1W9SA

Structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
DLKNPYERIQAEAYDAMSGIQTEGTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLLGDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Family 6 Carbohydrate Binding Modules Recognize the Non-Reducing End of Beta-1,3-Linked Glucans by Presenting a Unique Ligand Binding Surface
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
molecule keywords BH0236 PROTEIN
total genus 30
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1w9sA00
1D7PM 3IDAA 1PMJX 2EIBA 3WNNA 4A3ZA 1OD3A 2EICA 4BXSV 2W95A 3T2PA 2W3JA 3MUZ1 4YPJA 4XUOA 3WF0A 1W9WA 1GOFA 2Y6LA 1O8PA 3UNPA 4XUTA 4P08A 2V5DA 3MO4A 5DPNA 1F4HA 1JYWA 1SDDB 1UY2A 1JZ5A 2W47A 5EJZB 5DQ0A 4CUCA 2J1AA 3DYMA 3T09A 1K3IA 4QB2A 3SKVA 4DUXA 3P6BA 1JU4A 1JU3A 3MV11 1TG7A 3THDA 3K4DA 4RYDA 3DYOA 1UY0A 2VJXA 3GXUA 3CMGA 2E33A 2YFZA 1JHJA 1W8NA 1UMIA 2VTFA 1US2A 2WO3A 2XONA 2EIDA 4QDQA 2LS6A 1CZTA 2DCKA 3WF2A 3OEBA 3D3AA 5JXHA 1K45A 3ZM8A 2Y6HA 5HXMA 2BERA 4QDSA 2WYSA 5CYYA 4DXTA 1W0NA 3SKJE 3I2FA 5LA1A 4QAWA 4MADA 3WNOA 2VZTA 1W8OA 1L7RA 1ULPA 1XNAA 1J83A 5IFPA 2X09A 4A44A 4JHZA 3UETA 3A21A 4LKSA 5EJ1B 3JXSA 4QX1A 2VOTA 1R64A 1OF3A 3WF1A 5HPOA 3I2JA 1JYXA 2WZEA 3T2QA 3K77A 2VMEA 4KI5M 2BBAA 3FHAA 5JXGA 1IQDC 1UXZA 2VZSA 3LPFA 1F4AA 2VZUA 2VCCA 3EYPA 4TTGA 3ACIA 3OGVA 3W5MA 2W91A 3A23A 2QQIA 1DYOA 3OG2A 4FI9A 2WN3A 4OZOA 4BK4A 4ZZ5A 2W46A 4CUBA 4PQQA 2QQLA 1I5PA 2B9VA 2RV9A 2W94A 4L0PA 3GM8A 5IHRA 2Y6JA 5IJRA 3WF3A 4BK5A 1JYVA 2ZEWA 4W4ZA 3CIHA 5G04L 4ARYA 2J1TA 2W1SA 2QQKA 2QQNA 2ID4A 3LEIA 3ACFA 3K75B 3SEPA 3ABZA 2BGPA 3DYPA 4MOAA 4AG4A 5C70A 3PUHA 1H6YA 2E31A 2ZEXA 3CKHA 3I2IA 1HN1A 5I0DA 2ZEZA 2Z4FA 4CU6A 1NX9A 3I2GA 4XURA 1GOHA 3WEZA 4DEQA 3VDBA 1GUIA 3OGSA 4A41A 2ORXA 4LHSA 3T0BA 2LW8A 2W9XA 5G05L 3I97A 5JMOA 1UMHA 3SEEA 4CVUA 3FN9A 4M4RA 4ET7A 3T0AA 1GNYA 2XQXA 3BN6A 1NKGA 2VC9A 3C7HA 3LEKA 5JR2A 4UAPA 2B4KA 1WKYA 4LPLA 1JZ8A 2X10A 1OF4A 3VDAA 1W9SA 2ZEYA 3U37A 2VZ3A 4DUVA 1YQ2A 4OMDA 2KD7A 4A45A 2J1EA 1H6XA 4CU7A 3T0DA 4QX3A 2WAAA 1GOGA 1BHGA 3HNMA 2ORZA 1OT5A 5C7GA 4E8DA 5CZKA 3NJVA 3OGRA 1JZ4A 2CDOA 1UY4A 3IAQA 1XC6A 2V72A 4OYUA 2W1UA 2HLEA 3HNBM 1W9TA 4P02B 4QPWA 2CDPA 1UX7A 3IAPA 5C71A 1WCQA 2JE8A 5J1XA 5JXIA 1UY1A 4QX2A 4MO3M 2WO2A 1GMMA 3MBWA 3WNKA 4CUAA 1MPXA 4JKLA 2V4VA 3ETPA 3OBAA 2Y8KA 2VMDA 3WNLA 3WSOA 1JZ2A 5FUIA 1UYYA 1PX4A 4GZ9A 2J7MA 2WAOA 3CZUA 2C9KA 2BGOA 3K4ZA 1UYXA 3K46A 4HG6B 3WNPA 4XVHA 2VZQA 4A4AA 4E8CA 3E1F1 1W99A 3LE0A 2C26A 2WO1A 2QQJA 4P5YA 4ARXA 1PMHX 3C7GA 1GQPA 3CDZB 4DXSA 2WN2A 3F2ZA 3FL7A 2VO5A 2X05A 3ECQA 1P8JA 3C7OA 4Z2AA 3WNMA 3FHQA 3WF4A 1J84A 2VQUA 2BZDA 1GU3A 2WBKA 3VD7A 4KWUA 3C8XA 1PX3A 4ZXEA 3BGAA 2W1WA 1NAEA 4PT6A 4A6OA 3OEAA 2VMFA 4JKMA 2WABA 4XUPA 4QDRA 1LNSA 1UYZA 1TVGA 3HEIA 2YFUA 3W5NA 3C7EA 3VD3A 4GWIA 4M4PA 2VQTA 4ZZ8A 1KGYA 1XNTA 4XZUG 3NQHA 3THCA 1UXXX 3NRUA 2W1QA 1CX1A 1DP0A 2WZ8A 3IB3A 3GDBA 4JX0A 3NJXA 3I2KA 2RVAA 5DMYA 2E26A 4PF1A 5IFTA 1JYNA 1NUKA 3EB7A 4XUNA 3HNYM 4KMQA 2DDUA 3T2OA 4OUEA 5EIYB 4UOJA 3VD4A 1O59A 2RJ2A 1DLCA 3LPGA 1JZ7A 1K42A 5LA2A 2L9LA 2VZOA 3HN3A 4DUWA 3I3EA 2J1UA 4MGQA 4OMCA 5JXJA 5B4NA 1JZ6A 1SG3A 1O8SA 3GGLA 2C4XA 4JKKA 4W50A 5LCWL 3VDCA 2VR4A 4QB6A 3VD9A 4UI9L 2OKXA 1T2XA 1ULOA 1UZ0A 2JD9A 4XUQA 1CZSA 2Y6GA 3LQCA 2QBXA 4D0QA 2WQ8A 2YG0A 4MGSA 1RYYA 2YC4A 2J1SA 4IUGA 1EUUA 2VZPA 4CU8A 4CU9A 3K4AA 5IYYA 4QB1A 2VL4A 2WDBA 3WQBA 2VZRA 2VM9A 2PQSA 2J22A 3ACGA 5B4XA 4DEVA 5DN2A 4LQRA 2R7EB 1UWWA 2W87A 3HPNA 2J1RA 3A22A 2W92A 3MUY1 2EIEA 2W5FA 4QX0A 1KEXA 3DECA 3UESA 4A42A 3C7FA 5F7UA 4RN5A 4ZY9A 1UY3A 2J1VA 2QQOA 2XOMA 3HJRA 1JI6A 1CIYA 3LEGA 4W8JA 4BDVB 2Y6KA 3I3DA 5A1AA 3HOBA 1K12A 4GWJA 5JUVA 1SHWB 2ZXQA 2VCAA 3OB8A 2VZVA 2JKXA 3CQOA 4AAXA 1OH4A 3NNGA 2YB7A 1JZ3A 3ACHA 3CZJA 4BJ0A 2VMCA 4D8MA 4P00B 2VZ1A 3A7QA 1CZVA 2HYXA 3I2HA 2E32A 2Y64A 2WUHA 2DCJA 2JDAA 4TXWA 1XPWA 3IIIA 3I3BA 3PUIA 2VCBA 4DXRA 3P1IA 3VD5A 1EUTA 1L7QA 3MV01 3T08A 1US3A 2QQMA 2XHNA 5LA0A 3AC0A 2YC2A 3J7HA
chains in the Genus database with same CATH superfamily
1I5ZA 3Q8FA 4BQ3A 4D6RA 3AP5A 4PQ9A 1CGPA 5JMCA 5K9YA 3E5UA 5KWRA 3WNNA 4A3ZA 1JYWA 1OD3A 1VBB2 2Q8DA 2R071 1PO21 4CRQA 3SNMA 4XUOA 4IERA 1AR62 3WF0A 4BIFA 2VW2A 3UNPA 2WNVA 2A5ZA 4XQWA 1PZ9A 1CAXB 2RS53 2OIIA 1SBEA 1HV0A 1ND3B 4XFGA 4E2SA 1JZ5A 1DQ0A 4J1XA 4QKBA 5DQ0A 2WNVB 2J1AA 4RGGA 5JIUA 1JMUB 4XIOA 2PHFA 1Y3TA 2GMPA 5FZHA 4FP2A 1C1FA 4DUXA 4D7SA 2ZGQA 4CEYA 1DBNA 4NR1A 5H9RA 3K4DA 1PVC2 1AUYA 5C5TA 3WQ7A 4MV2A 3CMGA 1DGRA 1VRH3 2OT7A 4AF9A 4IE6A 4E2QA 1W8NA 1UMIA 4YNIA 2VTFA 1US2A 1TEIA 3PIGA 5BNNB 3OEBA 4FPKA 3R4DB 2ADEA 1X50A 1RUC3 3THPA 1K45A 2XJVA 4QT6A 1JH5A 1FOD2 1VRBA 3Q9OA 4BLJA 1WW5A 4MLOA 5HXMA 2BVBA 4Z2WA 1W6PA 2XBO2 4UBHA 1MACA 3KHBA 2QZ2A 4YW1A 3BCWA 4XFIA 2RJLA 4PLNA 4UFJA 2A6ZA 4MADA 2EXKA 3WNOA 1CPNA 4ISRA 1YFYA 2ZGTA 3AMMA 4EN7B 5C3PA 2X09A 4A44A 1HB1A 3B93A 4XPVA 1S0IA 2JX9A 4BISA 2V09A 4AQ6A 3O1RA 3A21A 4LKSA 1CR7A 1Q3EA 2WA3A 1YC61 1UMZA 5BXXA 1HRI2 4N7IA 1A8MA 1SPPB 1S0FA 1WA6X 3POYA 3RS6A 3IWZA 2D6MA 2RE9A 2JG9B 4K1ZA 3VKMA 1OFNA 1LHOA 2A6VA 1N3QA 2X5IC 5L7OA 1QNYA 4WM8A 4OQ8A 3KT1A 4WVWA 4D7YA 5BNOC 2B45X 4J6GA 2AR6A 1I1EA 1WCDJ 4ZONA 1LRHA 1LOAA 2VPVA 4IV1A 2VMEA 3GYDA 4Y1ZA 5HCAA 3ST7A 3WG3A 2XJSA 2ZGSA 5FY4A 4C1XA 1TME3 4Q0SA 2C9AA 3PURA 2OA2A 4RA0A 4XFCA 2PHWA 4QX5A 4F83A 4PBPA 5JSOA 4BQ5A 3FBMA 3LPFA 3ZFFA 4D7TA 1F4AA 4Z8BA 1G9BA 3POEA 2ILMA 3QCWA 4P9IA 4RS5B 1LOEA 2FDHA 1Q8QA 4CEWC 5IATA 3R4UA 2R042 3ACIA 1D4M2 5EWSA 1Q8VA 5A7OA 2VMHA 1DYOA 2LTNA 1W9FA 2LM3A 3X29B 2ERFA 1JBCA 3INAA 1H8TB 1FV3A 1LEMA 3U78A 4JGZA 4BK4A 4ZZ5A 5LW9A 3KV6A 4NRPA 1AR83 3JD71 4XJ9A 4QPGC 5K0UB 2LALA 4GJZA 4FAHA 3OSDA 1I5PA 3O5SA 2WNUC 4JC1A 1YIFA 2K2SA 3AYCA 3BODA 2B9VA 3MLLA 1QH6A 1KJRA 1WCKA 2R073 4I0WB 5A6ZA 4L0PA 5IHRA 4O9GA 1XYOA 4W4ZA 4WM8C 5G04L 2Q8EA 3GJBA 1NCRB 5A3MA 4UFKA 4LMFA 4HL0A 4ARYA 2J1TA 1DQ5A 1RUD3 4AQ2A 2VVDA 3J7LA 2UYBA 3BVCA 5ABJA 1N47A 4CP1A 3FFQA 2XMLA 3JBG3 1GLHA 1JXNA 1ZZ9A 5KC5A 1HXS2 4FO9A 3EO6A 1VBA2 3VHRA 3ZSMA 4N90A 1H6YA 2YHJA 2XKOA 4N43B 1O3SA 3RYRA 1UW8A 3KGZA 3I2IA 1IG0A 3ZYPA 4RGKA 3R6SA 2V4AA 1IPKA 2ZKLA 4RS5C 4CU6A 4QGLA 5F5IA 3I2GA 4QGMA 3WEZA 3U4SA 3RZMA 3PTRB 1LENA 3ZYIB 4NE9A 3T0BA 2JDNA 1OA4A 2W9XA 3L9JT 1SFNA 2UWBA 4KWLA 5F6LB 5G05L 1H2NA 3ZYJB 2FDJA 1XB9A 3NAPA 4FOVA 4HK8A 1LTEA 3SEEA 3S7IA 3T2TA 4LORA 3ZYHA 2ZABA 2PLV3 1N1TA 3O1OA 4JGZB 2ZX0A 2HEVF 1OSGA 2QQPA 4Q4W3 3AKPA 3ZMNA 3AMQA 3PIJA 1RUH1 4XABA 5FZAA 3LEKA 4CPBD 1X36A 5JR2A 4Y5Z0 2B4KA 5FZ3A 4EYUA 1FOD1 2BRTA 3ZR6A 2YDEA 1HIXA 1FPN2 1W9SA 5K8SA 1NQJA 4YW6A 3U14A 5T5PA 4KQ7A 1BBT2 2X29A 4QHOA 4RGAA 1EY2A 1GFF2 1RHI2 3T4VA 4ASMB 3ZXGA 2VOXA 3LZZA 4ATFA 4CDUB 4DUVA 4OMDA 3PJQA 1LU1A 4BB3A 2WLPA 1RUI2 1AL22 4XF0A 4AHXA 4HETA 5GLZA 4AFAA 1OH3A 1XU2A 4COWA 4I01A 4QX3A 2WAAA 1GOGA 4IE5A 1ASJ3 2OS2A 4WM8B 4AI2A 1HQNA 4MVTA 1G9FA 5L73A 5BV6A 1OT5A 5HI0A 5C7GA 1RMU3 4N9IA 2JG9A 3AL5A 2FDFA 3IAQA 2V72A 2RR12 4XHBA 5DAVA 4ZXKA 2HLEA 5HBAA 4IL7A 2P3IA 1FNYA 1CVNA 1BEV1 2VGDA 1O91A 1W9TA 4P9WA 1LGCA 4RHV3 2VW1A 3E6DA 2CDPA 1ENXA 1S0DA 3RG0A 3BIWE 1EYBA 1ZZCA 3IAPA 4IV1B 5FBZA 4B3NA 5A3UA 5J96B 2JE8A 4FFIA 1COV1 4Q26A 2NYYA 3E6CC 1OMIA 3OF1A 5A32A 1RUG2 5FZKA 4CCEA 3N9NA 5J1XA 3USUA 1DHKB 3ZDVA 4AI1A 3HVDA 4GULA 4QQOA 4FAGA 4KGQA 3M70A 4MO3M 3AZYA 1RUF3 2WO2A 3OPZA 5FZ1A 3WCRA 1MPXA 2WNUA 1QJX1 3NNFA 5FMBA 2VNRA 3PU8A 4JKLA 4Y1VA 5FPBA 2V4VA 3MICA 2IWGB 2Y33A 3H9AA 3OBAA 4CDWA 1SLCA 2RS11 2Y8KA 2XUEA 3ALQA 5A3TA 2I45A 2FMDA 4XQ4A 5FP4A 3WNLA 1PK6A 4GKXA 1DQ2A 3LOIA 1AXYA 3K4ZA 2VVFA 3O1MA 2CGNA 3WDWA 1UNBA 1HB4A 2OZ6A 3GBGA 4QXKA 3J8F3 4P5HA 1MQTC 1PO13 3N9QA 5FZFA 1W99A 1W2OA 5FXZA 3AK0A 3WUCA 1D4M1 1U12A 4PI2A 2C26A 3ZFFC 4ARXA 3C7GA 3JUUA 1GQPA 2EXJA 5DUWA 3VBSA 4DXSA 4Q8KA 2P5BA 1CAVA 1MS8A 1C5HA 2VO5A 2W39A 2A75A 4H55A 4IEZA 2X05A 3ECQA 2E63A 1LGNA 3DF0A 5F8PA 2ARAA 2DCZA 2IXLA 3C7OA 4X8NA 3RMXA 1H30A 1UO9A 5FMDA 2MEV2 4Z1VA 1JHNA 1OOPA 2ZX4A 4TLGA 3VN4A 1QOOA 4AI9A 2NN8A 4EN9B 2ZZJA 3N7JA 1AF9A 2VQUA 1AXKA 1W3VA 1KDMA 4KWJA 4YGEA 5FUPA 5FLIA 4META 4KBBA 4QXBA 1QJU1 5JOZA 1STMA 2WBKA 3VD7A 4EQVA 2XDVA 1N3PA 1PK6C 2PHLA 5DZEA 1LR5A 1PX3A 2Y34A 4Y4YA 4LT5A 3BOWA 5F5QA 1MS5A 3BGAA 1GV9A 2W1WA 3MPBA 4ZXEA 4C91A 4PT6A 1O4TA 5F3CA 3AZXA 2VMFA 3CJXA 1OOPB 3G6JB 2YV8A 3W20A 4CDXC 1IPSA 4LE4A 3H7YA 3B94A 1UYZA 1TVGA 2WKKA 1A3KA 3C7EA 1YQ6A 1SDWA 4GWIA 3AKTA 2YROA 4K6BA 2RDQA 2VQTA 4L2NA 1KGYA 3AB0A 3TWIA 3ZKYA 3ZXKA 3SCGA 3O0XA 3BPZA 5FYCA 1U5ZA 1IS5A 1DLLA 1R082 4PIYA 3ASIA 4Q29A 1UXXX 5KHHA 3ZDSA 3APBA 2WQ4A 2W1QA 5JZGC 2WZ8A 1WD4A 1RUI1 2GN7A 4E4DX 4ZS2A 1W6PB 4FT8A 1QDCA 3GDBA 4LHKA 3TEZA 1ZRRA 1OQEA 3I2KA 3TAYA 3WG2A 5LY2A 1QHDA 1B35C 4QM8A 1S4CA 5DMYA 3RWNA 4CA9A 1QJZA 1EAH1 2B8MA 4LOSA 3VKLA 1RUD1 1QKQA 4KMQA 4IE7A 4FTBA 5A6YA 4K9SA 5DZGA 4ASKA 2VQ0A 3RJ2X 2HWC1 4FSJA 4AEJA 4CDXA 2PYTA 2Y0IA 3J9SA 4HKLA 4HSLA 5KBFA 4GALA 3DUIA 4AOCA 2WA4A 2D40A 1F5JA 1W6MB 3VD4A 1UAIA 1ULFA 2ZGLA 4GMP1 2BQPA 2RJ2A 1EP0A 2WT0A 3WDYA 2AUYA 1XU1A 1PIV1 4BQ2A 3I54A 3H1WA 1VIWB 3QH6A 5AVPA 4KU8A 5FO9B 1RUNA 2L9LA 4DUWA 5DDJ3 3I3EA 4QPGB 2WSUA 3HBZA 4FPLA 3PHMA 1Z7S2 1DQ6A 4OMCA 5FP9A 3FHIB 3POWA 5B4NA 2QZ3A 1IHMA 5CAZA 1SG3A 5IVJA 1JZ6A 3MPPG 4JKKA 5LCWL 4IEWA 5C8CC 2MEV3 3G7DA 1RVF1 3CHXA 5DAPA 2ZKNA 1XNCA 1XRUA 3VD9A 4J25A 4CP2A 4XBQA 1T2XA 1SMVA 1WMXA 2VNGA 2JD9A 4COUA 3TEWA 3GZEA 3LD8A 5CKMA 3LQCA 2QBXA 1UZYA 5H9SA 2YG0A 5BNPC 1TQ5A 2CV6A 5FP7A 3ZOIA 2VG9A 4FP3A 1EUUA 4A7ZA 1J58A 3IDEA 3LDRA 5JSRA 2YU1A 4CU8A 4P9YA 4DQAA 2P17A 4NAMA 3K4AA 3IKWA 2E51A 3ZX7A 5IYYA 2WNOA 4R9AA 4AXOA 1UKRA 1WBLA 2GH2A 4YVSC 3WQBA 4CSWA 1DGLA 3ZXLA 1O3TA 1Q8PA 4QPIC 4CCCA 2XH6A 5ACA3 5JI7A 4S2GA 2PHUA 4DEVA 4LBQD 4LQRA 1SLLA 2WYFA 1YRZA 2MEV1 5FXXA 3AYDA 4Q4Y2 1OC1A 4LXLA 1R1ZA 5EPAA 3ZPYA 1DQ1A 3AKSA 3JD72 4DS0A 1QXRA 5CADA 4IQPA 4MHRA 1AYN1 1W0PA 1DIWA 1KEXA 3UESA 5FPVA 3VZNA 4YZ5A 4HN1A 2WQZC 5EYXA 5T5OA 2QQOA 4GMP3 4IEOA 2A7AA 3M8LA 1JYIA 3KS7A 3PLQA 4CCJA 1AR61 1TZOA 3LA3A 3E5XA 1OBNA 2PHXA 1PM7A 3L2YA 5LA9A 4KG0A 2Y6KA 3H3ZA 4CE8A 5EP9A 2CAVA 2JIJA 2BVVA 3K3NA 4GWJA 2D98A 1RUC1 1N1SA 1UOFA 2ZX2A 4IV3C 4HOOA 4KBZA 4YZ4A 5GLVA 3MI8A 1CJPA 1YI9A 1BZWA 4CEWA 1Z0HA 2VCAA 3RI8A 4GB32 2ZJCA 5EHDA 1H4GA 3CQOA 5I0SA 3NNGA 3HT1A 3SHRA 2JXAA 4JGYA 1RUI3 2BTVC 2RDRA 4BJ0A 1REEA 1RUOA 4AGRA 3RPQA 5FUNA 5FY9A 2SBAA 3ZIWA 2VZ1A 4YVWB 1EAH2 2HYXA 1TMF2 4B1LA 1Q8OA 3AYAA 2LRPA 3IPVB 4GKYA 1V0AA 4CDQC 4COVA 2GMMA 3IDCB 5FPXA 5SV8A 3M4FA 1XPWA 3IIIA 4LJHA 3PUIA 4BLIA 1M4WA 3C2UA 4AAPA 4DXRA 1ODMA 1OQDA 3P1IA 2Z5WA 3EXUA 1I6XA 3ZSLA 3VZJA 1O4ZA 1FPN3 5JI9A 4Z92B 1ND3C 4FPFA 1US3A 2YXSA 5K0UA 4GMP0 1SFYA 2DVGA 2GC2A 1BK0A 2IVJA 2JIGA 2PQQA 3KB5A 2XQXA 2YC2A 5CVRA 3VDDC 1RGSA 1AYM3 3B69A 3PUQA 3W59A 3O12A 3VLBB 2EAAA 4NUBA 1PMJX 2EIBA 1H9PA 5GM0A 1G8WA 2EICA 4AVBA 2CL2A 1AYM2 1ZBE1 2PAEA 2W95A 3KWVA 3H8XA 1PO23 1W8ZA 4IW3A 4Z82A 1W04A 2W3JA 3MUZ1 4O65A 2DV9A 5FY0A 1OXCA 4MGTA 1O8PA 3ATGA 2FDKA 1O3RA 3UGHA 2V5DA 4IV1C 1XOYA 5A6QA 4G9SB 2JDKA 3MO4A 1ZREA 1RUC2 4B1MA 1SDDB 2G4IA 1UY2A 1XNBA 3BTXA 5LEKA 5EJZB 2QE3A 5FY1A 1HN0A 1MR5A 3GCXA 1W3XA 1UX6A 5FZCA 3PMSA 4MXWA 4QB2A 2VTXA 5FO8B 3P6BA 5I0RA 1D2SA 4R4ZA 4UW3A 3MV11 3T1LA 2DU0A 1HQLA 3NSTA 1PO12 1QJFA 5FR3A 4AVTA 4CCMA 1VAMA 4RYDA 1ODNA 1BJQA 3TYJA 2RS33 2VJXA 2CWSA 3GXUA 5FFOC 3VBRC 1BK1A 2VOWA 1Q56A 4MGZE 3M3EA 1VBA1 1N3OA 4RFRB 1JHJA 2FHRA 2D6LX 1QXPA 2XG3A 1UOGA 2VUDA 4QDQA 2LS6A 3F95A 4QPIA 5D8AC 1CZTA 1QJY1 1DDLA 2AACA 3MF6A 4IEYA 3D3AA 5JXHA 3MW3A 5I8YA 1O3QA 3HBKA 1MZEA 2J42A 1IGOA 2Y6HA 2BERA 4QDSA 1S0BA 1UPSA 3QLQA 3RZGA 5BPXA 2QKDA 4AZZA 4XCBA 2OUHA 3RQ0A 3WG1A 4GQ7A 2IC1A 1PIV2 3N9MA 3VHNA 2BBVA 1ZZ7A 2QNKA 1U5XA 3IDBB 3WW4A 2X8KA 3MW2A 3WW2A 2JJ6A 3ZR5A 1ULPA 4B4QA 1XNAA 1W6MA 4GB31 1S0CA 1IS6A 5IFPA 2VUJA 4ATEA 1IKQA 3P3PA 4JHZA 1HV1A 4Y3OA 3W58A 3ZSKA 1VBD1 3KMHA 3LB9A 4RD7A 1KRIA 5EJ1B 2B5HA 4GH4B 2G19A 4AQTA 4QGNA 1NT0A 4GIQA 2C6SA 2R16A 3JXSA 2GU9A 2ZZQA 2OPWA 4K8RB 5DUXA 5DAWA 1RHI1 4CXYA 1OF3A 2DFBA 3AVRA 4F7ZA 3UT0A 5GZCA 1V6NA 3GNEA 1FNZA 1W05A 3POGA 4QKDA 4FPHA 2D6KA 1VP6A 4NHYA 3T2QA 1LJ7A 3K77A 5IVYA 1HJGA 2G9FA 3FHAA 3PU3A 4HKOA 1IG3A 5BYNA 5ISLA 4Y1XA 4LO7A 4WZFA 1IQDC 5FZMA 5FTTC 4I0AA 3VV1A 3CNAA 2JDUA 2FZ1A 3N36A 2R0FA 4AGVA 4EN6B 1RMU2 1PNFA 3J4UH 4N53C 5FZ0A 1HX6A 1OLMA 4XFHA 2QTWB 2QQIA 1NY72 1RIRA 3OG2A 3O0VA 2P37A 2EIGA 4FVVA 1RUH3 4AVVA 5J09A 2BOIA 4LKEA 4NWVA 3LDBA 1LESA 5FREA 1QH7A 3B00A 4HFSA 4LBQA 3ZFEB 4NIAA 4CCDA 5T3NA 2CHHA 1NA1C 5EV7A 1OLQA 1RUE2 4GA9A 1GZWA 1QDOA 2RV9A 3GBWA 4UW4A 4BHPA 1AR63 2ARXA 4K8FA 2W94A 2WZR1 3DGTA 3LWCA 4K21A 3DL3A 1RUE3 4XC9A 2OYZA 1Z78A 5AC93 4AL9A 1YJKA 3OY8B 1HRV3 2RG4A 4UF0A 4AHWA 5FAXA 1X82A 4LKDA 3POJA 4DOUA 2GALA 5EFUA 3KQRA 3WW3A 1NLRA 4CYDA 2HBUA 2QJVA 3OUIA 4Q4X3 4BH9A 1ZBA2 4AGGA 3LEIA 4YGDA 5FJKA 3ACFA 2Z42A 1KFUL 5JR7B 2GP5A 4OCTA 1VAKA 4DRRA 5A3PA 1NQDA 1PM4A 3DN7A 3CF6E 1LOFC 1QWRA 1LHWA 2XQRA 2YBSA 5CU1A 2A3WA 4AG4A 4IV3B 3PUHA 1WLWA 4KNCA 2VE1A 2BWCA 3KSCA 2ZEXA 3CKHA 4FXGB 5T55A 3LOBA 1PGL2 4QKNA 2ZEZA 3KGLA 3AJZA 4HSJA 4MGKE 3QBQA 4HVQA 1RHI3 1BVP1 2A1XA 1NX9A 3FE5A 4XURA 1GOHA 3ACLA 1GUIA 1TNRA 3OGSA 5KXBA 3PL0A 2MPFA 1GSLA 3ZN4A 3V65A 4EROA 1WLDA 1UMHA 5LB6A 4E2GA 5EJ3A 3I3MA 5FPLA 2BPA2 4CVUA 1J3PA 1VBD3 2Y0OA 4AI8A 3MZHA 1QY4A 3AKQA 4GB33 4MSVA 3T0AA 2JICA 1MS1A 3VBFA 4ET7A 1Y9MA 1NKGA 1VBD2 3T1MA 4K1YA 4DXZA 2VC9A 4HK9A 4WVVA 5JPMB 3OUHA 4QQPA 3DXUA 1WKYA 4LPLA 1JZ8A 3ZXFA 1UF2C 1W2UA 1QJU2 3POSA 3EJKA 1UZZA 3MLJA 3AMPA 2ZHMA 4ITCA 4YVSA 5FOJB 2BFUL 3U37A 5TSWA 4AEKA 1W8FA 3WP3A 2FD8A 5CFDC 2AENA 1CIWA 2YYOA 1YI7A 2PA7A 2D93A 1W6OB 3K3OA 1H2MA 4BMEA 3N7KA 1PIV3 2OZJA 4OQ9A 1GZTA 2WSVA 3MLKA 2YPDA 4DNYA 1EV13 2VU9A 2R041 4R9DA 3GCWA 4IEPA 4AFDA 5LWBA 4HBNA 3D82A 1H2LA 1XYNA 2HWC3 3TBDA 3ZFGB 1BHGA 3HNMA 5K7PA 3VBSC 2ORZA 4N43C 4AFBA 1ULDA 3DPRB 5CZKA 3NJVA 4E8DA 1SBFA 3I8TA 4GAZA 4NIDA 3HT2A 1XC6A 4OYUA 2OX0A 3IMMA 1FX5A 3UGFA 4YG0A 2ZGRA 4NVPA 3E6BA 4HN0A 1Y9GA 3JU9A 3GHNA 1AL23 4UXAA 1ST8A 1W6QA 2AEYA 3OGJA 3VBOB 2D44A 4RQPA 3EQEA 1NCRC 3VB9A 1DZTA 5F6KA 4BE3A 2XBO1 1X8EA 1C3HA 5A3NA 1RUE1 1JYCA 1UY1A 1FMD1 5H9PA 1AR82 4IEQA 4M3CA 4QX2A 1PVXA 3MBWA 4INDA 1WBFA 1D2QA 3RZKA 1C8NA 2WNEA 5ERLA 4K40A 4BXFA 1H4HA 2BNOA 1QU0A 1XE0A 2VMDA 2NMNA 4QU1A 3WSOA 2WFPA 1JZ2A 3WVJA 5IVBA 1PX4A 4GZ9A 1JOJA 3CZUA 2FBEA 4UT5A 4W6XA 3FUQA 2C9KA 5FK7A 1AJKA 2BGOA 3K46A 4PIZA 3D5OA 4TN7A 4XVHA 3PVNA 4YARA 3QOPA 4OZXA 1GQHA 4YM2A 4UFHA 3T3YA 5JOXA 4LTAA 3E5QA 1G86A 2VOVA 1RUJ1 5FYBA 1AL0G 3UJOA 3H8OA 1H1IA 1WGPA 3FL7A 1RITA 2ZHNA 2AEZA 1F2NA 1JOBA 3K51A 3MFCA 3NNMA 5FZ4A 5FZ9A 5KXEA 2AH2A 3CU7A 2C24A 1UKGA 3GHMA 5D8AA 4AR2A 4Z2AA 2HWF2 2VNVA 4R52A 4YG3A 3WNMA 2XVKA 2O8OA 5J37A 2HWE1 3FHQA 3WF4A 4RR3C 4DPNA 4LHLA 2ET7A 4YVWC 5BNOB 3ZFGC 4R9CA 4Y33A 4KWUA 3LFMA 3ELNA 4LKFA 4FFFA 5FY8A 4LBMA 2Q0AA 1F15A 1LODA 2XBO3 1YQ8A 3SISA 2WS91 4LBJA 4KG8A 1OKQA 5A1LA 5C8WA 2W68A 4C0HA 1OA3A 4S2HA 1DCSA 1XSRA 2WABA 4QDRA 1ZRDA 1XSQA 1QGLA 4NPRA 1POV1 4WM7B 5CKQA 1ZA4A 2YFUA 3POBA 4PJYA 4AE2A 3VD3A 5IK8A 4ZZ8A 3HN1A 3VBRB 2NPIA 3BTYA 1LCLA 4H3WA 1W8TA 1W0OA 2IXKA 2B46X 5F3EA 3M2MA 3RYKA 5ACA1 5IWFA 2D97A 4ZU5A 2JDPA 3FC0A 5EQUA 2HYKA 3KVBA 1ND2B 4GJYA 4DIQA 1V9U3 1CESA 5LBEA 5L19A 1Z7S3 1UU4A 5KHJA 4PHZA 2HEWF 3Q8AA 4I3PA 4Q5OA 4BMBA 2VH9A 1AX2A 1BVVA 1JTZX 2RVAA 4IGPA 4XYXA 1MEC1 2E53A 2E26A 2BV4A 4PBOA 4UW6A 4OHYA 5FK8A 1NUKA 1YCIA 4XUNA 4LOTA 5IAVA 3HAGA 3ETQA 4EN0A 4QPIB 2YBKA 2ZOEB 2AC1A 1BEV2 2OW4A 2ZAAA 1E5HA 5FMOS 3T2OA 1EV12 1K5MA 3LIGA 2VAUA 2VULA 2W2IA 3DCQA 3D0JA 4AQSA 1RVF3 5JWPA 1J1LA 1JZ7A 1TMF1 4XJUA 5I93A 1FI2A 2JDZA 1X9TA 5LA2A 2GAUA 1H9WA 3TOJA 4BQWA 3M3OA 1G7YA 1E57A 1QJX2 4LIVA 4C1WA 3SH3A 2XLGA 4Q0QA 4AW7A 1KJLA 1YO8A 2A6YA 4I30A 4PDWB 2C4XA 2Y38A 3NVCA 5A3LA 2HWF3 3GALA 1XXNA 4CXWA 1ZBE3 2VR4A 4QB6A 3H8UA 3SCHA 1F31A 2H6CA 2PAMA 4BQXA 1I9RA 3R4SA 4UI9L 3AZZA 2OKXA 3THTA 1ULOA 5AC92 3A0NA 3IBMA 3KHCA 5JVVA 1CZSA 2C1FA 1OVPA 3MF9A 1WMDA 3M3IA 1SACA 4YW3A 3FMGA 1EPWA 1YWKA 2ENRA 4D0QA 2WQ8A 2GC1A 3WQ0A 2D5HA 1LB2A 3WDVA 1YXWA 2JECA 5J36A 2ZGNA 4CCKA 1BCXA 2QUOA 1IOAA 4CU9A 3KM5A 1GBGA 4Q4X1 5L7OC 1UQXA 5FPUA 4IEVA 4CCOA 1HQWA 4NHMA 4B8EA 2OXBA 1VBC3 1WMFA 2NM1A 1OPOA 3ZYBA 5J3UA 5JAXA 2R7EB 1B35B 1UWWA 1SCSA 4QQHA 4UBGA 4XFBA 4LO4B 4U2AA 2JKBA 4WM7C 1OD5A 2W92A 2RMU2 1PGSA 2EIEA 1UYPA 3NMBA 1QXJA 3ZVXA 3RZHA 4IGQA 3KQ4B 4Y5TA 5JZGB 1FV2A 1TME2 1JYTA 4QX0A 5HCFA 1FT9A 4YM3A 1PZ7A 2EVXA 3DECA 5CFCC 1MS3A 2RMU3 4A42A 1CX4A 2CAUA 4RN5A 5F7UA 2QQVA 1XQNA 2XOMA 3N35A 4QQ2A 3UV9A 3B01A 3KVAA 4XDOA 1X8MA 3O7OA 5LEJA 2DUQA 1CIYA 1QIQA 4W8JA 4YW7A 5A7WA 2ADDA 3I3DA 4TWTA 4URTA 2WFF3 2WRAA 1GICA 3HOBA 4JGZC 1K12A 2HWD2 5JOYA 1V6OA 1OLRA 2N7GA 5JUVA 1I3HA 1SHWB 1OOPC 5LK7B 2H0VA 4FPGA 1AJOA 1WUVA 1MZFA 3TB0A 1H8VA 1NYWA 1QJY2 2F4LA 2VUCA 2ZX1A 3VKOA 4AAXA 3RVHA 5KC6A 4RQPB 3I2OA 1JZ3A 3POFA 5IK5A 1ENSA 3CZJA 1C8M3 4D8MA 4YZ3A 4V1PA 3A7QA 5C3QA 3KCYA 4HKWA 4LIUA 4BIOA 5FYHA 3WP5A 4KH9A 2E32A 1A8DA 2Y64A 1YFXA 4Q2FA 5DXDA 3B3QE 1MEC3 4IEUA 3SC7X 2RDNA 3ZSJA 1L7LA 5A80A 2ZAHA 2WINB 1LOBA 3I49A 4NMIA 1JN2P 1Z7S1 4FPOB 2VQAA 5F9TA 1XBFA 5L36A 2XHNA 4KGGA 2R1BA 3DKWA 5LA0A 1GZ9A 3AC0A 5GKAC 4L8QA 2DVDA 1D7PM 2JG8B 2UWAA 5DG2A 5C4WC 3LEMA 2PFWA 4XW3A 3SQOA 4OFGA 5JZGA 5KHKA 3DXTA 1W6OA 4TLFA 3HMYA 1C4RA 1GYKA 1RUF1 1R081 4LUMA 2IXHA 2JDMA 4AVSA 2A6XA 2HWC2 4D94A 2WO7A 3CLPA 1W9WA 4HT1T 2Y6LA 3VZMA 4EJRA 4XF9A 3U4XA 3OYWA 2OVUA 1COV3 5DDJ1 2AYHA 5FIXA 5DPNA 1F4HA 2XHKA 4QKFA 4W6YA 5FPZA 2A3XA 5I8SA 3USSA 1YIPA 2DBNA 4DINB 2W47A 3RSJA 3B7MA 1WW6A 2G9ZA 4NJ4A 1YYNA 3DYMA 1HJFA 1ZBA1 1AR71 5CKNA 2Q1MA 4QPGA 1K3IA 4LK7A 4YM0A 5AFBA 3SKVA 2CNAA 2RS31 1NZCA 1YJLA 4GWMA 1RMU1 4HLTA 1JU4A 3AM2A 5FJHA 1L3JA 4Q4W2 3PTYA 1TG7A 1ASJ1 3THDA 4Q4X2 1AVBA 1U0AA 3SH5A 1UU5A 4LK6A 2VTXJ 4JQRA 4MHUA 1ZX5A 4EZ4A 3AP9A 2E33A 3GBFA 4BPZA 1J59A 3CL1A 4WVZA 1Y4WA 2WFF2 1JW6A 4IE0A 4ZPIA 5E1RA 5K4LA 5C3RA 2EIDA 2CU5A 3NAPC 2DCKA 3WG4A 3WF2A 1CAWB 1RUD2 3VDDA 1RUJ3 3OBZA 2A73B 4OI2A 4CDWB 4NPLA 1F35A 2JENA 4CDQB 5A1FA 5FV3A 3EBRA 3AFKA 1T6GC 4HONA 3NKGA 4AEDB 1FOD3 4XACA 4DXTA 1BBT1 1OI6A 3U07A 4JGYC 3SKJE 3I2FA 1OFSA 2Y6FA 5A32B 5F3GA 1REDA 3H42B 1MZ6A 1ULEA 4L9BA 2VZTA 1W8OA 2BJSA 4XDQA 2ZCWA 2G9GA 2RS51 3OBTA 5LATA 1RXGA 4CDUC 3UETA 1LHNA 4E4HA 5CISA 5F37A 3N9LA 1NLSA 4N43A 1ZZ8A 2Q5TA 5IVFA 3KLSA 5GZGA 4NRQA 3KCCA 5B2GB 1W28A 5DAXA 5CIRA 1CD3G 3AP4A 2E7TA 3LA2A 5HXVA 2PHTA 2VOTA 4QX1A 4XJAA 5F2WA 4BWOA 5F1RA 5KXCA 3AXEA 3I2JA 5FBJA 4ASLA 2WZEA 4LHNA 3CEWA 3I59B 4MXWB 4CCNA 4JTOA 3VKFC 1AL21 4P9LA 1OVSA 4AVAA 1NCRA 1YEWA 1ZNPA 2BBAA 1BKZA 4XDPA 3BUCA 2R6QA 4LBOA 4COYA 2VMGA 2EXIA 3FLRA 1COV2 3ILFA 1NE4A 2FZ2A 3IIAA 5LASA 2AGSA 2WWSA 3LA7A 2D7FA 4XBNA 2VCCA 1S2KA 3LGRA 5FWEA 5IUQA 1D4M3 5T52A 3VBHB 2Q30A 2UWCA 4HMZA 1QMJA 3EYPA 4WM7A 5CG8A 2MHFA 2Q1ZB 2DCYA 2W91A 1OURA 1AHSA 1SLAA 1U5IA 1ZBA3 2R043 2XVGA 2ZTNA 4FI9A 5J98B 5C33A 5DABA 3RGBA 1KFXL 1H8TA 1RUF2 3NJYA 1FMD2 1Y43B 1AYN3 3NV2A 4AVCA 4EWDA 2FDGA 2QQLA 1VJ2A 1K5MC 2FDIA 2WT1A 4XTMA 5CBLA 2XPJA 1WCSA 1MVQA 4KL1A 2R072 1AR81 5CFCA 4M01A 2D3PA 4PLOA 1D0GA 1O5UA 3GM8A 4NAOA 5FZBA 1VMHA 2Y6JA 3OUJA 1RUJ2 1RINA 5IJRA 5EXOA 4JRAA 4BK5A 2ZEWA 4M0HA 3FUOA 3J8F2 4NOTA 3AL6A 3CIHA 5KHGA 4A6SA 4X6RB 5A33B 3VUOA 3ZXDA 4CP0A 1ULGA 2WNUB 1GP6A 2WWJA 3AZVA 4E4SA 3WHTA 2W1SA 4TSVA 2QQKA 3JBG2 3S57A 1KD7A 1ZM1A 4QD2A 1W2AX 3MIBA 3WR0A 4Y5SA 2PELA 5GZFA 2RS32 3K75B 1ZRIA 1WLCA 1YUDA 1ENQA 2BGPA 3ABZA 3DYPA 4MOAA 3SEPA 3VL8A 4EZHA 3BIEA 1S55A 3R05A 4OHVA 5AFEA 1W03A 2R062 1AZDA 3WHUA 2ZGUA 1OHFA 1SPPA 3N7LA 1AXZA 3UKTA 3VBSB 4YYOA 1HN1A 5I0DA 1AR72 3RI9A 3VBHC 2DVAA 2IUWA 4FOWA 3TEYA 1LHUA 2BFUS 2BUKA 3I2DA 4OHWA 2DVBA 3PUSA 5FYUA 3D0SA 3VDBA 4FFGA 4LHSA 3ME2A 3ROUA 5FWJA 1E5SA 3I97A 5GZEA 5A3WA 3UYJA 3BALA 4DY5A 5LK5A 5FKBA 1O7FA 3ZN6A 2KM2A 2EXHA 4AEDA 3V0AB 3FN9A 2ZBJA 4M4RA 1D0HA 2CYFA 5T50A 5BY5A 2WFF1 1ND2A 1NOVA 1LU2A 1GNYA 5JLVA 4PLMA 2FCVA 2DCTA 4Q8LA 4RFT0 5A33A 4I02A 1PVC3 1LGBA 2CTVA 2DU1A 2ARBA 1URXA 3H1YA 2X10A 3KD4A 2A71A 4N9HA 2YGLA 4Q4W1 5FYYA 3VDAA 1W9YA 3BU0A 1CAUB 5IW0A 5CFCB 5IVEA 1EPZA 2VXRA 2PTMA 3ZMOA 2UURA 4PIXA 1UZWA 2PHDA 1YHFA 5DAQA 2VMIA 3HQXA 1W90A 2P2KA 4JAAA 1YQ2A 4CEYB 5HV0A 2ZGMA 1A6CA 2KD7A 4DO0A 1HB2A 2GNMA 2JWPA 4FPEA 4A45A 3KT7A 2J1EA 4AHZA 2K46A 1VRH1 1H6XA 4CU7A 3T0DA 5IK4A 4YRDA 3QD6A 4DRVA 2P6CA 4LO5B 5APAA 3WOGA 4YFWA 3HQRA 2XUMA 3HD8B 2RR13 3O0WA 5I0UA 5T5JA 3OGRA 2HWB1 2BNNA 2CDOA 2GNTA 3BB6A 3FBYA 5FZ7A 1JZ4A 1H1MA 1U5YA 3IM0A 2YBPA 2ZACA 3PVOA 4YG6A 5AVAA 3KF3A 2XGXA 4YW2A 1ONAA 4JTNA 5FLHA 5GALA 3UL2A 4XJZA 1UD1A 1YNAA 4LITA 1UX7A 1ZVFA 2HKXA 5IAXA 3AMNA 5C71A 1WCQA 4EE2A 4ONUA 2ZGKA 2ZX3A 4C8DA 1GP4A 5DUVA 4SBVA 2GC3A 3AXDA 4YZ2A 4Y4RA 3JQWA 2QCSB 5FYZA 2ZS6B 3WY6A 3GJAA 4CUGA 5HV4A 3B9CA 3BYWA 4WVMB 2BGCA 3K48A 1NY71 4FTSA 2CGOA 4UFLA 3VDDB 3RNSA 3SMHA 4N7UA 5E8AA 3ZSEA 1IPJA 4W65A 3ZFEC 4JRLA 2WAOA 4G4FA 4YLZA 3IN9A 4HG6B 2IXJA 1VBE3 3WUDA 4AK3A 1BMV1 1C28A 5BNQA 5LRRA 4DMIA 2QDNA 2KXLA 4A4AA 2UU8A 4E8CA 5C9AC 5A3OA 2HWB3 1ND2C 4D6QA 4LA3A 4YGCA 5I8TA 1LULA 1ALYA 3NV1A 2EALA 3LE0A 5T5LA 3ZLIA 1UN1A 2WO1A 4CDQA 4P5YA 1WWYA 4Q4Y1 3WV6A 3CDZB 4CCLA 3DV8A 4JVAA 2HH9A 3WINE 1CAWA 2WN2A 3F2ZA 3J8F1 4IETA 4QHBA 5LY1A 2DF7A 4XFFA 5EZWA 2R061 1TME1 3WDUA 1SEFA 1VBA3 3RYPA 1P8JA 1PGW2 4FQZA 2CSGA 3VBHA 1CAXA 1O4YA 4U36A 4M0NA 5C6CA 2Z79A 2RM21 2RS13 3UK9A 5C5UA 5FOBB 1WW4A 2ES3A 2BZDA 2ZA9A 3FWEA 4V2VA 1S2BA 3RDIA 2ZHKA 2PAKA 5EYYA 1V9U2 1VBB1 2FCTA 3C8XA 3ZFEA 1RC6A 3NWKA 4AEDC 2BW8A 3P5BA 2P3KA 3I59A 1H0BA 2DUPA 5IK7A 3CJIB 2VBDA 1POV3 3OEAA 2WLQA 3I3QA 5FP3A 5LBFA 4JKMA 4CXXA 2B42B 4XUPA 5BNNC 4NIHA 1KS4A 4KWKA 4NO4A 1GANA 1BEV3 2WS93 3HWJA 4HANA 2E6VA 2P4EA 2AZ5A 3KV9A 3BKZA 4NIGA 2A3YA 1MZ5A 2TBVA 4HPKA 3NNJA 1CAVB 3VL9A 1WW7A 5GLUA 1QNWA 4Q0VA 5F39A 4AEMA 2OPKA 2YUEA 2DBIA 3E97A 3MGUA 4XZUG 1NG0A 2BEOA 3NQHA 4XOGA 4Q4V1 3TNQA 2YPJA 1FYUA 4YW4A 5CB7A 3NRUA 4GWNA 4R4XA 4RHV2 1CX1A 3IZOA 5FZOA 1DP0A 1UIJA 5IT6A 4P9JA 4K20A 3OGGA 5C4WA 1FPN1 4JQTA 5A6XA 1QOTA 4H7MA 2HEYF 2PLV2 4UW5A 4JX0A 1CWPA 5F32A 4Y26A 1H1AA 1RL3A 2LROA 5FYTA 4LUKA 5BNPB 1FATA 3RZZA 3IT8A 4EV0A 3S6PA 5IFTA 4MXVA 1JYNA 1RJ8A 1N1YA 5FZ8A 1NLQA 2VW0A 4PDWA 4BQ1A 3O1PA 1GWKA 1R1A1 4GH4A 5DUUA 2DDUA 5L9BA 3W21A 1OUXA 4OUEA 5EIYB 2LUWA 2QDRA 3OCPA 1HLCA 3CO2A 1O59A 5FZOB 1SLBA 3LPGA 3WX5A 4RSUA 2DUOA 4EWEA 5FPAA 3U1XA 2ETEA 2QQWA 2VZOA 1K5MB 3HN3A 3VZKA 2ZPXA 3ZYGA 4DFSA 3KV5A 1O6UA 4FPYA 1UL9A 2J1UA 2TNFA 4MGQA 5JXJA 1LOCA 5DDJ2 2CGPA 2DTWA 1O8SA 5JPNB 4MZUA 5J7MA 4ISQA 4LBLA 4Q1PA 5A7WB 3N4MA 2NQYA 3FZ3A 3KF5A 4AFCA 2RS12 4XILA 5HCBA 1BMV2 1JUHA 2Y60A 3A0KA 4Y1UA 4FPCA 4LBNA 4BU2A 2ARCA 3O1UA 4XUQA 3S5QA 2IXIA 1YQCA 3H0OA 1OKOA 3MIDA 3RZJA 2BYVE 5L9VA 3VBOC 2ZMKA 1MVEA 2BDRA 1AR92 1HW5A 4MGSA 1RYYA 2YC4A 3ES4A 3JB8A 4IUGA 4CPBA 1NCQC 4O7XA 1H8TC 2BNMA 3MIFA 5JSPA 1CQ9A 2JG8A 4B7KA 1F5FA 5CFDB 3FLTA 2GZWA 4GXLA 4QB1A 5T54A 2WDBA 4LR4A 1CN1A 2UY8A 5FY7A 2VZRA 1PNGA 3MHZA 5D21A 4P9GA 5C8CA 2NP0A 5E89A 5CEHA 3ACGA 3P3NA 3QACA 4XMIA 5DN2A 1JUIA 1KQRA 1EV11 1O5LA 3TN92 1MS9A 2XJRA 1XNDA 4R8HA 2ZMNA 1OPMA 2J1RA 4QXCA 3M3CA 2V5YA 5A7NA 3MUY1 3OOXA 3DEMA 4DZGA 3ZN6B 3RJRA 5GLTA 4XJ8A 2BWAA 1K5JA 3JD73 1NE6A 3KT4A 4IDZA 4XJWA 3SCFA 4D3WA 4DY3A 1RB8G 3C7FA 4ZY9A 5A7PA 2XR4A 3PUAA 1PK6B 2YGMA 4ZKTB 1NA1A 1SLIA 1BBT3 2X5IB 4FOYA 4AFMA 1JI6A 3LEGA 2Q8CA 3ZN5A 4BDVB 4L92A 5FP8A 2WR9A 3T30A 1R1A3 4QM9A 3T4HB 4E27A 2PHRA 5CA6A 5C9AA 5FZ6A 4Q0UA 2CY6A 1REFA 2QQUA 3BOPA 1UOJA 4P14A 3USUB 3OB8A 4OULA 3WCSA 3Q8BA 5LBBA 2IVIB 1W8WA 3BPSA 1DGRN 2YB7A 4JGYB 4M3CE 5FZEA 5FZLA 2VBBA 1LKNA 2VMCA 2IFRA 1YLLA 4H14A 4P00B 5E16A 3OPTA 1UOBA 2ZHLA 4PF5A 2NMOA 3I2HA 5FO7B 4Q4V3 1OA2A 1DGWA 4YW5A 1WD3A 2JDAA 1EAH3 5A7QA 3I3BA 3VKNA 5C9AB 4LA2A 2VCBA 3LF7A 1T6BX 1GP5A 4B4RA 3WP6A 4PDWC 3H1MA 3LSEA 2WNVC 3VD5A 5BUVA 1KITA 3AP7A 1IKPA 1EUTA 1L7QA 1W2NA 2Q1FA 2JD4A 4QMAA 4BOWA 1NA1B 2X5IA 4LLFA 4BQYA 2PMWB 2ZGOA 3UJQA 3WP4A 1SBDA 3KZ4C 2Y26A 4XFAA 1HRV1 1SQ4A 3IDAA 4V2WA 5FYSA 4NRMA 5AC91 4BXSV 4CDUA 3T2PA 1W6QB 4YPJA 5IVVA 4N53B 1YQ5A 1SCRA 2WL1A 1GOFA 4YSFA 4Y22A 3B02A 3OPWA 4G3YC 4OI4A 4RS5A 4P08A 4XUTA 4FPJA 4IEXA 2O14A 1CPMA 3DPRA 3NL1A 2OQ6A 3WT3A 1N1VA 4XMAA 2ET1A 1HXS1 3PJYA 5FXVA 4COZA 4LO6B 4HZFA 4S2FA 3BTZA 5FYIA 4Y22B 4CUCA 2VD7A 1LOFA 4E9KA 3T09A 3MIGA 2D5FA 4MH0E 3ORJA 3SITA 3QH7A 4NHLA 1YFWA 3MYXA 3H3LA 3N3HA 2UYAA 1JU3A 4Q4Y3 3S0MA 3N9OA 4TYSA 3D8CA 3BI3A 5BNOA 1AR91 4H2AA 1PMIA 1TNFA 2QFEA 3VBUB 3ZPOA 3DYOA 5FKCA 3ILNA 3HR9A 1ENRA 1DF0A 1FXZA 1UY0A 4X8PA 1C8M1 3ON7A 4XXAA 4A3XA 2YY1A 1GQGA 4YM1A 2DVFA 2YFZA 3LIHA 4LNVA 5H9QA 1POQA 5ANQA 2XONA 2WO3A 1JS9A 4CEYC 1QEXA 4BA6A 5L9RA 4LO8A 1V70A 3N7MA 3WZ1A 1A78A 1ZYBA 1IS3A 3MEPA 1AR93 1QJEA 1WMEA 3ZM8A 3IPVA 1BYHA 4IE4A 1Y9QA 2WYSA 4ZHNA 3FJSA 1WCUA 5CYYA 1W0NA 4RQPC 3TNPB 2WIIB 2HWB2 2OUJA 4I09A 4QAWA 4CP9B 4URAA 3DKQA 3WXPA 5LA1A 1BLZA 2O8QA 4NHKA 4OI1A 1SFPA 2Q8OA 3RWKX 3OBRA 3JCIA 1L7RA 1J83A 3ES1A 4OLLA 1UIKA 5ANNA 1V00A 3A23A 4L11A 1AX0A 1RXFA 4XEZA 4CDXB 1VRH2 1VB4A 2FQPA 2WZPP 4QU2A 3WDTA 2DYCA 4OUMA 1RTVA 2JB8A 4I3GA 2XJQA 4PI0A 4XETA 4J1WA 5GJ6A 4XQDA 2R49A 1PGL1 2TUNA 3NNLA 1R64A 3W9AA 3WF1A 5HPOA 1X9PA 1JYXA 1V6KA 3Q8EA 3VZOA 1QQP1 3AMHA 4EN8B 4FTEA 3J7NA 3VBOA 4KI5M 2XWJB 1GWLA 2D6NA 4UF0B 4LE3A 2FMYA 1LAJA 5JXGA 1DZQA 4OI0A 1Q43A 2HJIA 1UXZA 2VZSA 2P3JA 3M3QA 1RUG1 1E5IA 2Q4SA 2VZUA 5FZDA 3OYWB 3ZFFB 1GWMA 1VPHA 2IZWA 3WQ1A 2R0HA 2A70A 4TTGA 3ZFGA 1S0JA 2V73A 3OGVA 3U75A 3W5MA 1UU6A 3TN91 4KU7A 4JV4A 1V6IA 4QQLA 3TRSB 2WN3A 4OZOA 5FYVA 3S7EA 2W46A 3ZXJA 4BCUA 2KR2A 4CUBA 4PQQA 5D2AA 1Y7BA 5E88A 5K0UC 3M1HA 2EF6A 2BP6A 4JCKA 4ZU4A 1J3QA 2X53S 3UGGA 1WLTA 4H7LA 1S0EA 4XBLA 2RM22 4IESA 2D3SA 4Z07A 2GDFA 1W6NA 1ZZ6A 1HRI1 2VVEA 5F2SA 4AYUA 1TMF3 4ES9A 1GNHA 2R30A 1SLTA 4IGOA 4Q0PA 4F3JA 3DPRC 3WF3A 3O1TA 1W2TA 1D4VB 1JYVA 4AI3A 2O1QA 2E7AA 1J3RA 1BQPA 1AYM1 1ZBE2 2VUAA 4L99A 2DWRA 4XXPA 2XKPA 5FDBA 3JQXA 4IV3A 5FYMA 5CG9A 2QQNA 2E7QA 2ID4A 1X33A 1C57A 1NXMA 3SLIA 1VBE2 3VBFC 3VGIA 5ABJC 5JDBA 4XHXA 2NZ9A 4OVEA 4XF3A 1VMFA 2H0BA 5FQ0A 5FY5A 5C70A 3BU7A 2JB4A 1V9U1 2GMEA 4RR3A 2E31A 1QQP3 3IMNA 3NO8A 2C5DA 1Q8SA 3V56A 1NCQA 2Z4FA 2XJUA 4A7KA 1M06G 1QQP2 4XF1A 4DEQA 1ZZBA 4N8MA 5CNAA 3I7DA 4A41A 2GNDA 2ORXA 4BZ4A 2LW8A 1NXD1 3NV3A 5JMOA 1R093 2AREA 2D3RA 4UFMA 3OD4A 1DYPA 2BOJA 3MW4A 1R092 1B35A 1Q5OA 3BN6A 1WZXA 2RJKA 3FFZA 3OY8A 1DFQA 1ND3A 3C7HA 3HQUA 4UAPA 4FOQA 2PXJA 2GN3A 4MGIE 1IS4A 1OF4A 2JDHA 2XL9A 3VHOA 1ASJ2 2P34A 5KR7A 1W6NB 2XWBB 2ZEYA 4YVSB 3O14A 5GZDA 5JOWA 4CDWC 4QX8A 2F4PA 3ZXEA 2HWE3 2VOKA 2VZ3A 2PN5A 3A4UA 3AZWA 1DU3D 1QOSA 3B9IA 3VBUA 4EWAA 1IZ3A 4LBQB 3CJIA 3VBFB 4XIKA 3OD0A 3PNAA 1XE8A 1G9DA 5C3SA 1H2KA 4XAAA 3AJYA 1E5RA 1KDKA 2C0ZA 2YZ4A 1DZRA 4XAEA 1TE1B 1F8VA 1UY4A 1F9KA 4LBKA 1QF3A 4OHXA 3AP6A 2A6WA 2W1UA 1YFUA 1W39A 2XXZA 1NCQB 1PGW1 3ZKUA 3LDKA 3WDXA 5JCTA 4O61A 4AHYA 3HNBM 4P02B 4QPWA 3O1VA 4QXHA 5D1IA 2XLAA 2WT2A 1DGWX 4JDNA 1AYN2 5FQ0B 4ORFA 1JOPA 4ZU7A 4CP9A 4FBFA 4D6SA 3ZO0B 5JXIA 3LSDA 3V0AA 2IXCA 1MQTA 1RUH2 2WC2A 1FMD3 5KHIA 3GZTB 4CUAA 1GMMA 1ULCA 4NROA 2Z2SB 3UKVA 3WNKA 3O1SA 2VCMA 3JZVA 1PHMA 4QX7A 4F8AA 3ETPA 2RS52 4C0BA 3VHPA 1XE7A 1VBC2 3RMYA 2I07B 3BTAA 3JB4C 1AX1A 4OUSA 3ZYRA 2SLIA 4UWDA 5FUIA 1UYYA 4YVWA 1CJDA 2J7MA 4GD4A 4MG2A 2ZMLA 3MIEA 2WJSA 2UY9A 2R1DA 1UYXA 3PVBB 3LKJA 5HCHA 4R9BA 3WNPA 2VZQA 2DFCA 1VBB3 1MS0A 1GR3A 2B39A 3E1F1 4WBBA 1UCXA 1GZCA 3S5AA 1CONA 1APNA 1HKDA 2WZR2 3GZAA 3H7JA 2RM23 4A2UA 4CEWB 2QQJA 3POIA 1XJAA 2JEMA 4O9EA 1PMHX 1HDKA 1RUG3 4UYBA 4XTPA 4ES8A 1AR73 4BM8A 3V0BB 2R063 3OJBA 4GH4C 4Y20A 3TEXA 5E6HA 4TZDA 4A7YA 4LULA 3WD5A 1S2EA 2E9QA 3D6EA 5C3OA 5JIAA 1J84A 1HRV2 5IVCA 4N53A 3WW1A 1GU3A 3ZIXA 3J7MA 3MIHA 1C5IA 1WA4A 1OUSA 1X7NA 4QHZA 5A7SA 1R083 4YGBA 2JG9C 2R32A 3MFAA 1V6MA 2YC0A 3AFGA 2JE9A 2O0OA 4YZ1A 5J48A 1NAEA 1VE0A 4QPYA 5KXDA 4A6OA 1W8UA 5DZFA 1B09A 1VB2A 1S0GA 2F6BA 2GC0A 2JE7A 1NZIA 5D8AB 3S30A 1LNSA 3ENRA 4FXKB 5FZGA 3V0BA 3NJZA 3HEIA 4I0BA 1CAUA 3CJIC 4FCAA 4B7EA 3W5NA 4M4PA 5FMOL 3FX3A 3RRDA 1HB3A 3KV4A 1KXGA 1XNTA 2XL7A 5CFDA 1QJU3 2W08A 4UFIA 4NN0A 5FZIA 3THCA 2H6BA 4X6QB 1VLNA 1ZA7A 2P6HA 1XYPA 3IB3A 1W8HA 4MGYE 2Z69A 1A34A 4Q27A 3NAPB 3K2OA 4W6WA 3EHKA 1V6JA 4XF4A 1DYKA 3NJXA 4NPMA 2GSYA 1J1TA 3U11A 2G1MA 3UKNA 1G9CA 4HVOA 3LFIA 3N9PA 4PF1A 2RR11 3AVSA 3EB7A 3HNYM 2YU2A 3PDQA 4M3CF 3I4IA 5GLWA 1PO11 4M3CB 2YMZA 4IXLA 3FLPA 1MQTB 3NKTA 2RHPA 2VXJA 3H50A 4UOJA 3RFRA 4B29A 1C8M2 1IQAA 3GZUC 4NHXA 1DLCA 2WZR3 2VBPA 1K42A 2XB6C 2HWD1 2RMU1 5LZ6A 2P3YA 1HXS3 4B4PA 3AX4A 2I74A 2IFWA 1LEDA 1UPIA 3AYEA 4NWWA 5ABJB 3ZXAC 3OTFA 3H3UA 2FCUA 3VBRA 4RL7A 1R091 4Y1YA 4QWNA 4M00A 2D6PA 1PO22 1QJX3 4MX3A 4C90A 1G9AA 4WV8A 3GGLA 4W50A 2I2SA 3EMRA 3VDCA 1PVC1 2CWMA 5FLJA 1VBC1 4MUVA 3M7AA 5C8CB 5A70A 2K0GA 1KS5A 2ATFA 1DG6A 5LRSA 1UZ0A 2B7YA 4JZRA 2JG8C 5C4WB 3U0ZA 2Y6GA 4HVRA 3J26N 2QVSB 3ITQA 4HXCA 4RHV1 4NIIA 3V64A 2XJTA 4AWDA 3WNXA 2KA3A 2J1SA 4YFZA 5I91A 4L97A 5DG1A 1UZVA 2WWUA 1V6LA 2VZPA 3LAGA 4ZS3A 2ZGPA 2TEPA 3RZLA 3PMEA 1LHVA 1PZ8A 4HPKB 2VL4A 2NLRA 3ILRA 4WZCA 4OHZA 4AI0A 2OQ7A 1R1A2 4Y20B 3R0RA 1SZBA 2VM9A 2PQSA 2J22A 3D4KA 3CBNA 3NW4A 5B4XA 2JDYA 1ZRFA 4XCAA 4Y24A 4Q1RA 2GP3A 2HWF1 3LCPA 1HRI3 4CTEA 2GH8A 2W87A 3HPNA 1S1AA 3A22A 4I2OA 3B5LB 4XZPA 5SV5A 3HIFA 3MDPA 2DTYA 1LOGA 2D6OX 5FRAA 2W5FA 2B9UA 1VALA 3URFA 4P9XA 1G6NA 2F17A 4LLOA 2DURA 4Q4V2 1VMJA 1UY3A 2J1VA 4PCRA 2BU9A 2WS92 2EA7A 1VAVA 3HJRA 5FMCA 4FFHA 4D69A 4BQ4A 3PVEA 3TN93 5F5CA 2D43A 4K7JA 3C3VA 4YWAA 1BXHA 2PLV1 3NV4A 5A1AA 2XJPA 4RR3B 1GKBA 5L7OB 4JDOA 4E4ZA 5ACA2 1XNKA 1MS4A 2K9ZA 1OQ1A 1JODA 2VECA 5FXWA 5LBCA 2MNGA 1QJY3 2HWD3 4JHTA 2ZXQA 2XLFA 1POV0 4XE9A 5F3IA 2VZVA 2JKXA 1C1LA 5M0TA 1OLME 2GNBA 1LECA 4DB5A 1OH4A 3ACHA 3SH4A 4S2DA 1RVF2 3AKRA 4FQ4A 2VNOA 3ZYFA 1GNZA 2RDSA 3KCXA 3VBUC 1ACCA 2XVLA 1MEC2 1CZVA 1DQ4A 3SXWA 3VZLA 3GF6A 2WUHA 1VR3A 2DCJA 3U10A 4TXWA 5F5AA 2W0XA 2P1BA 4K3UA 1RJ7A 4SLIA 1ZRCA 2HBTA 4CZSA 3L2HA 5BNNA 3H8RA 3JBG1 4WVMA 5BNPA 4BYYA 1GZWB 1VBE1 3Q8CA 5FCCA 3T08A 3MV01 4JDMA 2EAKA 4LEJA 2QQMA 1FAYA 1W06A 2HWE2 4MYEA 5I0TA 2VY0A 2W52A 3WLUA 3J7HA
chains in the Genus database with same CATH topology
1D7PM 3IDAA 1PMJX 2EIBA 3WNNA 4A3ZA 1OD3A 2EICA 4BXSV 2W95A 3T2PA 2W3JA 3MUZ1 4YPJA 4XUOA 3WF0A 1W9WA 1GOFA 2Y6LA 1O8PA 3UNPA 4XUTA 4P08A 2V5DA 3MO4A 5DPNA 1F4HA 1JYWA 1SDDB 1UY2A 1JZ5A 2W47A 5EJZB 5DQ0A 4CUCA 2J1AA 3DYMA 3T09A 1K3IA 4QB2A 3SKVA 4DUXA 3P6BA 1JU4A 1JU3A 3MV11 1TG7A 3THDA 3K4DA 4RYDA 3DYOA 1UY0A 2VJXA 3GXUA 3CMGA 2E33A 2YFZA 1JHJA 1W8NA 1UMIA 2VTFA 1US2A 2WO3A 2XONA 2EIDA 4QDQA 2LS6A 1CZTA 2DCKA 3WF2A 3OEBA 3D3AA 5JXHA 1K45A 3ZM8A 2Y6HA 5HXMA 2BERA 4QDSA 2WYSA 5CYYA 4DXTA 1W0NA 3SKJE 3I2FA 5LA1A 4QAWA 4MADA 3WNOA 2VZTA 1W8OA 1L7RA 1ULPA 1XNAA 1J83A 5IFPA 2X09A 4A44A 4JHZA 3UETA 3A21A 4LKSA 5EJ1B 3JXSA 4QX1A 2VOTA 1R64A 1OF3A 3WF1A 5HPOA 3I2JA 1JYXA 2WZEA 3T2QA 3K77A 2VMEA 4KI5M 2BBAA 3FHAA 5JXGA 1IQDC 1UXZA 2VZSA 3LPFA 1F4AA 2VZUA 2VCCA 3EYPA 4TTGA 3ACIA 3OGVA 3W5MA 2W91A 3A23A 2QQIA 1DYOA 3OG2A 4FI9A 2WN3A 4OZOA 4BK4A 4ZZ5A 2W46A 4CUBA 4PQQA 2QQLA 1I5PA 2B9VA 2RV9A 2W94A 4L0PA 3GM8A 5IHRA 2Y6JA 5IJRA 3WF3A 4BK5A 1JYVA 2ZEWA 4W4ZA 3CIHA 5G04L 4ARYA 2J1TA 2W1SA 2QQKA 2QQNA 2ID4A 3LEIA 3ACFA 3K75B 3SEPA 3ABZA 2BGPA 3DYPA 4MOAA 4AG4A 5C70A 3PUHA 1H6YA 2E31A 2ZEXA 3CKHA 3I2IA 1HN1A 5I0DA 2ZEZA 2Z4FA 4CU6A 1NX9A 3I2GA 4XURA 1GOHA 3WEZA 4DEQA 3VDBA 1GUIA 3OGSA 4A41A 2ORXA 4LHSA 3T0BA 2LW8A 2W9XA 5G05L 3I97A 5JMOA 1UMHA 3SEEA 4CVUA 3FN9A 4M4RA 4ET7A 3T0AA 1GNYA 2XQXA 3BN6A 1NKGA 2VC9A 3C7HA 3LEKA 5JR2A 4UAPA 2B4KA 1WKYA 4LPLA 1JZ8A 2X10A 1OF4A 3VDAA 1W9SA 2ZEYA 3U37A 2VZ3A 4DUVA 1YQ2A 4OMDA 2KD7A 4A45A 2J1EA 1H6XA 4CU7A 3T0DA 4QX3A 2WAAA 1GOGA 1BHGA 3HNMA 2ORZA 1OT5A 5C7GA 4E8DA 5CZKA 3NJVA 3OGRA 1JZ4A 2CDOA 1UY4A 3IAQA 1XC6A 2V72A 4OYUA 2W1UA 2HLEA 3HNBM 1W9TA 4P02B 4QPWA 2CDPA 1UX7A 3IAPA 5C71A 1WCQA 2JE8A 5J1XA 5JXIA 1UY1A 4QX2A 4MO3M 2WO2A 1GMMA 3MBWA 3WNKA 4CUAA 1MPXA 4JKLA 2V4VA 3ETPA 3OBAA 2Y8KA 2VMDA 3WNLA 3WSOA 1JZ2A 5FUIA 1UYYA 1PX4A 4GZ9A 2J7MA 2WAOA 3CZUA 2C9KA 2BGOA 3K4ZA 1UYXA 3K46A 4HG6B 3WNPA 4XVHA 2VZQA 4A4AA 4E8CA 3E1F1 1W99A 3LE0A 2C26A 2WO1A 2QQJA 4P5YA 4ARXA 1PMHX 3C7GA 1GQPA 3CDZB 4DXSA 2WN2A 3F2ZA 3FL7A 2VO5A 2X05A 3ECQA 1P8JA 3C7OA 4Z2AA 3WNMA 3FHQA 3WF4A 1J84A 2VQUA 2BZDA 1GU3A 2WBKA 3VD7A 4KWUA 3C8XA 1PX3A 4ZXEA 3BGAA 2W1WA 1NAEA 4PT6A 4A6OA 3OEAA 2VMFA 4JKMA 2WABA 4XUPA 4QDRA 1LNSA 1UYZA 1TVGA 3HEIA 2YFUA 3W5NA 3C7EA 3VD3A 4GWIA 4M4PA 2VQTA 4ZZ8A 1KGYA 1XNTA 4XZUG 3NQHA 3THCA 1UXXX 3NRUA 2W1QA 1CX1A 1DP0A 2WZ8A 3IB3A 3GDBA 4JX0A 3NJXA 3I2KA 2RVAA 5DMYA 2E26A 4PF1A 5IFTA 1JYNA 1NUKA 3EB7A 4XUNA 3HNYM 4KMQA 2DDUA 3T2OA 4OUEA 5EIYB 4UOJA 3VD4A 1O59A 2RJ2A 1DLCA 3LPGA 1JZ7A 1K42A 5LA2A 2L9LA 2VZOA 3HN3A 4DUWA 3I3EA 2J1UA 4MGQA 4OMCA 5JXJA 5B4NA 1JZ6A 1SG3A 1O8SA 3GGLA 2C4XA 4JKKA 4W50A 5LCWL 3VDCA 2VR4A 4QB6A 3VD9A 4UI9L 2OKXA 1T2XA 1ULOA 1UZ0A 2JD9A 4XUQA 1CZSA 2Y6GA 3LQCA 2QBXA 4D0QA 2WQ8A 2YG0A 4MGSA 1RYYA 2YC4A 2J1SA 4IUGA 1EUUA 2VZPA 4CU8A 4CU9A 3K4AA 5IYYA 4QB1A 2VL4A 2WDBA 3WQBA 2VZRA 2VM9A 2PQSA 2J22A 3ACGA 5B4XA 4DEVA 5DN2A 4LQRA 2R7EB 1UWWA 2W87A 3HPNA 2J1RA 3A22A 2W92A 3MUY1 2EIEA 2W5FA 4QX0A 1KEXA 3DECA 3UESA 4A42A 3C7FA 5F7UA 4RN5A 4ZY9A 1UY3A 2J1VA 2QQOA 2XOMA 3HJRA 1JI6A 1CIYA 3LEGA 4W8JA 4BDVB 2Y6KA 3I3DA 5A1AA 3HOBA 1K12A 4GWJA 5JUVA 1SHWB 2ZXQA 2VCAA 3OB8A 2VZVA 2JKXA 3CQOA 4AAXA 1OH4A 3NNGA 2YB7A 1JZ3A 3ACHA 3CZJA 4BJ0A 2VMCA 4D8MA 4P00B 2VZ1A 3A7QA 1CZVA 2HYXA 3I2HA 2E32A 2Y64A 2WUHA 2DCJA 2JDAA 4TXWA 1XPWA 3IIIA 3I3BA 3PUIA 2VCBA 4DXRA 3P1IA 3VD5A 1EUTA 1L7QA 3MV01 3T08A 1US3A 2QQMA 2XHNA 5LA0A 3AC0A 2YC2A 3J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7P M;  3IDA A;  1PMJ X;  2EIB A;  3WNN A;  4A3Z A;  1OD3 A;  2EIC A;  4BXS V;  2W95 A;  3T2P A;  2W3J A;  3MUZ 1;  4YPJ A;  4XUO A;  3WF0 A;  1W9W A;  1GOF A;  2Y6L A;  1O8P A;  3UNP A;  4XUT A;  4P08 A;  2V5D A;  3MO4 A;  5DPN A;  1F4H A;  1JYW A;  1SDD B;  1UY2 A;  1JZ5 A;  2W47 A;  5EJZ B;  5DQ0 A;  4CUC A;  2J1A A;  3DYM A;  3T09 A;  1K3I A;  4QB2 A;  3SKV A;  4DUX A;  3P6B A;  1JU4 A;  1JU3 A;  3MV1 1;  1TG7 A;  3THD A;  3K4D A;  4RYD A;  3DYO A;  1UY0 A;  2VJX A;  3GXU A;  3CMG A;  2E33 A;  2YFZ A;  1JHJ A;  1W8N A;  1UMI A;  2VTF A;  1US2 A;  2WO3 A;  2XON A;  2EID A;  4QDQ A;  2LS6 A;  1CZT A;  2DCK A;  3WF2 A;  3OEB A;  3D3A A;  5JXH A;  1K45 A;  3ZM8 A;  2Y6H A;  5HXM A;  2BER A;  4QDS A;  2WYS A;  5CYY A;  4DXT A;  1W0N A;  3SKJ E;  3I2F A;  5LA1 A;  4QAW A;  4MAD A;  3WNO A;  2VZT A;  1W8O A;  1L7R A;  1ULP A;  1XNA A;  1J83 A;  5IFP A;  2X09 A;  4A44 A;  4JHZ A;  3UET A;  3A21 A;  4LKS A;  5EJ1 B;  3JXS A;  4QX1 A;  2VOT A;  1R64 A;  1OF3 A;  3WF1 A;  5HPO A;  3I2J A;  1JYX A;  2WZE A;  3T2Q A;  3K77 A;  2VME A;  4KI5 M;  2BBA A;  3FHA A;  5JXG A;  1IQD C;  1UXZ A;  2VZS A;  3LPF A;  1F4A A;  2VZU A;  2VCC A;  3EYP A;  4TTG A;  3ACI A;  3OGV A;  3W5M A;  2W91 A;  3A23 A;  2QQI A;  1DYO A;  3OG2 A;  4FI9 A;  2WN3 A;  4OZO A;  4BK4 A;  4ZZ5 A;  2W46 A;  4CUB A;  4PQQ A;  2QQL A;  1I5P A;  2B9V A;  2RV9 A;  2W94 A;  4L0P A;  3GM8 A;  5IHR A;  2Y6J A;  5IJR A;  3WF3 A;  4BK5 A;  1JYV A;  2ZEW A;  4W4Z A;  3CIH A;  5G04 L;  4ARY A;  2J1T A;  2W1S A;  2QQK A;  2QQN A;  2ID4 A;  3LEI A;  3ACF A;  3K75 B;  3SEP A;  3ABZ A;  2BGP A;  3DYP A;  4MOA A;  4AG4 A;  5C70 A;  3PUH A;  1H6Y A;  2E31 A;  2ZEX A;  3CKH A;  3I2I A;  1HN1 A;  5I0D A;  2ZEZ A;  2Z4F A;  4CU6 A;  1NX9 A;  3I2G A;  4XUR A;  1GOH A;  3WEZ A;  4DEQ A;  3VDB A;  1GUI A;  3OGS A;  4A41 A;  2ORX A;  4LHS A;  3T0B A;  2LW8 A;  2W9X A;  5G05 L;  3I97 A;  5JMO A;  1UMH A;  3SEE A;  4CVU A;  3FN9 A;  4M4R A;  4ET7 A;  3T0A A;  1GNY A;  2XQX A;  3BN6 A;  1NKG A;  2VC9 A;  3C7H A;  3LEK A;  5JR2 A;  4UAP A;  2B4K A;  1WKY A;  4LPL A;  1JZ8 A;  2X10 A;  1OF4 A;  3VDA A;  1W9S A;  2ZEY A;  3U37 A;  2VZ3 A;  4DUV A;  1YQ2 A;  4OMD A;  2KD7 A;  4A45 A;  2J1E A;  1H6X A;  4CU7 A;  3T0D A;  4QX3 A;  2WAA A;  1GOG A;  1BHG A;  3HNM A;  2ORZ A;  1OT5 A;  5C7G A;  4E8D A;  5CZK A;  3NJV A;  3OGR A;  1JZ4 A;  2CDO A;  1UY4 A;  3IAQ A;  1XC6 A;  2V72 A;  4OYU A;  2W1U A;  2HLE A;  3HNB M;  1W9T A;  4P02 B;  4QPW A;  2CDP A;  1UX7 A;  3IAP A;  5C71 A;  1WCQ A;  2JE8 A;  5J1X A;  5JXI A;  1UY1 A;  4QX2 A;  4MO3 M;  2WO2 A;  1GMM A;  3MBW A;  3WNK A;  4CUA A;  1MPX A;  4JKL A;  2V4V A;  3ETP A;  3OBA A;  2Y8K A;  2VMD A;  3WNL A;  3WSO A;  1JZ2 A;  5FUI A;  1UYY A;  1PX4 A;  4GZ9 A;  2J7M A;  2WAO A;  3CZU A;  2C9K A;  2BGO A;  3K4Z A;  1UYX A;  3K46 A;  4HG6 B;  3WNP A;  4XVH A;  2VZQ A;  4A4A A;  4E8C A;  3E1F 1;  1W99 A;  3LE0 A;  2C26 A;  2WO1 A;  2QQJ A;  4P5Y A;  4ARX A;  1PMH X;  3C7G A;  1GQP A;  3CDZ B;  4DXS A;  2WN2 A;  3F2Z A;  3FL7 A;  2VO5 A;  2X05 A;  3ECQ A;  1P8J A;  3C7O A;  4Z2A A;  3WNM A;  3FHQ A;  3WF4 A;  1J84 A;  2VQU A;  2BZD A;  1GU3 A;  2WBK A;  3VD7 A;  4KWU A;  3C8X A;  1PX3 A;  4ZXE A;  3BGA A;  2W1W A;  1NAE A;  4PT6 A;  4A6O A;  3OEA A;  2VMF A;  4JKM A;  2WAB A;  4XUP A;  4QDR A;  1LNS A;  1UYZ A;  1TVG A;  3HEI A;  2YFU A;  3W5N A;  3C7E A;  3VD3 A;  4GWI A;  4M4P A;  2VQT A;  4ZZ8 A;  1KGY A;  1XNT A;  4XZU G;  3NQH A;  3THC A;  1UXX X;  3NRU A;  2W1Q A;  1CX1 A;  1DP0 A;  2WZ8 A;  3IB3 A;  3GDB A;  4JX0 A;  3NJX A;  3I2K A;  2RVA A;  5DMY A;  2E26 A;  4PF1 A;  5IFT A;  1JYN A;  1NUK A;  3EB7 A;  4XUN A;  3HNY M;  4KMQ A;  2DDU A;  3T2O A;  4OUE A;  5EIY B;  4UOJ A;  3VD4 A;  1O59 A;  2RJ2 A;  1DLC A;  3LPG A;  1JZ7 A;  1K42 A;  5LA2 A;  2L9L A;  2VZO A;  3HN3 A;  4DUW A;  3I3E A;  2J1U A;  4MGQ A;  4OMC A;  5JXJ A;  5B4N A;  1JZ6 A;  1SG3 A;  1O8S A;  3GGL A;  2C4X A;  4JKK A;  4W50 A;  5LCW L;  3VDC A;  2VR4 A;  4QB6 A;  3VD9 A;  4UI9 L;  2OKX A;  1T2X A;  1ULO A;  1UZ0 A;  2JD9 A;  4XUQ A;  1CZS A;  2Y6G A;  3LQC A;  2QBX A;  4D0Q A;  2WQ8 A;  2YG0 A;  4MGS A;  1RYY A;  2YC4 A;  2J1S A;  4IUG A;  1EUU A;  2VZP A;  4CU8 A;  4CU9 A;  3K4A A;  5IYY A;  4QB1 A;  2VL4 A;  2WDB A;  3WQB A;  2VZR A;  2VM9 A;  2PQS A;  2J22 A;  3ACG A;  5B4X A;  4DEV A;  5DN2 A;  4LQR A;  2R7E B;  1UWW A;  2W87 A;  3HPN A;  2J1R A;  3A22 A;  2W92 A;  3MUY 1;  2EIE A;  2W5F A;  4QX0 A;  1KEX A;  3DEC A;  3UES A;  4A42 A;  3C7F A;  5F7U A;  4RN5 A;  4ZY9 A;  1UY3 A;  2J1V A;  2QQO A;  2XOM A;  3HJR A;  1JI6 A;  1CIY A;  3LEG A;  4W8J A;  4BDV B;  2Y6K A;  3I3D A;  5A1A A;  3HOB A;  1K12 A;  4GWJ A;  5JUV A;  1SHW B;  2ZXQ A;  2VCA A;  3OB8 A;  2VZV A;  2JKX A;  3CQO A;  4AAX A;  1OH4 A;  3NNG A;  2YB7 A;  1JZ3 A;  3ACH A;  3CZJ A;  4BJ0 A;  2VMC A;  4D8M A;  4P00 B;  2VZ1 A;  3A7Q A;  1CZV A;  2HYX A;  3I2H A;  2E32 A;  2Y64 A;  2WUH A;  2DCJ A;  2JDA A;  4TXW A;  1XPW A;  3III A;  3I3B A;  3PUI A;  2VCB A;  4DXR A;  3P1I A;  3VD5 A;  1EUT A;  1L7Q A;  3MV0 1;  3T08 A;  1US3 A;  2QQM A;  2XHN A;  5LA0 A;  3AC0 A;  2YC2 A;  3J7H A; 
#chains in the Genus database with same CATH topology
 1I5Z A;  3Q8F A;  4BQ3 A;  4D6R A;  3AP5 A;  4PQ9 A;  1CGP A;  5JMC A;  5K9Y A;  3E5U A;  5KWR A;  3WNN A;  4A3Z A;  1JYW A;  1OD3 A;  1VBB 2;  2Q8D A;  2R07 1;  1PO2 1;  4CRQ A;  3SNM A;  4XUO A;  4IER A;  1AR6 2;  3WF0 A;  4BIF A;  2VW2 A;  3UNP A;  2WNV A;  2A5Z A;  4XQW A;  1PZ9 A;  1CAX B;  2RS5 3;  2OII A;  1SBE A;  1HV0 A;  1ND3 B;  4XFG A;  4E2S A;  1JZ5 A;  1DQ0 A;  4J1X A;  4QKB A;  5DQ0 A;  2WNV B;  2J1A A;  4RGG A;  5JIU A;  1JMU B;  4XIO A;  2PHF A;  1Y3T A;  2GMP A;  5FZH A;  4FP2 A;  1C1F A;  4DUX A;  4D7S A;  2ZGQ A;  4CEY A;  1DBN A;  4NR1 A;  5H9R A;  3K4D A;  1PVC 2;  1AUY A;  5C5T A;  3WQ7 A;  4MV2 A;  3CMG A;  1DGR A;  1VRH 3;  2OT7 A;  4AF9 A;  4IE6 A;  4E2Q A;  1W8N A;  1UMI A;  4YNI A;  2VTF A;  1US2 A;  1TEI A;  3PIG A;  5BNN B;  3OEB A;  4FPK A;  3R4D B;  2ADE A;  1X50 A;  1RUC 3;  3THP A;  1K45 A;  2XJV A;  4QT6 A;  1JH5 A;  1FOD 2;  1VRB A;  3Q9O A;  4BLJ A;  1WW5 A;  4MLO A;  5HXM A;  2BVB A;  4Z2W A;  1W6P A;  2XBO 2;  4UBH A;  1MAC A;  3KHB A;  2QZ2 A;  4YW1 A;  3BCW A;  4XFI A;  2RJL A;  4PLN A;  4UFJ A;  2A6Z A;  4MAD A;  2EXK A;  3WNO A;  1CPN A;  4ISR A;  1YFY A;  2ZGT A;  3AMM A;  4EN7 B;  5C3P A;  2X09 A;  4A44 A;  1HB1 A;  3B93 A;  4XPV A;  1S0I A;  2JX9 A;  4BIS A;  2V09 A;  4AQ6 A;  3O1R A;  3A21 A;  4LKS A;  1CR7 A;  1Q3E A;  2WA3 A;  1YC6 1;  1UMZ A;  5BXX A;  1HRI 2;  4N7I A;  1A8M A;  1SPP B;  1S0F A;  1WA6 X;  3POY A;  3RS6 A;  3IWZ A;  2D6M A;  2RE9 A;  2JG9 B;  4K1Z A;  3VKM A;  1OFN A;  1LHO A;  2A6V A;  1N3Q A;  2X5I C;  5L7O A;  1QNY A;  4WM8 A;  4OQ8 A;  3KT1 A;  4WVW A;  4D7Y A;  5BNO C;  2B45 X;  4J6G A;  2AR6 A;  1I1E A;  1WCD J;  4ZON A;  1LRH A;  1LOA A;  2VPV A;  4IV1 A;  2VME A;  3GYD A;  4Y1Z A;  5HCA A;  3ST7 A;  3WG3 A;  2XJS A;  2ZGS A;  5FY4 A;  4C1X A;  1TME 3;  4Q0S A;  2C9A A;  3PUR A;  2OA2 A;  4RA0 A;  4XFC A;  2PHW A;  4QX5 A;  4F83 A;  4PBP A;  5JSO A;  4BQ5 A;  3FBM A;  3LPF A;  3ZFF A;  4D7T A;  1F4A A;  4Z8B A;  1G9B A;  3POE A;  2ILM A;  3QCW A;  4P9I A;  4RS5 B;  1LOE A;  2FDH A;  1Q8Q A;  4CEW C;  5IAT A;  3R4U A;  2R04 2;  3ACI A;  1D4M 2;  5EWS A;  1Q8V A;  5A7O A;  2VMH A;  1DYO A;  2LTN A;  1W9F A;  2LM3 A;  3X29 B;  2ERF A;  1JBC A;  3INA A;  1H8T B;  1FV3 A;  1LEM A;  3U78 A;  4JGZ A;  4BK4 A;  4ZZ5 A;  5LW9 A;  3KV6 A;  4NRP A;  1AR8 3;  3JD7 1;  4XJ9 A;  4QPG C;  5K0U B;  2LAL A;  4GJZ A;  4FAH A;  3OSD A;  1I5P A;  3O5S A;  2WNU C;  4JC1 A;  1YIF A;  2K2S A;  3AYC A;  3BOD A;  2B9V A;  3MLL A;  1QH6 A;  1KJR A;  1WCK A;  2R07 3;  4I0W B;  5A6Z A;  4L0P A;  5IHR A;  4O9G A;  1XYO A;  4W4Z A;  4WM8 C;  5G04 L;  2Q8E A;  3GJB A;  1NCR B;  5A3M A;  4UFK A;  4LMF A;  4HL0 A;  4ARY A;  2J1T A;  1DQ5 A;  1RUD 3;  4AQ2 A;  2VVD A;  3J7L A;  2UYB A;  3BVC A;  5ABJ A;  1N47 A;  4CP1 A;  3FFQ A;  2XML A;  3JBG 3;  1GLH A;  1JXN A;  1ZZ9 A;  5KC5 A;  1HXS 2;  4FO9 A;  3EO6 A;  1VBA 2;  3VHR A;  3ZSM A;  4N90 A;  1H6Y A;  2YHJ A;  2XKO A;  4N43 B;  1O3S A;  3RYR A;  1UW8 A;  3KGZ A;  3I2I A;  1IG0 A;  3ZYP A;  4RGK A;  3R6S A;  2V4A A;  1IPK A;  2ZKL A;  4RS5 C;  4CU6 A;  4QGL A;  5F5I A;  3I2G A;  4QGM A;  3WEZ A;  3U4S A;  3RZM A;  3PTR B;  1LEN A;  3ZYI B;  4NE9 A;  3T0B A;  2JDN A;  1OA4 A;  2W9X A;  3L9J T;  1SFN A;  2UWB A;  4KWL A;  5F6L B;  5G05 L;  1H2N A;  3ZYJ B;  2FDJ A;  1XB9 A;  3NAP A;  4FOV A;  4HK8 A;  1LTE A;  3SEE A;  3S7I A;  3T2T A;  4LOR A;  3ZYH A;  2ZAB A;  2PLV 3;  1N1T A;  3O1O A;  4JGZ B;  2ZX0 A;  2HEV F;  1OSG A;  2QQP A;  4Q4W 3;  3AKP A;  3ZMN A;  3AMQ A;  3PIJ A;  1RUH 1;  4XAB A;  5FZA A;  3LEK A;  4CPB D;  1X36 A;  5JR2 A;  4Y5Z 0;  2B4K A;  5FZ3 A;  4EYU A;  1FOD 1;  2BRT A;  3ZR6 A;  2YDE A;  1HIX A;  1FPN 2;  1W9S A;  5K8S A;  1NQJ A;  4YW6 A;  3U14 A;  5T5P A;  4KQ7 A;  1BBT 2;  2X29 A;  4QHO A;  4RGA A;  1EY2 A;  1GFF 2;  1RHI 2;  3T4V A;  4ASM B;  3ZXG A;  2VOX A;  3LZZ A;  4ATF A;  4CDU B;  4DUV A;  4OMD A;  3PJQ A;  1LU1 A;  4BB3 A;  2WLP A;  1RUI 2;  1AL2 2;  4XF0 A;  4AHX A;  4HET A;  5GLZ A;  4AFA A;  1OH3 A;  1XU2 A;  4COW A;  4I01 A;  4QX3 A;  2WAA A;  1GOG A;  4IE5 A;  1ASJ 3;  2OS2 A;  4WM8 B;  4AI2 A;  1HQN A;  4MVT A;  1G9F A;  5L73 A;  5BV6 A;  1OT5 A;  5HI0 A;  5C7G A;  1RMU 3;  4N9I A;  2JG9 A;  3AL5 A;  2FDF A;  3IAQ A;  2V72 A;  2RR1 2;  4XHB A;  5DAV A;  4ZXK A;  2HLE A;  5HBA A;  4IL7 A;  2P3I A;  1FNY A;  1CVN A;  1BEV 1;  2VGD A;  1O91 A;  1W9T A;  4P9W A;  1LGC A;  4RHV 3;  2VW1 A;  3E6D A;  2CDP A;  1ENX A;  1S0D A;  3RG0 A;  3BIW E;  1EYB A;  1ZZC A;  3IAP A;  4IV1 B;  5FBZ A;  4B3N A;  5A3U A;  5J96 B;  2JE8 A;  4FFI A;  1COV 1;  4Q26 A;  2NYY A;  3E6C C;  1OMI A;  3OF1 A;  5A32 A;  1RUG 2;  5FZK A;  4CCE A;  3N9N A;  5J1X A;  3USU A;  1DHK B;  3ZDV A;  4AI1 A;  3HVD A;  4GUL A;  4QQO A;  4FAG A;  4KGQ A;  3M70 A;  4MO3 M;  3AZY A;  1RUF 3;  2WO2 A;  3OPZ A;  5FZ1 A;  3WCR A;  1MPX A;  2WNU A;  1QJX 1;  3NNF A;  5FMB A;  2VNR A;  3PU8 A;  4JKL A;  4Y1V A;  5FPB A;  2V4V A;  3MIC A;  2IWG B;  2Y33 A;  3H9A A;  3OBA A;  4CDW A;  1SLC A;  2RS1 1;  2Y8K A;  2XUE A;  3ALQ A;  5A3T A;  2I45 A;  2FMD A;  4XQ4 A;  5FP4 A;  3WNL A;  1PK6 A;  4GKX A;  1DQ2 A;  3LOI A;  1AXY A;  3K4Z A;  2VVF A;  3O1M A;  2CGN A;  3WDW A;  1UNB A;  1HB4 A;  2OZ6 A;  3GBG A;  4QXK A;  3J8F 3;  4P5H A;  1MQT C;  1PO1 3;  3N9Q A;  5FZF A;  1W99 A;  1W2O A;  5FXZ A;  3AK0 A;  3WUC A;  1D4M 1;  1U12 A;  4PI2 A;  2C26 A;  3ZFF C;  4ARX A;  3C7G A;  3JUU A;  1GQP A;  2EXJ A;  5DUW A;  3VBS A;  4DXS A;  4Q8K A;  2P5B A;  1CAV A;  1MS8 A;  1C5H A;  2VO5 A;  2W39 A;  2A75 A;  4H55 A;  4IEZ A;  2X05 A;  3ECQ A;  2E63 A;  1LGN A;  3DF0 A;  5F8P A;  2ARA A;  2DCZ A;  2IXL A;  3C7O A;  4X8N A;  3RMX A;  1H30 A;  1UO9 A;  5FMD A;  2MEV 2;  4Z1V A;  1JHN A;  1OOP A;  2ZX4 A;  4TLG A;  3VN4 A;  1QOO A;  4AI9 A;  2NN8 A;  4EN9 B;  2ZZJ A;  3N7J A;  1AF9 A;  2VQU A;  1AXK A;  1W3V A;  1KDM A;  4KWJ A;  4YGE A;  5FUP A;  5FLI A;  4MET A;  4KBB A;  4QXB A;  1QJU 1;  5JOZ A;  1STM A;  2WBK A;  3VD7 A;  4EQV A;  2XDV A;  1N3P A;  1PK6 C;  2PHL A;  5DZE A;  1LR5 A;  1PX3 A;  2Y34 A;  4Y4Y A;  4LT5 A;  3BOW A;  5F5Q A;  1MS5 A;  3BGA A;  1GV9 A;  2W1W A;  3MPB A;  4ZXE A;  4C91 A;  4PT6 A;  1O4T A;  5F3C A;  3AZX A;  2VMF A;  3CJX A;  1OOP B;  3G6J B;  2YV8 A;  3W20 A;  4CDX C;  1IPS A;  4LE4 A;  3H7Y A;  3B94 A;  1UYZ A;  1TVG A;  2WKK A;  1A3K A;  3C7E A;  1YQ6 A;  1SDW A;  4GWI A;  3AKT A;  2YRO A;  4K6B A;  2RDQ A;  2VQT A;  4L2N A;  1KGY A;  3AB0 A;  3TWI A;  3ZKY A;  3ZXK A;  3SCG A;  3O0X A;  3BPZ A;  5FYC A;  1U5Z A;  1IS5 A;  1DLL A;  1R08 2;  4PIY A;  3ASI A;  4Q29 A;  1UXX X;  5KHH A;  3ZDS A;  3APB A;  2WQ4 A;  2W1Q A;  5JZG C;  2WZ8 A;  1WD4 A;  1RUI 1;  2GN7 A;  4E4D X;  4ZS2 A;  1W6P B;  4FT8 A;  1QDC A;  3GDB A;  4LHK A;  3TEZ A;  1ZRR A;  1OQE A;  3I2K A;  3TAY A;  3WG2 A;  5LY2 A;  1QHD A;  1B35 C;  4QM8 A;  1S4C A;  5DMY A;  3RWN A;  4CA9 A;  1QJZ A;  1EAH 1;  2B8M A;  4LOS A;  3VKL A;  1RUD 1;  1QKQ A;  4KMQ A;  4IE7 A;  4FTB A;  5A6Y A;  4K9S A;  5DZG A;  4ASK A;  2VQ0 A;  3RJ2 X;  2HWC 1;  4FSJ A;  4AEJ A;  4CDX A;  2PYT A;  2Y0I A;  3J9S A;  4HKL A;  4HSL A;  5KBF A;  4GAL A;  3DUI A;  4AOC A;  2WA4 A;  2D40 A;  1F5J A;  1W6M B;  3VD4 A;  1UAI A;  1ULF A;  2ZGL A;  4GMP 1;  2BQP A;  2RJ2 A;  1EP0 A;  2WT0 A;  3WDY A;  2AUY A;  1XU1 A;  1PIV 1;  4BQ2 A;  3I54 A;  3H1W A;  1VIW B;  3QH6 A;  5AVP A;  4KU8 A;  5FO9 B;  1RUN A;  2L9L A;  4DUW A;  5DDJ 3;  3I3E A;  4QPG B;  2WSU A;  3HBZ A;  4FPL A;  3PHM A;  1Z7S 2;  1DQ6 A;  4OMC A;  5FP9 A;  3FHI B;  3POW A;  5B4N A;  2QZ3 A;  1IHM A;  5CAZ A;  1SG3 A;  5IVJ A;  1JZ6 A;  3MPP G;  4JKK A;  5LCW L;  4IEW A;  5C8C C;  2MEV 3;  3G7D A;  1RVF 1;  3CHX A;  5DAP A;  2ZKN A;  1XNC A;  1XRU A;  3VD9 A;  4J25 A;  4CP2 A;  4XBQ A;  1T2X A;  1SMV A;  1WMX A;  2VNG A;  2JD9 A;  4COU A;  3TEW A;  3GZE A;  3LD8 A;  5CKM A;  3LQC A;  2QBX A;  1UZY A;  5H9S A;  2YG0 A;  5BNP C;  1TQ5 A;  2CV6 A;  5FP7 A;  3ZOI A;  2VG9 A;  4FP3 A;  1EUU A;  4A7Z A;  1J58 A;  3IDE A;  3LDR A;  5JSR A;  2YU1 A;  4CU8 A;  4P9Y A;  4DQA A;  2P17 A;  4NAM A;  3K4A A;  3IKW A;  2E51 A;  3ZX7 A;  5IYY A;  2WNO A;  4R9A A;  4AXO A;  1UKR A;  1WBL A;  2GH2 A;  4YVS C;  3WQB A;  4CSW A;  1DGL A;  3ZXL A;  1O3T A;  1Q8P A;  4QPI C;  4CCC A;  2XH6 A;  5ACA 3;  5JI7 A;  4S2G A;  2PHU A;  4DEV A;  4LBQ D;  4LQR A;  1SLL A;  2WYF A;  1YRZ A;  2MEV 1;  5FXX A;  3AYD A;  4Q4Y 2;  1OC1 A;  4LXL A;  1R1Z A;  5EPA A;  3ZPY A;  1DQ1 A;  3AKS A;  3JD7 2;  4DS0 A;  1QXR A;  5CAD A;  4IQP A;  4MHR A;  1AYN 1;  1W0P A;  1DIW A;  1KEX A;  3UES A;  5FPV A;  3VZN A;  4YZ5 A;  4HN1 A;  2WQZ C;  5EYX A;  5T5O A;  2QQO A;  4GMP 3;  4IEO A;  2A7A A;  3M8L A;  1JYI A;  3KS7 A;  3PLQ A;  4CCJ A;  1AR6 1;  1TZO A;  3LA3 A;  3E5X A;  1OBN A;  2PHX A;  1PM7 A;  3L2Y A;  5LA9 A;  4KG0 A;  2Y6K A;  3H3Z A;  4CE8 A;  5EP9 A;  2CAV A;  2JIJ A;  2BVV A;  3K3N A;  4GWJ A;  2D98 A;  1RUC 1;  1N1S A;  1UOF A;  2ZX2 A;  4IV3 C;  4HOO A;  4KBZ A;  4YZ4 A;  5GLV A;  3MI8 A;  1CJP A;  1YI9 A;  1BZW A;  4CEW A;  1Z0H A;  2VCA A;  3RI8 A;  4GB3 2;  2ZJC A;  5EHD A;  1H4G A;  3CQO A;  5I0S A;  3NNG A;  3HT1 A;  3SHR A;  2JXA A;  4JGY A;  1RUI 3;  2BTV C;  2RDR A;  4BJ0 A;  1REE A;  1RUO A;  4AGR A;  3RPQ A;  5FUN A;  5FY9 A;  2SBA A;  3ZIW A;  2VZ1 A;  4YVW B;  1EAH 2;  2HYX A;  1TMF 2;  4B1L A;  1Q8O A;  3AYA A;  2LRP A;  3IPV B;  4GKY A;  1V0A A;  4CDQ C;  4COV A;  2GMM A;  3IDC B;  5FPX A;  5SV8 A;  3M4F A;  1XPW A;  3III A;  4LJH A;  3PUI A;  4BLI A;  1M4W A;  3C2U A;  4AAP A;  4DXR A;  1ODM A;  1OQD A;  3P1I A;  2Z5W A;  3EXU A;  1I6X A;  3ZSL A;  3VZJ A;  1O4Z A;  1FPN 3;  5JI9 A;  4Z92 B;  1ND3 C;  4FPF A;  1US3 A;  2YXS A;  5K0U A;  4GMP 0;  1SFY A;  2DVG A;  2GC2 A;  1BK0 A;  2IVJ A;  2JIG A;  2PQQ A;  3KB5 A;  2XQX A;  2YC2 A;  5CVR A;  3VDD C;  1RGS A;  1AYM 3;  3B69 A;  3PUQ A;  3W59 A;  3O12 A;  3VLB B;  2EAA A;  4NUB A;  1PMJ X;  2EIB A;  1H9P A;  5GM0 A;  1G8W A;  2EIC A;  4AVB A;  2CL2 A;  1AYM 2;  1ZBE 1;  2PAE A;  2W95 A;  3KWV A;  3H8X A;  1PO2 3;  1W8Z A;  4IW3 A;  4Z82 A;  1W04 A;  2W3J A;  3MUZ 1;  4O65 A;  2DV9 A;  5FY0 A;  1OXC A;  4MGT A;  1O8P A;  3ATG A;  2FDK A;  1O3R A;  3UGH A;  2V5D A;  4IV1 C;  1XOY A;  5A6Q A;  4G9S B;  2JDK A;  3MO4 A;  1ZRE A;  1RUC 2;  4B1M A;  1SDD B;  2G4I A;  1UY2 A;  1XNB A;  3BTX A;  5LEK A;  5EJZ B;  2QE3 A;  5FY1 A;  1HN0 A;  1MR5 A;  3GCX A;  1W3X A;  1UX6 A;  5FZC A;  3PMS A;  4MXW A;  4QB2 A;  2VTX A;  5FO8 B;  3P6B A;  5I0R A;  1D2S A;  4R4Z A;  4UW3 A;  3MV1 1;  3T1L A;  2DU0 A;  1HQL A;  3NST A;  1PO1 2;  1QJF A;  5FR3 A;  4AVT A;  4CCM A;  1VAM A;  4RYD A;  1ODN A;  1BJQ A;  3TYJ A;  2RS3 3;  2VJX A;  2CWS A;  3GXU A;  5FFO C;  3VBR C;  1BK1 A;  2VOW A;  1Q56 A;  4MGZ E;  3M3E A;  1VBA 1;  1N3O A;  4RFR B;  1JHJ A;  2FHR A;  2D6L X;  1QXP A;  2XG3 A;  1UOG A;  2VUD A;  4QDQ A;  2LS6 A;  3F95 A;  4QPI A;  5D8A C;  1CZT A;  1QJY 1;  1DDL A;  2AAC A;  3MF6 A;  4IEY A;  3D3A A;  5JXH A;  3MW3 A;  5I8Y A;  1O3Q A;  3HBK A;  1MZE A;  2J42 A;  1IGO A;  2Y6H A;  2BER A;  4QDS A;  1S0B A;  1UPS A;  3QLQ A;  3RZG A;  5BPX A;  2QKD A;  4AZZ A;  4XCB A;  2OUH A;  3RQ0 A;  3WG1 A;  4GQ7 A;  2IC1 A;  1PIV 2;  3N9M A;  3VHN A;  2BBV A;  1ZZ7 A;  2QNK A;  1U5X A;  3IDB B;  3WW4 A;  2X8K A;  3MW2 A;  3WW2 A;  2JJ6 A;  3ZR5 A;  1ULP A;  4B4Q A;  1XNA A;  1W6M A;  4GB3 1;  1S0C A;  1IS6 A;  5IFP A;  2VUJ A;  4ATE A;  1IKQ A;  3P3P A;  4JHZ A;  1HV1 A;  4Y3O A;  3W58 A;  3ZSK A;  1VBD 1;  3KMH A;  3LB9 A;  4RD7 A;  1KRI A;  5EJ1 B;  2B5H A;  4GH4 B;  2G19 A;  4AQT A;  4QGN A;  1NT0 A;  4GIQ A;  2C6S A;  2R16 A;  3JXS A;  2GU9 A;  2ZZQ A;  2OPW A;  4K8R B;  5DUX A;  5DAW A;  1RHI 1;  4CXY A;  1OF3 A;  2DFB A;  3AVR A;  4F7Z A;  3UT0 A;  5GZC A;  1V6N A;  3GNE A;  1FNZ A;  1W05 A;  3POG A;  4QKD A;  4FPH A;  2D6K A;  1VP6 A;  4NHY A;  3T2Q A;  1LJ7 A;  3K77 A;  5IVY A;  1HJG A;  2G9F A;  3FHA A;  3PU3 A;  4HKO A;  1IG3 A;  5BYN A;  5ISL A;  4Y1X A;  4LO7 A;  4WZF A;  1IQD C;  5FZM A;  5FTT C;  4I0A A;  3VV1 A;  3CNA A;  2JDU A;  2FZ1 A;  3N36 A;  2R0F A;  4AGV A;  4EN6 B;  1RMU 2;  1PNF A;  3J4U H;  4N53 C;  5FZ0 A;  1HX6 A;  1OLM A;  4XFH A;  2QTW B;  2QQI A;  1NY7 2;  1RIR A;  3OG2 A;  3O0V A;  2P37 A;  2EIG A;  4FVV A;  1RUH 3;  4AVV A;  5J09 A;  2BOI A;  4LKE A;  4NWV A;  3LDB A;  1LES A;  5FRE A;  1QH7 A;  3B00 A;  4HFS A;  4LBQ A;  3ZFE B;  4NIA A;  4CCD A;  5T3N A;  2CHH A;  1NA1 C;  5EV7 A;  1OLQ A;  1RUE 2;  4GA9 A;  1GZW A;  1QDO A;  2RV9 A;  3GBW A;  4UW4 A;  4BHP A;  1AR6 3;  2ARX A;  4K8F A;  2W94 A;  2WZR 1;  3DGT A;  3LWC A;  4K21 A;  3DL3 A;  1RUE 3;  4XC9 A;  2OYZ A;  1Z78 A;  5AC9 3;  4AL9 A;  1YJK A;  3OY8 B;  1HRV 3;  2RG4 A;  4UF0 A;  4AHW A;  5FAX A;  1X82 A;  4LKD A;  3POJ A;  4DOU A;  2GAL A;  5EFU A;  3KQR A;  3WW3 A;  1NLR A;  4CYD A;  2HBU A;  2QJV A;  3OUI A;  4Q4X 3;  4BH9 A;  1ZBA 2;  4AGG A;  3LEI A;  4YGD A;  5FJK A;  3ACF A;  2Z42 A;  1KFU L;  5JR7 B;  2GP5 A;  4OCT A;  1VAK A;  4DRR A;  5A3P A;  1NQD A;  1PM4 A;  3DN7 A;  3CF6 E;  1LOF C;  1QWR A;  1LHW A;  2XQR A;  2YBS A;  5CU1 A;  2A3W A;  4AG4 A;  4IV3 B;  3PUH A;  1WLW A;  4KNC A;  2VE1 A;  2BWC A;  3KSC A;  2ZEX A;  3CKH A;  4FXG B;  5T55 A;  3LOB A;  1PGL 2;  4QKN A;  2ZEZ A;  3KGL A;  3AJZ A;  4HSJ A;  4MGK E;  3QBQ A;  4HVQ A;  1RHI 3;  1BVP 1;  2A1X A;  1NX9 A;  3FE5 A;  4XUR A;  1GOH A;  3ACL A;  1GUI A;  1TNR A;  3OGS A;  5KXB A;  3PL0 A;  2MPF A;  1GSL A;  3ZN4 A;  3V65 A;  4ERO A;  1WLD A;  1UMH A;  5LB6 A;  4E2G A;  5EJ3 A;  3I3M A;  5FPL A;  2BPA 2;  4CVU A;  1J3P A;  1VBD 3;  2Y0O A;  4AI8 A;  3MZH A;  1QY4 A;  3AKQ A;  4GB3 3;  4MSV A;  3T0A A;  2JIC A;  1MS1 A;  3VBF A;  4ET7 A;  1Y9M A;  1NKG A;  1VBD 2;  3T1M A;  4K1Y A;  4DXZ A;  2VC9 A;  4HK9 A;  4WVV A;  5JPM B;  3OUH A;  4QQP A;  3DXU A;  1WKY A;  4LPL A;  1JZ8 A;  3ZXF A;  1UF2 C;  1W2U A;  1QJU 2;  3POS A;  3EJK A;  1UZZ A;  3MLJ A;  3AMP A;  2ZHM A;  4ITC A;  4YVS A;  5FOJ B;  2BFU L;  3U37 A;  5TSW A;  4AEK A;  1W8F A;  3WP3 A;  2FD8 A;  5CFD C;  2AEN A;  1CIW A;  2YYO A;  1YI7 A;  2PA7 A;  2D93 A;  1W6O B;  3K3O A;  1H2M A;  4BME A;  3N7K A;  1PIV 3;  2OZJ A;  4OQ9 A;  1GZT A;  2WSV A;  3MLK A;  2YPD A;  4DNY A;  1EV1 3;  2VU9 A;  2R04 1;  4R9D A;  3GCW A;  4IEP A;  4AFD A;  5LWB A;  4HBN A;  3D82 A;  1H2L A;  1XYN A;  2HWC 3;  3TBD A;  3ZFG B;  1BHG A;  3HNM A;  5K7P A;  3VBS C;  2ORZ A;  4N43 C;  4AFB A;  1ULD A;  3DPR B;  5CZK A;  3NJV A;  4E8D A;  1SBF A;  3I8T A;  4GAZ A;  4NID A;  3HT2 A;  1XC6 A;  4OYU A;  2OX0 A;  3IMM A;  1FX5 A;  3UGF A;  4YG0 A;  2ZGR A;  4NVP A;  3E6B A;  4HN0 A;  1Y9G A;  3JU9 A;  3GHN A;  1AL2 3;  4UXA A;  1ST8 A;  1W6Q A;  2AEY A;  3OGJ A;  3VBO B;  2D44 A;  4RQP A;  3EQE A;  1NCR C;  3VB9 A;  1DZT A;  5F6K A;  4BE3 A;  2XBO 1;  1X8E A;  1C3H A;  5A3N A;  1RUE 1;  1JYC A;  1UY1 A;  1FMD 1;  5H9P A;  1AR8 2;  4IEQ A;  4M3C A;  4QX2 A;  1PVX A;  3MBW A;  4IND A;  1WBF A;  1D2Q A;  3RZK A;  1C8N A;  2WNE A;  5ERL A;  4K40 A;  4BXF A;  1H4H A;  2BNO A;  1QU0 A;  1XE0 A;  2VMD A;  2NMN A;  4QU1 A;  3WSO A;  2WFP A;  1JZ2 A;  3WVJ A;  5IVB A;  1PX4 A;  4GZ9 A;  1JOJ A;  3CZU A;  2FBE A;  4UT5 A;  4W6X A;  3FUQ A;  2C9K A;  5FK7 A;  1AJK A;  2BGO A;  3K46 A;  4PIZ A;  3D5O A;  4TN7 A;  4XVH A;  3PVN A;  4YAR A;  3QOP A;  4OZX A;  1GQH A;  4YM2 A;  4UFH A;  3T3Y A;  5JOX A;  4LTA A;  3E5Q A;  1G86 A;  2VOV A;  1RUJ 1;  5FYB A;  1AL0 G;  3UJO A;  3H8O A;  1H1I A;  1WGP A;  3FL7 A;  1RIT A;  2ZHN A;  2AEZ A;  1F2N A;  1JOB A;  3K51 A;  3MFC A;  3NNM A;  5FZ4 A;  5FZ9 A;  5KXE A;  2AH2 A;  3CU7 A;  2C24 A;  1UKG A;  3GHM A;  5D8A A;  4AR2 A;  4Z2A A;  2HWF 2;  2VNV A;  4R52 A;  4YG3 A;  3WNM A;  2XVK A;  2O8O A;  5J37 A;  2HWE 1;  3FHQ A;  3WF4 A;  4RR3 C;  4DPN A;  4LHL A;  2ET7 A;  4YVW C;  5BNO B;  3ZFG C;  4R9C A;  4Y33 A;  4KWU A;  3LFM A;  3ELN A;  4LKF A;  4FFF A;  5FY8 A;  4LBM A;  2Q0A A;  1F15 A;  1LOD A;  2XBO 3;  1YQ8 A;  3SIS A;  2WS9 1;  4LBJ A;  4KG8 A;  1OKQ A;  5A1L A;  5C8W A;  2W68 A;  4C0H A;  1OA3 A;  4S2H A;  1DCS A;  1XSR A;  2WAB A;  4QDR A;  1ZRD A;  1XSQ A;  1QGL A;  4NPR A;  1POV 1;  4WM7 B;  5CKQ A;  1ZA4 A;  2YFU A;  3POB A;  4PJY A;  4AE2 A;  3VD3 A;  5IK8 A;  4ZZ8 A;  3HN1 A;  3VBR B;  2NPI A;  3BTY A;  1LCL A;  4H3W A;  1W8T A;  1W0O A;  2IXK A;  2B46 X;  5F3E A;  3M2M A;  3RYK A;  5ACA 1;  5IWF A;  2D97 A;  4ZU5 A;  2JDP A;  3FC0 A;  5EQU A;  2HYK A;  3KVB A;  1ND2 B;  4GJY A;  4DIQ A;  1V9U 3;  1CES A;  5LBE A;  5L19 A;  1Z7S 3;  1UU4 A;  5KHJ A;  4PHZ A;  2HEW F;  3Q8A A;  4I3P A;  4Q5O A;  4BMB A;  2VH9 A;  1AX2 A;  1BVV A;  1JTZ X;  2RVA A;  4IGP A;  4XYX A;  1MEC 1;  2E53 A;  2E26 A;  2BV4 A;  4PBO A;  4UW6 A;  4OHY A;  5FK8 A;  1NUK A;  1YCI A;  4XUN A;  4LOT A;  5IAV A;  3HAG A;  3ETQ A;  4EN0 A;  4QPI B;  2YBK A;  2ZOE B;  2AC1 A;  1BEV 2;  2OW4 A;  2ZAA A;  1E5H A;  5FMO S;  3T2O A;  1EV1 2;  1K5M A;  3LIG A;  2VAU A;  2VUL A;  2W2I A;  3DCQ A;  3D0J A;  4AQS A;  1RVF 3;  5JWP A;  1J1L A;  1JZ7 A;  1TMF 1;  4XJU A;  5I93 A;  1FI2 A;  2JDZ A;  1X9T A;  5LA2 A;  2GAU A;  1H9W A;  3TOJ A;  4BQW A;  3M3O A;  1G7Y A;  1E57 A;  1QJX 2;  4LIV A;  4C1W A;  3SH3 A;  2XLG A;  4Q0Q A;  4AW7 A;  1KJL A;  1YO8 A;  2A6Y A;  4I30 A;  4PDW B;  2C4X A;  2Y38 A;  3NVC A;  5A3L A;  2HWF 3;  3GAL A;  1XXN A;  4CXW A;  1ZBE 3;  2VR4 A;  4QB6 A;  3H8U A;  3SCH A;  1F31 A;  2H6C A;  2PAM A;  4BQX A;  1I9R A;  3R4S A;  4UI9 L;  3AZZ A;  2OKX A;  3THT A;  1ULO A;  5AC9 2;  3A0N A;  3IBM A;  3KHC A;  5JVV A;  1CZS A;  2C1F A;  1OVP A;  3MF9 A;  1WMD A;  3M3I A;  1SAC A;  4YW3 A;  3FMG A;  1EPW A;  1YWK A;  2ENR A;  4D0Q A;  2WQ8 A;  2GC1 A;  3WQ0 A;  2D5H A;  1LB2 A;  3WDV A;  1YXW A;  2JEC A;  5J36 A;  2ZGN A;  4CCK A;  1BCX A;  2QUO A;  1IOA A;  4CU9 A;  3KM5 A;  1GBG A;  4Q4X 1;  5L7O C;  1UQX A;  5FPU A;  4IEV A;  4CCO A;  1HQW A;  4NHM A;  4B8E A;  2OXB A;  1VBC 3;  1WMF A;  2NM1 A;  1OPO A;  3ZYB A;  5J3U A;  5JAX A;  2R7E B;  1B35 B;  1UWW A;  1SCS A;  4QQH A;  4UBG A;  4XFB A;  4LO4 B;  4U2A A;  2JKB A;  4WM7 C;  1OD5 A;  2W92 A;  2RMU 2;  1PGS A;  2EIE A;  1UYP A;  3NMB A;  1QXJ A;  3ZVX A;  3RZH A;  4IGQ A;  3KQ4 B;  4Y5T A;  5JZG B;  1FV2 A;  1TME 2;  1JYT A;  4QX0 A;  5HCF A;  1FT9 A;  4YM3 A;  1PZ7 A;  2EVX A;  3DEC A;  5CFC C;  1MS3 A;  2RMU 3;  4A42 A;  1CX4 A;  2CAU A;  4RN5 A;  5F7U A;  2QQV A;  1XQN A;  2XOM A;  3N35 A;  4QQ2 A;  3UV9 A;  3B01 A;  3KVA A;  4XDO A;  1X8M A;  3O7O A;  5LEJ A;  2DUQ A;  1CIY A;  1QIQ A;  4W8J A;  4YW7 A;  5A7W A;  2ADD A;  3I3D A;  4TWT A;  4URT A;  2WFF 3;  2WRA A;  1GIC A;  3HOB A;  4JGZ C;  1K12 A;  2HWD 2;  5JOY A;  1V6O A;  1OLR A;  2N7G A;  5JUV A;  1I3H A;  1SHW B;  1OOP C;  5LK7 B;  2H0V A;  4FPG A;  1AJO A;  1WUV A;  1MZF A;  3TB0 A;  1H8V A;  1NYW A;  1QJY 2;  2F4L A;  2VUC A;  2ZX1 A;  3VKO A;  4AAX A;  3RVH A;  5KC6 A;  4RQP B;  3I2O A;  1JZ3 A;  3POF A;  5IK5 A;  1ENS A;  3CZJ A;  1C8M 3;  4D8M A;  4YZ3 A;  4V1P A;  3A7Q A;  5C3Q A;  3KCY A;  4HKW A;  4LIU A;  4BIO A;  5FYH A;  3WP5 A;  4KH9 A;  2E32 A;  1A8D A;  2Y64 A;  1YFX A;  4Q2F A;  5DXD A;  3B3Q E;  1MEC 3;  4IEU A;  3SC7 X;  2RDN A;  3ZSJ A;  1L7L A;  5A80 A;  2ZAH A;  2WIN B;  1LOB A;  3I49 A;  4NMI A;  1JN2 P;  1Z7S 1;  4FPO B;  2VQA A;  5F9T A;  1XBF A;  5L36 A;  2XHN A;  4KGG A;  2R1B A;  3DKW A;  5LA0 A;  1GZ9 A;  3AC0 A;  5GKA C;  4L8Q A;  2DVD A;  1D7P M;  2JG8 B;  2UWA A;  5DG2 A;  5C4W C;  3LEM A;  2PFW A;  4XW3 A;  3SQO A;  4OFG A;  5JZG A;  5KHK A;  3DXT A;  1W6O A;  4TLF A;  3HMY A;  1C4R A;  1GYK A;  1RUF 1;  1R08 1;  4LUM A;  2IXH A;  2JDM A;  4AVS A;  2A6X A;  2HWC 2;  4D94 A;  2WO7 A;  3CLP A;  1W9W A;  4HT1 T;  2Y6L A;  3VZM A;  4EJR A;  4XF9 A;  3U4X A;  3OYW A;  2OVU A;  1COV 3;  5DDJ 1;  2AYH A;  5FIX A;  5DPN A;  1F4H A;  2XHK A;  4QKF A;  4W6Y A;  5FPZ A;  2A3X A;  5I8S A;  3USS A;  1YIP A;  2DBN A;  4DIN B;  2W47 A;  3RSJ A;  3B7M A;  1WW6 A;  2G9Z A;  4NJ4 A;  1YYN A;  3DYM A;  1HJF A;  1ZBA 1;  1AR7 1;  5CKN A;  2Q1M A;  4QPG A;  1K3I A;  4LK7 A;  4YM0 A;  5AFB A;  3SKV A;  2CNA A;  2RS3 1;  1NZC A;  1YJL A;  4GWM A;  1RMU 1;  4HLT A;  1JU4 A;  3AM2 A;  5FJH A;  1L3J A;  4Q4W 2;  3PTY A;  1TG7 A;  1ASJ 1;  3THD A;  4Q4X 2;  1AVB A;  1U0A A;  3SH5 A;  1UU5 A;  4LK6 A;  2VTX J;  4JQR A;  4MHU A;  1ZX5 A;  4EZ4 A;  3AP9 A;  2E33 A;  3GBF A;  4BPZ A;  1J59 A;  3CL1 A;  4WVZ A;  1Y4W A;  2WFF 2;  1JW6 A;  4IE0 A;  4ZPI A;  5E1R A;  5K4L A;  5C3R A;  2EID A;  2CU5 A;  3NAP C;  2DCK A;  3WG4 A;  3WF2 A;  1CAW B;  1RUD 2;  3VDD A;  1RUJ 3;  3OBZ A;  2A73 B;  4OI2 A;  4CDW B;  4NPL A;  1F35 A;  2JEN A;  4CDQ B;  5A1F A;  5FV3 A;  3EBR A;  3AFK A;  1T6G C;  4HON A;  3NKG A;  4AED B;  1FOD 3;  4XAC A;  4DXT A;  1BBT 1;  1OI6 A;  3U07 A;  4JGY C;  3SKJ E;  3I2F A;  1OFS A;  2Y6F A;  5A32 B;  5F3G A;  1RED A;  3H42 B;  1MZ6 A;  1ULE A;  4L9B A;  2VZT A;  1W8O A;  2BJS A;  4XDQ A;  2ZCW A;  2G9G A;  2RS5 1;  3OBT A;  5LAT A;  1RXG A;  4CDU C;  3UET A;  1LHN A;  4E4H A;  5CIS A;  5F37 A;  3N9L A;  1NLS A;  4N43 A;  1ZZ8 A;  2Q5T A;  5IVF A;  3KLS A;  5GZG A;  4NRQ A;  3KCC A;  5B2G B;  1W28 A;  5DAX A;  5CIR A;  1CD3 G;  3AP4 A;  2E7T A;  3LA2 A;  5HXV A;  2PHT A;  2VOT A;  4QX1 A;  4XJA A;  5F2W A;  4BWO A;  5F1R A;  5KXC A;  3AXE A;  3I2J A;  5FBJ A;  4ASL A;  2WZE A;  4LHN A;  3CEW A;  3I59 B;  4MXW B;  4CCN A;  4JTO A;  3VKF C;  1AL2 1;  4P9L A;  1OVS A;  4AVA A;  1NCR A;  1YEW A;  1ZNP A;  2BBA A;  1BKZ A;  4XDP A;  3BUC A;  2R6Q A;  4LBO A;  4COY A;  2VMG A;  2EXI A;  3FLR A;  1COV 2;  3ILF A;  1NE4 A;  2FZ2 A;  3IIA A;  5LAS A;  2AGS A;  2WWS A;  3LA7 A;  2D7F A;  4XBN A;  2VCC A;  1S2K A;  3LGR A;  5FWE A;  5IUQ A;  1D4M 3;  5T52 A;  3VBH B;  2Q30 A;  2UWC A;  4HMZ A;  1QMJ A;  3EYP A;  4WM7 A;  5CG8 A;  2MHF A;  2Q1Z B;  2DCY A;  2W91 A;  1OUR A;  1AHS A;  1SLA A;  1U5I A;  1ZBA 3;  2R04 3;  2XVG A;  2ZTN A;  4FI9 A;  5J98 B;  5C33 A;  5DAB A;  3RGB A;  1KFX L;  1H8T A;  1RUF 2;  3NJY A;  1FMD 2;  1Y43 B;  1AYN 3;  3NV2 A;  4AVC A;  4EWD A;  2FDG A;  2QQL A;  1VJ2 A;  1K5M C;  2FDI A;  2WT1 A;  4XTM A;  5CBL A;  2XPJ A;  1WCS A;  1MVQ A;  4KL1 A;  2R07 2;  1AR8 1;  5CFC A;  4M01 A;  2D3P A;  4PLO A;  1D0G A;  1O5U A;  3GM8 A;  4NAO A;  5FZB A;  1VMH A;  2Y6J A;  3OUJ A;  1RUJ 2;  1RIN A;  5IJR A;  5EXO A;  4JRA A;  4BK5 A;  2ZEW A;  4M0H A;  3FUO A;  3J8F 2;  4NOT A;  3AL6 A;  3CIH A;  5KHG A;  4A6S A;  4X6R B;  5A33 B;  3VUO A;  3ZXD A;  4CP0 A;  1ULG A;  2WNU B;  1GP6 A;  2WWJ A;  3AZV A;  4E4S A;  3WHT A;  2W1S A;  4TSV A;  2QQK A;  3JBG 2;  3S57 A;  1KD7 A;  1ZM1 A;  4QD2 A;  1W2A X;  3MIB A;  3WR0 A;  4Y5S A;  2PEL A;  5GZF A;  2RS3 2;  3K75 B;  1ZRI A;  1WLC A;  1YUD A;  1ENQ A;  2BGP A;  3ABZ A;  3DYP A;  4MOA A;  3SEP A;  3VL8 A;  4EZH A;  3BIE A;  1S55 A;  3R05 A;  4OHV A;  5AFE A;  1W03 A;  2R06 2;  1AZD A;  3WHU A;  2ZGU A;  1OHF A;  1SPP A;  3N7L A;  1AXZ A;  3UKT A;  3VBS B;  4YYO A;  1HN1 A;  5I0D A;  1AR7 2;  3RI9 A;  3VBH C;  2DVA A;  2IUW A;  4FOW A;  3TEY A;  1LHU A;  2BFU S;  2BUK A;  3I2D A;  4OHW A;  2DVB A;  3PUS A;  5FYU A;  3D0S A;  3VDB A;  4FFG A;  4LHS A;  3ME2 A;  3ROU A;  5FWJ A;  1E5S A;  3I97 A;  5GZE A;  5A3W A;  3UYJ A;  3BAL A;  4DY5 A;  5LK5 A;  5FKB A;  1O7F A;  3ZN6 A;  2KM2 A;  2EXH A;  4AED A;  3V0A B;  3FN9 A;  2ZBJ A;  4M4R A;  1D0H A;  2CYF A;  5T50 A;  5BY5 A;  2WFF 1;  1ND2 A;  1NOV A;  1LU2 A;  1GNY A;  5JLV A;  4PLM A;  2FCV A;  2DCT A;  4Q8L A;  4RFT 0;  5A33 A;  4I02 A;  1PVC 3;  1LGB A;  2CTV A;  2DU1 A;  2ARB A;  1URX A;  3H1Y A;  2X10 A;  3KD4 A;  2A71 A;  4N9H A;  2YGL A;  4Q4W 1;  5FYY A;  3VDA A;  1W9Y A;  3BU0 A;  1CAU B;  5IW0 A;  5CFC B;  5IVE A;  1EPZ A;  2VXR A;  2PTM A;  3ZMO A;  2UUR A;  4PIX A;  1UZW A;  2PHD A;  1YHF A;  5DAQ A;  2VMI A;  3HQX A;  1W90 A;  2P2K A;  4JAA A;  1YQ2 A;  4CEY B;  5HV0 A;  2ZGM A;  1A6C A;  2KD7 A;  4DO0 A;  1HB2 A;  2GNM A;  2JWP A;  4FPE A;  4A45 A;  3KT7 A;  2J1E A;  4AHZ A;  2K46 A;  1VRH 1;  1H6X A;  4CU7 A;  3T0D A;  5IK4 A;  4YRD A;  3QD6 A;  4DRV A;  2P6C A;  4LO5 B;  5APA A;  3WOG A;  4YFW A;  3HQR A;  2XUM A;  3HD8 B;  2RR1 3;  3O0W A;  5I0U A;  5T5J A;  3OGR A;  2HWB 1;  2BNN A;  2CDO A;  2GNT A;  3BB6 A;  3FBY A;  5FZ7 A;  1JZ4 A;  1H1M A;  1U5Y A;  3IM0 A;  2YBP A;  2ZAC A;  3PVO A;  4YG6 A;  5AVA A;  3KF3 A;  2XGX A;  4YW2 A;  1ONA A;  4JTN A;  5FLH A;  5GAL A;  3UL2 A;  4XJZ A;  1UD1 A;  1YNA A;  4LIT A;  1UX7 A;  1ZVF A;  2HKX A;  5IAX A;  3AMN A;  5C71 A;  1WCQ A;  4EE2 A;  4ONU A;  2ZGK A;  2ZX3 A;  4C8D A;  1GP4 A;  5DUV A;  4SBV A;  2GC3 A;  3AXD A;  4YZ2 A;  4Y4R A;  3JQW A;  2QCS B;  5FYZ A;  2ZS6 B;  3WY6 A;  3GJA A;  4CUG A;  5HV4 A;  3B9C A;  3BYW A;  4WVM B;  2BGC A;  3K48 A;  1NY7 1;  4FTS A;  2CGO A;  4UFL A;  3VDD B;  3RNS A;  3SMH A;  4N7U A;  5E8A A;  3ZSE A;  1IPJ A;  4W65 A;  3ZFE C;  4JRL A;  2WAO A;  4G4F A;  4YLZ A;  3IN9 A;  4HG6 B;  2IXJ A;  1VBE 3;  3WUD A;  4AK3 A;  1BMV 1;  1C28 A;  5BNQ A;  5LRR A;  4DMI A;  2QDN A;  2KXL A;  4A4A A;  2UU8 A;  4E8C A;  5C9A C;  5A3O A;  2HWB 3;  1ND2 C;  4D6Q A;  4LA3 A;  4YGC A;  5I8T A;  1LUL A;  1ALY A;  3NV1 A;  2EAL A;  3LE0 A;  5T5L A;  3ZLI A;  1UN1 A;  2WO1 A;  4CDQ A;  4P5Y A;  1WWY A;  4Q4Y 1;  3WV6 A;  3CDZ B;  4CCL A;  3DV8 A;  4JVA A;  2HH9 A;  3WIN E;  1CAW A;  2WN2 A;  3F2Z A;  3J8F 1;  4IET A;  4QHB A;  5LY1 A;  2DF7 A;  4XFF A;  5EZW A;  2R06 1;  1TME 1;  3WDU A;  1SEF A;  1VBA 3;  3RYP A;  1P8J A;  1PGW 2;  4FQZ A;  2CSG A;  3VBH A;  1CAX A;  1O4Y A;  4U36 A;  4M0N A;  5C6C A;  2Z79 A;  2RM2 1;  2RS1 3;  3UK9 A;  5C5U A;  5FOB B;  1WW4 A;  2ES3 A;  2BZD A;  2ZA9 A;  3FWE A;  4V2V A;  1S2B A;  3RDI A;  2ZHK A;  2PAK A;  5EYY A;  1V9U 2;  1VBB 1;  2FCT A;  3C8X A;  3ZFE A;  1RC6 A;  3NWK A;  4AED C;  2BW8 A;  3P5B A;  2P3K A;  3I59 A;  1H0B A;  2DUP A;  5IK7 A;  3CJI B;  2VBD A;  1POV 3;  3OEA A;  2WLQ A;  3I3Q A;  5FP3 A;  5LBF A;  4JKM A;  4CXX A;  2B42 B;  4XUP A;  5BNN C;  4NIH A;  1KS4 A;  4KWK A;  4NO4 A;  1GAN A;  1BEV 3;  2WS9 3;  3HWJ A;  4HAN A;  2E6V A;  2P4E A;  2AZ5 A;  3KV9 A;  3BKZ A;  4NIG A;  2A3Y A;  1MZ5 A;  2TBV A;  4HPK A;  3NNJ A;  1CAV B;  3VL9 A;  1WW7 A;  5GLU A;  1QNW A;  4Q0V A;  5F39 A;  4AEM A;  2OPK A;  2YUE A;  2DBI A;  3E97 A;  3MGU A;  4XZU G;  1NG0 A;  2BEO A;  3NQH A;  4XOG A;  4Q4V 1;  3TNQ A;  2YPJ A;  1FYU A;  4YW4 A;  5CB7 A;  3NRU A;  4GWN A;  4R4X A;  4RHV 2;  1CX1 A;  3IZO A;  5FZO A;  1DP0 A;  1UIJ A;  5IT6 A;  4P9J A;  4K20 A;  3OGG A;  5C4W A;  1FPN 1;  4JQT A;  5A6X A;  1QOT A;  4H7M A;  2HEY F;  2PLV 2;  4UW5 A;  4JX0 A;  1CWP A;  5F32 A;  4Y26 A;  1H1A A;  1RL3 A;  2LRO A;  5FYT A;  4LUK A;  5BNP B;  1FAT A;  3RZZ A;  3IT8 A;  4EV0 A;  3S6P A;  5IFT A;  4MXV A;  1JYN A;  1RJ8 A;  1N1Y A;  5FZ8 A;  1NLQ A;  2VW0 A;  4PDW A;  4BQ1 A;  3O1P A;  1GWK A;  1R1A 1;  4GH4 A;  5DUU A;  2DDU A;  5L9B A;  3W21 A;  1OUX A;  4OUE A;  5EIY B;  2LUW A;  2QDR A;  3OCP A;  1HLC A;  3CO2 A;  1O59 A;  5FZO B;  1SLB A;  3LPG A;  3WX5 A;  4RSU A;  2DUO A;  4EWE A;  5FPA A;  3U1X A;  2ETE A;  2QQW A;  2VZO A;  1K5M B;  3HN3 A;  3VZK A;  2ZPX A;  3ZYG A;  4DFS A;  3KV5 A;  1O6U A;  4FPY A;  1UL9 A;  2J1U A;  2TNF A;  4MGQ A;  5JXJ A;  1LOC A;  5DDJ 2;  2CGP A;  2DTW A;  1O8S A;  5JPN B;  4MZU A;  5J7M A;  4ISQ A;  4LBL A;  4Q1P A;  5A7W B;  3N4M A;  2NQY A;  3FZ3 A;  3KF5 A;  4AFC A;  2RS1 2;  4XIL A;  5HCB A;  1BMV 2;  1JUH A;  2Y60 A;  3A0K A;  4Y1U A;  4FPC A;  4LBN A;  4BU2 A;  2ARC A;  3O1U A;  4XUQ A;  3S5Q A;  2IXI A;  1YQC A;  3H0O A;  1OKO A;  3MID A;  3RZJ A;  2BYV E;  5L9V A;  3VBO C;  2ZMK A;  1MVE A;  2BDR A;  1AR9 2;  1HW5 A;  4MGS A;  1RYY A;  2YC4 A;  3ES4 A;  3JB8 A;  4IUG A;  4CPB A;  1NCQ C;  4O7X A;  1H8T C;  2BNM A;  3MIF A;  5JSP A;  1CQ9 A;  2JG8 A;  4B7K A;  1F5F A;  5CFD B;  3FLT A;  2GZW A;  4GXL A;  4QB1 A;  5T54 A;  2WDB A;  4LR4 A;  1CN1 A;  2UY8 A;  5FY7 A;  2VZR A;  1PNG A;  3MHZ A;  5D21 A;  4P9G A;  5C8C A;  2NP0 A;  5E89 A;  5CEH A;  3ACG A;  3P3N A;  3QAC A;  4XMI A;  5DN2 A;  1JUI A;  1KQR A;  1EV1 1;  1O5L A;  3TN9 2;  1MS9 A;  2XJR A;  1XND A;  4R8H A;  2ZMN A;  1OPM A;  2J1R A;  4QXC A;  3M3C A;  2V5Y A;  5A7N A;  3MUY 1;  3OOX A;  3DEM A;  4DZG A;  3ZN6 B;  3RJR A;  5GLT A;  4XJ8 A;  2BWA A;  1K5J A;  3JD7 3;  1NE6 A;  3KT4 A;  4IDZ A;  4XJW A;  3SCF A;  4D3W A;  4DY3 A;  1RB8 G;  3C7F A;  4ZY9 A;  5A7P A;  2XR4 A;  3PUA A;  1PK6 B;  2YGM A;  4ZKT B;  1NA1 A;  1SLI A;  1BBT 3;  2X5I B;  4FOY A;  4AFM A;  1JI6 A;  3LEG A;  2Q8C A;  3ZN5 A;  4BDV B;  4L92 A;  5FP8 A;  2WR9 A;  3T30 A;  1R1A 3;  4QM9 A;  3T4H B;  4E27 A;  2PHR A;  5CA6 A;  5C9A A;  5FZ6 A;  4Q0U A;  2CY6 A;  1REF A;  2QQU A;  3BOP A;  1UOJ A;  4P14 A;  3USU B;  3OB8 A;  4OUL A;  3WCS A;  3Q8B A;  5LBB A;  2IVI B;  1W8W A;  3BPS A;  1DGR N;  2YB7 A;  4JGY B;  4M3C E;  5FZE A;  5FZL A;  2VBB A;  1LKN A;  2VMC A;  2IFR A;  1YLL A;  4H14 A;  4P00 B;  5E16 A;  3OPT A;  1UOB A;  2ZHL A;  4PF5 A;  2NMO A;  3I2H A;  5FO7 B;  4Q4V 3;  1OA2 A;  1DGW A;  4YW5 A;  1WD3 A;  2JDA A;  1EAH 3;  5A7Q A;  3I3B A;  3VKN A;  5C9A B;  4LA2 A;  2VCB A;  3LF7 A;  1T6B X;  1GP5 A;  4B4R A;  3WP6 A;  4PDW C;  3H1M A;  3LSE A;  2WNV C;  3VD5 A;  5BUV A;  1KIT A;  3AP7 A;  1IKP A;  1EUT A;  1L7Q A;  1W2N A;  2Q1F A;  2JD4 A;  4QMA A;  4BOW A;  1NA1 B;  2X5I A;  4LLF A;  4BQY A;  2PMW B;  2ZGO A;  3UJQ A;  3WP4 A;  1SBD A;  3KZ4 C;  2Y26 A;  4XFA A;  1HRV 1;  1SQ4 A;  3IDA A;  4V2W A;  5FYS A;  4NRM A;  5AC9 1;  4BXS V;  4CDU A;  3T2P A;  1W6Q B;  4YPJ A;  5IVV A;  4N53 B;  1YQ5 A;  1SCR A;  2WL1 A;  1GOF A;  4YSF A;  4Y22 A;  3B02 A;  3OPW A;  4G3Y C;  4OI4 A;  4RS5 A;  4P08 A;  4XUT A;  4FPJ A;  4IEX A;  2O14 A;  1CPM A;  3DPR A;  3NL1 A;  2OQ6 A;  3WT3 A;  1N1V A;  4XMA A;  2ET1 A;  1HXS 1;  3PJY A;  5FXV A;  4COZ A;  4LO6 B;  4HZF A;  4S2F A;  3BTZ A;  5FYI A;  4Y22 B;  4CUC A;  2VD7 A;  1LOF A;  4E9K A;  3T09 A;  3MIG A;  2D5F A;  4MH0 E;  3ORJ A;  3SIT A;  3QH7 A;  4NHL A;  1YFW A;  3MYX A;  3H3L A;  3N3H A;  2UYA A;  1JU3 A;  4Q4Y 3;  3S0M A;  3N9O A;  4TYS A;  3D8C A;  3BI3 A;  5BNO A;  1AR9 1;  4H2A A;  1PMI A;  1TNF A;  2QFE A;  3VBU B;  3ZPO A;  3DYO A;  5FKC A;  3ILN A;  3HR9 A;  1ENR A;  1DF0 A;  1FXZ A;  1UY0 A;  4X8P A;  1C8M 1;  3ON7 A;  4XXA A;  4A3X A;  2YY1 A;  1GQG A;  4YM1 A;  2DVF A;  2YFZ A;  3LIH A;  4LNV A;  5H9Q A;  1POQ A;  5ANQ A;  2XON A;  2WO3 A;  1JS9 A;  4CEY C;  1QEX A;  4BA6 A;  5L9R A;  4LO8 A;  1V70 A;  3N7M A;  3WZ1 A;  1A78 A;  1ZYB A;  1IS3 A;  3MEP A;  1AR9 3;  1QJE A;  1WME A;  3ZM8 A;  3IPV A;  1BYH A;  4IE4 A;  1Y9Q A;  2WYS A;  4ZHN A;  3FJS A;  1WCU A;  5CYY A;  1W0N A;  4RQP C;  3TNP B;  2WII B;  2HWB 2;  2OUJ A;  4I09 A;  4QAW A;  4CP9 B;  4URA A;  3DKQ A;  3WXP A;  5LA1 A;  1BLZ A;  2O8Q A;  4NHK A;  4OI1 A;  1SFP A;  2Q8O A;  3RWK X;  3OBR A;  3JCI A;  1L7R A;  1J83 A;  3ES1 A;  4OLL A;  1UIK A;  5ANN A;  1V00 A;  3A23 A;  4L11 A;  1AX0 A;  1RXF A;  4XEZ A;  4CDX B;  1VRH 2;  1VB4 A;  2FQP A;  2WZP P;  4QU2 A;  3WDT A;  2DYC A;  4OUM A;  1RTV A;  2JB8 A;  4I3G A;  2XJQ A;  4PI0 A;  4XET A;  4J1W A;  5GJ6 A;  4XQD A;  2R49 A;  1PGL 1;  2TUN A;  3NNL A;  1R64 A;  3W9A A;  3WF1 A;  5HPO A;  1X9P A;  1JYX A;  1V6K A;  3Q8E A;  3VZO A;  1QQP 1;  3AMH A;  4EN8 B;  4FTE A;  3J7N A;  3VBO A;  4KI5 M;  2XWJ B;  1GWL A;  2D6N A;  4UF0 B;  4LE3 A;  2FMY A;  1LAJ A;  5JXG A;  1DZQ A;  4OI0 A;  1Q43 A;  2HJI A;  1UXZ A;  2VZS A;  2P3J A;  3M3Q A;  1RUG 1;  1E5I A;  2Q4S A;  2VZU A;  5FZD A;  3OYW B;  3ZFF B;  1GWM A;  1VPH A;  2IZW A;  3WQ1 A;  2R0H A;  2A70 A;  4TTG A;  3ZFG A;  1S0J A;  2V73 A;  3OGV A;  3U75 A;  3W5M A;  1UU6 A;  3TN9 1;  4KU7 A;  4JV4 A;  1V6I A;  4QQL A;  3TRS B;  2WN3 A;  4OZO A;  5FYV A;  3S7E A;  2W46 A;  3ZXJ A;  4BCU A;  2KR2 A;  4CUB A;  4PQQ A;  5D2A A;  1Y7B A;  5E88 A;  5K0U C;  3M1H A;  2EF6 A;  2BP6 A;  4JCK A;  4ZU4 A;  1J3Q A;  2X53 S;  3UGG A;  1WLT A;  4H7L A;  1S0E A;  4XBL A;  2RM2 2;  4IES A;  2D3S A;  4Z07 A;  2GDF A;  1W6N A;  1ZZ6 A;  1HRI 1;  2VVE A;  5F2S A;  4AYU A;  1TMF 3;  4ES9 A;  1GNH A;  2R30 A;  1SLT A;  4IGO A;  4Q0P A;  4F3J A;  3DPR C;  3WF3 A;  3O1T A;  1W2T A;  1D4V B;  1JYV A;  4AI3 A;  2O1Q A;  2E7A A;  1J3R A;  1BQP A;  1AYM 1;  1ZBE 2;  2VUA A;  4L99 A;  2DWR A;  4XXP A;  2XKP A;  5FDB A;  3JQX A;  4IV3 A;  5FYM A;  5CG9 A;  2QQN A;  2E7Q A;  2ID4 A;  1X33 A;  1C57 A;  1NXM A;  3SLI A;  1VBE 2;  3VBF C;  3VGI A;  5ABJ C;  5JDB A;  4XHX A;  2NZ9 A;  4OVE A;  4XF3 A;  1VMF A;  2H0B A;  5FQ0 A;  5FY5 A;  5C70 A;  3BU7 A;  2JB4 A;  1V9U 1;  2GME A;  4RR3 A;  2E31 A;  1QQP 3;  3IMN A;  3NO8 A;  2C5D A;  1Q8S A;  3V56 A;  1NCQ A;  2Z4F A;  2XJU A;  4A7K A;  1M06 G;  1QQP 2;  4XF1 A;  4DEQ A;  1ZZB A;  4N8M A;  5CNA A;  3I7D A;  4A41 A;  2GND A;  2ORX A;  4BZ4 A;  2LW8 A;  1NXD 1;  3NV3 A;  5JMO A;  1R09 3;  2ARE A;  2D3R A;  4UFM A;  3OD4 A;  1DYP A;  2BOJ A;  3MW4 A;  1R09 2;  1B35 A;  1Q5O A;  3BN6 A;  1WZX A;  2RJK A;  3FFZ A;  3OY8 A;  1DFQ A;  1ND3 A;  3C7H A;  3HQU A;  4UAP A;  4FOQ A;  2PXJ A;  2GN3 A;  4MGI E;  1IS4 A;  1OF4 A;  2JDH A;  2XL9 A;  3VHO A;  1ASJ 2;  2P34 A;  5KR7 A;  1W6N B;  2XWB B;  2ZEY A;  4YVS B;  3O14 A;  5GZD A;  5JOW A;  4CDW C;  4QX8 A;  2F4P A;  3ZXE A;  2HWE 3;  2VOK A;  2VZ3 A;  2PN5 A;  3A4U A;  3AZW A;  1DU3 D;  1QOS A;  3B9I A;  3VBU A;  4EWA A;  1IZ3 A;  4LBQ B;  3CJI A;  3VBF B;  4XIK A;  3OD0 A;  3PNA A;  1XE8 A;  1G9D A;  5C3S A;  1H2K A;  4XAA A;  3AJY A;  1E5R A;  1KDK A;  2C0Z A;  2YZ4 A;  1DZR A;  4XAE A;  1TE1 B;  1F8V A;  1UY4 A;  1F9K A;  4LBK A;  1QF3 A;  4OHX A;  3AP6 A;  2A6W A;  2W1U A;  1YFU A;  1W39 A;  2XXZ A;  1NCQ B;  1PGW 1;  3ZKU A;  3LDK A;  3WDX A;  5JCT A;  4O61 A;  4AHY A;  3HNB M;  4P02 B;  4QPW A;  3O1V A;  4QXH A;  5D1I A;  2XLA A;  2WT2 A;  1DGW X;  4JDN A;  1AYN 2;  5FQ0 B;  4ORF A;  1JOP A;  4ZU7 A;  4CP9 A;  4FBF A;  4D6S A;  3ZO0 B;  5JXI A;  3LSD A;  3V0A A;  2IXC A;  1MQT A;  1RUH 2;  2WC2 A;  1FMD 3;  5KHI A;  3GZT B;  4CUA A;  1GMM A;  1ULC A;  4NRO A;  2Z2S B;  3UKV A;  3WNK A;  3O1S A;  2VCM A;  3JZV A;  1PHM A;  4QX7 A;  4F8A A;  3ETP A;  2RS5 2;  4C0B A;  3VHP A;  1XE7 A;  1VBC 2;  3RMY A;  2I07 B;  3BTA A;  3JB4 C;  1AX1 A;  4OUS A;  3ZYR A;  2SLI A;  4UWD A;  5FUI A;  1UYY A;  4YVW A;  1CJD A;  2J7M A;  4GD4 A;  4MG2 A;  2ZML A;  3MIE A;  2WJS A;  2UY9 A;  2R1D A;  1UYX A;  3PVB B;  3LKJ A;  5HCH A;  4R9B A;  3WNP A;  2VZQ A;  2DFC A;  1VBB 3;  1MS0 A;  1GR3 A;  2B39 A;  3E1F 1;  4WBB A;  1UCX A;  1GZC A;  3S5A A;  1CON A;  1APN A;  1HKD A;  2WZR 2;  3GZA A;  3H7J A;  2RM2 3;  4A2U A;  4CEW B;  2QQJ A;  3POI A;  1XJA A;  2JEM A;  4O9E A;  1PMH X;  1HDK A;  1RUG 3;  4UYB A;  4XTP A;  4ES8 A;  1AR7 3;  4BM8 A;  3V0B B;  2R06 3;  3OJB A;  4GH4 C;  4Y20 A;  3TEX A;  5E6H A;  4TZD A;  4A7Y A;  4LUL A;  3WD5 A;  1S2E A;  2E9Q A;  3D6E A;  5C3O A;  5JIA A;  1J84 A;  1HRV 2;  5IVC A;  4N53 A;  3WW1 A;  1GU3 A;  3ZIX A;  3J7M A;  3MIH A;  1C5I A;  1WA4 A;  1OUS A;  1X7N A;  4QHZ A;  5A7S A;  1R08 3;  4YGB A;  2JG9 C;  2R32 A;  3MFA A;  1V6M A;  2YC0 A;  3AFG A;  2JE9 A;  2O0O A;  4YZ1 A;  5J48 A;  1NAE A;  1VE0 A;  4QPY A;  5KXD A;  4A6O A;  1W8U A;  5DZF A;  1B09 A;  1VB2 A;  1S0G A;  2F6B A;  2GC0 A;  2JE7 A;  1NZI A;  5D8A B;  3S30 A;  1LNS A;  3ENR A;  4FXK B;  5FZG A;  3V0B A;  3NJZ A;  3HEI A;  4I0B A;  1CAU A;  3CJI C;  4FCA A;  4B7E A;  3W5N A;  4M4P A;  5FMO L;  3FX3 A;  3RRD A;  1HB3 A;  3KV4 A;  1KXG A;  1XNT A;  2XL7 A;  5CFD A;  1QJU 3;  2W08 A;  4UFI A;  4NN0 A;  5FZI A;  3THC A;  2H6B A;  4X6Q B;  1VLN A;  1ZA7 A;  2P6H A;  1XYP A;  3IB3 A;  1W8H A;  4MGY E;  2Z69 A;  1A34 A;  4Q27 A;  3NAP B;  3K2O A;  4W6W A;  3EHK A;  1V6J A;  4XF4 A;  1DYK A;  3NJX A;  4NPM A;  2GSY A;  1J1T A;  3U11 A;  2G1M A;  3UKN A;  1G9C A;  4HVO A;  3LFI A;  3N9P A;  4PF1 A;  2RR1 1;  3AVS A;  3EB7 A;  3HNY M;  2YU2 A;  3PDQ A;  4M3C F;  3I4I A;  5GLW A;  1PO1 1;  4M3C B;  2YMZ A;  4IXL A;  3FLP A;  1MQT B;  3NKT A;  2RHP A;  2VXJ A;  3H50 A;  4UOJ A;  3RFR A;  4B29 A;  1C8M 2;  1IQA A;  3GZU C;  4NHX A;  1DLC A;  2WZR 3;  2VBP A;  1K42 A;  2XB6 C;  2HWD 1;  2RMU 1;  5LZ6 A;  2P3Y A;  1HXS 3;  4B4P A;  3AX4 A;  2I74 A;  2IFW A;  1LED A;  1UPI A;  3AYE A;  4NWW A;  5ABJ B;  3ZXA C;  3OTF A;  3H3U A;  2FCU A;  3VBR A;  4RL7 A;  1R09 1;  4Y1Y A;  4QWN A;  4M00 A;  2D6P A;  1PO2 2;  1QJX 3;  4MX3 A;  4C90 A;  1G9A A;  4WV8 A;  3GGL A;  4W50 A;  2I2S A;  3EMR A;  3VDC A;  1PVC 1;  2CWM A;  5FLJ A;  1VBC 1;  4MUV A;  3M7A A;  5C8C B;  5A70 A;  2K0G A;  1KS5 A;  2ATF A;  1DG6 A;  5LRS A;  1UZ0 A;  2B7Y A;  4JZR A;  2JG8 C;  5C4W B;  3U0Z A;  2Y6G A;  4HVR A;  3J26 N;  2QVS B;  3ITQ A;  4HXC A;  4RHV 1;  4NII A;  3V64 A;  2XJT A;  4AWD A;  3WNX A;  2KA3 A;  2J1S A;  4YFZ A;  5I91 A;  4L97 A;  5DG1 A;  1UZV A;  2WWU A;  1V6L A;  2VZP A;  3LAG A;  4ZS3 A;  2ZGP A;  2TEP A;  3RZL A;  3PME A;  1LHV A;  1PZ8 A;  4HPK B;  2VL4 A;  2NLR A;  3ILR A;  4WZC A;  4OHZ A;  4AI0 A;  2OQ7 A;  1R1A 2;  4Y20 B;  3R0R A;  1SZB A;  2VM9 A;  2PQS A;  2J22 A;  3D4K A;  3CBN A;  3NW4 A;  5B4X A;  2JDY A;  1ZRF A;  4XCA A;  4Y24 A;  4Q1R A;  2GP3 A;  2HWF 1;  3LCP A;  1HRI 3;  4CTE A;  2GH8 A;  2W87 A;  3HPN A;  1S1A A;  3A22 A;  4I2O A;  3B5L B;  4XZP A;  5SV5 A;  3HIF A;  3MDP A;  2DTY A;  1LOG A;  2D6O X;  5FRA A;  2W5F A;  2B9U A;  1VAL A;  3URF A;  4P9X A;  1G6N A;  2F17 A;  4LLO A;  2DUR A;  4Q4V 2;  1VMJ A;  1UY3 A;  2J1V A;  4PCR A;  2BU9 A;  2WS9 2;  2EA7 A;  1VAV A;  3HJR A;  5FMC A;  4FFH A;  4D69 A;  4BQ4 A;  3PVE A;  3TN9 3;  5F5C A;  2D43 A;  4K7J A;  3C3V A;  4YWA A;  1BXH A;  2PLV 1;  3NV4 A;  5A1A A;  2XJP A;  4RR3 B;  1GKB A;  5L7O B;  4JDO A;  4E4Z A;  5ACA 2;  1XNK A;  1MS4 A;  2K9Z A;  1OQ1 A;  1JOD A;  2VEC A;  5FXW A;  5LBC A;  2MNG A;  1QJY 3;  2HWD 3;  4JHT A;  2ZXQ A;  2XLF A;  1POV 0;  4XE9 A;  5F3I A;  2VZV A;  2JKX A;  1C1L A;  5M0T A;  1OLM E;  2GNB A;  1LEC A;  4DB5 A;  1OH4 A;  3ACH A;  3SH4 A;  4S2D A;  1RVF 2;  3AKR A;  4FQ4 A;  2VNO A;  3ZYF A;  1GNZ A;  2RDS A;  3KCX A;  3VBU C;  1ACC A;  2XVL A;  1MEC 2;  1CZV A;  1DQ4 A;  3SXW A;  3VZL A;  3GF6 A;  2WUH A;  1VR3 A;  2DCJ A;  3U10 A;  4TXW A;  5F5A A;  2W0X A;  2P1B A;  4K3U A;  1RJ7 A;  4SLI A;  1ZRC A;  2HBT A;  4CZS A;  3L2H A;  5BNN A;  3H8R A;  3JBG 1;  4WVM A;  5BNP A;  4BYY A;  1GZW B;  1VBE 1;  3Q8C A;  5FCC A;  3T08 A;  3MV0 1;  4JDM A;  2EAK A;  4LEJ A;  2QQM A;  1FAY A;  1W06 A;  2HWE 2;  4MYE A;  5I0T A;  2VY0 A;  2W52 A;  3WLU A;  3J7H A; 
#chains in the Genus database with same CATH homology
 1D7P M;  3IDA A;  1PMJ X;  2EIB A;  3WNN A;  4A3Z A;  1OD3 A;  2EIC A;  4BXS V;  2W95 A;  3T2P A;  2W3J A;  3MUZ 1;  4YPJ A;  4XUO A;  3WF0 A;  1W9W A;  1GOF A;  2Y6L A;  1O8P A;  3UNP A;  4XUT A;  4P08 A;  2V5D A;  3MO4 A;  5DPN A;  1F4H A;  1JYW A;  1SDD B;  1UY2 A;  1JZ5 A;  2W47 A;  5EJZ B;  5DQ0 A;  4CUC A;  2J1A A;  3DYM A;  3T09 A;  1K3I A;  4QB2 A;  3SKV A;  4DUX A;  3P6B A;  1JU4 A;  1JU3 A;  3MV1 1;  1TG7 A;  3THD A;  3K4D A;  4RYD A;  3DYO A;  1UY0 A;  2VJX A;  3GXU A;  3CMG A;  2E33 A;  2YFZ A;  1JHJ A;  1W8N A;  1UMI A;  2VTF A;  1US2 A;  2WO3 A;  2XON A;  2EID A;  4QDQ A;  2LS6 A;  1CZT A;  2DCK A;  3WF2 A;  3OEB A;  3D3A A;  5JXH A;  1K45 A;  3ZM8 A;  2Y6H A;  5HXM A;  2BER A;  4QDS A;  2WYS A;  5CYY A;  4DXT A;  1W0N A;  3SKJ E;  3I2F A;  5LA1 A;  4QAW A;  4MAD A;  3WNO A;  2VZT A;  1W8O A;  1L7R A;  1ULP A;  1XNA A;  1J83 A;  5IFP A;  2X09 A;  4A44 A;  4JHZ A;  3UET A;  3A21 A;  4LKS A;  5EJ1 B;  3JXS A;  4QX1 A;  2VOT A;  1R64 A;  1OF3 A;  3WF1 A;  5HPO A;  3I2J A;  1JYX A;  2WZE A;  3T2Q A;  3K77 A;  2VME A;  4KI5 M;  2BBA A;  3FHA A;  5JXG A;  1IQD C;  1UXZ A;  2VZS A;  3LPF A;  1F4A A;  2VZU A;  2VCC A;  3EYP A;  4TTG A;  3ACI A;  3OGV A;  3W5M A;  2W91 A;  3A23 A;  2QQI A;  1DYO A;  3OG2 A;  4FI9 A;  2WN3 A;  4OZO A;  4BK4 A;  4ZZ5 A;  2W46 A;  4CUB A;  4PQQ A;  2QQL A;  1I5P A;  2B9V A;  2RV9 A;  2W94 A;  4L0P A;  3GM8 A;  5IHR A;  2Y6J A;  5IJR A;  3WF3 A;  4BK5 A;  1JYV A;  2ZEW A;  4W4Z A;  3CIH A;  5G04 L;  4ARY A;  2J1T A;  2W1S A;  2QQK A;  2QQN A;  2ID4 A;  3LEI A;  3ACF A;  3K75 B;  3SEP A;  3ABZ A;  2BGP A;  3DYP A;  4MOA A;  4AG4 A;  5C70 A;  3PUH A;  1H6Y A;  2E31 A;  2ZEX A;  3CKH A;  3I2I A;  1HN1 A;  5I0D A;  2ZEZ A;  2Z4F A;  4CU6 A;  1NX9 A;  3I2G A;  4XUR A;  1GOH A;  3WEZ A;  4DEQ A;  3VDB A;  1GUI A;  3OGS A;  4A41 A;  2ORX A;  4LHS A;  3T0B A;  2LW8 A;  2W9X A;  5G05 L;  3I97 A;  5JMO A;  1UMH A;  3SEE A;  4CVU A;  3FN9 A;  4M4R A;  4ET7 A;  3T0A A;  1GNY A;  2XQX A;  3BN6 A;  1NKG A;  2VC9 A;  3C7H A;  3LEK A;  5JR2 A;  4UAP A;  2B4K A;  1WKY A;  4LPL A;  1JZ8 A;  2X10 A;  1OF4 A;  3VDA A;  1W9S A;  2ZEY A;  3U37 A;  2VZ3 A;  4DUV A;  1YQ2 A;  4OMD A;  2KD7 A;  4A45 A;  2J1E A;  1H6X A;  4CU7 A;  3T0D A;  4QX3 A;  2WAA A;  1GOG A;  1BHG A;  3HNM A;  2ORZ A;  1OT5 A;  5C7G A;  4E8D A;  5CZK A;  3NJV A;  3OGR A;  1JZ4 A;  2CDO A;  1UY4 A;  3IAQ A;  1XC6 A;  2V72 A;  4OYU A;  2W1U A;  2HLE A;  3HNB M;  1W9T A;  4P02 B;  4QPW A;  2CDP A;  1UX7 A;  3IAP A;  5C71 A;  1WCQ A;  2JE8 A;  5J1X A;  5JXI A;  1UY1 A;  4QX2 A;  4MO3 M;  2WO2 A;  1GMM A;  3MBW A;  3WNK A;  4CUA A;  1MPX A;  4JKL A;  2V4V A;  3ETP A;  3OBA A;  2Y8K A;  2VMD A;  3WNL A;  3WSO A;  1JZ2 A;  5FUI A;  1UYY A;  1PX4 A;  4GZ9 A;  2J7M A;  2WAO A;  3CZU A;  2C9K A;  2BGO A;  3K4Z A;  1UYX A;  3K46 A;  4HG6 B;  3WNP A;  4XVH A;  2VZQ A;  4A4A A;  4E8C A;  3E1F 1;  1W99 A;  3LE0 A;  2C26 A;  2WO1 A;  2QQJ A;  4P5Y A;  4ARX A;  1PMH X;  3C7G A;  1GQP A;  3CDZ B;  4DXS A;  2WN2 A;  3F2Z A;  3FL7 A;  2VO5 A;  2X05 A;  3ECQ A;  1P8J A;  3C7O A;  4Z2A A;  3WNM A;  3FHQ A;  3WF4 A;  1J84 A;  2VQU A;  2BZD A;  1GU3 A;  2WBK A;  3VD7 A;  4KWU A;  3C8X A;  1PX3 A;  4ZXE A;  3BGA A;  2W1W A;  1NAE A;  4PT6 A;  4A6O A;  3OEA A;  2VMF A;  4JKM A;  2WAB A;  4XUP A;  4QDR A;  1LNS A;  1UYZ A;  1TVG A;  3HEI A;  2YFU A;  3W5N A;  3C7E A;  3VD3 A;  4GWI A;  4M4P A;  2VQT A;  4ZZ8 A;  1KGY A;  1XNT A;  4XZU G;  3NQH A;  3THC A;  1UXX X;  3NRU A;  2W1Q A;  1CX1 A;  1DP0 A;  2WZ8 A;  3IB3 A;  3GDB A;  4JX0 A;  3NJX A;  3I2K A;  2RVA A;  5DMY A;  2E26 A;  4PF1 A;  5IFT A;  1JYN A;  1NUK A;  3EB7 A;  4XUN A;  3HNY M;  4KMQ A;  2DDU A;  3T2O A;  4OUE A;  5EIY B;  4UOJ A;  3VD4 A;  1O59 A;  2RJ2 A;  1DLC A;  3LPG A;  1JZ7 A;  1K42 A;  5LA2 A;  2L9L A;  2VZO A;  3HN3 A;  4DUW A;  3I3E A;  2J1U A;  4MGQ A;  4OMC A;  5JXJ A;  5B4N A;  1JZ6 A;  1SG3 A;  1O8S A;  3GGL A;  2C4X A;  4JKK A;  4W50 A;  5LCW L;  3VDC A;  2VR4 A;  4QB6 A;  3VD9 A;  4UI9 L;  2OKX A;  1T2X A;  1ULO A;  1UZ0 A;  2JD9 A;  4XUQ A;  1CZS A;  2Y6G A;  3LQC A;  2QBX A;  4D0Q A;  2WQ8 A;  2YG0 A;  4MGS A;  1RYY A;  2YC4 A;  2J1S A;  4IUG A;  1EUU A;  2VZP A;  4CU8 A;  4CU9 A;  3K4A A;  5IYY A;  4QB1 A;  2VL4 A;  2WDB A;  3WQB A;  2VZR A;  2VM9 A;  2PQS A;  2J22 A;  3ACG A;  5B4X A;  4DEV A;  5DN2 A;  4LQR A;  2R7E B;  1UWW A;  2W87 A;  3HPN A;  2J1R A;  3A22 A;  2W92 A;  3MUY 1;  2EIE A;  2W5F A;  4QX0 A;  1KEX A;  3DEC A;  3UES A;  4A42 A;  3C7F A;  5F7U A;  4RN5 A;  4ZY9 A;  1UY3 A;  2J1V A;  2QQO A;  2XOM A;  3HJR A;  1JI6 A;  1CIY A;  3LEG A;  4W8J A;  4BDV B;  2Y6K A;  3I3D A;  5A1A A;  3HOB A;  1K12 A;  4GWJ A;  5JUV A;  1SHW B;  2ZXQ A;  2VCA A;  3OB8 A;  2VZV A;  2JKX A;  3CQO A;  4AAX A;  1OH4 A;  3NNG A;  2YB7 A;  1JZ3 A;  3ACH A;  3CZJ A;  4BJ0 A;  2VMC A;  4D8M A;  4P00 B;  2VZ1 A;  3A7Q A;  1CZV A;  2HYX A;  3I2H A;  2E32 A;  2Y64 A;  2WUH A;  2DCJ A;  2JDA A;  4TXW A;  1XPW A;  3III A;  3I3B A;  3PUI A;  2VCB A;  4DXR A;  3P1I A;  3VD5 A;  1EUT A;  1L7Q A;  3MV0 1;  3T08 A;  1US3 A;  2QQM A;  2XHN A;  5LA0 A;  3AC0 A;  2YC2 A;  3J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...