1W9HA

The structure of a piwi protein from archaeoglobus fulgidus.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
398
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMHPYEGTKVKLSSKRYLLTLLQPYLVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN AF1318
publication title Crystal Structure of a Piwi Protein Suggests Mechanisms for Sirna Recognition and Slicer Activity
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Nuclear protein
total genus 138
structure length 398
sequence length 417
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w9hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w9hA01
2WY2D 3OYKA 1DBPA 1JBEA 3OO0A 4OKKA 1TV6A 1TM2A 2VUIB 5JNRA 4EP5A 1Z12A 2OPPA 4CGDA 3NGIA 1QS4A 5FBKA 4N76A 3TR8A 3AO5A 3PX4A 3B6PA 1MB3A 3HDVA 4NQRA 4IMJB 3LUFA 1DJMA 1MIHA 3NBMA 1BA2A 2HHQA 3IP5A 2FN8A 1S6QA 3O75A 1X9SA 1LJUA 4GW6A 1GUDA 2PUFA 2GBZA 2RJNA 5CY4A 2OPQA 5BRAA 4JB0A 2QKKA 4QPJC 1WAJA 1LJLA 1NJXA 3VQAA 1XHZA 1Q9YA 1JXBA 1DBQA 3TAPA 2R47A 2PZSA 3G0ZA 4DLEA 1I39A 1O1WA 3A10A 3JSMA 3T38A 5DMRA 1RT5A 3G1WA 3K58A 3AVIA 4IBNA 2O20A 4C8KA 5HROA 2LUOA 3QO9A 1NK9A 3HPHA 3EY1A 4MQ3A 4B08A 4Z4IA 1BQNA 4FM0A 3LPUA 1EP4A 1J53A 5J1EA 4CGJA 2MYUA 1J54A 3HXMA 2F8TA 3FFWA 3M8PA 3AA4A 1SKRA 4HNSA 3ZT4A 4IMIB 5IX8A 1ZBIA 2P1JA 1A04A 3FFXA 4KI4A 2FMKA 3GWGA 3I0SA 4CEDA 3RVMA 4B9NA 1SXGA 4I2QA 3OLYA 4E1NA 2VYCA 2IPMA 2ATQA 3NAEA 3JPYA 2E4WA 3OS0A 1USGA 3GBPA 3RVLA 3DRPA 1U47A 2F96A 4MR7B 4M3XA 4KREA 4PE5B 4AHUA 4F3TA 2V0NA 3HDGA 3KKEA 3HJFA 4IFVA 1KGSA 1WSFA 3QEXA 4JASB 4OLAA 1L3SA 2WOMA 3OY9A 3TI0A 1CXQA 3GBVA 4YR7A 3HUUA 2OQRA 4NYNA 1JLBA 3PX6A 4H4OA 4KB1A 2LIVA 4FK0A 1BIUA 2B4JA 3RR8A 4CHPA 3NFAA 3KLHA 1WN7A 2FLKA 3RR7A 4E0DA 4EVQA 5KRTA 3AA5X 4MRMA 2G8KA 1QQAA 3M8SA 4DQDA 3B6OA 1IKXA 1VSIA 1JDPA 3UUGA 4DF4A 1BHLA 1RXEA 1KRWA 4KV8A 1LW0A 3HEBA 3MM4A 1TAUA 1NOZA 3OJSA 3LKBA 1IKWA 4DQQA 1D5WA 5HRSA 4OTZA 1WNSA 1A5WA 4C8MA 4CJUA 3EODA 1JYEA 3RTVA 1GUBA 5JNTA 1DP4A 3DBIA 3SZ2A 1NK7A 1RBRA 4UHKA 4FM2A 2IPNA 2JBAB 2QVGA 3V1OA 2B1JA 1FFSA 3ZT3A 3MQ4A 4B8CA 4MLDA 3OYGA 5CYQA 4XLTA 4KI6A 1W25A 2EHGA 4J2EA 1IKVA 1YIOA 3M6MD 1WSGA 3GRCA 3D02A 1Z15A 1QE1A 4AILC 4M3UA 3URMA 2QU7A 5KRSA 4CCHA 3LANA 1D9FA 4KHSA 1KVBA 3HSTB 2E4YA 2HHWA 4CIGA 3TAFA 1ZGGA 1RTHA 3HM9A 3CG0A 2LPMA 5CZ2A 4BACA 1MB0A 1KTQA 2FQYA 4Z9BA 1QTMA 4AHRA 1E2BA 1UDRA 3RH0A 2JBAA 1ITGA 2QVCA 2GV9A 1S8NA 3VQ9A 1M5TA 3QESA 1JYFA 2HHUA 4HTUA 3GV0A 1LBIA 3CNBA 2LBPA 5GOTA 2GX6A 2IYNA 3VN5A 3K5MA 1TAQA 3VA3A 1RNHA 1CHNA 4E7PA 3QEVA 4TLLB 2FEWB 1NXPA 5JNVA 3HL8A 3A0UA 5KQPA 4K8XA 3NBPA 5HRNA 1FK9A 3Q41A 4RY0A 5FRNA 3BBLA 3EAFA 1RDBA 3KLEA 4LDZA 4CJ4A 3RQIA 5E3JA 2B4AA 1USKA 3AVGA 3OYCA 4G0PA 1PUXA 1D1PA 3DM2A 3SQ4A 3FDFA 4Q7EA 2PE5A 2X7XA 2HMIA 4E3SA 4DG1A 2IDOA 3QELA 4GVMA 1KFDA 3VNAA 4UHJA 4AHCA 4Z4FA 1RDDA 1HRHA 4RV5A 4PA1A 4YNQA 3K57A 1L5UA 1C0UA 3H5WA 1Y1LA 4IG3A 4KQ9A 4XAQA 4HUEA 3JVDA 3F73A 3U3YA 4CJ5A 2PUBA 3KG2A 2YNIA 3T19A 1Z18A 3OS2A 3BREA 3V9ZA 2FEPA 4CFBA 3OQOA 2AJQA 2NT3A 2FTKE 1GLGA 3UIQA 3AA3A 4XXHA 3KTOA 1NOYA 4YLEA 4DTNA 2P9HA 4CK1A 3H1EA 2Z1GA 3AO1A 1E6KA 3VQ6A 4RY9A 3KD1E 2E4XA 4DSLA 1KVAA 3ZCMA 3T3FA 4KHNA 1RTDA 1TL3A 4FZYA 3SAJA 3EULA 1ZHHA 1GOBA 4LE1A 4CJVA 1NXSA 4WXEA 1FFWA 3DI6A 2O4IA 4KTZA 5C25A 4C8LA 3NF7A 2D5RA 4BE2A 4E7LA 3PX0A 3V9WA 3KS9A 1EHCA 3TAEA 4FZXC 2JB9A 5FBHA 3M9XA 1KMIY 1HMVA 4G97A 4W5TA 2HVHA 1VSEA 2E4LA 4NV3A 2PUDA 4OGEA 3HO1A 3CFOA 1B9FA 1P8AA 3MXJA 2QV0A 4BDPA 3IPCA 1XC9A 3DOLA 3TMYA 3H6GA 3O1JC 5KGWA 4EVSA 3E61A 4E1MA 4FJGA 4G0QA 3KLNA 4DQPA 4JRPA 3KKRA 5DKFA 3O2JA 1T34A 3AVNA 4O1IA 1JF8A 4OJRA 4FJJA 1U2PA 1IO2A 4Q0BA 4W5NA 3HSYA 1LAWA 2MYTA 2X74A 3AVHA 4MYRA 2FSPA 2QXFA 2M98A 4QOZB 1SKWA 1JDNA 4ELTA 3EZ5A 3HP9A 4G0OA 3TAQA 2Q5CA 3LP1A 3OYAA 2GKGA 2Z1JA 2YHBA 3LAMA 4CF0A 3QEKA 1JLFA 3VQ5A 4CF9A 4J2DA 3C6TA 1URPA 3U3GA 1IG9A 3V6DA 2Z1IA 4HCCA 1LWEA 1E6LA 5CNJA 3MEDA 4KAZA 2QKBA 2E4UA 4CF2A 3NF9A 1ASVA 1NJZA 3QETA 3H6HA 2HSGA 1LV5A 4RKRA 3LZIA 2NT4A 2F8SA 1YMVA 1VSHA 2Z1HA 4O5BA 4KFBA 1F21A 4EGSA 1X9WA 1NK5A 4EUKA 3VQDA 4FJKA 4Z9AA 4EYQA 4IDKA 2L19A 4H4MA 4I7FA 4CFCA 1ZVVA 1FKPA 6CHYA 1C4WA 1U04A 4FLYA 2OPSA 2IPAB 2B5JA 3N75A 5HM6A 4FK2A 1G15A 3KCNA 3LALA 3JTEA 3SUQA 4FW1A 4ZMRA 1K66A 1RCHA 2ZQBA 3OM1A 1JKHA 1XHFA 4RK1A 1X9MA 3OMWA 1MAVA 4EYGA 1QP7A 4FJ9A 2IDMA 3L2RA 3NGZA 7ABPA 3LKVA 2ID7A 3H5LA 1RTIA 2KZMA 3T95A 3HVRA 3TO5A 1MVOA 5TQ2B 1TKXA 2KW4A 5HLFA 4ZJPA 4OATA 1Z26A 4QAGA 4HYEA 5FWXA 4O4GA 1HPZA 4FXDA 5KTQA 1D8YA 4OGCA 3CKMA 2XY6A 4ML3A 4NCBA 3IPAA 3OLVA 4D6YA 3F6PA 2KZZA 4DLGA 4I9QA 4Q5VA 4CEQA 1JH9A 2Y1IA 4E7HA 2NUBA 5CNIA 1PHRA 1RT7A 3NDKA 2PYJA 4FVMA 4JLHA 4CECA 2NZUG 4Z4CA 3SUOA 4QCLA 1D1QA 1WAFA 5F64A 4CGHA 1P6QA 5DGCA 4E7JA 1EETA 2HHXA 1I3CA 3R0JA 4MFBA 3FMVA 4H3KB 2LSNA 3CG7A 5TQ2A 1RPJA 3K9CA 1C0MA 2HW3A 3VQCA 3HV2A 1W9HA 5I3UA 1TMYA 4DFJA 3OLWA 3CG4A 4B9TA 4EZ6A 4ETNA 3G10A 4M3TA 1BGXT 1NK4A 1WLJA 4ELUA 3D8UA 3H5IA 1DC8A 4EYOA 2PUAA 5JNWA 5IC5A 3ZT1A 3IS9A 1RZRA 3C3MA 3TANA 1R0AA 1B92A 4W5RA 4YCSA 3AO2A 4G86A 5I4CA 1K6YA 1LAVA 4FK4A 4B9UA 3QEWA 3RVSA 3DRSA 3S3NA 4JS5A 2PLNA 5GQSA 4FLZA 1JFTA 4JOQA 4B3OA 3QEIA 2R4QA 1BQMA 1KLMA 1JHZA 3CQ8A 3CS3A 3SI6A 1KRXA 2JCGA 1OXKB 4FJNA 4S05A 4RDCA 3Q9SA 4KNYA 3QINA 3HK2A 1U4BA 4DMNA 1TK0A 2IOYA 3LWMA 3OYIA 2P4UA 3O3HA 2FC0A 3AVMA 4CFDA 5D2CA 3I8DA 4KHYA 3OLXA 3SY8A 4AHSA 1VSLA 4CJWA 4Z4EA 4BDZA 6ABPA 3N53A 2FKAA 3NHGA 4LX8A 5IEJA 2FMHA 3SCXA 3T1AA 3GT7A 5JNUA 3EJWA 1TVMA 3NE6A 4CF8A 3NNDA 3M8QA 4IGAA 3UKJA 2XHBA 1KFSA 1Y97A 4ZYLA 4YV7A 1HEYA 4HUFA 3KLGA 5SWMA 4Y9TA 1IKYA 3SQ1A 3ULDA 3AVFA 3N0RA 1PEYA 3AVKA 1T8EA 2GI4A 4EY3A 4FCYA 3NH1A 2WRZA 4YO7A 2EX3A 3KLFA 4CK3A 4N5SA 4W5QA 4RSMA 4E89A 1RNLA 4H3HB 4MGEA 4RK0A 4NCAA 1GCGA 3RRHA 4MR7A 2XY7A 3MA0A 1FFGA 1RZRD 2A1RA 2TMYA 3TAGA 2OZSA 1Z2EA 2KFNA 2Q3SA 1OXBB 2HJ9A 3LUCA 4KQCA 1DCFA 1JLAA 5DK5A 4NICA 4DSKA 1PNRA 4EP4A 4KPYA 3OYLA 4PEVA 2PKXA 4O44A 2AYXA 1TGOA 2CHFA 2ITGA 2JLEA 4IILA 2RKIA 3QIOA 1J5OA 3ZSWA 3SG0A 3G85A 3H5TA 3OYMA 1UOCA 4IG0A 4DU4A 1BCOA 3SQ0A 1T03A 4RW9A 2A9RA 3HCWA 1BDHA 4RW6A 3OYHA 3NF6A 4IF4A 4CJTA 4F4KA 1GCAA 3QLUA 3QX8A 4L85A 2R48A 1TKTA 3NF8A 4DTUA 1QO0A 3OQMA 2HHTA 4FJHA 4D6XA 1BI4B 3DLRA 3A0RB 2HHSA 3VQQA 1RBVA 4OKJA 3LUHA 3NHMA 3OYBA 1DG9A 3AV9A 1Q8IA 3DGFC 3Q7TA 4F8JA 2WJWA 3DMJA 3FFTA 4G1QA 4PICA 3IDOA 1GOCA 5CHYA 4CEOA 2P5OA 1M5UA 3LZJA 4DSIA 4ICLA 4M3RA 4N56A 3B2NA 4CJLA 2D0BA 4JRQA 3W9SA 2PUEA 3O74A 5J2QA 2NZVG 3NHZA 3HP6A 5J2PA 3P5JA 3N0WA 3BRQA 4H8KA 2MYNA 3F9KA 2PJUA 4E7OA 3C94A 1ZDMA 1IIBA 1C1AA 3FFIA 2A9QA 2ZAYA 3GL9A 2YNHA 4E7KA 4P1ZA 4M3WA 3KTQA 2IPLA 3RVOA 1QMPA 4IFYA 4RY8A 1EXQA 2JVKA 2GUIA 4CJFA 3H1GA 3QNNA 4B9LA 3EGCA 3L2WA 4CHYA 4RS3A 2RDMA 3MECA 4JP1A 1S1XA 1C6VA 2WWVD 4MQFB 1CEYA 3V1RA 3L2QA 3TAMA 1KLNA 4CJKA 3OLZA 3WNEA 2PUCA 3N8IA 5FWYB 3VQ8A 3E01A 4FE4A 2BDPA 1CLQA 3K5LA 4JA2A 3BDPA 1KVCA 2RN2A 3K2PA 1SV5A 1B9DA 3OM0A 3ZSXA 4ZTFA 4CGGA 2YNGA 3QERA 2JVJA 1QQBA 2E4ZA 4CEAA 2G8WA 1JLCA 1N6QA 2FEKA 2D0CA 2P5GA 1DTQA 3LPTA 3TABA 1SL0A 5IBQA 5CZ1A 5KC9A 1L3UA 3CLKA 1GOAA 4ETMA 1S1VA 1DCKA 1QO0D 4RXTA 3F7NA 3GYBA 3LUJA 1RT1A 3NCIA 4MS4B 4M45A 5EWMB 3SPZA 2WJAA 4OPJA 3OYDA 4LH4A 4H60A 2L17A 1UA1A 2DFHA 3RVRA 1NY5A 3CYMA 2IGIA 1Z2DA 4RXMA 4Z4GA 1TK8A 3DZDA 3VQBA 4M42A 2YKNA 3RVKA 4FJXA 3SPYA 1C1BA 3O4QA 1VSDA 2QSJA 1A5VA 3D0PA 3ZT2A 3MMNA 3O21A 4KTWA 1D4ZA 3NH0A 1NXWA 4MS1B 2FBTA 2FW0A 1YK1A 1MU2A 4MPTA 1AB5A 3LMKA 3NNSA 4O55A 3I42A 4LE0A 4KB0A 1T7PA 1LK0A 4Z4HA 3DGEC 4MS4A 2E6MA 5EWMA 2FQWA 1L5ZA 1ZBFA 2WONA 4P98A 4WT7A 4O5AA 1A5XA 3T6KA 3QLUC 4B9MA 3O2SB 3EQ2A 1U49A 4CHQA 1CXUA 3D45A 3SJJA 3O1IC 4DSJA 5HP1A 1L3TA 3DLGA 2FBVA 1NK8A 3KK1A 1LBHA 2GBPA 1D2AA 2MSWA 5B3JA 3NGYA 3DRRA 1BDJA 4ID5A 3AVBA 3S99A 2I6FA 1JL1A 4DFMA 4MS1A 2I5JA 1DZ3A 2A9PA 3KJXA 1A2OA 5KGXA 3RMCA 3KIOA 1JLGA 2KQ2A 4RU1A 4LH5A 3SYZA 4DTRA 1JFVA 1EWVA 4KK4A 1NXVA 1TL1A 4CIFA 3HS3A 5JS2A 3AO4A 1VK0A 1ABFA 4LSLA 3SUPA 4YS6A 3O1HB 4FZZA 2OENG 1NK6A 2ZE2A 3CM5A 3ISNC 4DQIA 2HNYA 1S1UA 4ELVA 1ISRA 1Z17A 1RBTA 3C3KA 3KYJB 2G8UA 4DWIA 2E6LA 1BL3A 2L2QA 3L49A 5DLEA 3VNBA 3LP2A 3LWLA 2OA8A 2WMYA 3ASMA 3C6QA 3MYYA 4DS5A 1I3AA 3OVNA 5IUNC 1P2FA 1FSPA 4EZ9A 4L4UA 4CBVA 1ZH4A 3VQPA 3OJUA 1VSKA 1T05A 2GWRA 1HNVA 4LD0A 5ED4A 5CNKA 3ZT0A 3BRSA 3ZSQA 3VQ7A 2WB4A 4K8ZA 4G0XA 1YVUA 5TQJA 4CHNA 3OYNA 1WSIA 2YKMA 4KV7A 1CZBA 1S9GA 4PQUA 1WSJA 8ABPA 3O3GA 4RK7A 3VQ4A 3WNGA 1QSLA 3L6UA 4E19A 1SRRA 4ZTJA 1SKSA 1QQCA 2J48A 2IC3A 2HQBA 4I9LA 4UQGA 3HPOA 1BVHA 2X78A 4D74A 1BDIA 1JFSA 4RW7A 1WSHA 4CIEA 5TPZD 3CFRA 2PAFA 2LP4Y 4DTMA 5E41A 3C97A 3RRGA 1REVA 1UAXA 3IRXA 1TLFA 4RKQA 4DFKA 3JS5A 3IAYA 3KYIB 3N6VA 1VRTA 3S3MA 3O4NA 4F06A 4J2AA 5FRMA 1R8JA 4LSNA 4F3OA 1U45A 5CYMA 5HRPA 2QW1A 4FYDA 1DRJA 2JK1A 3DYAA 4OLBA 3ALYA 1NKCA 1EWTA 1TVRA 4AHTA 4XARA 3O3FA 1HNIA 5ABPA 2HHVA 1QNLA 3QX9A 2QR3A 3OYFA 4BDYA 2H3HA 4Q6WA 3I0RA 3CZCA 4XIUA 5TPWB 4Y1CA 3S3OA 4PY5A 3NH2A 1XHEA 3IP6A 3HVTA 3PUFA 3O2QB 2VWJA 4YFUA 4ZPJA 4DF8A 1QSSA 4GNRA 4JAVC 3K5NA 5IUJC 3PO5A 1RXIA 4CGIA 3T8YA 2ETJA 5B3JC 1VPWA 5J2MA 3ZSYA 3LP3A 4CJEA 1NXXA 1YK0A 4WUTA 4M41A 3QEPA 1YTAA 2BE2A 1C0TA 3N0XA 2AYZA 1EX4A 4TMYA 4CHOA 3EQZA 5TE9A 4FB4A 3H5VA 2VUHB 4MS3B 1S1WA 3F6CA 5TPWA 4LDAA 4FJ7A 3WNFA 4QICA 3OYEA 2XY5A 3KSMA 1KSPA 2ID9A 1XWLA 2RGYA 4F2RA 2JVIA 1ZBHA 4EYKA 5FDLA 5KWSA 3C95A 5HRRA 3AVJA 2ZD1A 1DRKA 1QKKA 1VSFA 3NNNA 1XI1A 4WXMA 1SL1A 3LUAA 2FVYA 1S9EA 1U8TA 2P51A 4F11A 3RMBA 1X1PA 1EAYA 4WWHA 1Z13A 4DU3A 2PL9A 1VSMA 2MSLA 3MEGA 3P83D 4QYMA 5TQ0B 3SM9A 4O0JA 3ILYA 4MS3A 2PL1A 2ZWMA 4PZ0A 1QP0A 2FLWA 4RXUA 1EWKA 2FBYA 4B8AB 3TARA 3LFTA 3EDCA 2YV0X 1AB6A 4KMRA 4BWJA 4BE1A 1L3VA 1ZN2A 4HNQA 4OPKA 4FW2A 4CHZA 2G8IA 3AO3A 3QIPA 5C5CA 3QEMB 5BQ3A 4R5PA 3IG1A 3ITHA 4QYWA 1ZY2A 4YGXB 1RT3A 3SQNA 4F2SA 1F51E 4DADA 4RWEA 4YWHA 3H1FA 1SXHA 2MSKA 4JS4A 4DTPA 4ETIA 1DC7A 4MRMB 1FXXA 3DLHA 4FJMA 5TQ0A 3VA0A 2FQXA 1NKEA 4IKFA 1JL2A 1NTRA 2HVIA 1VKRA 4RK4A 2A9OA 4CF1A 1CZ9A 1VRVA 1NXTA 4OBBA 3LOPA 2VG6A 4DFPA 1RILA 1YTUA 4OKEA 2DFEA 3MAQA 4ZMSA 3PY8A 3QEMA 3I09A 1YT3A 1EKEA 5EWLB 3MEEA 2DFFA 1QSYA 1DBWA 1L5YA 3CM6A 3KHTA 1QPZA 3MF4A 1KCFA 4G0MA 3ROTA 4HNRA 4M88A 1S5JA 4KK3A 4FLWA 4C8NA 4OG2A 3PV8A 4E7IA 1H9CA 2FBXA 1ZH2A 1YS6A 4IRXA 4W5OA 3CHYA 1RT2A 3V81A 4M3YA 3E3MA 1ZITA 1U48A 4TN5A 3H5OA 1LWCA 2MYPA 5EU7A 1UWBA 5DCLA 5HKOA 2DY4A 4RW4A 2JRLA 4HHTA 2CD7A 1HQEA 5EWLA 5SZTA 3HUTA 3L3VA 1IH7A 2L18A 3KJVA 5HSGA 4CE9A 5I42A 3AVAA 4YP9A 5IUKC 1ASUA 4KFCA 1NXOA 1JWLA 4G0YA 1NKBA 2PYLA 1RBSA 3WNHA 3V4IA 3H75A 4MR9B 3HYFA 2G8VA 2E4VA 1JLQA 4XFKA 2QZJA 3LUGA 4NCGA 1K68A 1DLOA 4CK2A 4RG8A 3AVCA 2QK9A 1JLEA 3L2VA 4CGFA 4KHWA 3KK3A 3SNKA 4Y1DA 4FJIA 4DSEA 2FN9A 1BI4A 3L3UA 1LWFA 5HQJA 1QHTA 3QNOA 3M8RA 2N9UA 5BR1A 3MXMA 4ZHRA 3CZ5A 5IEBA 1JX6A 2R7YA 2YHAA 1TK5A 3I5AA 3V1QA 3QLHA 3LDSA 3L8BA 4MR9A 1JL3A 4B9VA 4S04A 4DTSA 4N03A 1TKZA 4FLXA 1N5YA 1E6MA 1A0OA 3RVJA 2G8HA 1TJYA 3C6UA 2VK2A 5J2NA 4CJ3A 3V9SA 4AHVA 2XY8A 4RK6A 4LZLA 5C24A 3K59A 1YS7A 4MQEB 3QELB 3RWUA 2XDYA 3RVNA 4LY7A 1HYVA 1WETA 2RJOA 5D3GA 1FKOA 4BWMA 2OZMA 1BCMA 3AVLA 3ROFA 1ZBLA 1P6UA 4WE1A 1VSJA 2H0AA 3OO1A 4DTJA 1SXIA 1Q9XA 2RPIA 3CRNA 4CEZA 1PNTA 2HQRA 4MQFA 3I45A 5JNSA 4CJSA 3OS1A 4PUOA 1LW2A 5FWYA 1EFAA 4J2BA 4JB2A 4KVFA 1ZESA 3KK2A 4GPAA 1RDAA 4MQEA 1BAPA 2M1ZA 4RK5A 4KZKA 1M2FA 1RDCA 3QLVA 3BILA 2CHEA 5HBMA 4MLCA 3S9HA 4KHQA 3EYZA 4Z0UA 4NYFA 5C5EA 2CWDA 3LTEA 5KC8A 4MR8B 4DQRA 3P1GA 1Z16A 1ZGZA 1VLZA 3CU5A 4KTQA 2HB5A 3M9WA 4DS4A 4XASA 4DSFA 4GMJB 4FLVA 2HNDA 1ZYQA 2XRIA 3LP0A 4CEBA 1D9DA 3BGRA 1SUQA 1HQUA 4C8OA 1J9AA 4RZSA 1HJRA 1ZAYA 4DU1A 1ISSA 2R25B 2JGUA 2QXYA 3RMDA 2PY5A 5TPZA 1RT4A 1F4VA 4Q6BA 2RF2A 3SQ2A 2FMFA 5JS1A 3DLBA 1D5AA 4FLUA 2FXIA 4MR8A 4FJ8A 4HVJA 4CJPA 4F12A 5KI6A 1C0EA 1J56A 1U2QA 3KLIA 1USIA 5PNTA 3LUKA 4ID1A 4RW8A 1RTJA 5EWJB 1DTTA 2PUGA 4DQSA 2DRIA 4TLMB 3SV3A 4CJRA 3CTPA 3OMXA 3Q15C 4N47A 4CFAA 2B6AA 4KRFA 4CJQA 2KTQA 3RVPA 3SNNA 2G8FA 2KFZA 2Y1JA 4DN6A 1JXEA 2KYRA 3OQNA 2BGGA 3QLTA 1C1CA 3K4HA 5CNMA 1BIZA 4FE7A 2VG7A 9ABPA 5IULC 3IP7A 3KLOA 3Q7SA 2O4GA 4YRZA 5DTEA 3DLKA 3V9XA 1S6PA 4OVLA 4MAAA 1APBA 1FQWA 4FJ5A 5KQMA 1UA0A 1S1TA 3V9UA 5EWJA 3Q7RA 1NK0A 1M2EA 1HYSA 2X6SA 3A2FA 4FM1A 4F8RA 1SL2A 4M3ZA 2OYQA 1RBUA 2FMIA 1KRPA 3CFYA 1ZBUA 2VWKA 3LAKA 4BE0A 3TX6A 3AA2A 1ABEA 3VQEA 2YNFA 3JVIA 1ASWA 4LE2A 4PYRA 4N0QA 3GA5A 4DTOA 3HZHA 5FROA 1Z25A 3IP9A 1CYEA 1TKDA 3H08A 3CFPA 2DTUA 2X6NA 1SD5A 1XWWA 4Z99A 5T3YA 4Z0NA 1XHXA 2IOCA 3DOKA 5T7BA 4O1HA 2VG5A 5KQLA 4CEFA 3THVA 4KO0A 1NJYA 1JLKA 4TSXA 1QP4A 2PMCA 3RMAA 4AH9A 3OYJA 2XO7A 3TWHA 4FLTA 4N41A 1VRUA 3QK7A 1BISA 2OPRA 2D0AA 3TB6A 4CEEA 3HT3A 3MXIA 4DTXA 3PO4A 5FWXB 4I2PA 3ZSVA 3U6FA 4O0IA 1NJWA 2HNZA 5K14A 3QLVC 3FGZA 4KKOA 2IAJA 4LRQA 1RT6A 3ZSOA 4N0PA 2IKSA 4CERA 3JYTA 4FJLA 3ILHA 1U0SY 3JPWA 5KQGA 3KKSA 4HCBA 3KD5E 5BRJA 3TD9A 4KHUA 1B00A 2BANA 4PWDA 1YMUA 3P9YA 2HPHA 4CESA 3DLEA 5C42A 4WZZA 3L2UA 3A3KA 3LUDA 3RVQA 4L8RB 3SV4A 4G0ZA 1WSEA 2W42A 2A1SA 1DCMA 3K5OA 3ZSZA 3MIZA 2IS3A 2HQOA 1HYZA 4EVRA 4B09A 3C3WA 1W0HA 4B9SA 3SUNA 3ZSRA 1NATA 3UK0A 3JY6A 4HUGA 1PEAA 3HPGA
chains in the Genus database with same CATH superfamily
4KODA 4Q1FA 1QHGA 4KRXA 2GBLC 4ZXPA 2XE6A 2HHCA 2GPTA 4F4HA 2PU5A 3X1WA 1Z12A 2VCHA 4M7RA 3TD2A 1C41A 5LZ5A 3HV0A 1QQTA 5K8CA 4MVJA 5FBKA 1COWA 3R3JA 5G2OA 3HDVA 3H1VX 3DJFA 3LUFA 4UBJA 1DJMA 4N5HX 1G21A 1S6QA 2XDQA 4P4SA 1GUDA 3LECA 4D45A 4CUKA 5E7JA 3FNRA 1OI4A 1LJLA 1EK6A 1TTHA 1QWSA 2PDAA 1GL3A 4RHXA 3SZRA 2ON6A 1XZPA 3LZ6A 5HROA 3PNBA 1N36K 3L07A 4UAUA 4KUGA 4Z4IA 5K5EA 5LWQA 5KDLA 3DW1X 2FDXA 2VSXA 4KFTA 2BTEA 4WIAA 1Q0RA 1BRTA 4MGIR 1EVLA 2X0KA 3WQSB 1KJJA 2ZT8A 5BOVA 1XU7A 1JSLA 1S3IA 4FS3A 4TS3A 4E30A 1ARZA 2P9NB 1R0CA 1VHTA 3ZGYA 4WJKB 1SFRA 1MA0A 1XZGA 3SAFA 1L2TA 4M9XA 2QL6A 4M21A 1WSFA 4JASB 2YMLA 3ESBA 4JYZA 4LWZA 3R1IA 2JJYA 4H9GA 4OI1A 2ZTMA 4LRUA 2Q3JA 4MV1A 1Q12A 1JEYA 4HWGA 3UK6A 5AK3A 1V71A 2PFUA 2MR6A 4BRPA 1LSUA 2I2FA 4P6VF 5K7SA 1IKXA 4PLGA 3HCRA 1TF2A 1K5HA 2PQMA 3DKPA 1JG2A 5H70A 1GNVA 3BJZA 1PLKA 3IPXA 4XDZA 4PPYA 4XPZA 4AJOA 3L92A 3NBFA 4P7BA 4JC8A 2PX2A 4QWWA 1FP6A 4WHMA 5JNTA 2G9RA 3TSQA 3DBIA 4TWAA 2JEZA 4IIDA 2DR0A 3RUCA 1PFQA 4HUTA 1AU9A 2IPNA 4UOQA 3KZ1E 4DA7A 2YVLA 8GPBA 3K0AA 4IX1A 4TTPA 4NOKA 3ZEAA 2XCIA 4XD2A 3SEQA 4CQMA 2EATA 3LANA 4FYIA 4ROTA 4ILHA 3EO3A 4P83A 4PC7A 3H87A 2IOQA 1KTQA 3N2GA 5DNDA 3ECSA 4FN4A 3RH0A 1UXKA 3IIEA 3RPEA 2GV9A 1GPUA 4OCZA 4IWNA 4B1FA 2PGDA 5DTIA 1XTTA 1T35A 3CNBA 4P54A 5AOCA 1EBUA 3I1IA 4LRXA 2IYNA 3TQSA 1JNYA 3FDZB 5DBHX 3R0QA 1ZC3A 3QV2A 3TU5A 2WVHA 4RVHA 4NL4H 3TRIA 2YIVX 2V5UA 1PR5A 1DFHA 2ZRMA 4BRIA 5ESRA 2I2DA 3EGIA 2EAUA 4YX9A 4R41A 2FXUA 1O8CA 4JQCA 4DV3B 1A1VA 1USKA 5DM0A 3MN1A 1U2SA 1TZKA 3IV6A 1HRKA 3K2QA 2ZJ5A 1XRLA 2PWBA 3EEFA 3CLSD 1MJFA 4XOUA 421PA 3GLGB 3ZE0B 3NBAA 3EC2A 3SC2A 3AINA 1K27A 1VGQA 4IG3A 3KNZA 4UTPA 3Q88A 4BBAA 1T6BY 4EY4A 2QK4A 5B5SA 2FP3A 3OQOA 3L8DA 4IM7A 4KR6A 4EB6A 2HCJB 3N05A 3ZWYA 3GA0A 2IDKA 2O3SA 1G1MA 2XYHA 4FOLA 2AQ8A 5L3SA 1NURA 5KTTA 4PZLA 2WNHA 3AWIA 1ZOLA 4PG5A 1Y48E 3JASA 3PX2A 4LE1A 3TIIA 2O4IA 4KTZA 5GADl 4OREX 2HLNA 1G42A 1YQQA 3PYXA 4C3OB 2H9YA 4HSGA 4IDPA 3UVEA 4EBBA 1RBZA 4OXIA 1SCIA 2OPHA 1O94A 3TZ6A 4K25A 1MDFA 2HVHA 4NV3A 2W8BA 1IU9A 1PV4A 3OZIA 2G1PA 5LMCA 4PFJA 2KBFA 2VDNB 3CIFA 3MJSA 3KLNA 2CBZA 4CFZA 3O2JA 1F3OA 2H08A 2AOXA 3IKJA 1KSHA 3H2GA 2ZSDA 5C37A 4NCHA 1YQWA 4F4FA 1YL5A 3J80A 1JDNA 3Q8XB 4X64B 3OIUA 2GKGA 5K1ZA 3IKTA 1WJGA 2I2CA 3AYXB 4WZBB 2GM3A 3VQ5A 1G8FA 3HXLA 4MWTA 4YIKA 4MVJE 2YY5A 1IG9A 4LC1A 1KBZA 1E6LA 1FSZA 9ATCA 3B9BA 1WD5A 1TM5E 3H6HA 1R74A 3P2JA 4PO9A 2PX8A 2NPIA 1JJFA 4O8CA 3MBIA 3SLKA 3HBAA 4FYXA 3BFJA 2HPZA 2ZUDA 4UE2A 2ZJRL 1FKPA 3WK8A 3D4LA 4DR1K 1NW9B 3KL4A 4CE6A 3SC6A 2FK8A 3O8QA 4ZYZA 1I51A 4P3XA 1AK9A 2EX1A 1PE0A 5LYJF 3QVUA 4YMUA 2HLDD 5IVPA 1ZNQO 2Y1EA 3LNCA 3FXAA 5AWFC 1RTIA 2R6FA 3UWMA 3HVRA 1B76A 2KW4A 3N2ZB 4ZCMA 5BQFA 3THWB 4HYEA 1SQSA 3BK7A 2P6PA 3UG6A 1TNDA 1CDOA 2FFAA 4GYKA 3F4KA 4IQGA 3MCAB 5KPZA 2QTCA 3ND6A 1M34A 3L6EA 3VSBA 5DHAA 3RC3A 1W6RA 3WLFA 5DW3A 3GEHA 4C05A 2ERCA 2FZWA 3TW4A 3UJCA 4L5YA 4DZTA 4PPNA 3PA6A 2OAGA 4G8DA 3SZUA 1UPUA 2VHQA 3M8KA 3G2KA 3DPSA 4TSFA 4S2UA 3DOIA 3FSEA 3HCPA 4R8MA 1X80A 4YAIA 2V7TA 2XNDD 3LAWA 3OSUA 5AUNB 3RVSA 3DC7A 3O08A 2RGGA 4JCOA 4YDQA 2V9ZA 2OCEA 5EXPA 1TPZA 4Z0TA 1BQMA 4EF6A 1BYIA 4FFDA 5BNFA 2OANA 3CQ8A 3F3SA 1KRXA 4CBUA 1WW3A 2JFWA 2WSBA 2P6OA 4MLZA 4EK9A 3ZY5A 1P72A 2YIMA 5LMUK 3PT9A 4PX2A 4B33A 4DR7B 3E81A 4CDGA 5H81A 5IW8A 3SJHA 3K4PA 2FKAA 4XCQA 1W46A 1O03A 5IEJA 3KZCA 4HAVA 4JZKA 1GDTA 5D3KA 1YF3A 3VOTA 4HLUC 5C32A 1QRAA 4BVHA 4I5IA 4UVIA 2OAEA 4YV7A 3H99A 4X1IA 1HE5A 5SWMA 2O8CA 4Q7LA 4D9GA 2QMEA 4AXXA 1QVWA 3RLIA 4YP0A 4FMPA 4E4TA 1QHNA 2C5FA 4DA8A 3ZWBA 1WE2A 5EMHA 5AICA 4GC9A 3CY6A 2XY7A 3AHJA 4XH9B 2ZS8A 2Q4DA 4F4IA 5IM4A 3TINA 4H7KA 4RMIA 4NK5A 4JBLA 1G7SA 2FPSA 2HJ9A 3BGVA 3ZWPA 1A3CA 2CHFA 3IX7A 2FG6C 4DU4A 1J06A 3HCWA 3OYHA 3GGCA 4DLVA 1EX1A 4F4KA 4P7GA 4JI7B 3KQHA 4D6XA 4I5EA 1CY7A 3C45A 4P33A 3OYBA 3DMJA 4JLPA 3CNQS 2VYVA 4M3RA 3ZHUA 4CG1A 3P5JA 4MYTA 3VR6A 2RKWA 1GU1A 2MR5A 1DC4A 3W5SA 3ZTTA 4OM7A 4BNJA 3QPUA 3DEZA 1VSTA 3EVBA 1LLUA 4OJMX 1R0WA 4QXRA 4CZGA 4DMLA 3ZNQA 3DLIA 4LX0A 3QVMA 3O93A 3AJDA 4TTVA 1SC1A 2YFKA 5AJTA 4CJKA 2V6GA 1VQ5N 4UVGA 5CXUA 3IBYA 2QNIA 3EFBA 2FPUA 2RN2A 1KDYA 2B36A 1SV5A 3EZ7A 2UYHA 2C8JA 4JODA 4RV9A 1Q0PA 4JDUA 3M3DA 1SL0A 2W4IA 1HDZA 2HWYA 1L5FA 4OBXA 2AOTA 2ZJYA 4R2HA 3F7NA 4TXNA 5J4KA 4P5PA 1T4CA 5LJVA 5LP1A 5D3MB 3M4ZA 3IUNA 2MJLA 1F8UA 3HCDA 4U2EA 4H0FA 2O6HA 3KXLA 4M42A 2JGDB 2A4KA 1VSDA 1IYZA 2NZJA 3ZXSA 2OZLA 5B3LA 4UPVA 1W29A 4GWKA 2C2ZA 5AVTA 4IGFA 1TLTA 3PIDA 2Z4SA 2YQ4A 2FF7A 4TT3A 1EAMA 3P9CA 1NY6A 3I42A 3GPIA 3U0BA 1JFLA 1XQXA 3N8DA 1JA1A 1Z4JA 2W2LA 4PSUA 4UU0A 3TIVA 3G1UA 4KXLA 3QRWA 2ZJPL 1C1XA 4JK3A 4L8FA 3R6DA 1ECCA 3IBTA 4JEHA 4C3UA 1E9SA 4E14A 2I33A 2GQ0A 4AQYB 3NHWA 2W2NA 3LZCA 1NPTO 4ENQA 1EQYA 2FF6A 1RKBA 1WF6A 1GLEG 5LOVA 1KI6A 5IXJA 8LDHA 3RKUA 3VPHA 5KVQA 3KIOA 5BQ5A 2GXAA 4AS3A 5SY4A 1L5WA 5SYMA 3VX4A 1PNOA 4RGBA 1X7YA 3IJ5A 2WTMA 5AFSA 4KK4A 3U7JA 1XKXA 1DKUA 1A8QA 1OBCA 4OHXA 2VDWA 1MZVA 4BVKA 2ZR7A 2Z3WA 2D0OB 4YQFA 1SOWA 3EYWA 3ASMA 4LOJA 4RVCA 1M34E 5KMGB 3R9KA 4JUIA 3Q72A 3KJIA 2YINC 5HK8A 3MQFA 2IIQA 4BNDA 2XQVA 2CCGA 5A06A 3KHYA 2UVDA 3CR7A 3LXUX 1WVGA 3A7DA 2I3BA 1J20A 5JAZA 1CUFA 4MV3A 8ABPA 1C9KA 5LIPA 5KVCA 4HQNA 1RLMA 1US8A 2XZPA 4C0WA 3AM1A 2JFNA 4D74A 4YT5A 3S2ZA 1IONA 4B3FX 1ZD8A 2LP4Y 4L3VA 5J3JA 2IITA 1R6XA 2YBEA 3LNTA 3RUIA 3U3OA 1UAXA 3M5PA 4YUAA 1RJGA 2N0SA 4QVKA 5F7ZA 1V8BA 4F3OA 1B2LA 2QW1A 1NKCA 2ZT7A 1TVRA 3O3FA 1UOQA 1WCWA 4NJMB 2PMFA 4OUDA 2BJVA 4XIUA 3I9KA 1UC4B 1PBNA 3DZGA 4BB5A 4MKRA 3DAOA 2B3TA 5HUJA 1Z4PX 3VR2D 2GCGA 3I8OA 1RJ9A 4YGYA 1W94A 1ZK0A 4YXWA 2E18A 3Q5GA 1SCAA 1I2CA 4GX2A 3T3HA 5C0YA 1Q19A 1N33K 4F92B 1DBSA 4LUCA 4MW5A 4TWBA 3Q0TA 2ID9A 4QU0A 3T3IA 4DBLC 4LJKA 1WKVA 2QTFA 1VP3A 1JHPA 4JI1K 3NRCA 3VEWA 1BX3A 5GV8A 1VSFA 4OYHA 3X44A 3MS7A 1U2TA 3SF8B 4BGBA 2PV0A 3TNYA 3LUAA 4E5UA 1L4FA 2IEYA 1KI7A 1FMFA 4O5FA 4MMXB 1KJIA 5AQRA 3O9MA 4NMXB 3D2LA 3BGDA 4QYMA 1GTG1 2YWXA 5MF6A 4ER0A 2NU9A 3CXUA 2J9YB 1EWKA 2VQSA 2OP0A 4HNUA 3LYUA 5F3DA 6NULA 2YV0X 3X2EA 1UAGA 3AETA 4OMUA 4FW2A 3U48A 1TC1A 3L1JA 5HOQA 3PCTA 5DNAA 1PR0A 1RHMA 3NT4A 2ZUCA 1E5VA 3A9RA 4PX5A 5AESA 1KZ7B 3CCBA 4G1EB 2CFTA 1NTRA 1YUWA 1U9YA 1VRVA 1PTKA 2HSZA 4IVNA 4URHA 3IPLA 3I12A 5AQKA 4G26A 2GCNA 2R96A 4JEIA 2QEQA 5HCNA 3CM6A 4Q4DA 3QTTA 3MF4A 1GPJA 1IWPB 4HXYA 4BY9C 4R3WA 3OBBA 3K35A 1H9CA 2D5IA 1XE3A 5CBPA 4A5OA 3U7GA 2HU7A 4QGGA 4GZMA 3UXYA 3FOAA 4CMJA 5EZQA 1L6RA 3OPNA 3IB6A 2BH9A 3SK3A 3HI6A 3N3BC 5SZTA 3HUTA 1QGAA 3E1KA 4F6CA 4CE9A 4J4HA 3AU9A 5I42A 2IY7A 4QRHA 3AVAA 2FPXA 1WNFA 1RHRA 1JWLA 2G4LA 4WINA 3D5EA 1RZUA 3VQTA 1DT5A 5EJGA 4KGDA 3VVBA 2OTJN 2X0IA 1VJDA 3QE2A 5TF0A 4HVLA 4C2BA 3DD5A 3N7TA 1BHSA 1XTUA 4N82A 4AIIA 3J7TA 4FMCF 3R3SA 1P73A 3PDIA 5DO9A 1L9XA 3MD9A 2O23A 2XTJA 1B23P 2W0MA 3EUEA 4N4AA 4LF8K 2JA1A 1P5HA 4DQLA 5J2NA 2FZCA 2DWCA 4D8VA 3V9SA 1ECGA 5JYDA 5J43A 1V3TA 1J25A 5T4FA 1NXQA 5DYIA 3CWQA 2I4LA 2RJOA 1I01A 4KIFA 2I66A 2EKPA 2Z8XA 3CRNA 2POQX 1ONPA 2HPAA 1R6UA 2VK8A 1HFJA 2K5UA 3FY4A 1PDOA 1IHUA 1NMEA 5FWYA 1ZU5A 4IXCA 1VQLN 1BAPA 1KBQA 2FGKA 3OD5A 4L4ZA 4Z7QB 2QGFA 4L0QA 3S9HA 3PQEA 5LCXA 3EYZA 4B7ZA 3SMSA 4Y30A 5G0VA 2NSJA 4FCWA 5IMSA 2XOEA 3QWIA 2FSVA 2V55B 4ENUA 2HNDA 4EG0A 3HJUA 3ANMA 2LTAA 3BGRA 1G4AE 4ZI7F 3NMUF 1ZH0A 4GDMA 4TMTA 4BNLA 3IA2A 4E5DA 1QZ5A 1C0LA 5ICGA 3U7RA 2ZW9A 5AHWA 3RK1A 3H3OB 3UCFA 4QELA 1VCIA 4BKOA 2GFHA 3QUTA 6ADHA 3S1SA 2DQZA 5BNTA 1JDTA 8MHTA 4RGYA 4BRLA 3AF6A 2O0JA 5PNTA 5GM2A 5F7XA 4PQEA 2PUGA 2DRIA 4DVJA 1V5GA 4R1MA 3CB4A 1L8LA 2P41A 1QLJA 3G7SA 3R0VA 2ONJA 1V4TA 3ZX4A 1G20A 2WYHA 1N6LA 3NDJA 4PBSA 5F0XA 5C8YB 1TJ3A 3FNBA 3TRJA 4H4CA 2XWBF 4CL2A 5UKDA 3L0ZA 4FHFA 1AF7A 4LYYA 3V9UA 2GD0A 2PMDA 3KR0A 1RBUA 5M3BA 2B9VA 2DTEA 3CEJA 2ASEA 4HBZA 1ASWA 4LE2A 3CD6N 3LT5A 5T4BA 4PXYA 5FROA 1K9MO 3FMIA 3CZQA 5G1OA 4OU4A 3H08A 1RXSA 1XWWA 4GSYA 4IG9A 2ZKIA 3O31A 1W5TA 4NR0A 3PWZA 5EHXA 4CMBA 3G25A 2CBXA 1A8PA 2DPYA 1BSVA 4BVBA 2GBCA 3RFFA 2QPLA 2YZMA 3QX7A 5U4XA 2BTQA 3CRW1 4HDMB 3FGZA 2ATCA 4L73A 5FLXA 3I23A 1U2DC 2UXCK 3MJEA 1DGQA 1PNQA 5TY0A 4XI9A 5LLDA 2HIHA 3DLEA 2CUTA 3MWEB 2IVFA 4MUBA 1KR5A 3L1KA 1JAZA 4K87A 1PX0A 3SV4A 1X3LA 1XN1A 2ZQYA 4Z0HO 3K9NA 2CZGA 1UC5B 2Q0RA 4CHGA 2B2NA 3SU8A 4EB3A 1H4QA 3OD1A 4ZICA 4WOBA 4ALMA 4DQXA 2XDWA 2CLOB 5FI5A 4FUQA 1CR6A 4JXKA 2BD0A 2YHWA 3QOFA 3HJGA 4UBMA 2PWZA 5DM1A 2P65A 1QS4A 5JQGA 1NVXQ 3GG4A 3L06A 2ZSUA 4TQ9A 3OY2A 4NQRA 2AK2A 1O3YA 1X9SA 1EEHA 3L1HA 4ICIA 1E1LA 5CY4A 2IA5A 2WIAA 3W8NA 3B85A 2R97A 4L75A 4H2DA 1K3TA 4DLSA 3IIJA 4M1SA 3UV7A 2E6KA 2B7LA 3G1WA 4W9MC 3JYQA 1DAIA 1IQUA 4UOZA 3TTSA 3FPLA 2WJYA 5AQHA 3VOSA 3LPUA 3M6GA 1F48A 4PAWA 4OI2A 1J54A 5IABA 3V9PA 4JBGA 3CN9A 4U7WA 4BO5A 1QGDA 4MB2A 3CA8A 1N32K 3CNLA 2P1JA 1KNQA 1N77A 4UAVA 3S0JA 3ZZUA 3C6HA 3VUFA 5T41A 1G2PA 2IF0A 4PN3A 3RNLA 2IPMA 4M0DA 1IM5A 4C76A 1USGA 3GBPA 3OAAD 2P9PB 1IBLB 3Q9LA 2V7PA 1QIIA 2WOMA 3M81A 4A36A 4RM2A 5F78A 4EO7A 1IJKA 1YJCA 3L7CA 1JQJC 1K1EA 2ECQA 5ESDA 1P4GA 1AT1A 1H85A 4KIWA 3U4GA 2YWGA 1ONBA 1E4OA 3T3EA 1HF3A 5K6AA 3RC2A 3DTVB 1MB9A 3NB0A 2PBRA 5CG1A 4BUZA 3AW8A 2NNWA 1FVHA 2YWFA 4AU1A 3T15A 2IX3A 2J4FA 3SQXA 1FFAA 1D5WA 5FJIA 3CZ4A 4AK9A 4C8MA 2HOQA 2J45A 4E2FA 1N2CA 3C3CA 3ENVA 4JGBA 2I2WA 4FKBA 2W11A 3ZJ4A 4D44A 5IHXA 2VHTA 2P5TB 2QL9A 4MLDA 1AQYA 2EHGA 2YVAA 5CCEA 2LWIA 1TT5B 5MLCQ 2XV1A 2SCUB 5DM60 3HDQA 5JDCC 3WQBA 3BHIA 3L0SA 4JYMA 1AZTA 4E6EA 3OZAA 1LV8A 2XPCA 2Q7OE 2EEPA 3ZI4A 4A27A 4PU0A 2WFMA 2WF7A 1UFVA 2FQYA 3OT1B 1SCKA 3B7WA 4W99A 5BPLA 2NSLA 1F7UA 5L4SA 4O2AF 3DT6A 2Z8YM 2PX0A 4C7OA 4BX9A 3O80A 2KLHA 4KGVA 4ZOLB 3PJRA 3TB4A 1E2MA 1AX9A 4OOFA 1AK2A 1J7JA 3OZEA 1WHTB 3HBFA 4FD2A 5F1KA 1U3TA 4A0RA 2ZRKA 3FYSA 5JNVA 5DBGA 1XEXB 1UBGA 4N39A 1BE1A 5KQPA 2NXWA 5DOZA 1AKMA 4RY0A 3I73A 3OURA 1OGYA 1ETHA 3LY9A 4YRLA 1SVSA 1XKTA 3CTMA 4JAXA 3LL3A 5B64A 4E3SA 3PGMA 1U0NA 4L15A 1YJNN 1KFDA 2X2PA 1G3MA 1E79A 2YFHA 4FOIA 1GA1A 4KQKA 4TM8A 3R9PA 1OD6A 2JJ1A 2ZR9A 1CDZA 3UH0A 3QWBA 5JNLA 4NS1A 2YNMD 1P29A 5CB0A 4YXFA 3RJ5A 4KAJA 4KQFA 3GRFA 2CFIA 3Q3EA 1JJ7A 2BBTA 4X85A 1GLGA 3NXKA 2C7VA 1QHHA 3JYLA 3VDNB 3NEPX 3G2IA 5F5LA 1CJVC 4OKIA 4CK1A 5BMOA 5B2ZA 1ZX1A 2AJDA 4FGKA 3GEGA 3AO1A 1XFDA 1SOAA 3KD1E 2E4XA 1KVAA 2QD4A 1MO3A 3T3FA 2XYRA 1V7PC 1ZGJA 4G4SO 4FTWA 4H0OA 3HJAA 2KWIA 3CLSC 1LTKA 1C1HA 3CCQN 4MQLA 3OM9A 1TUGA 1MHPA 1TO2E 4EMBA 4FZXC 3C2QA 1QO7A 1KMIY 4CZJA 1LQ2A 4W5TA 2PUDA 2E4LA 4Q18A 2C3OA 5TS3A 1P1JA 1RHUA 2D0DA 3IHLA 5C8DA 2INGX 2QV0A 2JCXA 2QM7A 3O8NA 3KKZA 4PG6A 2Z4RA 3ZDFA 3GK3A 4AECA 4E1MA 4CV1A 4JWKA 2PJRA 1TO6A 2F1HA 3ICPA 1KOLA 2JKYA 1LAWA 2JLCA 1ONOA 2WZCA 4QOZB 1UXOA 3F2IA 2X0EA 1A7UA 1DAHA 3NTXA 2PZLA 2V9CA 1OYYA 4ZZ0A 5JY1A 4CTJA 5KKNB 2HYDA 1BO6A 1Z83A 2QTNA 5CNJA 2EGGA 5ERGB 2OV8A 5C7YA 1TKCA 3OQ1A 3M0EA 3RQSA 4MO4A 2QMUA 1BMFD 1XLVA 2WAOA 4Y7CA 5DBEX 3DW3X 4OP2A 1GILA 3RYFB 3ODPA 4C0JA 3HACA 2H3EA 2J1LA 1DKLA 2WD7B 2L19A 4BLVA 5DLYA 3EL2A 4L9SA 2IEGA 5FOXA 1PSWA 4JKBA 1K7CA 1M8GA 2B5JA 3N75A 3SDZA 4A2CA 4DGQA 1QYVA 4JK8A 1PRYA 1YIDA 3KE8A 4ZCRA 1HZZA 1OAAA 3RWMB 1O57A 3BAZA 1GRRA 2I8CA 3OMWA 1QP7A 1EINA 4PL7A 3NGZA 4R1TA 1RKVA 3FNQA 3CINA 3JR7A 5HLFA 3F6YA 2JK0A 3A27A 1GGMA 3SVZA 4O4GA 4CM8B 5ALUA 5JG7A 4YPOA 2PT5A 4ML3A 1LZKA 3OQIA 1Z5GA 3TLMA 3IPAA 3F6PA 4M54A 5ALDA 4GXTA 2LR0A 1KO5A 3NDKA 1MJNA 3S41A 4QCLA 3PD7A 5IS2A 2IIRA 2BHLA 4BTEA 3WK5A 1TM4E 1Z7GA 5A05A 4IS3A 2XQKA 1KHTA 5BRDA 3VQCA 1T44A 3ETGA 3ONDA 1SUEA 2O2YA 4ZVLA 3I2KA 3OIYA 1USUA 4ITVA 3HSCA 4JC5A 2RAUA 3KEGA 5KSPA 5HUQA 4U4AA 3MTJA 3NDRA 1ZW6A 4MAFA 4B3OA 1N2CE 3WR5A 2WJ4A 4Z49A 3Q5EA 2GETA 1KQFA 4D0LB 4NONA 4R51A 2BKXA 3SI6A 2EJVA 1E1RD 1N3IA 2G0NA 3PRKE 3Q9SA 4TRMA 2J87A 1VL2A 2OEPA 2WWGA 3LWMA 1Q0SA 1U4NA 4YJ2B 2XLBA 2FB9A 1N2JA 2HNBA 3G0DA 4WDQA 1A4UA 3QPCA 4BPRA 4BDZA 2ONKA 4JXZA 4AZ3A 4JI8K 3GT7A 4GXQA 4M53A 4DEXA 1FFXB 2KSQA 4NNOA 3WGZA 3M2PA 5BNIA 2OOSA 1U1EA 3DLLL 1Y97A 4ZYLA 4DABA 2XIJA 1JMYA 4AN4A 4GMKA 3CCEN 4EZBA 4TN1A 1FLAA 1UT8A 1RNLA 4H3HB 3PJGA 1C9NA 2IOFA 2WJHA 3IDSA 3TAGA 2OZSA 2HJVA 3RAPR 4OQFA 2A40A 4RZHA 2XODA 1WZ2A 2IVOA 3R24A 3G13A 4WFBL 4C2AA 4ND1A 4F6RA 4DSKA 2QWRA 4GL2A 3AEKA 4IILA 1ZD4A 4RSGA 2NTEA 4BEJA 3LQFA 4EGCB 3PKZA 2VYQA 3W2EA 1BDHA 1Z0ZA 4CLRB 2Y3IA 2MOKA 2C92A 2Q1TA 3GFBA 3V34A 4M2LA 3GEBA 1PS9A 4AS2A 1BI4B 3LM8A 1WUIS 4GYWA 5D86A 1ESEA 3AV9A 2V4ZA 4AD8A 3HJTA 3QSYA 4O63O 1PI3A 4XIJA 4EBFA 3G0BA 1QS0A 3OG9A 3UB2A 4CM1A 1HK7A 3KXDA 1A7KA 1H6DA 2FKNA 2P9EA 3RS2A 3BF8A 1CF4A 3O74A 5EUBA 3OETA 3RBVA 2P2NA 3G5AA 5K0SA 1O4WA 3PQFA 3EXFB 3NDIA 3NR2A 3C3EA 2A9QA 1NDHA 4G3XA 2H11A 1EXQA 3IP1A 2AG0A 3IXQA 2ISQA 3EGCA 2WWIA 4RS3A 3HYRA 3EK2A 1C6VA 2OILA 2WWVD 1FZTA 5K99A 1KLNA 3O9ZA 3ANYB 1HOTA 1D4OA 1Y7LA 1RI4A 3DEAA 4LF5K 1R9MA 3RUPA 2VDOB 2HSEA 4MGZR 3B3AA 3QBJA 4MI3A 2CF6A 3EVCA 1DTQA 3LCRA 1GZ5A 3TDNA 4BFYA 2X41A 5BPNA 3HU5A 4MP8A 2HPVA 3AWDA 1RHJA 1RDFA 2ILTA 3JYHA 4X97A 1QYXA 4D3ZA 3CC2N 2WJAA 2HWWA 3UGJA 3VGKA 4MB0A 5IVKA 3LQ4A 5AW6A 3AVTA 2G8LA 3U16A 4YRFA 4YAFA 3H1TA 3VVCA 4XIIA 3NBQA 2G08A 3Q8KA 1ZUWA 3ZK8A 4PS0A 2BFAA 3ACCA 5IRCD 1U0OC 2GF9A 1M1NB 4O55A 1D2MA 2WJVA 4HN2A 4CF3A 4DSNA 1IULA 2DPMA 2V7YA 4EW6A 3CCUN 4Y9DA 1WABA 1VKZA 1YS9A 3WYNA 3HTVA 1DKGD 4WJLA 2RCYA 2I7NA 4DSTA 3NGYA 5BN3B 2P9SA 1E89A 1XI2A 3UYKA 5FWNA 1Z6TA 1V7CA 2JF0A 3DEIA 3PZBA 1L4HA 4LBYA 3CN7A 3WKEA 2Y71A 4UU7A 1C30B 5ALOA 4CIFA 1SA0A 5IHPA 2PY6A 1UUFA 3R9XB 4MTLA 4ABTA 3CM5A 2V65A 4A16A 3L8GA 1XGKA 2COKA 4YRRA 4Y2YA 2NRZA 4GRAA 3EIWA 1W36B 3OJUA 4HNAA 3A9CA 3NASA 2BMDA 1IK6A 1KYIA 3AR2A 2SNIE 4K8ZA 1QZZA 4EG7A 3B3JA 5L45A 4DAEA 1BX0A 2F1RA 1B2RA 1LS1A 3O3GA 1RP7A 1L8AA 5FL7A 4E19A 1CZUA 3QKUA 4KL8S 2J0UA 1AKEA 2HIAA 1CHDA 3CONA 4B3SB 1UJ6A 4C30A 1KK1A 3ZHOA 2LCFA 1F6BA 2NX2A 3UJ7A 4RW7A 1E96A 3FNFA 3CFRA 3A9VA 2ZM6K 5BQXA 1CQIA 2L69A 2HRZA 4G36A 4IFBA 2HRDA 3RS9A 3KEQA 4H1WA 1E9VA 3VPAA 2ATXA 2ZJQL 1AN0A 4ZO6A 4G24A 4LSNA 1TF5A 4QO7A 4YP6A 1PFKA 1KXJA 2QYTA 2V51B 4DV2K 1QVRA 2FSGA 1DIGA 4NE7A 4O0LA 1V5EA 1QNLA 5B8HA 1KEKA 3OC0A 3SBDA 1RABA 2FF3B 3SE0A 5JYEA 4NOJA 1QIFA 5JROA 3NCTA 3CC7N 1KXZA 1P9RA 4GKAA 2Q3DA 2VWJA 4DF8A 1WDTA 5IUJC 3TZBA 4AVYA 3AJ8A 3RBZA 4B3JA 2BMAA 1ESNA 4ZCSA 5FPEA 3GN1A 4B76A 3RYIB 2GF0A 4M41A 4PPQA 1FUYB 5CLFA 3ER8A 4QE3A 3R3HA 2JAXA 2ZRCA 2DPNA 1JVSA 1S1WA 3EF0A 1FTQA 2ZRNA 4MVJI 2D4WA 3PTZA 1T8RA 2DU8A 5JSQA 3CRMA 1V9LA 4AMBA 2EX4A 3ENNA 3D6FA 2IWHA 4NZ9A 1RWOA 4JD5A 3T1HB 2E1PA 1PW7A 3JQPA 1IJBA 4DR6K 1NZJA 3HO6A 3L1VA 4WTOA 2FVYA 1M2NA 4M9SA 2YJZA 1SU6A 2JEYA 3U19A 1IXKA 3FMGA 4XH4A 1POWA 1CUWA 2TYSB 4IJKA 2GRAA 3JRXA 4CM4B 2QJFA 4BE1A 2IOFK 5CEFA 2PU7A 3TFOA 4Q16A 2XD9A 4ENWA 3TG8A 2QLJA 3TCNA 4HAXA 2WNSA 1RIFA 1MG5A 1ZY2A 1O7JA 4YYZA 2G1AA 1SIOA 4BQFA 5F2NA 3LPDA 1DC7A 1BHO1 1FP4B 4B85A 3G02A 3TF5A 1YRWA 4I19A 5CA0A 1H2YA 1MRNA 4OQXA 2BLNA 4OBBA 2QN8A 2VFAA 4OJTA 1DAOA 3W7BA 1RILA 2BC9A 4JP5A 4CZIA 2C9ZA 1WMDA 2K2WA 2CJWA 3JQ7B 3TNJA 3ROPA 1N6OA 1WPXA 4KWEA 5AI9A 1KEWA 4KN5A 1P8ZA 4GM4A 3T7ZA 2G28A 4WLVA 1LK7A 2R66A 2FBXA 1WF3A 4F3YA 3K31A 4IV8A 3HWX1 5B1DA 2ZATA 5MGBA 2B9EA 1VSVA 4F60A 5EKXA 4B7UA 3UMFA 2J3IA 4X7PA 3U39A 5CIWA 4TN5A 5BV1A 1XTQA 4U7PB 1P0IA 1C3OA 4NNJA 4E5VA 3SOZA 4BC2A 2NQ2C 4GLLA 2JFZA 3EXEB 4UBLA 3GBSA 1VHQA 2WFLA 3BAFA 2EFJA 1RBSA 1I24A 2RH4A 4IAOA 2G8VA 2E4VA 3SBTA 3VKFA 2ZSBA 3AKYA 4OHPA 3WHPA 1K8YB 1C9JA 2JH3A 1YQTA 5I8PA 3NUZA 4Y2VA 5DNCA 4MYCA 3N8KA 2OHJA 5BP7A 2ZYUX 1WXQA 3NP7A 1A7AA 3TZQA 1ZPDA 5EJ9A 4HXGA 2P5SA 3UT5A 2AMJA 4RENA 2XNSA 4PPFA 2EFDB 3IXMA 4FLXA 4ZVRA 3GXOA 1I2DA 5FPQA 2ZT6A 4CM5A 3RWUA 2B8EA 2O4CA 4PXAA 1FKOA 3WIEA 3B9PA 3IPYA 2CLLB 3RFVA 1P6UA 3U8XA 4MA0A 3CJRA 4CLOB 1DOAA 1JSXA 4QTUB 3D2FB 2DSNA 2RHMA 4D41A 1WUKS 3WLAA 2PAVA 3MRXA 4TUYF 2JRCA 4V3CA 3IDQA 4RQAA 4MQEA 2H54A 3D1VA 2M1ZA 3NG1A 2FMUA 4LCBA 4KZKA 2BFCA 1ZI6A 4ZOEA 4OX9K 1USVA 4N5MA 3QLVA 3AF2A 2XITA 2Z2XA 3EZYA 3U13A 3CVOA 4YRGA 2J0VA 4DM4A 3P96A 4KYVA 1T0UA 1Z16A 1P7WA 5H80A 2HCRA 3D4NA 4GMJB 1L9KA 4RFSB 4CEBA 3OCYA 4GQIA 2C1ZA 2VH2A 4CM3A 3CEMA 1SVOA 1SK9A 3ZK9A 5TVGA 2WHEA 3QEJA 1GSAA 3RMDA 3CCCA 4IUDS 3UKUB 2UVQA 3SLGA 4XUEA 5F2RA 1WAMA 3DV0A 3ZH2A 4OL9A 4FJ8A 4FHZA 3ZYCA 4HFNA 3QJ5A 1OROA 1PTJC 1DTTA 4RVSA 2WICA 1GAXA 2PR2A 3WLKX 3PI6A 1PR9A 2G8FA 2V9PA 3O8MA 3ID6A 4KXVA 4NLBA 1MX9A 1RXYA 5EZSA 3ETEA 2Q2OA 1Y80A 9ABPA 3K70B 4D0RA 2QB5A 3G0HA 3OX2A 1N9GB 3OZTA 4AM7A 3EXHB 1OFIA 4WKBA 3UJ6A 4BJHB 5HR5A 2R5NA 4J0EA 2FI1A 4AULA 1HDIA 3VPZA 4B9QA 4PSVA 4UTXA 3HB4X 4XFJA 1UOEA 4M3ZA 1LB1B 2ZVQX 3AA2A 1U7PA 5B36A 1ABEA 4OHYA 4RCYA 3PC4A 1KJYA 1YOBA 3FJOA 2HRCA 2ZI4A 4DCPA 1G21E 2WQZA 3G9UA 4RHCA 2GJKA 4BNNA 7REQA 2O8FA 1MV8A 5ALLA 3IURA 2VAMA 3TWHA 4B82A 1D0IA 4DV0K 4OQMA 3TB6A 1N0UA 4XW2A 4R16A 3GUHA 4NBRA 4CLEA 4PCUA 1Z73A 1NJWA 3AHIA 1NRXA 4NB4A 3NTLA 3EEOA 5B53A 2IZ5A 4ONEA 4HMOA 1RS0A 2JNWA 1G2OA 3KKSA 4B6OA 1U90A 2W2KA 3F5FA 4I4TB 2HPHA 4CESA 1YUMA 3I4CA 1TW2A 4A7PA 3WSWA 1Q86O 4MGKR 1V6SA 3C7DB 2A1SA 3C6MA 4C0AC 2NO1A 3BHMA 1A7JA 2B34A 1XMJA 5GINA 1B42A 1IH8A 1SKQA 4OPMA 3MWYW 2WVGA 2ITMA 1YSCA 1O8BA 3ISVA 4R6XA 1TCVA 3TJRA 2VUIB 2AK3A 2BW0A 3L4QA 1PZXA 2IV3A 4CG3A 1YJWN 2J3DA 3JX9A 1XIVA 5B6IA 1Z0FA 5DH9A 1LLCA 1AJEA 5BYKA 3KBOA 1UMDA 1ZOIA 1BA2A 2ZYAA 3BEOA 3DEJA 3BE4A 5HOEA 4M83A 3UA4A 2P30A 3FD8A 2GCEA 2Z95A 2OD7A 4GLBA 5J5CA 1EUQA 5EIHA 4YRSA 4CMEA 1LOTB 2ADOA 5K6TA 4ZEXA 3COVA 3IE1A 3D3WB 1X94A 3FLEA 3K2IA 1Y3AA 1I13A 4H59A 5HFJA 5J1EA 3E7DA 3HXMA 3K09A 3L4BC 4BVLA 3AA4A 3CRQA 1PQ4A 3TTUA 1GG2A 2IYQA 1VCHA 4BG9A 1V45E 4FYHA 1SXGA 1FBTA 4NY1A 1YS1X 2WD8A 4CODB 3HFGA 4H0VB 2CKDA 3UW3A 2F9FA 4YOWA 2FG5A 4TTSA 2QTZA 3A5LC 2G25A 2WTNA 4Z7NB 1M7HA 1TD9A 2I54A 5JIBA 2ZUWA 3AXSA 4K3VA 3WWPA 1T3SA 4D98A 4DM7A 2B8WA 4YR7A 3HUUA 1YFLA 3PV0A 3NGMA 3T7TA 2YHUA 1TC2A 1JQLB 2I4MA 2ODQA 4UULA 1IPHA 4MKHA 3PNSA 2J0EA 3TMAA 2PXHA 4KV8A 3UWPA 1AS0A 4MLEA 2F48A 3OU2A 2R7NA 2QOEA 1ZJYA 1KTIA 3GLTA 1I7PA 5KHAA 3T4EA 3QOWA 1RYEA 4X1KA 4X71A 1RWXA 3DPIA 1JYEA 2P1ZA 1Y9DA 2HSDA 4IJVA 3VAYA 4PQRA 5CAEA 5LJIA 2NUAB 2GILA 10MHA 2CW5A 1FFSA 3WICA 1C3XA 1YACA 3D0KA 4WZ6A 4IS2A 2XXAA 1M90O 3LBHA 2P7IA 4O2BA 4TRJA 4B34A 1IOVA 4A0SA 4KO3S 3SQLA 4CIGA 3O4JA 1JIUA 1PJCA 2PKEA 3AI7A 2FN7A 3I01A 4RMJA 1Q5PA 2RHKA 4FKMA 4UCWA 5CA1B 4WKPA 4D97A 2VPWA 4JP3A 3EXIA 1ZKDA 3GZJA 1TFUA 3ZCPA 3VR5A 4TTRA 1A9SA 4YP5A 1JPNA 4L6IA 1GDDA 1SXJA 3T0GA 3KTAA 4AAYA 2XUDA 3UKOA 4X8LA 1I2ZA 4CCWA 2D8AA 2EKLA 3HL8A 1JV2B 3A0UA 3NM5A 1TUBA 4HWRA 1U0LA 2JLZA 2CMGA 5I7EA 2A57A 3AUSA 1GA6A 3V4LA 4JI3B 4LDZA 1L3CA 2Q29A 3N28A 1TYQB 1HYGA 1UQRA 5DRYA 1OI3A 2P7HA 1Z6ZA 4GBED 3WLEA 4Y6RA 3DM2A 5BV8A 1HI9A 1F1BA 4L0CA 5JXIA 3B5IA 2IDOA 5FEMA 2G0TA 4D6PA 4TKLA 2GZ1A 4UHJA 5L4LA 1B0PA 2IKQA 1VHWA 4AUEA 5MN6A 1YZGA 4E4RA 3JRNA 4XAQA 3JXUA 4HUEA 1FMTA 4A0HA 4BZWA 3D5QA 1Q50A 1LBEA 1DC6A 1JG3A 2J9FA 3DWLA 2ECPA 2W6NA 2NT3A 1O6GA 2EFHB 1DBRA 3GJZA 5K4HA 5C8YF 3GAMA 4QOGA 3C0BA 1T9CA 4RY9A 4UU1A 1QVAA 1SQFA 4UARA 1U2VB 1PS0A 2WTAA 3ZOKA 4GECA 4IW3B 5FR2A 3V8VA 3SQDA 3NIFB 1DE0A 2CNDA 5C25A 2D5RA 2AD1A 4Q5IA 1A77A 2C4MA 1C3VA 1EHCA 2DTDA 1R8SA 1WBJB 4RVDA 1SHTX 3Q8MA 1T6NA 1Y4ZA 4BVPA 2PNJA 2BMJA 1HMVA 4LHYA 2YNMC 4A73A 1VSEA 4F7DA 2R8ZA 1XV5A 3PSIA 5CVEA 4Y1RA 5AQ1A 3T9AA 3CGGA 4C7MA 5B7NA 4LY3A 3WWDA 5LU9A 3A2NA 1XWFA 1Z0DA 3A1WA 3IVAA 4MZXA 1J1IA 1C4OA 2F4VK 1BN7A 3DAYA 4L22A 5MHTA 5HW0A 4NCNA 4BX0A 2J9GA 5MFZA 3N7UA 1UP4A 2FN3A 2VTBB 2F7TA 4YRMA 3M4YA 1A5ZA 4L5BA 4Q9DA 2F4NA 1Y8RA 3LK7A 1H4VB 1YU9A 3JQ8B 2VNJA 3M70A 4LNUA 4HCCA 3K0CC 3FUTA 2E4UA 4CF2A 3NF9A 2DSTA 3U4AA 2HSGA 5KWIA 3HC7A 1QHEA 1XZJA 3E5HA 2YJTD 1Z9BA 2WUFA 1X8XA 3KQVA 3IPRA 2WOOA 2GMWA 5ECYA 4BRFA 4INZA 4LQLA 3T12A 1N6NA 3EIFA 3JQQA 2V6FA 3B1FA 3BIXA 3IGFA 1ZVVA 2NTYC 5FOVA 1K6EA 2BR3A 4DR1B 1UMBB 4WF9L 5A2QA 4JS0A 5A3SA 3V46A 1T0IA 5JO0A 3WGNA 4ZQCB 2NO7A 2UYOA 1EGMB 4OY3A 4RK1A 1NGCA 3RC8A 2FMXA 2GPYA 1QQOA 3LM2A 3A5MC 2V4UA 2V6MA 3U7IA 2X7HA 3RU7A 3H18A 1CUBA 3JD1A 4K0KK 5JANA 1ZICA 4CCAA 1EK0A 1K92A 4RWZA 3IQZA 3UE5A 2OO5C 5B7QA 1BGVA 4U3JB 5CCBA 2PYJA 4WCFA 2W6ID 4BPBA 2E5FA 3K0FA 2EARA 1F8GA 2BGLA 5D6OA 3WWZA 3X1MA 3V1UA 1TQ4A 5TQ2A 1KY4A 4EJSB 1Q0ZA 4ETNA 3MS2A 1Q7YO 4M3TA 2EKDA 3C6BA 3COPA 2BFDA 3FYHA 1CIJA 2C3YA 3KVYA 4IL5A 5AQVA 4NBNA 3D7LA 3KV1A 3PHCA 3P4IA 4OHVA 2C2OA 4LHEA 3DSRA 3IDFA 4B9UA 6PFKA 4B6GA 4LXIA 1VTKA 2ARKA 4BE4A 2ZSIA 3CUEF 4YOYA 2DWUA 1J0EA 2HFJA 3E7WA 3LPMA 2ZYIA 2EFGA 4FWOA 1U4BA 4ARIA 1ONNA 1VPDA 4HWIA 1X9HA 2QQEA 1ESZA 3Q7EA 3OU6A 3H4MA 4DUYB 5KNCD 2J33A 3I8DA 2Y9PB 1EJBA 4HTFA 3N53A 4B4OA 2DJ5A 1VDZA 4M99A 5C4IA 1UBNA 1KEPA 3IOBA 1L4GA 3OIGA 3O4VA 1L5GB 1XZQA 2EQBA 4FCTA 2XHBA 4ESOA 3C8MA 3FTCA 1HEYA 3G17A 3ZWVA 3SQ1A 3ESCA 3F5MA 3AVFA 1GN9A 2PRIA 1DDOA 2VATA 3KAKA 3L0DA 3VXKA 5BN5B 4GMFA 5DW0A 3RRHA 4MR7A 2R1TB 4AUNA 2Q3SA 1BEEA 1UXGA 5LNK1 4IV0A 2B6NA 5EIEA 5KZMB 1Q81O 1UF9A 5DU2A 3T1YB 3RT7A 1Z2OX 4I66A 3U9DA 1P7PA 5CT4A 4ZOLF 3VR4A 3F9RA 3TS1A 1S8FA 3QLUA 4XZ3A 4D8WA 1VRWA 5CFMA 1BA0A 1LXCA 4LCEA 1JS1X 1INLA 2I22A 3RSGA 1UBSB 3DLRA 1EXWA 5IKXA 2MIIA 5TVKA 2XUHA 1GSHA 4K9NA 1GOCA 4JEPA 3C65A 3EY9A 5A0TA 3TRDA 3CLRC 4OGLA 1Z4IA 2DFVA 2YXBA 3A1CA 5I9NA 2P4EA 1LBQA 1ZGCA 5KYVA 3MMVA 1R6AA 5DRTA 1VLHA 4BQEA 4J9UE 5I9SA 5JFGA 5FTMA 5BWMA 3IT0A 4R8KA 3Q3IA 3COSA 2P0YA 2IEBA 4NXMB 3NIBA 2XGOA 3M1YA 4TKZA 2Q4OA 4AJ1A 1CKEA 3L2WA 1ZNYA 4UBNA 1ISJA 2H1LA 3SDBA 2IYSA 1JAYA 1C0IA 3WNEA 1KAXA 4E07A 2C5LA 1ESDA 1MC5A 1B9DA 1J39A 3ZSXA 2QE7D 3JARA 2VJNA 2ZWPA 4DJEC 4KAAA 3RO7A 5T6MA 3W4IA 4B73A 2GJ8A 3AIKA 1O5TA 4LMPA 1KAMA 1M6VA 3QVWA 4E5SA 2D1QA 2UUAK 2O2SA 5E6UB 3PVZA 1RT1A 3NCIA 4AL4A 3KETA 4DQ8A 5H9WA 3ICCA 4L57A 1RAAA 2D0IA 1TIPA 4OHMA 4FFVA 4RXMA 2W2OA 2FWJA 2YKNA 4FJXA 2QSJA 3K0HA 4RJKA 1QBGA 4AJ2A 3NH0A 2Y4OA 2HA6A 5E4YA 4RD3A 2QM0A 3ROZA 2NYAA 2YRFA 4I2NA 3B5EA 1GQSA 3FGOA 3JAKA 1LK0A 1W75A 2GPJA 2WONA 1X7ZB 3RKRA 1WS6A 4QTXA 5HP1A 4WLEA 4RGQA 4BOYA 1WXIA 4OQDA 4CBXA 3GG2A 1F60A 2AKEA 2BMVA 4MVJG 1RR6A 2BZ0A 4J90A 4TLDA 3RMCA 3CT4A 4LPKA 4ITUA 4JL8A 1JLGA 1P7YA 5LB2A 2HTFA 4Q21A 5JS2A 4K6KA 4YS6A 2XNKA 2QQ5A 2Y1WA 4DWWA 2HNYA 5IZCC 2NQTA 2P9LB 3S1AA 2FPIA 5D5HA 1RXUA 5FOSA 3BICA 3GVIA 1QGED 3FGNA 2L2QA 3C6QA 3VNQA 2C2XA 3RF7A 2PZGA 3O47A 4N3BA 1XF1A 3S4YA 3ZT0A 1XEWX 1R9GA 5IJ0B 3GZ4A 1N7HA 1BDGA 5EXEA 2YKMA 3FG9A 1S9GA 3U81A 1DAMA 3VQ4A 2ZE6A 1V8OA 2JAOA 2QU8A 4FYYA 4L3OA 1SQ0A 1AV7A 1MH1A 2XZDA 5ALFA 4MROA 4YDUA 3O82A 1S5PA 1PN3A 3V8EA 3X0DA 4J49A 4J0HA 3BD7A 4RDHA 3JS5A 3E70C 4MDYA 1PFVA 5AKIA 1WMSA 3GT0A 3P39A 3ZY2A 4ISGA 2CVOA 4EARA 3TN7A 1C0PA 1E1QD 2QRVB 4PYMA 5AI0A 1KH3A 5HIAA 4KFSA 3UGTA 1EM6A 4IOLA 3I0RA 3CZCA 4KB5A 3S3OA 4KQWA 4P84A 1J42A 1SZJG 1FLVA 4DARA 3G3EA 3WBKA 1QSSA 4JAVC 3PO5A 3NYQA 5CH3A 2HBLA 2V6BA 3OJLA 4UUOA 3ZSYA 1DKQA 4RPJA 1X1RA 3U1TA 2EG9A 3EOBI 4YJ2F 1JI3A 3KYDB 4EW3A 3OCZA 4TVOA 2AN3A 3GQBB 1C7EA 3TCKA 1TMOA 5AW2A 1FXUA 1OLXB 4YJHB 2BPOA 4OH1A 1WQ3A 5LNK6 2WIBA 1XJ0A 5D85A 3IUMA 4WBNA 4DCSA 1DG1G 2J6HA 1Q22A 2IIBA 3T1OA 4KPUB 5EQTA 1YL7A 4GGMX 2NP7A 4WXMA 5DSTA 1SKAA 1X1PA 3GCXA 2WBNA 5JDIC 1UZUA 3F9CA 3A70A 1ML3A 4HOYA 3VGLA 1DINA 4RXUA 2ZBPA 4F56A 3RTEA 3DBHA 1JG6A 1XMIA 1ZN2A 1TYDE 3EF3A 2QWPA 3ENOA 3NVDA 5M29A 1EB9A 2XE7A 3F2KA 2GXSA 2GN6A 4MWGA 1L1EA 3KP1A 4ZXFA 1K7FB 1RI5A 1UDWA 3F1KA 3DLHA 2ZE5A 2ZQ5A 2IXAA 1TJ4A 1VKRA 1I5EA 2O1WA 2HZ7A 3HGQA 1ZU4A 1SVWA 1PT7A 3H19A 1BWPA 4UPEA 4ZMSA 1U8EA 5CFLA 3KWMA 4L0MA 1X13A 1QSYA 5EP1A 2ANBA 2O07A 1SZ2A 8AT1A 4A62A 3ZS9A 3L6QA 5BV7A 2W0SA 1NX9A 1W88A 2FQQA 3O8CA 1ENPA 3FWKA 4QXOA 1RT2A 3DZJA 1KE1A 3ADBA 3G9QA 5BN4B 2YFQA 1QH8A 5EPOA 5INTA 3O8OA 4G1VA 3I1FA 2R1ZA 3OWXA 4EEZA 2DHQA 5A9SA 4RLHA 4BGEA 3OIVA 5JS6A 4B5LA 2ZJ1A 1WG8A 4HNGA 4DR3K 3G79A 3GU3A 3IAAA 1K63A 4XPIB 2GYYA 4IDGA 3WFJA 2PIAA 4QQKA 2ZUUA 4G0YA 2EWVA 1NKBA 2CLIB 1OXVA 2APJA 5HBGA 2NOAA 4DIMA 1YRHA 4L74A 1T29A 1X9JA 4O0MA 1E3IA 1NGAA 1MH9A 2O2IA 2KW5A 1JBKA 2ZYVX 5IYZB 2VJBA 3WUHA 3N87A 3W1WA 5HQJA 1E58A 2GCOA 4M0LA 2KE5A 5BVGA 1KEEB 3ANTA 2IXEA 4UQPA 1DUVG 3VESA 1M2OA 4X8HA 1XUPO 1RACA 1A0OA 2WYIA 3LF2A 5DLDA 1YS7A 4RFVA 3I4FA 3QELB 4B87A 1WSAA 2AQIA 4BWMA 1I2AA 1A5AB 5A3JA 3VSEA 2R8RA 2P91A 1SXIA 5THXA 1WB9A 1P3JA 1NUSA 1Y3BE 1G20E 2Z98A 4L8LA 5EJFA 1FJ2A 4PSKA 1GRQA 2IHZA 3IOMA 4Q93A 5B7GA 2HOEA 1ZESA 2FZLA 1T6CA 1ZGBA 3PC2A 2V74B 3ZLBA 3OPMA 1JLRA 3AZOA 1Z5OA 4B2PA 3QWAA 3JATA 4F2PA 2VTDA 2FFRA 1C81A 2D1YA 4KTQA 1HYHA 1UBRS 4K6HA 4AJLA 4KAFA 2FPWA 4CG2A 2YWDA 5HRUA 4DJJA 4C22A 3P0IA 5KTKA 4RJJA 3PNQA 4JHDA 1V48A 4V0SA 4IHQA 1MW9X 1C7RA 1LJ8A 1X9IA 5TPZA 3AVYA 1F4VA 1YCGA 5JS1A 2X2EA 4IO0A 4Q9AA 2ALJA 4AW9A 4AO8A 3AVVA 2JLSA 4MR8A 4HVJA 3ZCXA 2PVCA 1Q14A 1JFFA 3TI9A 4DLNA 4O4JB 2GYVA 1GRCA 4LF4B 3UB3A 5HQTA 3N5KA 2BL4A 3MAGA 4BTVA 4MO5A 1NNI1 2UYYA 3UUFA 2DQYA 5FNVA 2KTQA 4I6JA 4S12A 3BWDD 1H2EA 4WOPA 3TLGB 3OQNA 2BGGA 5F3WB 3QLTA 3UF0A 4ZGGA 3DXMB 5IT4A 5FCDA 3W5JA 1NJ2A 1XXLA 2WV9A 3RSEA 3SLCA 2ETXA 1HRDA 2VDPB 1FZQA 4EPWA 2F1JA 4WFQA 4BN5A 1O87A 3GJXC 1RQGA 5JRZA 1GTZA 5E7IA 2R60A 2FMIA 5TEWA 2AMVA 4EHFA 3WRVA 3LAKA 1M67A 3CFYA 5EOYA 1XCPA 4K28A 5LLSA 4RA6A 1GLLO 1EFRD 4HDOB 1HTWA 5A9RA 1USWA 4V19S 3CFPA 2SKCA 1SD5A 4RLSA 3BL8A 2I7DA 3RT9A 5HZMA 1RBMA 3TVTA 1JDSA 3E15A 2PMCA 1CRQA 3R3ZA 3NOOA 3RK4A 4MRNA 2YX1A 4BFXA 1Y0BA 2YIDA 3C87A 5C3UA 4IIHA 4WEQA 2QDXA 3L0YA 4EI2A 4TWIA 3V2IA 5GJBA 1RT6A 2VVTA 1JH8A 4N0PA 2FUEA 3OZVA 2ZKLA 1P6XA 5E7QA 4A3SA 2Y92A 4BRHA 3WNZA 2O3RA 2ZIUB 1T25A 3K92A 1FL9A 1JG1A 4UFPA 1J6ZA 2PZKA 1WDLA 2XW6A 1C3EA 1NT4A 2EZ8A 2VRCD 3U3RA 3R0ZA 2Q0UA 1EBBA 2A84A 2OP1A 4YJFA 3DF9A 1NV8A 1V11A 2OV2A 3EQ8A 2AXPA 4DRXA 2GF2A 3NEAA 1JBEA 4MVJM 3NFYA 2OECA 3LF1A 2OLJA 4TTJA 1XAJA 1JR6A 2VWQA 3JVUA 4HGRA 2PZEA 4YYEA 1SVLA 1H22A 3JALA 1MB3A 3WMRA 1HMPA 3DJYA 1AG9A 3IP5A 4NKRA 5A4KA 3OH8A 2PSFA 5LWHA 4JMPA 2PUFA 2GBZA 2RJNA 4D9KA 4EHBA 5EZYB 1DB3A 2IPXA 2BRUA 4B6EA 3E9ZA 3MJDA 1JXBA 3ND7A 5ALIA 2OBFA 1HSZA 2A1TS 2J4RA 3MHTA 3CJCA 4LA4A 4KQXA 2NYVA 1SHKA 2WWTA 1NK9A 5K3OA 4YDHB 3O7WA 4HGYA 3B5JA 4Q00A 3SFTA 4X6XA 3PHJA 4YOXA 2MYUA 4AY6A 4AT1A 2QMOA 5DN6A 3FFWA 4HNSA 4OHFA 1ZINA 1HFEL 1Q92A 4RZ2A 1TO1E 5BN1A 5FF9A 3LM9A 1KMHA 1VBMA 4DDVA 4MCAA 1IUOA 4MCHA 4XH1A 3ZU2A 3X3HA 4RLQA 3AP2A 2J6BA 2Q99A 3DXZA 3S2GA 3NOVA 3SFVA 5F2OA 4LSGA 2AP1A 3GROA 1RE1A 4IFVA 5CM2Z 1KGSA 1XQ6A 3D8TA 1IZ0A 4RD0A 2Q0HA 3UHJA 4HRAA 1HDRA 2DHRA 1PO7A 4RZIA 2ZP1A 4V39A 3WGKA 3WXBA 4H4OA 1F14A 4DC0A 3OPVA 4DYHA 1BIUA 4CETA 1QAQA 5ALMA 2OFXA 4GXRA 4D8UA 4EI9A 5DEIA 4DQUA 3CLRD 4MRMA 3VM6A 3WZMA 4DF4A 3D1LA 1RXEA 1CR2A 3IUYA 2QT9A 1QIJA 3PGJA 4Y2TA 3R3LA 3WJ1A 1NMDA 4DJTA 2WHYA 3BFVA 3M1IA 2PV7A 3BJMA 4P4NA 1GG8A 3NHRA 2WIGA 3P1JA 3TSOA 5I5EA 2YY6A 1OFUX 1ODCA 2VP6A 3KVGA 1II0A 5JCXA 1R2QA 3ED1A 4KMMA 3WMFA 3HPRA 1GFZA 4BU0A 1LSJA 2BKLA 3G59A 2BUCA 1Z8FA 3EUWA 3BZCA 1X3MA 2R0QC 1PL7A 3GDQA 3HUFA 1Z29A 4FZ5A 4YACA 3CUWA 2OC4A 5BWLA 4NP6A 3FUXA 4OSOA 2W4QA 1RBYA 1P4RA 3ANLA 4RPCA 1DIBA 2WSSD 3AV3A 4AY4A 2YASA 1QRSA 1JCFA 1S8NA 3I9V1 1JYFA 3GCZA 4UUBA 2AIRA 3ZDAA 2C1XA 3FCCA 2J9RA 3U61B 1IRIA 4C88A 4EFNA 3OJCA 4KXWA 1XA4A 4YRAA 2UU9K 3TNLA 4WK4B 4WN9A 1MVNA 2Q7XA 3QPBA 1S72N 3HCCA 3C1TA 1ECJA 3PEEA 1LPOA 1VJTA 1A4XA 4M7PA 1QHAA 4HRVA 4KMOA 4MULA 5EHZA 1Z82A 3IYLW 1I0IA 1EP1B 3UYLA 3RQIA 4OD0A 2ZTUA 3BD6A 4RAOA 5FPNA 4M0UA 1PT6A 2PBDA 1OZHA 4V0NA 4PLTA 4Q7EA 2RHHA 2X7XA 3DTVD 3OFJA 3CQ9A 3S2SA 1ILEA 3AOEC 1XQWA 4QFDA 3P9KA 4DWVA 3EMVA 1X6VA 3U6KA 1KDVA 2Y6VA 2C5HA 1I3OA 1T4BA 4NZOA 3BREA 1PVDA 1ZBSA 3FMOB 2LE0A 1JHVA 2DFDA 5A5GA