFWA 2RKIA 1HRHA 5DGCA 3ROTA 4FM2A 4CGFA 4CE9A 1Y97A 1RTJA 1WSIA 1ZITA 1EKEA 4WZZA 4CHOA 1L3TA 2QKKA 1J54A 3TAFA 4FJ7A 4LDZA 1ZBIA 1S1WA 4FB4A 1REVA 2IOYA 4D6YA 2HQBA 2G8FA 1JFSA 3HS3A 1RT2A 4YNQA 4EYQA 4FYDA 2HW3A 2I6FA 4IMJB 4Q6BA 4KAZA 3OO0A 3H6HA 4I2PA 1NXWA 3K59A 4QYWA 3VQ7A 3KLOA 4KHQA 5ABPA 2JGUA 5KC8A 4M3ZA 4O5AA 1ISRA 4JAVC 1RBRA 3IP9A 3VQDA 5JNWA 3F6PA 4RV5A 4IDKA 3JS5A 1FQWA 2A9OA 4CHQA 3G0ZA 1ZBFA 4E7PA 3EZ5A 2FMIA 4E1NA 2XY8A 3D8UA 1BL3A 4CGIA 4B9SA 2WB4A 3RVOA 2ITGA 2FBYA 1M5UA 1S6QA 1Z25A 3FFTA 5E3JA 4DN6A 3HUTA 3VA0A 1QPZA 2RPIA 4EZ9A 1ABFA 1DCMA 2PAFA 3RR7A 1JXBA 2GKGA 4M3XA 4PE5B 4YWHA 3QELA 4MGEA 3TO5A 4YGXB 2HMIA 5JNVA 4RW7A 3K4HA 4KHUA 4XIUA 3ZSQA 3KTOA 3NF6A 5K14A 2NT3A 1SUQA 3QIOA 2QZJA 2P51A 4IFYA 1Z12A 3FFIA 1C0UA 4UHKA 1RT6A 3NHGA 1DBPA 1XHXA 4H60A 4CF0A 3DLRA 3T19A 1RDBA 4OPKA 3O2JA 4QCLA 3MQ4A 3SPYA 3SQ4A 3SUOA 4YLEA 5CYQA 3HZHA 5I3UA 2IKSA 1U8TA 4KFCA 1QNLA 1WNSA 4JP1A 1W9HA 1TV6A 3B2NA 4OBBA 2P5GA 1AB6A 1FKPA 4ETIA 3MXMA 1X9MA 3OVNA 1G15A 1FFSA 2D0BA 4G1QA 3N53A 4AILC 2JVKA 3RRHA 1LK0A 3E61A 3SY8A 3RVMA 3VQ8A 3LUKA 4RK4A 1VK0A 4EYGA 1DJMA 3MEDA 3B6OA 2PUCA 3AVGA 4ID5A 1QHTA 5FBKA 1JFVA 3N0WA 1WSFA 4H4MA 4PQUA 1ZBHA 3LPTA 1SKWA 1GUBA 1HEYA 1BHLA 3B6PA 1TK5A 4KQ9A 5DCLA 4N76A 2YKMA 2NT4A 4XLTA 1Z17A 1JBEA 3LMKA 2IDOA 5FWXB 5JNUA 1L5ZA 3BRQA 3VQAA 4HNSA 4CGJA 1E6LA 1HQUA 4J2BA 4K8XA 4G97A 3H08A 1OXKB 4FLYA 3JYTA 3EQZA 4K8ZA 3LP3A 3G85A 3UKJA 1ZHHA 1TKZA 1NKCA 3OLVA 3MM4A 1RT4A 4CFDA 2FQXA 4RW6A 4MLDA 1SV5A 2FC0A 1ABEA 4RY9A 4FZXC 4P1ZA 1EWKA 4UHJA 2YV0X 3DRSA 3OYNA 3NF7A 5KGXA 3RMCA 2AYZA 1EAYA 1NKEA 3OYHA 3O3HA 5TQ2B 4HCCA 4DS5A 1NK9A 4YV7A 3QNNA 5HSGA 2QXYA 3M9XA 3AA4A 4WT7A 1JLGA 3H75A 4L8RB 1FSPA 4B3OA 1U4BA 4BE2A 3KLGA 3OMWA 2WJAA 3RQIA 4DS4A 2LP4Y 2RJNA 4WE1A 4ELUA 3SYZA 4CF8A 2LBPA 4MQEA 3AA3A 3QEPA 4AHRA 1ZAYA 2FLWA 4FW2A 4B9NA 1B00A 3QLUA 1U49A 2Q3SA 3D0PA 1C1CA 3IPCA 1QO0D 4DTOA 2YNGA 3L49A 3VQ5A 2RDMA 3GT7A 4RWEA 3NNDA 4CEQA 3C3KA 2WMYA 3QO9A 3L2QA 1S1UA 1W0HA 2PUDA 1T03A 4QICA 4CHYA 3HJFA 2YHBA 1J56A 1RZRA 4AHUA 5FROA 1JFTA 1PEYA 4TLMB 4OGCA 3LP1A 2DFEA 4PA1A 4DF8A 4F11A 3E3MA 1PHRA 3WNFA 4DTXA 2HHWA 3ITHA 3VQ4A 1A5WA 2HNDA 5KQLA 2OZSA 1S1TA 5GOTA 3MYYA 4FVMA 2GBPA 1BQMA 1NXPA 2A9RA 1IKYA 4AHVA 1KFSA 5D2CA 4I9QA 4O1HA 2IOCA 1WAFA 1SKSA 2HJ9A 3M8PA 5HRRA 2E6MA 1DG9A 3QLUC 4CFCA 3LAKA 2BANA 3NNNA 2L18A 3ILHA 2FTKE 1UAXA 4HCBA 5ED4A 2FVYA 3OQMA 1RXEA 3VNAA 1K66A 4Z99A 5J2QA 4CF2A 1DZ3A 3HP6A 1RBTA 2KQ2A 3K9CA 1VSDA 2B4AA 3QELB 4LE1A 2O20A 1NY5A 2LIVA 3K5LA 5KI6A 3TAMA 3D02A 1ASWA 1VKRA 1TAUA 3N6VA 4M3RA 1MVOA 4O4GA 4GW6A 3CFRA 3IS9A 1IG9A 3BBLA 1JL2A 3JVDA 5HQJA 4TSXA 1WN7A 1VSJA 3MAQA 3QLHA 2LPMA 1MB0A 6CHYA 4MRMB 2E4UA 4BWMA 3OLXA 3SV3A 4DU4A 3H6GA 4PYRA 2HHUA 3LUGA 2DTUA 1MU2A 5TQJA 1LWEA 4B9VA 5CY4A 1C1AA 2G8HA 1C6VA 3IRXA 1SRRA 3NNSA 1QSSA 3KJVA 4DFKA 1KVBA 1NXSA 3CTPA 1KRXA 2MYPA 3I0RA 2QU7A 4H3HB 3NFAA 4FLWA 2X6SA 4BDZA 1DC8A 4MR8A 1ITGA 2LUOA 3KHTA 2JVIA 5TQ2A 4W5QA 4QYMA 3NGYA 3AO5A 3TD9A 2D0AA 2E6LA 1HYVA 4F3OA 3EODA 3LOPA 3CYMA 1EWTA 2IPAB 3HM9A 4DU3A 4Z4CA 4ZYLA 1RT5A 3EDCA 2XO7A 3RH0A 4HNRA 2PY5A 1RTIA 4MPTA 4FJGA 1CXQA 2EX3A 4N5SA 3OLYA 3SNKA 3LUFA 2OQRA 1P6UA 1JLAA 4FJXA 3RWUA 4RXUA 2XHBA 1DLOA 3AO4A 3AVAA 2FMKA 4MQEB 4Q7EA 5JNSA 2A1RA 1X9WA 3UK0A 4Z9BA 2NZVG 2IAJA 4JRPA 1T8EA 4ICLA 3TR8A 4HUGA 1LBHA 1GCGA 2XY7A 3CFYA 1RNHA 3V9ZA 1JF8A 1RTDA 4MLCA 2AJQA 2PUBA 4MS3B 4KV8A 4C8LA 3RVPA 2HVHA 4DTUA 1UWBA 4ZTJA 1MIHA 1DTTA 4CESA 1D4ZA 4BDYA 1B9DA 4F12A 5KQMA 1U47A 4TMYA 1USGA 1JLFA 1YTUA 1B92A 3TMYA 1JDNA 1GCAA 3KLEA 1NKBA 1FXXA 1E2BA 3SNNA 1YMUA 3KTQA 4F06A 4H8KA 4KB1A 4DFMA 2WOMA 3CS3A 1H9CA 2B1JA 4KREA 3V9UA 2FN8A 1TKTA 1KRWA 3AVNA 4FZYA 1L5UA 1YT3A 1RBUA 2GI4A 1JHZA 3JVIA 3IP5A 2KFZA 1RDCA 4E1MA 3OJSA 1F21A 2FQWA 2OPPA 3DRRA 4RXMA 1XHZA 2O4GA 4MYRA 5IUJC 4CEBA 1A5XA 3PX6A 2R48A 5BQ3A 1SXIA 4CJ4A 3RTVA 1NJYA 2G8UA 2R47A 3U3GA 4E7HA 1D2AA 2HNYA 3DLGA 3CG0A 4D74A 3S3NA 4DFJA 3HO1A 3V1OA 3KK3A 4E7KA 1BI4A 1KLMA 3C3WA 1KMIY 4Z4IA 3DZDA 3BDPA 2HVIA 3QINA 4KV7A 4C8NA 1KSPA 2JBAA 2MSKA 5CHYA 2DRIA 4FCYA 5B3JC 2MYUA 1TL1A 2Y1IA 1A04A 4CGDA 3QERA 1BI4B 4YP9A 1VRTA 4NYFA 4DWIA 3OS2A 3O21A 3AVHA 4E7JA 3NE6A 3ZSYA 1WAJA 2FKAA 2OZMA 4FJ9A 3O2QB 4WUTA 3IP7A 2BGGA 1TGOA 3VQ9A 1WSGA 4LX8A 5IULC 1NJWA 4MR8B 5F64A 3HEBA 4CECA 4ML3A 1NK4A 3M6MD 5TPZD 5DMRA 2OPSA 2CHEA 1RXIA 3K5MA 1PUXA 1TK0A 3S9HA 2FEWB 2WONA 3JY6A 2YKNA 3O74A 3Q9SA 4JS5A 2WRZA 3AVIA 3H5IA 4RK7A 1JL3A 1CEYA 1ZESA 1FK9A 4Y9TA 4Z0UA 3OS0A 3LZJA 4OJRA 4FJHA 3V1QA 2HSGA 3LUJA 3F73A 2DFHA 4CFAA 1YMVA 4EUKA 1TL3A 3HYFA 2ZE2A 4CJKA 3P5JA 4CJTA 4DSIA 1JLQA 5I42A 4OPJA 3GBPA 3URMA 3AO1A 4KRFA 1J53A 1ZN2A 1TMYA 1ZDMA 3AVLA 3IG1A 1VSHA 3OYKA 4S04A 4TN5A 4OLBA 4F2SA 4G0QA 3KKSA 4FLUA 4CJLA 1NK0A 3M8QA 2A9QA 3JPWA 5CZ1A 3LUDA 5EWMB 4RW4A 3M8RA 3K5NA 2M98A 1Y1LA 4LRQA 3CG7A 3KIOA 2HHSA 3DI6A 3HP9A 4PUOA 1SXHA 4DQQA 3DM2A 3QEIA 4DTJA 3VQPA 1TVRA 5CYMA 1WSJA 4PY5A 3H5VA 1NXVA 2CHFA 3PY8A 3MMNA 4IMIB 1RNLA 4F3TA 3QLVA 4ELTA 1Q8IA 1JYFA 4CJWA 2RN2A 1IKVA 4FZZA 3A0RB 1BGXT 2PUAA 1BQNA 2QVCA 1L3VA 1RDAA 5J2NA 2X6NA 3I8DA 3HCWA 5FWYB 3FGZA 3AV9A 1I39A 4HHTA 4KHNA 3EULA 5EWLA 4OATA 4DTPA 2FN9A 4RKRA 4KMRA 4B9TA 4E7OA 3CZ5A 2ID7A 4M42A 1KVAA 4AHSA 4LZLA 4FJNA 4D6XA 2P4UA 3AVFA 2WY2D 3ZSRA 3NAEA 4OTZA 3BGRA 4DLEA 3RVSA 2L17A 1RPJA 4CJSA 4G0PA 3O4QA 4IF4A 3C6TA 1PNTA 4RKQA 4YO7A 1ASUA 2IDMA 1UA1A 1JH9A 4MS4B 4DQPA 4CCHA 2IYNA 2W42A 2VG5A 4N0QA 1A2OA 1CZBA 4P98A 1UOCA 4G0ZA 4W5TA 3JPYA 3CLKA 1EXQA 3VN5A 4MR7A 5DLEA 3EGCA 4MS4A 4CBVA 1UDRA 2PUGA 3I42A 2FMHA 3HPOA 2X74A 1S1VA 3OYGA 4O55A 3GRCA 2PL9A 3KJXA 1ISSA 2H3HA 3VQBA 3ZSOA 1X9SA 3CKMA 3QEXA 1HPZA 4GMJB 3K57A 2R25B 4JB0A 3TWHA 1K68A 3NGIA 1LV5A 1ZBUA 3MF4A 3NH0A 2PJUA 3MXJA 4HNQA 1HQEA 4MQFA 1RT7A 5DTEA 4I7FA 1KTQA 3K2PA 3CFOA 4IBNA 3PO5A 4O5BA 2FBVA 3OY9A 2L19A 3T6KA 3K5OA 3L8BA 5EWJA 3O1IC 4CEAA 4I9LA 2QKBA 1DRKA 4ZMSA 3CNBA 1YVUA 3OYFA 3EJWA 4FJMA 3KK2A 3KYIB 3KYJB 5HKOA 3AO2A 4R5PA 4ETMA 3AVKA 3M8SA 2JBAB 3SCXA 4EP5A 4RY0A 3ZSXA 3QX9A 1QQAA 3OS1A 5J1EA 3LUHA 1KLNA 2OPRA 4DSEA 4N56A 5TPZA 2F8SA 2QK9A 1RBSA 3TX6A 5JNTA 1CXUA 1P6QA 1WETA 4XAQA 5KC9A 1GOAA 1EFAA 1KGSA 3OYIA 2JVJA 1SD5A 3RVQA 5FRNA 4YR7A 4CHZA 4M3YA 1BCMA 3C97A 3M9WA 4WXMA 1JLCA 2FBTA 1BAPA 3DBIA 1L3UA 5BRAA 2PMCA 2HQOA 5EWMA 3C3MA 1DP4A 3RRGA 1MAVA 1GOCA 2FQYA 3O3GA 3C6QA 5EWJB 3LTEA 2VUIB 1PNRA 3OYDA 3WNEA 3TANA 4YRZA 1VSIA 1QP4A 6ABPA 3D45A 3DRPA 2D0CA 5KTQA 3KS9A 2HHVA 1DTQA 3GL9A 3A3KA 3ZT0A 3EYZA 3HT3A 3L2UA 4FLZA 3TAGA 4CHNA 5I4CA 4DQSA 2PLNA 3RVLA 4ID1A 4GNRA 2VUHB 3U3YA 1W25A 1TAQA 4J2DA 2P1JA 4C8KA 1R8JA 3CZCA 1VPWA 2GBZA 2GUIA 5HRSA 3DGEC 1NK5A 2IGIA 2Z1IA 1JX6A 3C94A 5FBHA 3W9SA 3NF9A 1M2FA 3L2VA 1EWVA 1DBQA 4MAAA 3GV0A 1P2FA 3HL8A 2L2QA 3LKBA 3DLEA 3LWLA 4RDCA 1O1WA 1C4WA 1BDJA 3LUCA 5CNKA 1FFGA 1S6PA 2HPHA 2G8IA 4G0YA 3BREA 5HRPA 3AVJA 2ETJA 3ZSVA 3KSMA 1DCKA 1XI1A 3SPZA 4FE4A 2PYLA 3S3MA 2QVGA 1LJUA 1EX4A 3I09A 4M3TA 5EWLB 3V1RA 1NATA 3RVRA 1Z13A 1LW0A 4MS3A 4DG1A 3H5TA 1LJLA 5SZTA 4FJIA 5EU7A 2WWVD 4CK2A 5E41A 3SUNA 4W5NA 1BDIA 1IH7A 4YS6A 2YNFA 3OM0A 1C0MA 3AVBA 1RCHA 2ZWMA 1QKKA 4Z4HA 4JRQA 5FRMA 2JCGA 4CERA 1S9GA 4MQ3A 1VRUA 3NBPA
chains in the Genus database with same CATH superfamily
3NX4A 2H2GA 2Z8XA 3R74A 4U9HS 1XB2A 3U3DA 1P74A 2C4WA 4H7PA 5LYYA 1RYZA 2P62A 3K8QA 1RZRD 4HTUA 3KQNA 4ZOAA 3QETA 4BFLA 2NRTA 4O4IF 1U81A 1OX4B 2BFCA 3EAQA 4BLOA 2OHXA 5CW1A 1T34A 2AVNA 2B8WA 2BBOA 3R5FA 4NOMA 3W8DA 1V3TA 1I2ZA 1RAHA 1RKQA 3IAS6 3VH4A 3KXPA 2CXOA 3QQ5A 5G3ZA 2L42A 2B82A 3PD1A 5E9WA 1B0AA 1GZVA 3C65A 3DFZA 2JZNA 1JZQA 3U44B 4ZC1A 5KTKA 3HM2A 4AD8A 3SC6A 1QZZA 3TAXA 6REQB 1YFZA 1AB5A 3GHHA 1T6YA 3HKEB 4WBXC 3V1YA 5T4BA 2OAEA 5E6RB 3QWHA 3VPHA 4MW6A 2GTDA 4K9QA 5IKPA 4LDAA 5E7IA 2D1QA 4V38A 3AUAA 4L51A 3FF4A 2FG6C 1SEPA 2HA3A 1YTLA 4BEBA 1BFDA 1X7XB 3Q5GA 5HRUA 4DLRA 3RAEC 3HB7A 1PGQA 3VGJA 4L7QA 1GPH1 1A97A 2EKPA 3ZETA 2P3LA 3IUCA 3A2MA 3J7ZO 1QF7A 4LZAA 3ISNC 4QULA 4UW9A 3KPJA 1W34A 4H7KA 5LMUK 4RW9A 4F2RA 4QA9A 4F3YA 4DSFA 1ZK3A 3TARA 1SL0A 4NDZA 4XQGA 2W6KA 1OX5A 4PG4A 5D3ZA 2FPUA 1Z08A 3UT5B 3ANLA 4GGMX 2E4ZA 3BQ9A 4BY9E 4ZTFA 3A9RA 4JGIA 2DPNA 1XQYA 1G64A 4MUIA 3ETEA 5KVVA 1KQGA 4Q4LA 3KOUA 3L0DA 1QQAA 4JITA 1DT3A 4CW7A 3RR8A 1U1DA 3BJRA 3O7MA 5G0WA 1RDDA 1CY2A 1GPDG 2O2HA 4KN6A 1ZAKA 2DFFA 1EDOA 2Z3VA 2K4MA 4P3PA 4UVHA 2V51B 2OCIA 1CDZA 2QMOA 1N8TA 4HMQA 5C8ZA 1P18A 3HBLA 5HQ3A 3VISA 3DCYA 1K8QA 3QIAA 3RABA 2JAUA 2ZRAA 3SXJA 4WFJA 3SLCA 1G5QA 1YJXA 2LNDA 3LVFO 4S35A 3BMOA 1WCIB 4JKDA 1W75A 4DLGA 2OCPA 3J81A 2I03A 2YS7A 3R7LA 5EHZA 1JR6A 4Y1GA 4UU0A 3CUWA 1VXRA 2C92A 2PXHA 3BFKA 4GEKA 4PPFA 3FOWA 3RT1A 5JJLA 4DUGA 2ZTVA 3I2GA 3CYFA 2QN9A 1DRJA 3R23A 3FF1A 3GPCA 5C8XA 1KE2A 1J09A 3VDNB 2QT0A 4GEGA 4X60A 4MS1B 4LV8B 5E2IA 1DKGD 1Z2PX 4QBHA 3O2NA 5A62A 5AUOB 1D09A 2O2JA 1BOFA 4MUGA 4KK3A 4HDMA 1GTG1 1KAQA 1IEQA 3KC2A 1B93A 5DHSA 3VKWA 2PTGA 4C6HA 1GLNA 4CL3A 2WAYA 2A1SA 3HBMA 5I4IA 4LY7A 3G7NA 5FPKA 3ROFA 3RT9A 3FYCA 1LUAA 2WTAA 2ZI5A 1F5SA 1FCJA 4FTWA 4E2YA 1JKJB 1Y6QA 4WRRA 4CEHA 1T8WA 1X77A 4LZPA 4X6XA 2M6LA 4O0IA 4ZV7A 4CVNE 4AECA 4ETNA 3CQXA 2H06A 1VTKA 2IJGX 4L02A 4XM2A 4UDXX 2GF2A 3RD5A 3ZWCA 4B6SA 2VHQA 4YMLA 3D2LA 4K6MA 1QVZA 1KRPA 2HU2A 4MWEA 2B4RO 5C34B 5TC4A 3VKHA 2ZRPA 5I47A 2G07A 4CFBA 1FRZA 1YZNA 2I4OA 5DKFA 1HNZB 1HE3A 2NZUG 1AUXA 2RGAA 5I9LA 3NM4A 1NXXA 3C74A 1FU7A 4IHKA 4UEJA 1WETA 1GAQA 1Y7TA 2HLPA 2YOHA 3NDKA 3MAAC 1XEXA 2GM3A 3HBNA 4DDVA 3LHKA 2FPMA 4KN9S 4JI2B 3D2EA 4EIAA 1PGJA 2HNZA 2FKNA 1U9CA 2HQRA 3C85A 4RLQA 2HRCA 4WFIA 1FNBA 3K72B 4JHXA 4NQZA 2W2KA 3RYHB 5FEUA 2J9GA 1VMIA 2GCNA 2WU1A 3WB9A 5LQDA 3QV1A 4F46A 5H1YA 1THTA 4FOIA 2YIMA 4MCJA 1U3FA 3GLFE 3BD8A 1Y63A 1WZIA 2EQAA 3TLYA 5H82A 1E63A 4LOLA 4MRSA 4EHJA 4G6ZA 1M83A 3TLZA 3EUFA 1ECCA 3FY4A 3T7EA 3FYUA 2O2CA 2I5JA 3CX4A 4INJA 3MCWA 2FEXA 2YN0A 3EQ2A 3L5KA 1C1YA 3THOA 4BBPA 3I33A 2WKSA 4H3KB 4NABA 1V5EA 2BRUC 4IUCS 1GLEG 2AG1A 2BV3A 2FW1A 2AZXA 3R9XB 2NGRA 2YOGA 1PK7A 3PK0A 4LOAA 3HDGA 3SG0A 4DLAA 2IE8A 5I7OA 4WOJA 1YF3A 4JVNA 1CT9A 3VV3A 2RAVA 3O8CA 2I34A 5CNMA 5K99A 1QK4A 1D1QA 1GSIA 1KY2A 2A8YA 3OHMA 2WM2A 5KNCA 5T4FA 5BSEA 4IHJF 4DIDA 3A14A 3QVWA 4V24A 2CGEA 2P6RA 3TOZA 1WKBA 3G3EA 1NYTA 3IVMA 4GPAA 4I4TA 1OC2A 2C5FA 3LIPA 3N3BC 4CN8A 5F1YA 4KN8A 2NSHA 5KPJA 1M6HA 2BKXA 2P9GA 2XOKD 3OI7A 3N5KA 5IJXA 4BKPA 5ESXA 4S1TA 3EZGA 3PB3A 4TVOA 5B3LA 1ONSA 2ICAA 4ARCA 4GR4A 1NSTA 3KKEA 1TEXA 3OCWA 3UUWA 3G23A 4D1YA 3GOQA 2IYYA 5JANA 5H3CA 3NG1A 3L84A 1SC9A 4F04A 2G63A 3TVDA 4ZIRB 3RMBA 2HU5A 2QDKA 4ZTBA 2JCXA 5FULA 3CVJA 5I7HA 5MDHA 2W6JD 1Z2CA 2WJPA 4O0JA 2O2DA 1E1CB 1NKVA 2G67A 2IIVA 4FXDA 1H0RA 2WU3A 3PDJA 4HH1A 4YQYA 4AS2A 4LFBB 4RELA 1E18A 4XEIA 4GPTA 3PI6A 3MGBA 2IHJA 2W2PA 3FUWA 2VYVA 4IXWA 5K0BA 1RJWA 1V41E 4IIFA 4RQUA 3FGOA 4WK2B 4DBLE 3SZ2A 1XMJA 1PDOA 3FUTA 4FM0A 4OEHA 5BT9A 2IH5A 1IXYA 3WWZA 1P8AA 3RVKA 5AI6A 4R2KA 1OXVA 1BE6A 2R6JA 2UYQA 5M1OA 1Z6XA 4GICA 3I8BA 1V43A 3K09A 4PTZA 5BXYA 2XY4A 5KQRA 3V00A 3C95A 3QXHA 1Q0LA 4GYKA 4RIFA 5K3DA 1ZYQA 1BISA 3LKVA 4LNHA 3JWGA 4P4GA 5CG1A 4JBYA 5LJLA 3QLVC 4MAMA 3TF5A 4WJZA 3K9JA 1DJPA 1X15A 5CU7A 3BSFA 2XCRB 3NJ8A 3KB1A 2N3ZA 1YI2N 4JI1B 1LAWA 3B85A 4F7WA 4A15A 1R15A 4LKOA 1EJBA 3DOLA 2RHRA 3F6CA 3VR4D 4WH0A 1YRYE 3TDNA 4QVIA 2VTBB 2HWKA 2FBXA 1YV9A 4RF3A 3TD9A 1RT9A 2HZ7A 4NNOA 1ISIA 4BV3A 4F3RA 5IEJA 5FNVA 3ZY3A 3GGJA 3RMDA 2QA5A 1DO0A 4N5IX 2JJQA 2PG3A 3H9EO 1Q14A 4UTOA 1P9NA 1H0HA 3DDSA 5DDIP 4B4UA 4URFA 4ENQA 4OX9B 4JKGA 1L7NA 2WF7A 2GPJA 3P2YA 4XM1A 2IBSA 4I55F 3X2FA 2HMPA 3VRHA 1YS7A 3CA8A 1D03A 1CZLA 3L07A 1NK7A 4LEIA 4GS5A 3QXCA 5DTRA 4ZVUA 3V9XA 3R8CA 2FPIA 4M8LA 2NU9A 3LXRA 4NG5A 4Z9AA 3M7IA 1LNQA 1R0YA 4Y1CA 4JUBA 4ZO7A 5AVRA 5DM60 3Q41A 4IEIA 3IKJA 3EBLA 1TKRA 3AFHA 3F1KA 3O8QA 4YP7A 3ZVRA 1RT1A 4MLHA 4L85A 3IKMB 2NAPA 4AMVA 4ETMA 4Z49A 3K31A 4US1R 1BA3A 4CGHA 1WVIA 4QUKA 3GFPA 1C2YA 3I92A 2UDPA 3WLOA 2Y1EA 3CV3A 2AN5A 3X3HA 2N47A 3EE6A 2VF2A 1NKTA 1JLKA 4MINA 1CUHA 4TVBA 3QVVA 4S2UA 4DQVA 1R37A 1HDGO 2R2GA 1XAIA 3F7NA 3QPVA 5F5XA 3STWA 1UBOS 3UFXB 1JG1A 3H84A 3ZI0A 5FOQA 2VQFB 2P5YA 2FRVA 4O4HA 3PA8A 2CGLA 4H1HA 4INAA 2I65A 3MUNA 1QQ6A 2UZ1B 2UXCB 1P45A 4JIMA 3B51X 3ECAA 4QTTB 4FNMA 4XRRA 4B3MB 1AH2A 2DULA 5E6UB 3WK7A 2FPLA 1MLDA 3E48A 3L7CA 4AKHA 2J9FA 3OEHD 4RIGA 4KCGA 1TC1A 2G77B 5F23A 4J0CA 4QS8A 1RWQA 2CLDX 2ZIGA 4FFMA 2I5PO 1EWQA 1YD7A 2HRZA 1N6QA 4XYGA 4TYWA 16PKA 3DD1A 1KU6A 3GBSA 4RL4A 3FVRA 5DFAA 4E5PA 3CFPA 4YDUA 2WFZA 1X1DA 1TJYA 2XUFA 4FWMA 3IDOA 5GGXA 4G0VA 3H18A 1R27A 2ZQZA 3PQ3A 1MIOA 1DI0A 4N7RA 2JJ8A 3P31A 4M7WA 4NICA 4OG2A 3V7UA 2Z43A 3AWIA 1PJ3A 5M1FA 1II8A 5LB2A 1O95D 2KLBA 3U4AA 4MDAA 5K0NA 4KO4S 3RYFB 2QVYX 4ID9A 2AKYA 2E1ZA 1BX3A 4KODA 4FM1A 2IS3A 1KK3A 2IYUA 2D2VA 2ZWAA 4FCTA 2R6R1 4CK3A 1HTBA 1CUVA 1I9GA 3BDAA 3DDOA 1W7AA 3RU7A 1XQ9A 2HCFA 2FK7A 3I5AA 2A33A 3ZGZA 1V1RB 4MRVA 2VDLB 1OVMA 1Y7LA 3NV7A 1XXHA 1USKA 1EQUA 1C8BA 2BFPA 1MMFB 3B3AA 3MD9A 3NHLA 4JJ7A 4DBLC 1UPXA 3PIDA 1JG7A 1RCFA 4R71A 2J3EA 1CJTC 4DYDA 2Q3JA 1PL0A 1QGYA 4X7MA 5DYGA 3WNGA 2GYYA 1OZHA 2QS9A 1WQ3A 1RCUA 3HKBB 4J1NA 4UREA 4IG0A 3DE5X 4QTZA 2Z30A 4Y9SA 2R7LA 2P9PB 2E8AA 1EB8A 1NP3A 3GA0A 1YIOA 4BFTA 1I7SB 2NRXA 1OC4A 1T3GA 1VCOA 3IRVA 4DLXA 2D1SA 2IPOA 3C5HA 1S01A 2O0JA 4BRCA 2FW6A 1SBYA 1TZJA 4W7HA 3H6EA 4ZVOA 3N0XA 3TAQA 3VOBA 5KNCH 1X74A 2CUTA 5LR6A 3O7WA 4I5DA 3O3FA 1YL7A 4P4UA 3LKDA 4YJFA 1SVKA 1OAAA 4D3FA 1B6SA 1TW2A 3L8HA 2AMFA 2VUSA 4IIYA 4D8WA 3TW8A 5DOZA 1W0CA 4P0QB 5F1XA 1IEWA 3NGZA 3I2IA 4G0NA 4TROA 1MA0A 5AKKA 5T3YA 1E69A 4NEHB 2WABA 1XZLA 4Q18A 4B09A 3H97A 2AD1A 5IVIA 1UBTS 4M0MA 1SQ6A 1CF9A 4FGSA 3B48A 1DKLA 4JEIA 4QTXA 2Y76A 2CL0X 3DOJA 4K40A 1HJRA 3CCLN 2Z1GA 1L5YA 2HJVA 5JVHL 1E2GA 1W0KA 2BMAA 2G4VA 1Q17A 4TQUS 3ECCA 4DDWA 1JHAA 4I4IA 3ZX5A 3R7FA 2QM1A 6Q21A 3CZMA 4TS1A 4ZOCA 4C01A 4E08A 2DTXA 1Z0IA 2CDBA 1RTKA 3JALB 1UBEA 1Z18A 1HF3A 3NIBA 4D26A 4PSDA 3E5HA 3HA7A 3CETA 4WQ4C 2TECE 3UXMA 5BRJA 1DV1A 3PFIA 4L50A 4JI8B 3ER6A 4JJFA 1SXJD 4NMMA 1U8AA 4OYYA 1U6JA 3FVTA 2DFNA 3NM6B 4BUZA 5TT1A 4BVKA 9ABPA 1E1NA 4IKEA 3V2HA 1RYYA 1GTJ1 2AHOA 1FKOA 5K3FB 4KVGA 2BYTA 1SQKA 2X8LA 4BATA 4BQEA 3GGOA 1HM5A 3CM6A 4JC5A 3H3OB 1TUGA 3UO8B 1JAIA 3OE4A 4KI4A 1CLQA 4OOEA 3VH1A 4HNTA 3DOFA 2QPOA 3ZWBA 1S2NA 4YFVA 4KR9A 2WIDA 1I3CA 2WVJA 3HUFA 5FF9A 1Q50A 4UMVA 3GELA 3HPQA 3NBMA 4B33A 3PP8A 3T7AA 4EB6B 3AETB 1XVUA 4ZVNA 3B1KA 4M88A 4QVKA 3PF8A 1JDJA 2CLHB 2IOFK 3OE1A 2OXRA 4Q19A 3REQA 5K6RA 2QXFA 2DBQA 4UFNA 2GO1A 4R6XA 4UD2A 2ZTHA 3JZFA 3M1YA 3IH5A 3W5AA 4P4LA 2ERCA 2JA2A 3CNNA 4ZANA 2WWTA 1M34B 4J7AA 4AZVA 3GLFA 1YJCA 2WHXA 1M2EA 4MLPA 5K09A 5HROA 4C7JA 1ZMXA 1YS4A 2ID9A 2WKQA 4E2FA 1ENZA 3RHSA 4EAHD 1U2SA 2WP0A 2OSBA 3IMFA 2GO7A 4NMLA 4IJ5A 5BSGA 4RK1A 3P9YA 4NF2A 5IAGA 1N34B 1P62B 1TMKA 4B3RK 3F3MA 3GLRA 3OTIA 5FI5A 1YH3A 4EA9A 4FYWA 4LE2A 2PL5A 4EFNA 2B9VA 3P1GA 2CBZA 4EEKA 1NTRA 3ETGA 4DR7K 5D5PA 1TDJA 5HKAA 1QQBA 1XI2A 2H4WA 3C7NB 1KXZA 2PBFA 3GJ4A 1XTUA 3I52A 1FPMA 3ANNA 3I61A 4IMRA 4HC4A 5F9MA 5C7YA 1NMDA 3CJRA 4I6EA 2F48A 3O0TA 1GV1A 2EFEB 5JXHA 4TYYA 1VBNA 2P2GA 5E9AA 2CGKA 1HT2E 1JYEA 5KPDA 3GJQA 1OZGA 1WSWA 1I94B 4WOCA 1AHHA 4FYXA 4GMDA 5D00A 4E5NA 2F59A 2Y2UA 3IBSA 4J0DA 1TTTA 5DGHA 4MDYA 2ZKLA 1JTFA 3RSCA 3LGAA 4C6TB 2B4KA 4ENPA 4EVQA 3QX8A 3ODGA 1YDMA 3LNCA 5ALWA 4AN0A 3U0VA 1Y3CE 5FPPA 1PWHA 2Q50A 3JSMA 2ZSUA 3OSZA 5C7OO 1EXMA 2J85A 3NOOA 4GZMA 1A3CA 4W4TA 4QOIA 5SZJA 1EJ6A 3QTTA 3LHFA 4GWGA 1P1CA 4CKEB 1G19A 3LC1O 1UL1X 2HHCA 4AMGA 1WABA 5KSWB 4HUJA 2GRJA 5C8DA 5KYYB 5AQJA 1HDXA 4B3SB 4FOTA 4Y0NA 1RYBA 4E3ZA 5K4HA 1E0JA 3NMUA 1LTKA 2GZ2A 3DP9A 3QPUA 4FFNA 2QSUA 1JHOA 4KQGA 2P3QA 4A6PA 3VKFA 3HDYA 2IBTA 4K26A 3MMXA 5K3AA 3CW2A 3E9PA 2P6NA 1HURA 3EIWA 3UMMA 5J2TA 1GYRA 2Z04A 4YXWA 1GNRA 1N2CE 2PGJA 3QEOA 4J3NA 2J41A 2GN0A 4O4JB 5CFNA 1L6IA 2WM8A 3TVYA 3G25A 3BF3A 2PGLA 5B1EA 4A5BA 3DS8A 3GVCA 4DW8A 2LZ0A 2P0AA 1X7ZB 2X22A 1FQKA 5EMHA 4XARA 2C5HA 3N7UA 3HLTA 3IVCA 4BNLA 4DA8A 1AG9A 5GIOA 3MQFA 1OTXA 4LUCA 2B78A 3AKYA 2BJVA 2RBKA 4PWDA 1UT8A 2P4HX 2AF4C 4UUBA 4XQEA 5LBTA 5LZ8A 2WD8A 3WMEA 2VQEB 4H17A 1YR9A 4Y2VA 4LNUB 2IV3A 1QV6A 5C37A 3KXKA 4RGBA 4X90A 3AP3A 4YMHA 4DTMA 1KI6B 3GXBA 4FBLA 4B3MK 4FHEA 1Y6JA 4QFMA 4Q4HB 2OXIA 3TOSA 1ZN7A 1UMKA 2BCGY 1QFYA 3LDQA 3CLTD 1BQ4A 3I6MA 3FPAA 4GM1A 4WXRA 3RS4A 4C4RA 4P6VF 1M1XB 1ESNA 3RC2A 2BFEA 2OHJA 4JKCA 2CMFA 1K75A 3QLTA 5FV7A 4EDHA 3AW9A 4H5NA 4EI7A 1PEKE 3BGVA 3C6UA 4RIEA 1QGOA 3SU8A 4CM7A 2CXHA 5IXJA 5J4KA 4JNCA 1XQWA 5ELZA 3QMWA 5G40A 3K53A 5JXIA 1NVKA 3QEAZ 4JVSB 3ATUA 4X61A 1JCGA 4Q9DA 4LC9A 5EQDA 2GRAA 4YP1A 4E2XA 4ZCIA 4MUYA 4YFUA 3S7ZA 3WKCA 2O57A 1N36K 4MI3A 421PA 4DPLA 2ZGVA 1RFQA 1AT1A 4IIJF 4R1NA 1SKAA 3X1WA 2C2KA 5K3SA 1VPDA 1SXJE 3M1IA 3CXRA 2OC4A 4L3VA 1Y9EA 4PSVA 1RYMA 4P81A 2Q1NA 5DCYA 1NGDA 4RW8A 2ZAMA 3E3OA 3QEKA 1HV8A 1UAYA 2OM2A 2M6KA 2GZHA 2KQUA 2RHBA 3OE7A 4FSDA 3TJRA 3X2EA 3JX9A 1YZGA 5C32A 1DEHA 3OJ0A 4RCVA 1L7XA 4ZCPA 1O97D 3O9RA 3G6WA 1I2BA 4QUEA 1QZ3A 3COJA 2GFIA 4ZGWA 4LV6A 1W36B 1X1CA 1LVGA 4IIJB 4LYGA 1U2QA 1JLHA 4H7JA 4BFCA 1DC6A 4AX8A 4X65K 1XG5A 3N2KB 1U8ZA 1QH0A 1YS6A 3BJZA 3HKEA 3ZCUA 5T5QA 4FFLA 2NPFA 2XQFA 1I3LA 4D9BA 3DXZA 1VPVA 3RJ5A 1KK2A 4F2HA 1RBVA 4QAGA 1YC2A 2A9VA 3AM4A 1YZFA 4FCWA 4LK2A 5G1PA 4A82A 1J1ZA 4D97A 4EHNA 3L0IB 3EVGA 4V1CI 3FPSA 3KZNA 3BD9A 3W78A 5IAAA 1OXBB 2A0WA 3SJZA 4MV7A 3SXUB 3DYAA 1VI5A 1JKFA 2QTZA 3SUPA 3GDFA 4GMFA 4AKGA 4NYIQ 5B6PA 5KTTA 3M2TA 3OYMA 1XVIA 2IS1A 1IIBA 3UMVA 3SQ0A 1NNLA 5C5CA 1M1KO 3PXUA 2NZYA 1VKNA 5G4KA 3JWHA 4XE5A 1Q7RA 3KE8A 3ZNPA 4MGIR 1E9VA 1ZH2A 1KI8A 1IEVA 4RQAA 1KC1A 1DQPA 3DPSA 3LAMA 3T1HB 1SC4A 4ATNA 8LDHA 3SEZA 1FE8A 2HIHA 1Z2AA 3GN2A 1SG6A 4YXFA 3GJTA 1BOTO 3VTKA 5CFQA 1IZ7A 1ODIA 4CKWA 3Q3EA 3MDQA 1L5HB 2IXDA 3DMYA 2F8MA 2QLJA 2ODBA 1V5IA 2H5JA 3C6MA 5AI4A 4UHEA 1G9XA 2HSZA 4BQLA 3GPBA 2F7TA 3E6AA 1HEUA 1XPJA 1AO3A 1REQB 1E58A 2C0CA 2E9SA 2GLTA 2G72A 5DU2A 1INLA 1EK6A 4DU1A 1ZD4A 2CVZA 2DUWA 2N1MA 3AIIA 4I6JA 4A8TA 4DG9A 1GLLO 1Z0ZA 4YMUA 1P0IA 1RHRA 1YZTA 2MINB 2XYVA 1QOPB 3IEKA 3PF9A 3WFIA 4X85A 1NQUA 4C7KA 2Q0QA 1XEAA 4H2DA 2P9SA 5BVGA 1QM5A 2D0PA 3EY1A 4NPCA 4ZOLB 5ICEA 1G6HA 2A1UB 2BTOA 2Q4DA 4KKXB 1PYOA 3E7PA 4QELA 5KQDA 4UMFA 1AGXA 1VAZA 3F49S 1JL1A 5A03A 1P90A 1MA3A 3GD5A 4YASA 3NRCA 3D7MA 1G6OA 1YHZA 4XIIA 3EVNA 1FDOA 1YIDA 3L0SA 1USIA 1UZAA 3IJRA 5HILA 3UFBA 1JIUA 1CJMA 3WHLA 1A7KA 5I01A 4YP0A 3ONDA 5J59A 3II6X 4MKRA 2FP3A 4Q3BA 4DM3A 4C05A 4BU1A 1CERA 4ZTUB 2H1SA 2A58A 1SQ5A 2Y4OA 3H5WA 2FR1A 5IHXA 2XKBA 4YMIA 1V7PC 1ESZA 1QGUA 4XJTA 4CMGA 1U1GA 4JQCA 1HI9A 4LOIA 1DS6A 4O8ZA 2AOTA 4C78A 2Q9CA 2W2OA 4S12A 4YONB 1C7FA 2JFBA 1M66A 3G7SA 1LRLA 2DFLA 1E0KA 5HE9A 3T1TA 3V1TC 3G5TA 1R6VA 1ZGZA 2PD6A 3VOTA 4UM8B 2X0NA 3KQTA 4ARIA 2WYWA 1ODCA 2XWJI 5BV1A 4Y0VA 5M2QA 4KE8A 2WDPA 3KVVA 4NZMA 2VNKA 2GDZA 2Q3MA 2QN8A 3K0CC 3EGWA 2UUAB 4IRXA 5B36A 2WSBA 3E81A 1QSLA 2EG5A 2Z58A 5BUCA 1L7BA 5CA1F 3D2EB 3GFFA 3HDVA 5F1KA 1FSGA 3E01A 3TMKA 3VKGA 1PJAA 4PYKA 3KLHA 4RM2A 3TIXB 2ADFA 1B8UA 1XC9A 3OF2A 4RYLA 1QE0A 3L2RA 1C0PA 4IG4A 4B3IA 3SP1A 1E6EA 4WESA 1A72A 3JXEA 1R2QA 4X0EA 5IX8A 1OY1A 1HLDA 1JYSA 5KUTA 5JSKA 1MB9A 2WHPB 1K8RA 2AN9A 1H2WA 3EAFA 3MTDA 2Y6VA 2BR5A 4KGDA 4U9IS 5KTSA 2OYQA 4LJ9A 4RA9A 1HLPA 1U45A 2HBLA 5M29A 2IZ5A 1W4CA 2ZVPX 1ACMA 3I37X 4WBNB 2O0LA 2WIBA 3CJTA 3L8CA 5IUKC 3DE7X 1P7YA 4GI7A 4AXBA 4F84A 4MUKA 1RBQA 3AR8A 1PFYA 2PGDA 2ZVQX 3TTDA 1G20A 3EZXA 3LP8A 3NOQA 4HX9A 3LXMA 4PICA 4HLQB 1YUWA 5BW4A 3KIPA 3SJJA 4L4XA 3P32A 3VAZA 4DV7K 1JZSA 3ZUPA 7MDHA 3RWOA 5K7SA 5EKUA 3F71A 2DJIA 1A4UA 1AA6A 1VG1A 3G8DA 5CITA 3TKAA 1TO1E 4CCWA 2NRZA 4KLZA 1G4HA 4A1FA 3OESA 5C42A 4HS9A 3QKRB 2D06A 2VKQA 4IRMA 1VSFA 1CP3A 1QTRA 3B7WA 4HGNA 2BEKA 4DY4A 3I04M 3OYLA 1U7OA 2F3QA 4U2EA 2V0NA 4UAUA 5G0SA 3BTOA 3RODA 2A1TR 2K6GA 4S1VA 1T1IA 1NULA 4TWJA 3C24A 1L3BA 4M0EA 4WDRA 1G99A 2DE0X 2KE5A 3DLKA 2Z1JA 1O6BA 1TUBB 2PZ8A 1KAEA 4HDSB 4XYLA 4ZGBA 3ILYA 3U4CA 1N2BA 4RTLA 1ORDA 1GNTA 4K9DA 1O03A 1PL7A 1XDDA 3S0JA 4JBNA 1UXJA 1W4ZA 3QUBA 5ERXA 4QGSA 2Z1NA 2YWDA 4L2IA 4REQB 3SBXA 4A03A 2POQX 5GONA 2AE1A 2H5EA 3DZHA 4EA6A 4Y6PA 3ZE8A 2ZJ2A 4ZJZA 3ZLJA 1IHOA 4B7CA 3WRYA 2VQEK 1W0JA 2Q6IA 3N8IA 4WWHA 2NXJA 4LF7B 4JQSA 5LD2B 3INNA 2BDUA 3DOKA 1OVGA 3D5TA 3DFUA 1X39A 1NJIO 3ZE6A 4GE3A 1JJFA 3T1OA 3BERA 3HXTA 5L7YA 5DO9A 1SH7A 4KRXA 5C81A 3DL0A 2NTYC 4ID3A 5T4HA 3V9SA 3OD5A 1GCOA 3OBIA 4YUWA 2WIAA 1T8SA 3BVPA 4NBKA 1TQHA 2FMTA 4ZQBA 1D2CA 4EABA 3BJEA 3FBGA 5I7AA 1LLUA 1MEJA 1KYQA 2HK7A 4XB1A 4UTNA 4UUPA 2PFUA 2FH5B 2C96A 4ZPXA 3ZIAA 2QW8A 3U6KA 1YUBA 3AF3A 2WC9A 4WJLA 5DTMA 4RCHA 3HB0A 5AM1A 3TGWA 2QWQA 1K9VF 3EFEA 3E3NA 1XC7A 2PPLA 2OP1A 4CKCA 1VHJA 2ZRNA 1CZ9A 3MECA 3D3WB 5FHRA 2WU8A 1TLFA 4MRAA 3BM5A 3KQMA 4WAUA 4P3XA 5C0OE 1XD9A 4DPMA 1E6CA 4LYEA 5J47A 4DV0K 3QMMA 1NOJA 4FYYA 4L5CA 4U8HA 4C3OB 4IFVA 4BACA 1K7SN 2LD4A 2OCDA 1TUUA 4BTLA 3EPLA 2AEMA 1JB9A 4EHDA 5B4TA 2UYYA 2M2IA 3PNKA 5BW5A 4RUKA 1BG3A 3AHGA 1VECA 3I3OA 4QYXA 4CU5A 2FWMX 5EZ5A 1B9FA 2QTHA 1MO5A 2Q3CA 1JKHA 2QVXX 4NJMA 3W5IA 3H9UA 1XA0A 5AFSA 5DTIA 1S8FA 2AZ4A 2HQSA 2FXIA 3H2HA 2YXEA 1WXQA 2VCEA 2C94A 5JNSA 1AJEA 1SXJB 3A4VA 1CC1S 3N8HA 4EGSA 4I81A 5HR5A 1C1DB 2FW0A 2IYVA 3HJHA 4RSMA 1P8JA 4XFKA 1XQVA 4JI2K 1ZA1A 2B20A 3RRJA 3UNXA 1M5TA 3AK4A 2ZSIA 1W8IA 3NOXA 5EKXA 2CT8A 1T9GR 3VEVA 4N8EA 4Z1MA 4RD3A 3QIVA 2LW7A 2XD9A 1P60A 4HMOA 2FPSA 4KHSA 2V7QA 4O25A 1PKEA 5DHQA 5LBUA 3THSA 4WOKA 2ZRHA 4M41A 1U6ZA 4NQRA 4DMUB 3RF6A 4ZQEA 3A5LC 3HPGA 3A1VA 4RJLA 3WMRA 1VLJA 3OBBA 4D02A 4BC4A 3DEFA 4A27A 1GXSB 1CY6A 2KZMA 5I9EB 5EI5A 3KD1E 1IZ0A 4WTOA 1R4AA 3T1HK 1IDOA 1TU4A 2EP8A 1US8A 1YWGO 4OOFA 4Y1EA 2GX9A 3A6LA 3K94A 4YMSA 1DT9A 4DSOA 5HUHA 1KPHA 5K3EA 1ASVA 5FPEA 1IDN1 2CLSA 3A32A 3ENOA 5BNZA 2A5JA 3H1GA 4EGJA 3DVAA 3D7SA 2PH1A 3IMKA 1I3MA 2D54A 3TFWA 3P83D 2Z1HA 4H0VB 4AHCA 2OG1A 4U6QA 2AMLA 1W29A 3KSUA 3A7DA 3OCCA 4RD1A 3AA2A 1S4MA 4KQWA 4B6PA 5FADA 3EGIA 2W40A 4M8IA 5CEJA 3QPAA 1AKEA 4MW0A 1JTEA 2R4QA 3VO2A 2EQBA 3JR7A 3ZWMA 3QA9A 5IJWA 5ELLA 2QHXA 2YHYA 1P2SA 1Y5RA 2AZTA 4PFKA 4ZKEA 1BMQA 3CLVA 2DFVA 2F17A 2XECA 2VXOA 3A3PA 5L3ZA 3CH4B 4F6RB 1KIMA 5KMGB 1E2JA 3R40A 4XX0B 4QKQA 4WIAA 3GHYA 3GMTA 1ZU4A 1W47A 3KDAA 3FCCA 4N6NA 1K98A 3SVZA 4KITB 2JKZA 2C5LA 1C4OA 1L3TA 4B7UA 4BMSA 3F3KA 1AMNA 3AHIA 4OK6A 3CTMA 3QH4A 2CXQA 4D4GA 1YBVA 4NZOA 2IIBA 2WHYA 3C2QA 1XXHB 1CULC 1SUPA 4FEEA 4LDZA 1ZBIA 3M1FA 1XDZA 2WJHA 3EMBA 3K20A 1VYVA 3OUUA 4NATA 4TUYA 5DM4A 4DR6K 4XUCA 5TGZA 1LA2A 1MQAA 3DNPA 4J0EA 5EMJA 5DTQA 2OPBA 4YCBA 2PYDA 3L1HA 1A9PA 1KEEB 2GHIA 3CZ4A 3D2BA 1B0PA 5DASA 1U3CA 1JFSA 4Z54A 3VU8A 1EFLA 1RT2A 3EGXA 3M49A 1NLUA 3W6NA 2VEDA 3W7AA 2BGWA 4EYQA 2WG0A 4KAFA 1FVFA 4IMJB 1GGMA 1ZK2A 4Q6BA 3TJMA 1E99A 3W5HA 2OTJN 4UMEA 4G1EB 4YRPA 1GZSA 3TTSA 4D80A 3AINA 3EPKA 4CR6A 3F97A 1NXWA 3MERA 3K59A 3QEJA 4RIHA 4WGGA 4AN4A 3RBXA 4P38A 1QYVA 2QB5A 2QMQA 3BT7A 1OBOA 1NM5C 1B2LA 2ZRGA 4AMZA 3WOHA 121PA 4ZQFA 3T9CA 2JGUA 4RULA 3LWBA 5KC8A 1MABA 2F3SA 4L8YA 3W3AD 4O5AA 2QF7A 1HJOA 3DEAA 4NFYA 4NI5A 5B8HA 4MJ3A 4NKRA 4NCJA 4WPGA 5KYNA 4OIFA 5FOVA 2XCOA 4EY5A 1KEKA 4EG0A 1W5EA 2I3ZA 5EGNA 3TE6A 3FH0A 2A4MA 3I72A 4ZOLF 1XAHA 3OWHA 3Q0TA 3ZWYA 3TPFA 3G0ZA 2CVPA 3QKTA 4FZJA 2O8NA 1X7YB 2IYPA 2H1IA 4MKXA 3EZ5A 4MW5A 4H0XB 4IGIA 4ZO8A 4HUQB 4QLAA 5JIBA 1T5IA 1SZDA 4P84A 3OQHA 1YITN 1GZ4A 3I4CA 4KQXA 4O0LA 5K4AA 5SY6A 3Q2KA 4B9SA 4QVGA 4M1QA 1G8SA 3G13A 3O9TA 1WV0A 2CUZA 3HWSA 4G24A 1HE4A 2YIJA 1MRSA 4D4JA 4FWPA 2EL7A 3GQVA 5FBQB 3WYBA 2WFAA 1EVIA 3SFTA 4MDBA 5JXWA 5KPRA 5LQCA 1F17A 5ECGC 2AMJA 1ABFA 3MTEA 1V3QE 1TYCA 5CMLA 4D44A 2GN2A 4NOKA 4EENA 3BD6A 3EWAA 3J81k 5F3WB 4R1MA 1BWSA 4EQZA 1U98A 1Q0QA 1R4NA 3E5MA 3G59A 4HEA6 5I8ZA 2MMCA 4MGEA 3TO5A 4WLVA 3UT0A 1KAMA 5KSOA 5JNVA 4O63O 2JC3A 1UT6A 4UKDA 3BWDD 3PHCA 1YASA 2CVOA 2QTTA 4COOA 2KM1A 4QOGA 2W0MA 4AJJA 4WDQA 3SBOA 4N3CA 2IPXA 5BQFA 3KTOA 3AFIA 3RBAA 2C83A 3JS6A 1VA5A 2YXDA 1SUQA 3H1TA 4RKWA 2J87A 2QZJA 4TKUB 4B74A 4ZOBA 5BOSB 5AW3A 3KQPA 3D59A 5K0LA 1C0UA 2QP3A 4HLNA 3WK8A 4UHKA 1KO5A 3PXXA 5JPCA 2CNWA 4BGDA 2D4AA 4MTLA 1T13A 2B3TA 1DBPA 1XHXA 4IQ8A 3P9CA 2EV9A 2WHRA 2J3KA 2F1IA 1RDBA 5DLQC 4LCEA 4DC1A 2Q1XA 4KH5A 3KKKA 3O2JA 4NBRA 4DDMA 4DNPA 4QE3A 5DNYB 3AR2A 3SQ4A 1PJCA 2SNIE 2YFQA 3M4NA 3IODA 1S4QA 3WEEB 2AQ8A 2JAWA 4NPAA 1EXDA 5BW6B 3HYTA 2B5OA 2PO7A 3J80A 1WCXA 3U56A 1MJGA 1R9NA 3D8HA 2VH1A 4MMZB 3ORFA 1PLKA 5SZIA 1H2FA 4FOEA 2RG1A 4Q16A 5F2NA 3CPWM 2O7SA 4OBBA 2OVBA 5I9NA 1YGYA 2ZIFA 4M36A 3SD7A 1D1TA 1Q95A 4RGQA 5JPDA 5ARDA 3DMDA 1FKPA 4I9NA 1EPUA 2IYAA 4ETIA 3M6VA 1RQRA 3FCXA 4CF3A 3IEMA 3RHTA 1XLWA 3HFRA 1FFSA 1OT3A 1BJKA 5JAIA 3VVMA 5LPNA 4G1QA 3ZHQA 2HKIA 5HF5A 3SY8A 2PV7A 3DSRA 2AI1A 3VQ8A 2EKLA 2ZJ0A 2JFUA 1K7YA 3AFMA 4ZI7B 3AONB 4RK4A 1IOLA 4EG4A 1MDUB 3IT3A 2NNWB 4PYQA 2A78A 4FDAA 4B84A 2E5WA 1MX9A 3KD3A 3KT3A 4EYGA 4YJ2F 1CUZA 3B6OA 1E7MA 1OWNA 1ITZA 4WLOA 5DRTA 5E4YA 4JV5B 2RBGA 1VE9A 1B6RA 3AP1A 4KGZA 4R1LA 5CA0A 5CEEA 2FZEA 1QHTA 5FBKA 4E14A 1JFVA 3N0WA 1NI5A 1WSFA 3LLSA 5A06A 3A3OA 4FZ3A 4OJTA 3EGDA 3PWZA 4UUOA 4Y6SA 3RQSA 2G0AA 5FB3A 3MT8A 2AR9A 3JD0A 1NGHA 4BQSA 4WL0A 3D0QA 4YRQA 4OF4A 3RFCA 4BUJA 4D6XA 1IBLB 4FUQA 5EOYA 4Y0AA 1ISHA 3G2LA 4CLXA 2NT4A 3L82B 3BF7A 4MRPA 2FG5A 4DSNA 3CJCA 1HG1A 1I4EB 5EHIA 3SEQA 3C98A 5CE3A 1KEPA 1L5ZA 1T9ZA 3BRQA 4HWKA 3ZWPA 4AY3A 5FWXB 1V2GA 5I9BA 2Z2ZA 3C5EA 1KE1A 4YOVA 3AHFA 4G97A 4DMKA 5LXTA 4TQAA 1DJQA 3TXXA 4FLYA 1EVLA 1GFSA 4RCZA 1K4YA 4K8ZA 1Z0UA 2BGRA 4XDGA 4KYIB 3STVA 4MGKR 4I3HA 1EZ1A 1Y5IA 1JQLB 2XB9A 1EQ2A 1BH6A 3G85A 4HAVA 4R2XA 4X5OA 4FGKA 3GZTB 2VTDA 4OQXA 1NKCA 4NBLA 4V0SA 2GNOA 1RSZA 1RT4A 4CFDA 1ZMOA 1LWNA 4TYNA 2ZYTX 3KQKA 1SV5A 3ZDAA 2ATVA 3O93A 2ZGYA 2AA3A 4CKEA 1ABEA 2JH9A 3WL5A 3O8RA 1HUXA 3R20A 3BXOA 4RY9A 3STHA 3ZV5A 2GTHA 1FSZA 3IRUA 4FZXC 3NGMA 4KH1A 1ZFNA 3GRRA 4K8OA 1XU7A 2FSSA 2VTEA 4FBMA 4B8YA 3PNVA 4RD0A 4CJXA 4H6WA 3UMCA 2VHUA 4EPTA 3HY6A 4JEPA 1Z4KA 5EZYA 2BEUA 1GQRA 1NVAA 3QYJA 3SM3A 5IK2D 3M1LA 3L8EA 3ANXA 3RMCA 3AKZA 2JWLA 4N0MA 4M55A 3DLIA 1WMBA 2F9LA 1Z73A 4XR9A 5DNWA 4ED9A 3O3HA 3L7AA 4N0EA 3U3KA 3ZK7A 4M53A 2YHSA 2YN2A 1NK9A 3DONA 3LQ4A 3T7IA 1ULUA 3EC7A 5DWVA 1RJDA 3M9XA 3AA4A 1OGYA 3OFVA 2PWAA 4LJLA 5DM1A 4MO5A 3MWDA 3S2IA 5DMXA 4EUSA 4QZVA 1O0SA 4B3OA 2P5SA 4K88A 1R1DA 1KEUA 1ZC3A 4YJ3A 1KDVA 2WJAA 3RQIA 2LP4Y 4HWSA 4LNUA 2IVNA 4WE1A 2YWGA 3SYZA 4NU8X 2RAPA 4J76A 2JEZA 4OHXA 4RPHA 4MQEA 1UMCA 1K3FA 4EVIA 4ZZIA 3QEPA 1M2HA 4AHRA 4J0FA 5L3QB 4K3VA 2FLWA 2NO9A 4X3CA 5BURA 5IF9A 2VZEA 2D2XA 4B9NA 3WYAA 1EK5A 2DQZA 4P0PB 1G8YA 1RWVA 3QLUA 1PU2A 5TGTA 1P2VA 3A1TA 2Q3SA 4Z8YA 2B8TA 1P6XA 1N3YA 1DB3A 3WDLA 4YAUA 1AKMA 2WA1A 4HQFA 1SKBA 2M6RA 3C4VA 3IPCA 4DTOA 1LCIA 1QO0D 4IO0A 4TN1A 2X1LA 3L49A 5DRYA 3TBFA 4G9EA 1XTJA 3GT7A 3ZGYA 5SYNA 4UVIA 4Y30A 1UPTA 4CEQA 1Y34E 3ZE0B 1JDVA 2R8EA 3L2QA 1ZO8A 5LMCA 1K5DA 3NQ41 1S1UA 3EVEA 3U5ZB 3TPQA 4HAWA 4MI6A 4IWYA 1W0HA 4H0PA 1L7QA 2Q4EA 1FDUA 1KF0A 1V4VA 2D0DA 3HKCA 4CHYA 4XLZA 3ZHVA 4HQRA 1DRVA 4J2TA 3HI6A 1J56A 4HXFB 4GLJA 1F2VA 3E7WA 3ND5A 3A5MC 1YAHA 4XM0A 2FSHA 2PCJA 4MHOA 2ZJOA 4BFSA 5AVTA 4AHUA 2PR2A 4HZUA 4XSVA 1XMIA 4EYSA 1B1CA 5FROA 3E1KA 1JFTA 4TLMB 4CIVA 2I8AA 5MN6A 4OGCA 3LP1A 4Q05A 2QN3A 1VHQA 3ZETB 1WX1A 3M70A 3QX7A 4KG7A 3VR3A 2W2LA 4JUFA 2XYRA 1V37A 3U1TA 3N2KA 4OK3A 1OZFA 4DF8A 4UUMA 4F11A 2YVLA 3TDKA 1M2JA 1N75A 2R5WA 1PHRA 2X5KO 5EZYF 5I9SA 2DETA 2GCPA 3GO4A 4C87A 2GFHA 4IQGA 3EY9A 1D2MA 3R77A 1VYTA 4MVJP 4NBTA 4AZ3B 2O05A 3MYYA 3H99A 5GVSA 2BCEA 3O92A 2GBPA 4AJEA 2YASA 4KB5A 1DXYA 2E2PA 3OUTA 3PLNA 4HR7A 3FTDA 4EGQA 3BGOS 3QF4A 2BUPA 4CZJA 1AO0A 1NXPA 3DMTC 3VMFA 4C1NI 1CQZA 3IIMA 5AK0A 1GUFA 3DBRA 5ECWA 4ESEA 3RFUA 1T2FA 5IJ0A 4I9QA 4OQNA 2G5CA 1KI3A 2SKDA 4DDTA 4C89A 5EP4A 1WAFA 4DV4K 1SKSA 2DBVO 2PHZA 2WIFA 1QH1A 4NHOA 3BXXA 3B20A 4AZ3A 2XUJA 1DG9A 3N74A 4LN1A 3OEHA 3GCDA 1SUBA 3PQCA 3ZHYA 1KC3A 5ILQA 3EHEA 4XB2A 4A7PA 4CL0A 3WKEA 3G79A 4NCHA 2UUCB 5HIJA 1IG3A 5E0OA 3PQ4A 5EP2A 3HOSA 2KLAA 4BNHA 3IFSA 3KLBA 5CYOA 2PWBA 3OA0A 2FTKE 2Z2XA 3MJTA 4FI3C 2KBFA 3EXHA 4HCBA 5HCNA 3ZJYA 3KSZO 4DMCA 3SC3A 1YU6A 2RHHA 3BHNA 2AC7A 1ZOLA 1YRBA 5FT9A 4YRGA 3LT4A 1VE3A 3QYPA 1EGMB 1FS5A 3EXG1 1F0KA 3GGCA 3BTSA 3ME5A 3FPBA 3JW8A 5BVGB 2FW9A 1CUXA 2M32A 4CMEC 1W73A 1QG4A 1J22A 3BS4A 3H0CA 5KYUB 4NCXA 3VO1A 4DY6A 1Y33E 3I6ZA 3HE3A 4HG2A 4CF2A 2PKEA 1DZ3A 1U7DA 1C1XB 2PEYA 2VATA 2KQ2A 4MIOA 2HV8A 2YZ7A 3FZEA 3GCGA 1FMLA 2OMKA 3K9CA 5LBIA 4B31A 1JFFA 1SK9A 3JWJA 1HZZA 2O20A 3AHHA 1NY5A 3OJCA 1J39A 1W44A 4EF5A 1IJJA 2LIVA 2XUAA 7YASA 3TAMA 1KEWA 3IEUA 1IN4A 4DIUA 3CX6A 5K0FA 3L6OO 1IPHA 3AI2A 4XW2A 3O8NA 2HK9A 2HRQA 4AZTA 3A70A 3CRQA 4PHTX 3O4WA 1XT6A 1XZKA 3T9FA 2YUTA 3AG6A 1TAUA 3HCFA 4PFSA 3DPUA 1C8KA 2F1KA 4N5LA 4GW6A 5IBRA 1OLSA 1C1XA 1W5AA 1XDGA 4LGYA 1A2KC 1QGUB 3SFVA 5AVVA 2HRDA 1J25A 4GPBA 4IOCL 4BFZA 1R4MA 1SAZA 1T2CA 1JL2A 4HP8A 2JFZA 3R76A 1ONBA 4FD3A 2KMLA 5FD8A 4EW2A 1KQSM 1RJGA 3MAQA 1Z0FA 4JLAA 5GZ6A 1JEEA 5GZ1A 2OBLA 4Y6RA 6CHYA 4YLYA 2H08A 4EUEA 1T2EA 3VZQA 2QTDA 2YJ4A 4BWMA 3DOIA 2OILA 2WKRA 3OLXA 4QREA 1LTHR 4O8CA 3UF0A 3EVFA 1G0NA 1UM8A 5K05A 1FNDA 4CT4B 3D4PA 5LQAA 4C1NK 1HQKA 1V8BA 3EUEA 2FZWA 1PYGA 2WTNA 3ORRA 3RFTA 2YJZA 5ALVA 2MTBA 4C1BA 1U0BB 4HEJA 4KHPK 3RUCA 4B9VA 3A11A 5AQFA 3D0KA 4KN5A 3UJCA 3WJ2A 1L3IA 2HPAA 3WI7A 4AQDA 5JY1A 4JXZA 4TZ0A 4BFWA 3T94A 5IM4A 3BIWA 2MCFA 3T1NA 3SZOA 1C6VA 4HXGA 4YUAA 4YY3K 2PWPA 4A6XA 4BX9A 3DAFA 3DAWA 4IDPA 3NNSA 3RC9A 4I4TB 4TWRA 3SS7X 3V33A 4DFKA 1KOGA 1NXSA 1OFVA 3CTPA 5FOTA 1FMFA 4LYHA 1OZ0A 1LU9A 1XRRA 4PY2A 2DH6A 2Y4NA 4MQBA 2EWMA 3TU5A 2LTAA 2HREA 2ZU0C 3P27A 4D56A 5ADWA 3PEEA 3R3YA 4AFNA 1SN7A 2ZT5A 3E22B 3WLQA 1UKAA 1VKZA 3NFAA 1WPQA 1ZM4A 3HKDA 4D9FA 3MBKA 1DC8A 1Y3BE 4RVHA 3RS2A 2XKAA 1Y6ZA 4A5SA 5L4LA 3A04A 2IDZA 2LUOA 1VHWA 4DJ5X 1XUPO 4PWYA 2FN7A 4YDQA 3OPYA 2PS1A 2ZQ5A 3KJHA 4G5XA 3VOAA 4CZ2A 4D41A 4DSUA 5A5DA 1TM3E 5B55A 2DB3A 4W5QA 3OC6A 1QFJA 3OZSA 1X2BA 3ST7A 3EVZA 3AVQA 2MJLA 4KDEA 4RD6A 1AGRA 1U99A 1G63A 2QTGA 1Q11A 3A5NC 1DIOB 1VJ0A 2D0AA 2E6LA 1WKCA 2CVFA 3B60A 3GROA 3KU4A 1S02A 1A88A 4KBFA 3LOPA 4MI9A 5BOVA 4JT2A 2DBRA 2QRVB 4P7JA 3SSAA 3UMGA 1LSSA 3OCJA 2I87A 3C5CA 4G4SO 2X3FA 2WYIA 3HCDA 3SS9X 3DB2A 1KDTA 2FUG1 3PDIA 1UXOA 3ETHA 4TYPA 2X41A 2GPWA 2LGJA 3WK5A 3ZI7A 3WK4A 1RXVA 1SUCA 3IMCA 2XO7A 4CM8B 5AKHA 1RTIA 2F4VB 4MPTA 4FJGA 1EUDA 2HV9A 2QT9A 5IZ4A 3A26A 1KMNA 4JD5A 3OIYA 4N5SA 1SIWA 4TTSA 4D8YA 2HLHA 2OQRA 1P6UA 1AKQA 5AMXA 4GDFA 1Q77A 1IZ8A 2H7YA 5KPTA 1RFLA 3RTAA 3U31A 3VO9A 3W8NA 4NENB 3EE8A 1CUJA 2CK3D 3FFBA 4EPYA 4OXKA 1XCLA 4MQ5A 5JG7A 3HI4A 4EPRA 1KBZA 3THWA 3U61B 4ISCA 1N6HA 2AEEA 4N7JA 4CQMA 2MWMA 5LUAA 2I33A 2XMGA 1JIQA 1X7WA 2AN1A 1X94A 3K2QA 3MN1A 4G8BA 4O02B 3V7NA 3E9LA 2NYUA 3DDZX 3IQXA 5YASA 1Y9JA 3LWNA 1QVRA 1VOTA 4OB8A 1HL7A 4Z9BA 2NZVG 2IAJA 4JRPA 2X2OA 1MH1A 3TR8A 2IUYA 4IEFB 2LCIA 5ENVA 4C07A 5AM3A 1GCGA 2I1VB 5LUBA 3CFYA 3BGIA 1SVNA 4PIVA 4ZWNA 1DFIA 4E21A 4C0JA 4I66A 4IJUA 1W9MA 4EITA 1N77A 4DQUA 2FHPA 3PTAA 2OHHA 5HGJA 1LVUA 5C46F 1RNHA 1Y80A 4QBKA 4CETA 3AZOA 2GK4A 3MD0A 5HZKA 2VDPB 1T8RA 1NLMA 5EG5A 3COWA 1SVOA 1RI5A 3DOCA 1FXWF 3U13A 4FFPA 5FA8A 1H8HA 2VDOB 4CW7B 2YJ6A 1UC4B 4BNZA 4IINA 4BJHB 3LKZA 4CYMA 2DM6A 4ZQIA 3AIOA 1Q74A 2P2YA 4H4DA 4CLDA 1EFPB 3KUDA 3P9PA 4O6VA 4DMGA 5K6AA 3AWDA 2JFXA 3DE6X 4MS3B 1QB7A 5FR2A 4X94A 5AJHA 4C0QC 1OJLA 4D6PA 4GI2A 4R01A 1DOAA 2XUKA 1TYQA 4TTTS 1ZD9A 4CZMA 1ESEA 3LECA 4FQ7A 1SXJA 4WN3A 1LLDA 4UVEA 3IGFA 4BMCA 5AQHA 4J7UA 2EJWA 2YXBA 3BDIA 2EIXA 4JI1K 3OP4A 5E0KB 2HVHA 4YREA 3TTYA 3OQ6A 1Q1ZA 3LF2A 2WYHA 4OUDB 2BHSA 4K3UA 3LO8A 1CIVA 2O3QA 3S55A 1UJNA 4C4TA 5D5QA 4Y2HA 4BDYA 1PS8A 4M60A 4F12A 2ZT8A 2A0YA 1NGJA 2WBNA 3VEZA 1MC8A 2GRUA 2Y77A 4YIKA 1USGA 3I2HA 3CH5A 4HYYA 1IN7A 1ZVQA 3FNFA 4WX2B 1JV2B 4V3CA 3R7NA 2ZF5O 1G2IA 2YVAA 3SNNA 1YMUA 3HCRA 3LJKA 4K9RA 3TQCA 4F06A 1X80A 2FPGB 4BVHA 4DRZA 3RK0A 3U3OA 1DQNA 3O4JA 4OUDA 3LBAA 2GDJA 1OYWA 3UBTA 1GAXA 3CS3A 3IT0A 4NFHA 2WMOB 5EOVA 3ZOZA 2C2ZA 1AK2A 2JGNA 5J23A 5HIAA 4GL2A 2W8BA 3BSWA 4UM5A 4FHFA 5CW2A 1Y9ZA 4CKZA 3AVNA 1CRZA 3A9UA 2VAPA 5AHRA 3A2NA 2XCLA 2WF5A 5EHNA 3ZKAA 2H2AA 1YA8A 4Q5IA 2G9RA 5AM0A 5AZIA 1RACA 4N6OA 3GJZA 4TRJA 5AICA 4WLFA 5KQ8A 3LLMA 1ZD5A 3M6FA 4PKIA 1X19A 3PPXA 4DWOA 5G0TA 2ECFA 2JI8A 4S1OA 4L9RA 1BRTA 4FYIA 4E22A 4V3BA 3ADCA 1XA3A 1Y37A 1FW8A 3DRRA 3IXQA 1IHDA 2YJEA 4F4UA 1XHZA 1WLYA 3JQ8A 2G36A 3QVLA 3W90A 3L1KA 4CEBA 2O0KA 3R0QA 5JISA 3M6UA 5IJZA 5KEIA 2ZGZA 2GF9A 3E5RA 3RTVA 1LJ8A 4ZVMA 3WUHA 1QPGA 1J00A 1QQ7A 2FSIA 2J6BA 3BL6A 4KE6A 1NU0A 5JLJA 3IR5A 2VWHA 1NJYA 1GLCG 4EPWA 1ZMRA 3HU1A 1U0GA 3HCCA 1RYFA 4F5DA 4H0TB 2PDAA 4PZUA 3O4FA 4MCAA 3VVBA 3PL1A 1WXDA 4RANA 3T3NA 3O73A 4BLTA 4RW0A 2O06A 3UWKA 3P0JA 3FZGA 3GAMA 4IG9A 1QYCA 1A8SA 3CG0A 2UV8A 3FR7A 5AH0A 4GC9A 1DLIA 5EUCA 1WUAA 3ASZA 3TZQA 4KLRA 4TLEA 1QRTA 4A8JC 4RKYA 2HIMA 1KLMA 1PBNA 4ZCSA 5FTLA 2BFWA 3JATB 2QNRA 5AQOA 2HVIA 1SURA 4G84A 1ZNXA 4JGBA 2VRCA 1XCBA 3P9SA 5CHYA 1AKNA 3DV0B 4FHDA 2AXEA 4PAGA 3ZXYA 3DL7A 2GXUA 4DR4B 2V7XA 4FDVA 4Y2RA 2JGKA 4LRWA 4PZCA 3VJLA 4YCNA 5M04A 1A04A 5LP6B 1E2EA 5GVRA 1AXRA 4OP1A 1W76A 1KY3A 2QWPA 1QLHA 1H2AS 2QTWB 4ND4A 3FRJA 4YP9A 2PBDA 2IEAA 1MGOA 3UANA 4DWIA 4DLLA 3QEBZ 2JFFA 3F2VA 4Y67A 1UBLS 1XCJA 5JEDA 1Z06A 4HSEA 2FG7C 3FRIA 1E4FT 2EHDA 1ZJ4A 2QG4A 5CBPB 1NI3A 1NJWA 1WUKS 1LB1B 4IJKA 2BY4A 1PJSA 3ITKA 4AUKA 3FMFA 4GZ3A 4WE3A 4B3GA 1DX4A 3WEEA 2C8LA 1K8YB 1WCYA 4CVNA 2YL2A 1AS0A 1UKZA 2W70A 4CECA 1H93A 1Y82A 3DW1X 3KSRA 3PC6A 5IKXA 2EGGA 3KPUA 1X86B 2VRWA 5TPZD 2WFBA 3DJYA 3DTVA 5DMRA 2PFSA 4IDNA 3SX0A 4K87A 2Y1GA 3AR6A 3GT0A 3OLQA 2ZBQA 4NDNE 2IV2X 4CMAA 1PVOA 2CE2X 2VPYA 4LOKA 2O2GA 2ZPAA 5TVGA 1Z5OA 2JCYA 3I5UA 1YVRA 3ZLVA 4H31A 3EXFB 1TK0A 4CT5A 4QECA 3DULA 3FPJA 2O6LA 2JH3A 2DERA 3JY6A 3UHPA 1V26A 1U1CA 5HWSA 4JR0A 1EFUA 1R6AA 3CQ9A 2P9LB 2W5UA 4N39A 2R6AA 1N33K 4QX6A 5JT1A 3DTVB 4RK7A 4CKXA 1ZESA 1A96A 2FLOA 3KOOA 4GKKK 2Q1UA 4CFZA 1UOOA 3MWEB 1EA5A 1MVLA 4CHTA 1A9TA 2XWQA 2ZJBA 1KZ1A 3F73A 5JAZA 4CFAA 4DUYK 5H3HA 1JEJA 4R54A 4BNDB 2J6IA 3F96A 3ZCQA 1QQTA 4EUKA 5KJFA 2XRZA 3EXFA 1CHDA 1FJ2A 1OPRA 2ISCA 4M83A 1U90A 1VKHA 2VJLA 1JLQA 2Z95A 3RASA 1GADO 3AO1A 1PFVA 4IIVA 4P82A 4UAVA 5EMLA 2HIAA 3T7RA 1A1VA 1VLHA 4BREA 3E27A 5IS2A 1G5HA 4UNRA 1T5SA 4L3WA 5F3RA 1J53A 1NBOA 1SU8A 1ZN2A 3VOSA 4FPAA 1LK5A 4PZLA 3IG1A 1FP6A 1VSHA 3OYKA 2Q8QA 3EC1A 3O8QB 3ESYA 4JYMA 4R4JA 4TN5A 4Q48A 4EL5A 3ODPA 1GTRA 4KR6A 2H4YA 3L7OA 5HIMA 5EE3A 3M8QA 1A2BA 3AAPA 1Y7IA 3GGPA 4IV8A 4MJLA 1DAEA 1YKSA 3V1UA 4C3UA 1FBTA 3IQWA 3FSGA 4BROA 5FOSA 4D4KA 1PRYA 1GT91 3LUDA 4E09A 5CXUA 3WL3A 4Z94A 5DYNA 4JH0A 4TM7A 4D3XA 2G6TA 4BBJA 1UANA 2Q2NA 1WHSB 2WJ3A 2EF0A 5A0TA 4EW3A 2EKZ