1W9SA

Structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
b'DLKNPYERIQAEAYDAMSGIQTEGTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLLGDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0236 PROTEIN
publication title Family 6 Carbohydrate Binding Modules Recognize the Non-Reducing End of Beta-1,3-Linked Glucans by Presenting a Unique Ligand Binding Surface
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
total genus 30
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1w9sA00
2Y64A 4MO3M 1J83A 3CZJA 2QQLA 2PQSA 5CYYA 2VR4A 3AC0A 4ZXEA 3J7HA 2W3JA 1L7QA 5DPNA 4CUAA 5JR2A 4KI5M 4LHSA 2W1WA 1UY2A 1IQDC 2YFUA 3ECQA 4A3ZA 3EB7A 1LNSA 3A7QA 1NUKA 3IDAA 2X10A 2V4VA 1JZ3A 1SHWB 4QB6A 3UESA 2VZTA 2YG0A 4D8MA 4ZZ8A 1UY3A 2Y6KA 4ET7A 2BGPA 1UYXA 4QAWA 1GUIA 4RN5A 3MV11 2VO5A 5C7GA 3LPFA 2JD9A 2YB7A 3I3DA 2JE8A 5C71A 3HPNA 2WO1A 3VD3A 4A4AA 4QX1A 2CDPA 1OD3A 5JXIA 1ULPA 4JKKA 1PMJX 3OEAA 5IFPA 2J1EA 3C7EA 1UX7A 4OUEA 2WO2A 4L0PA 3WNKA 2V72A 3ETPA 3T0AA 3VD9A 4XVHA 1CIYA 2WN3A 5EIYB 1UYZA 1UMIA 2W1SA 1JI6A 1H6YA 2ORZA 3C7OA 4OMDA 3VDBA 5IHRA 4UAPA 3GXUA 3GGLA 3FHQA 5LA1A 2QQIA 3WNMA 1I5PA 3ACHA 4HG6B 4JX0A 2EIEA 4Z2AA 3SKJE 1DP0A 1GNYA 3VD5A 2VMFA 3K75B 3VDCA 1NKGA 1JYWA 3I2GA 5IYYA 3EYPA 4JHZA 3C8XA 2QQJA 4BXSV 2YC4A 4DXSA 3HJRA 2X09A 3T0DA 3A21A 3ABZA 4W4ZA 4GWJA 4ZY9A 2Z4FA 1DYOA 2E31A 1US2A 3THDA 2WBKA 2VCCA 2QQMA 2XQXA 2W94A 1WCQA 5JXJA 4RYDA 4W8JA 1JZ5A 2VMEA 1XNTA 4XUPA 1O8PA 1UY0A 4GZ9A 3MUY1 2C9KA 4PF1A 4CVUA 5HPOA 3A22A 3MV01 1JU4A 3D3AA 4BDVB 2EIBA 3I2IA 3WNNA 4OZOA 3VDAA 3K4AA 4XUQA 3F2ZA 2VMDA 3K4ZA 3T2QA 2E26A 4LPLA 1OF3A 2R7EB 4AG4A 1EUUA 2VZVA 3C7GA 1OT5A 2W87A 3FL7A 4A44A 2C4XA 5DMYA 3UNPA 3C7HA 3U37A 5IFTA 4IUGA 1SG3A 1JZ4A 2DCKA 3OGVA 2Y6GA 3NNGA 5JUVA 1JHJA 4ARXA 4BK5A 1F4HA 1UWWA 1UY1A 2W91A 2X05A 4QX3A 2LS6A 3MBWA 1JZ8A 1JYXA 1RYYA 2DDUA 1UY4A 2W1UA 5FUIA 5C70A 1K3IA 2VTFA 4W50A 4QX2A 3T2PA 2W47A 3I97A 2VQTA 2J1VA 4A6OA 1JZ6A 4CU6A 2B4KA 4ARYA 3BGAA 3W5MA 1JZ2A 3WNLA 4E8DA 4CUCA 4P08A 3OGRA 2ZEYA 2VMCA 1JZ7A 1NAEA 3LE0A 3THCA 3JXSA 4KMQA 1W0NA 2E32A 4TTGA 2L9LA 2J1UA 2VQUA 1R64A 3LEGA 1H6XA 4UOJA 1UYYA 4DUXA 3K46A 3MO4A 2W5FA 4DEQA 4DEVA 4QB1A 2Y8KA 2W92A 3VD7A 3BN6A 4DUWA 4M4PA 1JYNA 3WF3A 4UI9L 4BK4A 3HOBA 2VZ3A 1W8NA 2BZDA 2EICA 3I2HA 1J84A 4E8CA 3NQHA 1K12A 2VZPA 4XUTA 5LA2A 3T08A 3GDBA 1MPXA 3CMGA 4PT6A 3WSOA 2XHNA 5EJ1B 1DLCA 3MUZ1 3HN3A 2RVAA 5EJZB 1UMHA 4A41A 1D7PM 4M4RA 2WN2A 3SEEA 2EIDA 3NRUA 1WKYA 3LQCA 2ORXA 4OYUA 3DYPA 2VJXA 1XNAA 4QDQA 2W1QA 3FN9A 1EUTA 2WYSA 4GWIA 3ZM8A 2ID4A 4P5YA 2VZRA 1UZ0A 1P8JA 5A1AA 3LPGA 2HLEA 2JDAA 3VD4A 2JKXA 3GM8A 1O59A 3OBAA 3ACGA 4XUNA 4DXRA 2W46A 2WUHA 2XONA 2ZEXA 4CU7A 2YFZA 2Y6LA 1XC6A 2QBXA 4MGQA 1KGYA 2Y6JA 3IAPA 3NJVA 1GU3A 3I3BA 1NX9A 4LQRA 4QDRA 3SKVA 4DXTA 2VZSA 1JYVA 3OG2A 3OEBA 1HN1A 3CDZB 2DCJA 4CU8A 2J1SA 2J22A 3OGSA 3WNPA 4QX0A 3WF0A 1OH4A 3FHAA 4TXWA 2E33A 4P00B 1SDDB 3SEPA 1UXZA 4OMCA 2VOTA 2QQOA 1K42A 3OB8A 3PUIA 4QB2A 1W99A 1O8SA 1JU3A 3I3EA 3HEIA 3T0BA 4DUVA 1UXXX 4D0QA 1PX4A 3WNOA 2BERA 1PX3A 3WF1A 5DQ0A 5F7UA 1XPWA 5JXHA 2WABA 2WZEA 1CZTA 3E1F1 2W9XA 3WF4A 3DYOA 3WQBA 2OKXA 1GOFA 3HNMA 5DN2A 2KD7A 3HNBM 3I2KA 2ZEZA 2C26A 4XZUG 2VZQA 1T2XA 3I2JA 3WF2A 3ACIA 3IAQA 5G04L 5JXGA 1KEXA 2V5DA 5B4NA 1GOHA 2VL4A 2ZEWA 2W95A 2J1RA 3A23A 3K77A 2B9VA 4LKSA 1GQPA 5G05L 4QPWA 4PQQA 1W9WA 4BJ0A 1PMHX 2WO3A 3UETA 1CZSA 1W9TA 4MADA 5IJRA 3ACFA 1US3A 3LEIA 2YC2A 2WAOA 4A45A 1TG7A 4XURA 2VZOA 1TVGA 3P6BA 2XOMA 3DYMA 1YQ2A 2QQKA 3LEKA 2WZ8A 4MGSA 3CZUA 2WQ8A 2WDBA 1OF4A 2VM9A 2J1TA 3CQOA 3NJXA 5CZKA 2J1AA 3IIIA 4XUOA 1GMMA 3HNYM 3WEZA 3IB3A 2J7MA 1W8OA 4CU9A 4QDSA 2VCBA 1W9SA 4CUBA 3PUHA 4JKMA 5HXMA 3K4DA 5LA0A 5JMOA 1BHGA 1F4AA 5B4XA 2BBAA 3W5NA 4P02B 3I2FA 5J1XA 3T2OA 4KWUA 2RV9A 2VC9A 2VZUA 2BGOA 2RJ2A 3C7FA 2CDOA 2LW8A 3CKHA 4AAXA 5LCWL 1CZVA 4A42A 4MOAA 4YPJA 4JKLA 1K45A 3P1IA 1ULOA 2VZ1A 2VCAA 2Y6HA 1CX1A 1L7RA 2QQNA 4ZZ5A 5I0DA 3T09A 2HYXA 2ZXQA 2WAAA 1GOGA 3CIHA 4FI9A 3DECA
chains in the Genus database with same CATH superfamily
5KC6A 3MHZA 1MZFA 4RFT0 4HONA 1FAYA 1V6MA 4K21A 4NN0A 4URTA 3VKLA 1BMV2 4UFJA 3ZO0B 1PO23 5FZAA 2ZZJA 2HBTA 3NV2A 3PVBB 2A75A 2RMU1 1RUI2 2VR4A 3AC0A 2H6CA 2A73B 2AREA 4YRDA 3A4UA 3NAPA 5JR2A 3NV1A 3UGFA 3UGGA 4S2HA 5IK5A 4A3ZA 1UF2C 4O7XA 3V0AB 4NHYA 4NOTA 4AI3A 2DWRA 2RS32 2FDHA 1RINA 3LIGA 4CDQC 5JZGA 1KS5A 4M3CB 3HBZA 3KB5A 2XKOA 2X10A 4Y4YA 3TB0A 4YVSA 3ZSMA 3JU9A 2VXRA 2AENA 4OI4A 1DQ6A 4CA9A 3KHCA 2VGDA 2VTXA 3VBOC 4QB6A 5ABJB 4D8MA 4GXLA 1GYKA 5AC91 3U4SA 5BNNA 3AL5A 4JQRA 4EWDA 5GLWA 5KC5A 4QAWA 1NZCA 1QIQA 2Z69A 3NSTA 2R1DA 1GUIA 2LUWA 2W68A 3MV11 2W39A 4FP3A 4PCRA 3BIEA 4F8AA 5FZ3A 2EXHA 2LROA 3JQXA 5FYVA 2VULA 3VBRC 3I2OA 1J59A 5C8CA 4N43B 4CCMA 1DYKA 1R091 2DYCA 1MEC2 1B35C 1MQTC 2DTWA 3N9QA 4YG0A 5F3EA 5F8PA 2P6HA 1HQWA 2CDPA 4A4AA 5M0TA 2VMIA 4JKKA 1N3QA 3LOBA 3N9LA 4YW4A 4CP2A 1UX7A 3PDQA 5A6QA 5D8AB 1OI6A 4YZ5A 1AX0A 2VTXJ 1ZRIA 2GNTA 4OULA 1ENRA 2X8KA 3WNKA 1D2QA 3ZFEB 4AHXA 3VD9A 1JYTA 4XVHA 4AVTA 3PJYA 3KZ4C 4S2FA 1S55A 1RUH3 3S5AA 2FCTA 1UMIA 1ZVFA 2PXJA 2WS91 4TLFA 3POJA 4PDWB 2R042 5IATA 2OXBA 2ARCA 3NJYA 2CYFA 4XF3A 5LZ6A 1MR5A 4UF0B 5CIRA 5E6HA 2KM2A 3VKMA 4DXZA 2D6LX 5A32B 1BBT3 4BHPA 1G86A 1QOSA 2VVEA 1RUD3 2WNUC 2FDFA 1SLTA 2JD4A 1REEA 1V6KA 2B7YA 2WSVA 4YM1A 3SKJE 1MACA 4QPIB 5EP9A 2G9ZA 3WHUA 1RUJ3 2DU1A 3K75B 4QM8A 2GU9A 2PFWA 3VDCA 1F8VA 1Q8VA 3OD0A 1AR62 3GBGA 2EF6A 1ZBE2 1CAUA 2AR6A 4QU2A 5FPVA 2GALA 2V5YA 5CKQA 2E6VA 2EXIA 1PGW1 4KG8A 4MSVA 4MXWA 4TN7A 1DHKB 4XIKA 4BXSV 3L9JT 4DXSA 3H7YA 1QJU2 1DZTA 3HD8B 4WM7A 5ISLA 3B5LB 4GA9A 4CXWA 3AJZA 4U2AA 3WY6A 4GWJA 1UAIA 2Z4FA 2A71A 3IPVB 4XBQA 2WBKA 5KBFA 4AR2A 2HWF1 4XQ4A 2W94A 2DCYA 5JAXA 1CPNA 4FP2A 3PVOA 2H0VA 1ASJ1 3RJRA 1C4RA 1W6NA 4RYDA 1AR91 1VBD1 3VHPA 1A34A 1SLBA 1JZ5A 3WG4A 4HVOA 3FHIB 4QKBA 4LO4B 4AFAA 1GZWA 4XAEA 4V2VA 1UZYA 1UY0A 3ZPYA 4GZ9A 4QT6A 2E9QA 5JI7A 4BE3A 4KL1A 3MV01 1WW7A 3LDRA 5FYMA 3WNNA 4BDVB 1YFUA 2BYVE 2PAKA 2YDEA 4Q4V3 1VAKA 4KG0A 4ZXKA 3AP6A 1O7FA 3K4ZA 3T2QA 3DKQA 2E26A 3MF6A 3T3YA 3H1YA 1BEV3 5EV7A 1EUUA 4XABA 1OT5A 4GWMA 2WR9A 2ATFA 4KQ7A 4AFCA 4AHWA 2IUWA 4ASMB 3EHKA 4IEYA 4OUSA 1D4M3 1TQ5A 1SG3A 3OOXA 1UZVA 5IFTA 3V0AA 1N3PA 1XYNA 3CU7A 3I8TA 3OGVA 1GP5A 2RDQA 4MV2A 1W2NA 5C9AC 4M3CA 2VE1A 1I6XA 4FPYA 1SCRA 1OFNA 5J96B 2Y6FA 4ARXA 1UWWA 2YGMA 3HWJA 2LS6A 1AXYA 1UY4A 2W1UA 2A6VA 2R6QA 3M1HA 2IFWA 3VDDA 5K7PA 2DUOA 5EHDA 1AR71 2VTFA 1FATA 4QX2A 1LCLA 1RUI1 3N36A 3POBA 4LA3A 2VQTA 4P9IA 5CFCB 3AKTA 5JLVA 1PMIA 1VR3A 1UW8A 4EV0A 5FZHA 4ZKTB 1JZ6A 3FLPA 3PTYA 3ENRA 3VBUB 4FOWA 3ZMNA 4E8DA 4CUCA 4PHZA 2UWAA 3N4MA 2VQ0A 2YYOA 5A7PA 1EPZA 3OGRA 4GMP3 5EYYA 3BTAA 5LBBA 3ZFGC 3I3MA 1AHSA 1ND2B 1NAEA 4B1LA 2MEV3 2ARXA 1ZRDA 1ZM1A 2R062 4N43A 4KMQA 2E32A 5DABA 5FY1A 4TTGA 4K8RB 1W0PA 4CDUB 2C5DA 3ALQA 4I01A 3O0WA 1UU4A 2RS12 3F95A 4XFBA 1R64A 3LEGA 4XMAA 1LJ7A 5EWSA 5FO7B 5JDBA 1H6XA 3J7LA 3ORJA 1UYYA 2VQAA 2NYYA 4WM8C 3K46A 2JJ6A 3MO4A 1LAJA 2VXJA 3TBDA 4DEVA 2BUKA 4YM2A 4LITA 3J7NA 3VD7A 1POV0 2P17A 2RR12 1G9AA 2HWD2 5I0SA 4LK7A 2ZX4A 2VBPA 1JOPA 2OYZA 5IVFA 5LW9A 1JYNA 4UI9L 1W8FA 3BYWA 3RMYA 2D5HA 3HOBA 5BY5A 2VZ3A 1W8NA 1A3KA 4IERA 1STMA 2XKPA 2BZDA 4PDWA 1KDKA 1J84A 1LHUA 2P4EA 2VNOA 3CEWA 3FBMA 2ARBA 4UF0A 4LO7A 3DKWA 2ILMA 5L73A 2YV8A 4MGZE 5A80A 3T08A 5FZ8A 2ZGQA 4FOYA 1H2KA 3BOPA 5A32A 1VBB2 1MPXA 3CMGA 4IEZA 2D5FA 1F5JA 5JCTA 1DZRA 3R6SA 2LRPA 5I93A 1FMD3 1TMF2 2O8QA 3MUZ1 2A70A 2Y0OA 3HN3A 1FNYA 1MS8A 1VB2A 3GHNA 4QPIA 5SV5A 1F5FA 5FYUA 4A41A 2VMHA 1W2UA 1V9U2 2WN2A 2WQ4A 3NRUA 4UW4A 3FZ3A 2ET1A 4OYUA 4GMP0 5HCBA 5HCFA 4PI2A 1D4VB 4IGPA 4LOSA 1VBA2 3WUDA 4JGYB 4CDXC 1XYPA 1BK0A 4CCDA 4P5YA 4ES9A 1ZBA1 5A1AA 3HT1A 3NL1A 3LPGA 1W8WA 3JBG2 2JKXA 4JGZB 1RUE2 2DTYA 5DDJ1 1W9YA 3CJXA 1G9BA 2ZEXA 3VN4A 1HV1A 5C3RA 2ZGNA 2YFZA 1AR83 1MS0A 3PIGA 3E5UA 4NO4A 1XC6A 1PNGA 1IS5A 1QOTA 4LE4A 5FOBB 3KF5A 3POYA 2Y6JA 4YZ4A 4CPBD 4ONUA 3POFA 4LO6B 3OCPA 4CP9B 1VBC1 4Q4X3 1LU1A 3OPWA 1UNBA 5KXEA 3AL6A 3GJAA 2RJLA 1GZTA 2VOVA 5C8CC 4K1YA 3O5SA 1OH4A 2PHDA 1RTVA 4ZS2A 1LKNA 2ZGRA 2XHKA 1YJLA 3ZXDA 1UXZA 3WHTA 2JG9B 1O4TA 3MICA 3VBSC 3O1TA 1O3TA 2WRAA 1UIJA 2JDMA 4L2NA 1QJY3 4NPMA 2PLV1 4M3CF 1DU3D 2W0XA 4CCCA 4UBGA 5BNPC 5JXHA 1O8SA 4XFIA 3I3EA 5FZKA 3JD71 4XJUA 5JR7B 1FPN1 2ZKNA 3HR9A 4UFLA 2YU1A 1RVF2 4L97A 3W58A 5J48A 1PX4A 2X5IC 1W8HA 4BQ5A 2BERA 2QQWA 1PX3A 1SACA 3DF0A 3OD4A 3RZKA 4AW7A 1QWRA 1XPWA 4S2GA 4CXYA 5CKNA 2WABA 1UU5A 3E1F1 4WZFA 4D7TA 4FCAA 2W9XA 4CE8A 3B9IA 1DF0A 2OKXA 4EROA 3OBZA 4AL9A 1HRI1 1GOFA 3LFIA 1RUC1 3TAYA 5DAPA 1L3JA 2JKBA 4K3UA 3VBUA 2CGNA 3KWVA 1XB9A 3FE5A 4TYSA 4YZ3A 2GMPA 4B7KA 1S0JA 4L9BA 3WF2A 3APBA 2XVKA 1ZYBA 4YARA 3ZIWA 1ND2A 2A7AA 3RSJA 2A1XA 4BMBA 1RMU3 4HVQA 2AACA 3LAGA 2V5DA 1GOHA 3B3QE 2P34A 1S0DA 2OUJA 2RDSA 1RHI2 2J1RA 3A23A 3WG2A 4LOTA 4G9SB 4I0AA 1RXFA 1S0BA 3D4KA 4FXKB 5ERLA 5A1LA 4YM0A 5GZDA 3AXEA 1WWYA 5DG2A 1IKQA 5HXVA 5KHKA 4UBHA 2TNFA 2ZACA 2Q1MA 5FO8B 1YIFA 4TSVA 1X8EA 4I2OA 3GBFA 4HZFA 1WCDJ 3UETA 1W9TA 4NE9A 1LGCA 1V6LA 3AKSA 5A3NA 4E4DX 4F83A 2A3WA 1YI7A 2VVDA 1CN1A 1US3A 3VZMA 3BPZA 4AVAA 4CCJA 4A45A 1FX5A 3AP7A 2E7AA 2HWF3 1FOD2 2RS11 3KV6A 1F9KA 1YEWA 1EV12 2R1BA 4P9JA 2Q8OA 1SLCA 3P5BA 1RJ8A 1QNYA 1VBD3 1OA3A 2KXLA 4IGQA 2JICA 4UFHA 2LM3A 2YY1A 4J1XA 4ISQA 4NPLA 1DQ2A 2YUEA 5GKAC 3OJBA 2VM9A 3WV6A 1A8DA 4Y24A 2XJVA 1WMXA 2LTNA 3H8XA 4MGYE 4AYUA 1PHMA 2NPIA 2J1AA 3BU7A 4HKWA 2JDNA 3DXTA 3IIIA 4JGYA 4W65A 2ZMLA 3V65A 1PIV2 1S4CA 2BQPA 1TEIA 2Q4SA 4UFKA 2XJRA 5C3SA 1REFA 1YO8A 1UIKA 3MW4A 3IZOA 4Q8LA 1LHWA 1YWKA 4PIZA 1Y3TA 3HIFA 1LOBA 1W9SA 2QZ3A 2RDNA 4IV1A 4ZONA 4CPBA 5HXMA 1ULCA 3PMEA 4Q29A 2WNEA 4LORA 4Y1UA 1CAWB 3ZYFA 5B4XA 1RUNA 1J1LA 5F6KA 1IS6A 4R9AA 3MDPA 2RMU2 4RS5C 2MHFA 1NY71 2RV9A 1YRZA 3FC0A 4CP9A 4DZGA 2RS51 3URFA 4EN8B 4NAMA 3GZAA 5FV3A 3VBHA 1XNCA 3RZJA 4FBFA 2LW8A 3CKHA 1PM7A 3BTYA 4L99A 5LCWL 4MOAA 4NAOA 4N43C 1XNDA 1WBLA 4JKLA 4XJWA 5A6XA 1AR73 2GNMA 2JWPA 2VZ1A 2VCAA 2XJPA 4HKLA 1RUI3 4JQTA 5FPUA 4ZHNA 1ZNPA 2JG9A 3JBG1 3VKNA 2OX0A 5T5JA 4Q8KA 2D3SA 4ZZ5A 4KNCA 2FMYA 3N9MA 5FYCA 1VE0A 2ZAAA 3VV1A 2VW0A 1O3SA 4EWAA 2WAAA 4EZHA 4O65A 4AVVA 5D8AC 1GOGA 2HWE1 3DECA 3ZXAC 3C2UA 4ZPIA 3ZFEC 2RS33 1ZZ8A 4TLGA 1QMJA 1QY4A 2AZ5A 5AC92 1HB4A 3WDWA 2GP3A 1J83A 5IAXA 2MPFA 2E7TA 3DXUA 3CZJA 2PQSA 4DMIA 2QVSB 2ZGKA 3ZYIB 3PUQA 4EJRA 4ZXEA 1AF9A 3U0ZA 4PDWC 3NAPB 1ZZBA 3WW3A 4C8DA 4YW2A 1AXKA 4XXAA 2YFUA 5LY2A 5J98B 5ACA1 2DU0A 2AEYA 5AFEA 4RGKA 3MZHA 5EQUA 4LO5B 5JZGB 3M3OA 2OIIA 3IKWA 1GWLA 1X82A 1R092 5GLZA 1UKGA 4IEOA 3TEXA 3BI3A 4AI8A 4YVSB 4LTAA 3IDAA 3CNAA 2VOKA 3UKTA 1VMJA 4MZUA 4Q1RA 4QPIC 5DZFA 3WDVA 2FZ2A 1PGSA 1SHWB 5CISA 2FCVA 4O9EA 4OHZA 3UESA 2OZ6A 4AK3A 5FP7A 2F6BA 2J42A 2YG0A 2A3YA 4HKOA 1WLWA 3ZFFA 4YFWA 1W90A 3HQXA 1FNZA 1MEC3 2XGXA 3KVAA 4XJZA 1AJKA 4ET7A 3LZZA 1YQCA 5LRSA 3PU3A 3ME2A 5A3TA 4BMEA 1OC1A 3SH4A 1LOEA 1UL9A 1OQEA 1O4YA 2WS92 1Q8OA 3SHRA 2BTVC 1VALA 2XVLA 1VMHA 2ZGOA 1NA1A 4RN5A 4AFBA 5AFBA 4Q4W1 2Z2SB 1ODMA 3LPFA 3M70A 2JD9A 3Q8FA 3ZYGA 3GJBA 5AVAA 2Y26A 2IXKA 3I3DA 5F5IA 2PA7A 2WO1A 3JCIA 3VD3A 3CLPA 3KD4A 1C5IA 3AYCA 2HBUA 3ZXKA 1XQNA 2D43A 2VNVA 4Y1VA 1S0CA 2R043 1XNBA 3N9NA 4D6SA 3USUA 3LDKA 3RI8A 1C1FA 5IFPA 1TME1 3UYJA 1A78A 4OUEA 4R9DA 1DGWX 3WDYA 4OI1A 1QOOA 2GNDA 2VVFA 2WO2A 2C1FA 2CV6A 4FOQA 4IE6A 4IETA 4GH4C 3S7EA 5IK7A 3NVCA 3AMNA 3ETPA 5IAVA 1CIYA 1PGW2 5APAA 1YHFA 1FYUA 5EIYB 3FBYA 4K7JA 5FZCA 1JI6A 1REDA 2WT0A 3KT7A 1H6YA 2R49A 4PLOA 2VUAA 4XDPA 4M3CE 3O1UA 1AR63 4OMDA 3C7OA 5IK8A 1S0GA 3VDBA 1LGNA 1ZBE3 1MZ5A 2OPWA 3AP4A 4E4HA 5BNOA 5C3PA 4UAPA 4ZU5A 4BISA 3ZSLA 4KWKA 3RZLA 2WO7A 3KS7A 1M06G 2QQIA 1HKDA 4IESA 4JTOA 3OF1A 1ASJ2 1DQ1A 4COWA 3ACHA 4XF4A 5H9QA 5C4WB 2IXHA 1QJU3 4HG6B 2EIEA 1AR92 2PHRA 3BVCA 3CL1A 1WCSA 2B42B 3LOIA 1GNYA 4LLOA 4WBBA 4AEDC 5KXBA 2N7GA 5I0UA 1YFYA 2BP6A 2IXJA 4XDOA 1G8WA 4N7UA 3VKOA 4MX3A 1I5ZA 1JYWA 5DAVA 3KGZA 4NHMA 1Y7BA 2CL2A 1XSQA 2V4AA 4JRLA 5IYYA 3AYDA 3EYPA 4QKFA 3C8XA 2MNGA 2PLV3 4MXWB 1CAWA 1QGLA 1UN1A 3GCWA 5CFCC 2ZHKA 5A7WA 5FYIA 4YGCA 3ILFA 4WM7B 1FPN3 3FFQA 5LBEA 2X09A 3LSEA 5HBAA 1G9CA 2NLRA 5LEKA 5GLUA 3A21A 1SBDA 5DAXA 5FXWA 5IUQA 4MGTA 4NIDA 1J3RA 1DYOA 1OVSA 4B4RA 1G9DA 2D98A 4FTBA 2XQXA 4YFZA 4YGDA 1ND2C 1SZBA 3H9AA 4COZA 1ZX5A 2ZMKA 4YW6A 3B94A 1KS4A 1W6NB 2Y60A 1PZ9A 4CDUC 3M8LA 3BODA 1ONAA 4D7SA 3FLTA 1NQDA 3Q8EA 3VBFB 1GZWB 2VMEA 4YZ1A 1XNTA 1N3OA 2WT2A 3IDEA 4H14A 2ZJCA 1O8PA 2JENA 3RS6A 4ORFA 3OGGA 3MUY1 4PF1A 3QLQA 4IE0A 3D0SA 2W2IA 4RFRB 4B4QA 3ZYJB 3ES4A 5FKCA 3QOPA 1WZXA 1MS5A 2OT7A 3VDAA 4EN7B 2NM1A 5EZWA 4JCKA 4XUQA 1AR72 5K0UA 4Q1PA 3F2ZA 5GLTA 4QQ2A 5GZFA 1OF3A 3FMGA 3WQ7A 4AG4A 4OI2A 3FL7A 3C7GA 2W87A 4LHNA 5FP9A 5L7OA 5KHGA 3BOWA 3KHBA 3SLIA 4EN6B 1HIXA 2CWMA 4AFMA 5K8SA 3RZMA 1V6NA 2C6SA 4Z92B 1GNZA 2Q1ZB 5FUNA 5HCAA 4HN1A 1XOYA 3AFGA 2ZX2A 3PMSA 4QMAA 3VGIA 1JTZX 3ROUA 1F4HA 1UY1A 1CIWA 1AL22 2VNRA 2R072 3WR0A 2D6NA 1V0AA 1JZ8A 1SEFA 2VAUA 3VDDB 1JYXA 5J09A 5A3WA 2R063 3DPRA 5FP4A 2K2SA 4W50A 4JGYC 1C8M1 3AZWA 3T2PA 2W47A 1W04A 2RS13 2J1VA 1BKZA 4AEJA 3MLJA 5C33A 1LHNA 2PHUA 5FZ0A 2VPVA 3BGAA 2A6YA 2FDJA 3WNLA 3LF7A 4JGZC 4LXLA 3PURA 3T4HB 2RR13 2F4PA 2HWD3 2ZMNA 1JZ7A 4C0BA 5FZBA 1O3RA 2CGPA 4Z82A 3RI9A 4I3PA 4GAZA 4CCLA 5FQ0B 4AF9A 1LOGA 2JG8A 3B00A 2BGCA 2FBEA 2P5BA 2IC1A 3A0KA 2XQRA 3S5QA 4UOJA 3KQRA 4Y5Z0 1YNAA 2XWBB 1H30A 1RUG1 4DUXA 1HXS1 1SFNA 1N47A 3NJZA 4XQWA 3SQOA 4YNIA 3SCGA 4COUA 5IVVA 2E51A 2QDRA 4QB1A 2Y8KA 5E88A 4R52A 2PAMA 5FZDA 1VBB3 2VBDA 1C8NA 3M3IA 4XE9A 1TMF3 2PQQA 4A2UA 3B69A 4LLFA 1D0HA 4LBQD 4MUVA 2JG9C 1OBNA 1X9TA 2I07B 4XW3A 3POGA 4AQ6A 2EICA 4GULA 4B29A 5L9VA 3ZYPA 1ZBA2 2FZ1A 3I2HA 4E8CA 1V9U3 3BCWA 2IVJA 3NQHA 1Q3EA 2GAUA 1K12A 5F6LB 2XUMA 1H8TA 1ST8A 5DUUA 5LA2A 4HBNA 4NIAA 1QJEA 3VHNA 1VBA3 2QQUA 2YROA 5DDJ2 5FK7A 4AI0A 4X6RB 1QXRA 2BNNA 5C4WA 2JB4A 2UY9A 1VIWB 1ENQA 1IZ3A 1DLCA 4HXCA 4NRMA 5J37A 2RVAA 5FFOC 1OA4A 3D6EA 3JBG3 4Q26A 1H8VA 1VBC2 2XL7A 5FZGA 2P3KA 1RUE3 4I09A 1J3QA 2ORXA 3LQCA 4JVAA 1J1TA 4MYEA 1NLRA 2HWE3 2VJXA 3LGRA 4R9CA 3TEWA 1HN0A 1XNAA 3MF9A 4QDQA 4FAGA 3BTXA 1AYN1 1ZZCA 2E63A 3ZM8A 4XFGA 3ZN6B 4EN9B 4AEKA 2B5HA 2VZRA 3W59A 1YFXA 3AYEA 1UZ0A 1P8JA 2K0GA 4ZU4A 1CESA 2HWC2 3GM8A 4E4SA 1VAVA 4XUNA 4QXCA 1AVBA 2W46A 4AQTA 2PLV2 1OLME 2WUHA 2A6ZA 2RM21 3KGLA 3R4DB 1Q8QA 3AP5A 4AGRA 4CU7A 1JODA 2FMDA 2ZGTA 2F4LA 3INAA 5FY9A 4OHWA 1DFQA 3KV5A 3JD72 4J1WA 1JOBA 1KGYA 2YXSA 1FPN2 3WP3A 4YLZA 3I3BA 3VBFA 4MLOA 2ZX1A 1CWPA 5FY0A 4W6XA 5JIUA 4NHXA 3EQEA 1A6CA 5ABJA 4P9LA 4DXTA 2VZSA 1BZWA 3OG2A 3ZSEA 5H9RA 1ND3A 2WWSA 4FPGA 1HN1A 3D8CA 5DZGA 4QPGB 4CU8A 5A6YA 1BVP1 2J22A 4A7KA 3ZN4A 3WNPA 2UY8A 3WINE 1NLSA 4XIOA 1GWMA 1PK6B 1GP6A 1RVF3 2DUQA 4RHV2 1WW6A 1HRI2 2VOTA 4OMCA 5HI0A 1RC6A 1RUC2 2QQOA 4D6QA 3HVDA 5CFDA 1K42A 4Y1ZA 1GZ9A 4LBLA 4EWEA 3OB8A 2DCTA 1Q43A 1NXMA 1POV3 4YZ2A 1W99A 2DV9A 4YVWA 1BXHA 1VP6A 3IBMA 4AGGA 4Q0UA 3LCPA 3VHRA 5IT6A 3HBKA 3O0XA 4NIHA 2B8MA 3E5XA 3OPZA 1PO11 4AFDA 1UXXX 5CB7A 1S0IA 3GCXA 3OBRA 2Z79A 2XB6C 2ZHMA 4JHTA 1VBE1 3WT3A 4CCKA 4LJHA 5FYYA 1TME3 5A3PA 4OLLA 3VZOA 5F1RA 1G7YA 3DYOA 1B09A 2XLFA 4KBBA 5EXOA 5F2WA 3S7IA 3IDBB 1LOCA 5A7OA 4LKFA 3HNMA 1RHI3 1V6JA 3UL2A 5DN2A 2KD7A 1C5HA 3S57A 4AHZA 1BLZA 1HJGA 1FT9A 3HNBM 1APNA 5FKBA 1WBFA 1JW6A 2SBAA 4IEQA 1PVC1 4LT5A 1T2XA 4AWDA 2ZZQA 4HPKA 3T4VA 3POSA 4OFGA 5JXGA 1WA4A 2XJSA 3ZR5A 4BIOA 4PLNA 4CEWB 3R4UA 5FQ0A 1XU1A 4E9KA 2PYTA 3GNEA 2DVGA 5F3GA 3T1MA 2VL4A 1AL21 2QTWB 2R071 2ZTNA 5GJ6A 3H8RA 3K77A 3WXPA 2VD7A 2OUHA 5LATA 1Y9GA 1Y9QA 4LBQA 5F37A 2B9VA 4LKSA 4UW3A 1FOD3 1HQLA 1LODA 1GQPA 1X50A 1ZZ6A 4Q4Y1 3QCWA 4ITCA 1EV13 2XXZA 4K20A 4IEVA 4XFAA 5G05L 5DG1A 4QPWA 2YHJA 3BUCA 2OS2A 1W9WA 1MVEA 4JDOA 3PTRB 1V6OA 1WD4A 3U11A 4BJ0A 1PMHX 2JEMA 1CZSA 3BU0A 2XBO1 3ZPOA 4MADA 3RZHA 4XTPA 5A6ZA 3RVHA 2WFF1 1CVNA 3U75A 5JOXA 1NLQA 1JBCA 1LGBA 3GZEA 1R1ZA 1WW4A 2VZOA 4FPJA 1R082 2DVDA 4IXLA 1PIV3 2XOMA 5HV4A 1NOVA 2JDKA 4I3GA 4BLIA 1HV0A 5JOWA 3POEA 4C90A 4MGSA 4XBLA 3U14A 1LOAA 3HQUA 3NAPC 1NY72 1DQ4A 2TUNA 2RS52 1LESA 1EYBA 4N53B 4CSWA 5A3OA 2J1TA 3BPSA 4LUMA 4RGAA 1C28A 4LK6A 3LKJA 3AVSA 1AUYA 5JZGC 4RR3A 1W05A 4XUOA 4GALA 2XJQA 2RMU3 1UYPA 1C3HA 3HNYM 4LE3A 4YVSC 3ZN6A 1H1IA 1W8OA 5FMOL 5KXDA 1ZRRA 4IV1B 4AHYA 5EFUA 2P1BA 5LEJA 4JKMA 4DOUA 5LK5A 2HWE2 5BNNC 5JMOA 4AAPA 5IVBA 4FSJA 2C0ZA 5JPNB 4FPFA 1BHGA 3CBNA 4XHBA 1IGOA 1YXWA 3H3UA 4I30A 5JSOA 1J3PA 2D3RA 1S2KA 4XXPA 3FUOA 1UPSA 3TNQA 4CDWB 1QEXA 2VC9A 4RSUA 3VBHB 1HDKA 5FCCA 3QH6A 2BGOA 1XU2A 3GYDA 4QPGA 3SNMA 4QGLA 1NCRA 4GIQA 2CDOA 2E53A 2GN3A 1CZVA 1EAH2 3JB4C 5F5AA 4A42A 3POIA 4AI1A 3NKTA 3RZZA 4BXFA 5ACA2 5AC93 1PK6A 2CAUA 4UT5A 3P1IA 4A7ZA 1CGPA 4JTNA 4E4ZA 2Y6HA 2QUOA 1HB3A 3O0VA 2R30A 4K1ZA 1L7RA 2OW4A 4Q0QA 1Y4WA 2HWC1 3N7LA 1W28A 2UYBA 4CP1A 5I0DA 2HYXA 2ZXQA 2GC1A 1PNFA 2RG4A 4HK8A 2AC1A 4BZ4A 2HWB1 3CIHA 4FI9A 4J25A 4FOVA 1VRH1 1RGSA 1QXJA 2BWCA 2P6CA 2XDVA 5FZ1A 3SCFA 3K51A 3WW4A 2FHRA 4YG3A 3J7MA 3K2OA 4MO3M 1R093 5JIAA 3ES1A 4XDQA 5C8WA 5LBCA 3LD8A 4R8HA 5E89A 2G4IA 4GQ7A 4LKDA 2D6PA 1LEMA 3J7HA 1IKPA 3PUSA 4QHZA 5DXDA 3PL0A 3J26N 4MH0E 4HN0A 3OTFA 1JOJA 5DPNA 3V0BA 4KI5M 4LHSA 4FFFA 4Q4W2 4D6RA 3ECQA 2EAKA 4OVEA 1CJPA 2XJUA 4WZCA 1OVPA 2C24A 3V64A 2RJKA 4OCTA 1W6OB 4RHV1 2PHFA 2GC3A 1NUKA 1UOBA 2WS93 2A3XA 1NXD1 5JSPA 4NPRA 1NE4A 5FZFA 4AQ2A 2V4VA 1O91A 2ZABA 3TYJA 4XEZA 3L2HA 3U10A 1TME2 3RJ2X 3ZFFB 1UOGA 4BLJA 5D21A 4BYYA 3N9PA 3FWEA 4ZZ8A 1DGRN 3I4IA 1DZQA 1UY3A 4CEWA 2UURA 1S0EA 2Y6KA 4ASKA 5FYSA 4WM7C 5FPAA 4QQPA 1UYXA 4CZSA 1VB4A 1NA1B 5SV8A 1OLMA 1RJ7A 3LWCA 5C7GA 1OSGA 1WMFA 5FJHA 5JWPA 2XVGA 3ATGA 5BXXA 1SLIA 1AXZA 4P9WA 1JXNA 2JE8A 1F35A 2K46A 4YW1A 3E6CC 1AYN3 3VBFC 1OD3A 5JXIA 3SH5A 1CPMA 1ULPA 1X9PA 2JE7A 2WT1A 3DGTA 5FZ9A 3USUB 5FO9B 2EXJA 5E16A 2CWSA 4YYOA 3L2YA 2XL9A 3SCHA 5F5QA 1WW5A 4QM9A 1QH6A 3WG1A 4C1XA 2XG3A 1GWKA 4BQ1A 3P3NA 1ASJ3 3AXDA 1QXPA 5C5TA 2WN3A 2ZPXA 5FBJA 4Y22A 1AR93 2VBBA 1UYZA 1O5LA 2JE9A 4AE2A 2OQ6A 1W39A 4R4ZA 3ZMOA 4PBOA 3EO6A 1XXNA 2ORZA 1BK1A 3G7DA 5BNOB 2O8OA 5H9PA 4N53A 5DZEA 1ULGA 2BVBA 5T5PA 5IHRA 4PI0A 3GXUA 5IVEA 3GGLA 4FQ4A 3FHQA 3W20A 4JV4A 4OHXA 4ASLA 4E2QA 1GBGA 1IG0A 1I5PA 5FAXA 2R0FA 3N9OA 2FDKA 2KR2A 4JX0A 4Z2AA 4BQWA 4FTEA 1DP0A 4H7MA 4AI2A 4B8EA 4DNYA 2VMFA 1MVQA 1V6IA 3OYWB 4P9XA 5FBZA 4FPLA 4AXOA 1NG0A 2GMMA 5FLJA 3VDDC 2BNOA 3VBOA 4JHZA 3NMBA 1R081 4Q0VA 4DB5A 1YCIA 1E5SA 2Q30A 1Z0HA 2QQJA 3A0NA 2VUDA 3IIAA 1Z78A 3H3ZA 3KLSA 4RGGA 5FZ4A 5A7WB 3WW1A 4URAA 2VY0A 3NW4A 4FXGB 4CDWA 4INDA 3ABZA 5JI9A 1NYWA 1OHFA 3O14A 4AVSA 2XPJA 1US2A 4YG6A 3NV4A 2RHPA 2VCCA 2IXIA 3H42B 5A33B 2XLAA 1E57A 1Z7S1 3GZUC 4JDMA 4HVRA 2FDGA 1SBFA 4N7IA 1F15A 2B9UA 3VBRA 1Q56A 4W8JA 3VZNA 3Q9OA 1B35A 4LBMA 3MIGA 4NIIA 4XUPA 5C5UA 3M7AA 4ATFA 5A1FA 5H9SA 4BM8A 1LTEA 2C9KA 2I45A 4NWWA 4AEMA 4CVUA 3A22A 4BQ4A 5HPOA 5AVPA 3WD5A 4FPHA 1JU4A 1UMZA 4HANA 1WLCA 1X8MA 5K0UB 3QACA 3O1RA 1C8M2 4BCUA 2G19A 5LASA 4MHRA 1YC61 1K5JA 1HRV2 3SITA 5L7OB 1AL23 1MZ6A 2R073 5FMCA 2VZVA 3R05A 2JDPA 2VU9A 3ILNA 2C4XA 3NV3A 1NQJA 3FLRA 5DMYA 3UNPA 3CF6E 1EAH1 1MZEA 4QX5A 4V2WA 4LA2A 1W06A 4XCAA 2ES3A 1T6GC 3BALA 1LULA 2DCKA 2UWCA 1W6OA 4Z07A 5A3LA 4G4FA 3NNGA 1IS3A 5JUVA 1JS9A 4SBVA 3ZN5A 1LENA 3E5QA 4BK5A 3ZKYA 3B7MA 3LA2A 2W91A 2X05A 1RUG2 3R4SA 2Z42A 4CYDA 1UU6A 1HXS2 3AB0A 2WYFA 3MGUA 4QX3A 3RZGA 3U1XA 2DDUA 1O3QA 5J36A 3DPRB 3AFKA 5GZCA 4B7EA 4IV3B 2YPJA 1K3IA 1TNRA 1AZDA 1ENXA 2D44A 3GHMA 3I97A 4DS0A 4FT8A 3TEZA 2DBNA 2ZOEB 4BQYA 1SLLA 2G9GA 3UJQA 3VL9A 1OKQA 5FXXA 3W5MA 1JZ2A 3K3OA 4HL0A 4P08A 3ZXEA 1VAMA 4META 1DYPA 1QHDA 4C91A 3TRSB 5CNAA 2FDIA 2PHXA 5A3UA 2ZEYA 2VMCA 4MGIE 4PIXA 5FYBA 4IEWA 4BU2A 3JXSA 4LNVA 3AZYA 4Q4V1 2JG8B 1GV9A 2H6BA 2VQUA 1W8UA 5L19A 3WP5A 1ZBA3 2YU2A 3NO8A 3B9CA 4NHKA 1DDLA 2PHTA 4B4PA 2VW1A 1ULDA 2P3YA 4FPEA 2VUJA 2WNOA 4XJAA 2G1MA 3RFRA 5DDJ3 4RA0A 3LB9A 3BN6A 4XACA 5IW0A 5IVJA 4DUWA 5FPZA 1W9FA 1W3VA 3WF3A 3GBWA 1UO9A 4QX7A 2DBIA 4BK4A 1OPOA 4QHBA 3WDTA 5FIXA 1AYN2 2CNAA 4S2DA 1CR7A 1J58A 1WUVA 2OZJA 3H0OA 3I3QA 1BYHA 1VBC3 3LIHA 1W3XA 4L92A 1DQ5A 3VBSB 1IPKA 1H8TB 3DV8A 4MG2A 2W08A 2VZPA 3WCSA 1K5MB 1CX1A 2HJIA 2O1QA 1XYOA 2ZS6B 3E97A 1UOJA 1WMDA 4FO9A 2CTVA 5FZEA 3VZLA 3W9AA 2RM22 1KD7A 3GDBA 5BNPB 1C1LA 4IL7A 4PT6A 4R9BA 4JDNA 2JECA 3UJOA 2XHNA 3H1WA 4IEUA 5EJ1B 2XJTA 5ANNA 4XFHA 5I91A 4JC1A 4DY3A 2X5IB 2HWC3 1MS1A 3OYWA 1UMHA 1VJ2A 1QNWA 4D7YA 5FWEA 2D93A 4H7LA 1WKYA 2NMNA 4KU8A 2BPA2 1RUF1 4Y20A 5LY1A 1U5ZA 1CD3G 2VG9A 5J7MA 1G9FA 2MEV1 4YW7A 3JD73 2W52A 2WZR1 2W1QA 1O5UA 4CTEA 1EUTA 4GWIA 5FPXA 2QZ2A 2ID4A 3VBUC 2A5ZA 2BW8A 4I0WB 2P37A 4QQOA 1W2TA 2JDAA 3VD4A 1O59A 3OBAA 4OQ9A 5FLHA 4DXRA 3JB8A 5A33A 2WA4A 2D7FA 2D6OX 2Y0IA 3DN7A 1QJX1 5JPMB 4M01A 2XONA 3KCCA 5A7QA 3ZFGA 3TWIA 4CEWC 2CSGA 2SLIA 2QBXA 1YIPA 4AVBA 3PU8A 4RHV3 1HRI3 3IAPA 3NJVA 1Y9MA 3VLBB 1RUC3 1NX9A 1PO12 1RB8G 2ET7A 5E8AA 2AYHA 1DG6A 5FJKA 4XF0A 3UKVA 3LA7A 2O14A 3SKVA 5BV6A 4Y1XA 1ND3B 1S2BA 1JYVA 3OEBA 1UKRA 1VBE2 1TZOA 2DCJA 3DEMA 3RG0A 3ZYRA 3IMMA 3OGSA 2HEYF 5CG9A 5A3MA 4HSJA 4QX0A 4EN0A 4TXWA 2PHLA 2E33A 4P00B 5EYXA 3WOGA 5LBFA 3SEPA 4BPZA 3EJKA 4O61A 3T2TA 5A7NA 5CFDB 3MPBA 2D97A 4Q0PA 4DY5A 5J3UA 3I59A 3AKPA 2ZAHA 1OFSA 3ZX7A 1ULEA 5LB6A 3ITQA 4YVWB 3PUIA 1OA2A 3ZIXA 1R1A2 4YM3A 2QJVA 1PVC2 3BB6A 4BQXA 4CEYB 1I9RA 4YGBA 4E27A 4XOGA 4DUVA 1LU2A 4NRPA 2ERFA 1S1AA 4Q5OA 2ZKLA 2DVFA 1WLTA 4OI0A 1JYIA 1Q5OA 1HW5A 3WNXA 3AZZA 2O0OA 2R32A 4DPNA 3WF1A 4N53C 4LBOA 5F7UA 4QGNA 3ZDSA 3RNSA 2GC0A 3AMQA 2IXCA 2XH6A 2WZEA 2KA3A 3CJIB 2HKXA 3VKFC 2BEOA 4IV3A 2D6MA 4RD7A 5CKMA 1AR81 1KITA 3MI8A 4Q4Y2 1ZA4A 5I0TA 1OXCA 2UWBA 3THTA 1DGWA 3RWKX 4U36A 3WG3A 3WF4A 1HRV1 4M0NA 4SLIA 2VCMA 3ZKUA 3O1VA 4P9YA 3FUQA 4OZXA 4CDXA 2ZHLA 3LA3A 5CVRA 1OKOA 4HETA 4Q4X1 4XYXA 1UZZA 2C26A 2WLQA 2ZEZA 4IV1C 4CXXA 3VZJA 1I1EA 3WP4A 2XBO2 4HPKB 3I2JA 3ACIA 2WFF2 1W6QB 2DFCA 3IAQA 4LULA 1KJRA 3ZOIA 4QQLA 2FQPA 1N1TA 3OUIA 4QPYA 3KVBA 4GJYA 1OH3A 3ZSKA 2OA2A 4MGKE 3SISA 2ZEWA 1S2EA 2W95A 2WNVB 4WVMB 1MS9A 4A6SA 4CDWC 4RS5B 3VBHC 1SPPA 2GC2A 1TE1B 3NNJA 1YI9A 3OUJA 4LBQB 5KHHA 2EXKA 1QJY1 2HYKA 1NE6A 4QQHA 3MPPG 1ZRCA 4UYBA 3O1MA 3MLKA 1R083 3RRDA 2WC2A 2E7QA 2JXAA 4PQQA 1RITA 3I7DA 1U12A 1IHMA 4CCEA 1SFYA 4NHLA 3K48A 2Q8DA 2RS53 5L9RA 2NMOA 3RQ0A 5GZGA 2IWGB 3VBSA 1ODNA 3ACFA 3KCYA 1VRBA 2VH9A 3OGJA 1K5MA 4QXKA 2YC2A 1YYNA 2WAOA 3EXUA 3KV9A 1PGL1 1RUOA 2P3JA 4R4XA 4XURA 1Z7S3 5T50A 4EQVA 1PVXA 5BNPA 2Q5TA 3FFZA 1TVGA 4LBKA 3AKQA 3K3NA 5FP3A 3DYMA 3Q8BA 2NN8A 1GANA 1YQ2A 3UKNA 4H3WA 2BWAA 3AM2A 1NT0A 3LEKA 2IVIB 2WZ8A 2ZHNA 1VLNA 4V1PA 1M4WA 2X5IA 4KGGA 1DQ0A 1XE7A 5D2AA 4FPCA 3MLLA 3CZUA 4QWNA 5T52A 2WDBA 3UK9A 4BH9A 3B01A 3WCRA 1UD1A 4RL7A 4C1WA 2ZCWA 3CQOA 4BOWA 5K4LA 5T3NA 5DUWA 3GZTB 3THPA 1WA6X 4FTSA 1RMU1 4RR3B 4ZU7A 5L36A 1LB2A 3H8OA 3ZXLA 5CAZA 3B93A 1HB1A 4X8NA 5JOYA 2WINB 3IB3A 4I02A 1ACCA 3WX5A 3H3LA 4CU9A 4QDSA 2PELA 2VCBA 4OUMA 4CUBA 1E5IA 2QDNA 4GKYA 3U4XA 3K4DA 3OBTA 1EAH3 1SQ4A 2HWB2 4H2AA 3ZFFC 5ACA3 2BV4A 3M3QA 1VRH2 3ON7A 5FZOB 1X7NA 1CAXA 4IEPA 1COV2 3AK0A 4KH9A 3W5NA 2BBAA 2BNMA 2OQ7A 4RQPB 4FFIA 4P02B 2ZGPA 1EPWA 3D5OA 3I2FA 3KQ4B 4Y26A 1A8MA 3CO2A 4KWUA 5IWFA 1NA1C 1GP4A 1W6PA 1QJFA 2D3PA 2P3IA 5JOZA 2QQPA 4LEJA 4BA6A 4N90A 4EYUA 2ZBJA 1NCRB 2RJ2A 2WIIB 2GSYA 3C7FA 5ANQA 4CP0A 4Q27A 3J8F1 3KM5A 4AVCA 4YPJA 5FOJB 1K45A 5FUPA 5D1IA 2DVBA 5LA0A 3WP6A 4IGOA 4WVVA 4A3XA 1AL0G 1GSLA 1QQP1 4JRAA 2LALA 4PJYA 3KSCA 2GDFA 4E2GA 3J9SA 3T09A 1SCSA 3P3PA 4Q4W3 3ZVXA 3VZKA 4GB32 4D0QA 4CEYA 5EPAA 1AYM1 3JZVA 2Y64A 5F3CA 5HCHA 2QFEA 4GH4B 2YBKA 2IZWA 3PUAA 3S6PA 2EVXA 2QQLA 4YGEA 1OPMA 5CYYA 3ZR6A 2Y38A 1FV3A 2Q8EA 4QU1A 2NP0A 4OHYA 5FPLA 2W3JA 5FTTC 3V0BB 1UZWA 1L7QA 3O1PA 4CUAA 5BNOC 5T5OA 3J4UH 4XF9A 2W1WA 1UY2A 1IQDC 3MIHA 3TN92 3UT0A 3PVEA 4QKNA 3LDBA 1N1SA 5FLIA 4EE2A 1OOPB 3CJIA 3EB7A 5A70A 3N35A 2OVUA 5C6CA 5I8SA 3QBQA 5CADA 4Y1YA 4B3NA 1C57A 1VPHA 2AUYA 1X36A 1LNSA 1YQ6A 1XE8A 3A7QA 4HOOA 1PO22 4MVTA 4DINB 3RDIA 4X6QB 1XSRA 1LRHA 1DLLA 4COVA 4F7ZA 3ETQA 4CUGA 3WLUA 1ZZ9A 4AEDB 4LBJA 1R1A1 4PF5A 1JZ3A 5KHJA 1S0FA 1AX2A 2VZTA 1W6QA 1WCKA 2Z5WA 2XR4A 1BMV1 1U5XA 3VHOA 4GJZA 3AJYA 4QGMA 5LWBA 2V73A 4P14A 2BGPA 5FPBA 2EIGA 5LA9A 3VL8A 5JVVA 1QU0A 1YQ5A 4QXBA 1NCQB 5FXVA 4WVZA 1CONA 2WNVA 3HT2A 4WVMA 1GZCA 4RS5A 1W6MB 2VO5A 2WWJA 1H0BA 5FZIA 3TEYA 1YJKA 3MEPA 3EBRA 2YB7A 3WDUA 1RUF3 2RS31 3HQRA 3S30A 3H1MA 5FY7A 2BOJA 1IPJA 2YC0A 4DFSA 5C71A 3HPNA 2CU5A 2ADEA 3VUOA 2WZR3 3BKZA 4QX1A 5GZEA 1JYCA 4IE4A 3WQ0A 2YGLA 2DURA 2IFRA 5GLVA 3SXWA 1PMJX 4QD2A 4F3JA 3O1OA 3OEAA 4N8MA 2JB8A 2J1EA 3C7EA 1W0OA 3SC7X 4FAHA 3NKGA 2WZPP 1ALYA 3OPTA 3AX4A 4L0PA 4CCOA 5D8AA 3WUCA 4QHOA 1QJX3 2V72A 4PBPA 3T0AA 5K0UC 4IEXA 3ZFEA 2K9ZA 3LSDA 3C3VA 4Y22B 2WL1A 4W6YA 2I74A 1GLHA 1F2NA 2W1SA 5L7OC 1DGLA 2CAVA 4N9HA 4HSLA 1BCXA 1JHNA 4EZ4A 1BJQA 4XJ8A 4FPOB 5FRAA 4KU7A 2JDZA 3AMPA 4K9SA 2Y34A 1Z7S2 4LO8A 3WNMA 5LA1A 2JDUA 1MEC1 4HFSA 2ZX0A 3UGHA 4CDQB 3NNMA 1RUH2 2V09A 2ARAA 1KJLA 5FXZA 3VD5A 4Q2FA 1NKGA 5JMCA 5CBLA 2OPKA 3I2GA 3VBOB 4UXAA 4IDZA 2ADDA 3DPRC 3KT1A 4IV3C 5FZOA 2D6KA 4UW5A 1BBT2 3FJSA 1I3HA 2H0BA 4FPKA 4RQPA 2YC4A 4XC9A 4XJ9A 4UWDA 4Z8BA 1RUD2 3HJRA 3PVNA 4GD4A 3USSA 5CA6A 5I8TA 2A6XA 4NROA 4UFIA 4YSFA 1IPSA 2R041 3T0DA 4W4ZA 1QH7A 4ZY9A 2RDRA 3M3EA 4A7YA 1RUJ2 2E31A 3NNFA 3THDA 1KDMA 4DRRA 1UOFA 4BWOA 4HMZA 1GICA 2XLGA 3IPVA 2XMLA 2QQMA 3ZSJA 1FI2A 2A6WA 1WCQA 4LHKA 5F5CA 1XJAA 5JXJA 3VBRB 2JG8C 1C8M3 1GR3A 2ENRA 1RIRA 4NUBA 1B35B 1MQTB 2YBSA 1HRV3 1ZZ7A 2C9AA 5FWJA 1OURA 2VMGA 1H4GA 2ZGUA 3MIFA 4IE5A 3I54A 2RE9A 1AR61 2IXLA 3WZ1A 2VOWA 1HQNA 3NWKA 1ZBE1 5KWRA 1MS3A 1COV1 2DFBA 3D3AA 2EIBA 3I2IA 1V70A 1UX6A 4OZOA 5GM0A 5FZMA 3DUIA 4GH4A 3K4AA 1H9PA 1Y43B 2VMDA 5BYNA 1QJU1 3PNAA 4NWVA 2WSUA 1KFXL 3M2MA 5IVCA 1HLCA 3KV4A 4LPLA 2R7EB 5F2SA 4XETA 1RUG3 1JH5A 1H1AA 1HXS3 4XTMA 1LECA 4A44A 4B1MA 1H8TC 1CAVB 3C7HA 1K5MC 3U37A 3BTZA 4IUGA 1DGRA 1OOPA 2AGSA 3FX3A 1JZ4A 2TBVA 2X29A 5C4WC 2Y6GA 2GP5A 3DL3A 3AKRA 2WNUB 4Q4V2 4CCNA 1OQDA 4NR1A 4Y33A 1JHJA 4OQ8A 3T1LA 3RYKA 2EA7A 4GB31 1BEV2 1HX6A 4AEDA 2PAEA 4AI9A 1W8TA 1DIWA 1UQXA 1QDOA 3MBWA 5GALA 3E6BA 1H2LA 1RYYA 3E6DA 5FUIA 5C70A 4O9GA 1D4M2 4FFHA 1XNKA 4LUKA 2VOXA 1AX1A 4Z1VA 1VMFA 1KFUL 1W8ZA 3B02A 5CFCA 3AP9A 1NCQA 5DAWA 4A6OA 4CU6A 2B4KA 3ZYHA 1N1YA 4M00A 3I2DA 1AJOA 5FZLA 4ARYA 3TNPB 1SFPA 1W6MA 3TN91 1X33A 4Z2WA 4K8FA 1E5RA 2ZGSA 4FFGA 2HH9A 4M0HA 3O1SA 5FMOS 3H50A 5T5LA 3LE0A 1PO21 2B46X 3THCA 5FMBA 1W0NA 5BNQA 2L9LA 2CY6A 4LIUA 2J1UA 4LR4A 4CDUA 3JQWA 2BBVA 3IDCB 3D0JA 1N1VA 1MS4A 1UCXA 4LHLA 3IT8A 4NRQA 5ABJC 3N7MA 1GQGA 1LOFA 1ND3C 1JUHA 3ZDVA 5K9YA 2W5FA 2FD8A 5FY4A 2JIJA 3Q8CA 3R0RA 2PHWA 5KXCA 4DEQA 4PQ9A 2W92A 1RUF2 2RM23 5TSWA 4YW5A 4D94A 2MEV2 4M4PA 1W2OA 2DCZA 2WZR2 4FQZA 4C0HA 1OUSA 3ZXGA 4ES8A 2YBPA 2NZ9A 5CFDC 4OHVA 3ZLIA 1FV2A 1QF3A 2JIGA 4MHUA 2AH2A 2VECA 4XFCA 1IG3A 3D82A 5B2GB 4GWNA 3MW3A 4YWAA 4YVWC 4XUTA 5FZ6A 5T54A 4CEYC 4HLTA 4XHXA 2GZWA 2R0HA 2R061 4D3WA 3QD6A 1QJX2 3J8F3 2ZX3A 5FYZA 1DBNA 5DAQA 1NZIA 5E1RA 5C9AB 5F39A 4Q0SA 3WSOA 4CDQA 4P9GA 4NVPA 1GQHA 3IN9A 1POQA 2ZA9A 5EJZB 4D69A 1QQP3 3GALA 2QCSB 4L8QA 2PMWB 1URXA 5FMDA 5BPXA 1D7PM 4M4RA 3ZXJA 2VUCA 3SEEA 2EIDA 4Y20B 1LEDA 4HT1T 1OUXA 4X8PA 2RR11 2BRTA 3CJIC 3MYXA 2HWD1 4KGQA 3N7JA 3DYPA 1AYM3 3RYRA 2F17A 2Y33A 5KR7A 4AZZA 3FN9A 2NQYA 2WYSA 3KCXA 1PO13 1QKQA 3IM0A 3TOJA 4PIYA 1FMD2 3GF6A 3KMHA 3UV9A 3RPQA 2BJSA 3Q8AA 2CHHA 3W21A 3S0MA 2HLEA 1CX4A 2JX9A 1ZRFA 1VBE3 3ACGA 2BDRA 3H8UA 1H2NA 4JGZA 3AYAA 3ZFGB 4XILA 3OUHA 4Y5TA 5I8YA 1VBB1 2Y6LA 4TWTA 1RUH1 4LIVA 5L9BA 1TMF1 4MGQA 1MQTA 4Y5SA 4GKXA 1GU3A 2PTMA 2DUPA 3AVRA 2Q8CA 2WNVC 5FP8A 1KRIA 4LQRA 3ACLA 3MFAA 4WM8B 4QDRA 1CQ9A 1V9U1 4DQAA 1Q8SA 3AMHA 1R1A3 1PVC3 5EJ3A 3CDZB 1FXZA 2J1SA 4W6WA 4NIGA 2ZGLA 3V56A 1VBA1 1BBT1 3WF0A 1RUD1 1OD5A 1AR82 3FHAA 5CEHA 1WD3A 3SMHA 3WVJA 2EALA 1SDDB 2GMEA 3DCQA 3OY8B 4LBNA 3T30A 1PM4A 3M4FA 3PIJA 4UFMA 3U07A 1RUJ1 3I59B 2CGOA 4K6BA 4I0BA 4Q4X2 1PZ8A 1CAVA 1RUE1 5IVYA 4QB2A 4BQ2A 3MFCA 1EP0A 1U5IA 1W2AX 4KWLA 4NMIA 3RMXA 4Q4Y3 1JU3A 3ILRA 3HEIA 5FZ7A 3T0BA 2I2SA 3N3HA 2WNUA 3KF3A 3JUUA 4XFFA 4XAAA 4DRVA 5CU1A 3WNOA 1YLLA 1KQRA 4XPVA 4XZPA 5IK4A 2XBO3 2BVVA 1OLRA 5DQ0A 2WFF3 1YFWA 1QJY2 1O6UA 3WQ1A 1CZTA 1Q8PA 3SH3A 4RR3C 3POWA 4J6GA 4DIQA 1DCSA 1BVVA 1ENSA 4ATEA 4CDXB 4TZDA 1JMUB 5FYHA 1KXGA 2UYAA 1IQAA 3N7KA 2VW2A 3I2KA 4UW6A 1SBEA 4XZUG 2BFUL 5DUXA 1RXGA 3IMNA 2VZQA 4FVVA 2GH2A 4XCBA 3ASIA 3RWNA 4MXVA 4XF1A 5G04L 2WQZC 1PGL2 4IW3A 2WFPA 4AQSA 1LR5A 2DVAA 4BB3A 5BNNB 1KEXA 4QKDA 5LK7B 1YQ8A 3ELNA 3O12A 4RQPC 3RYPA 1H2MA 1RVF1 2YZ4A 5B4NA 4L11A 2Q0AA 2ETEA 1GKBA 3EMRA 4LKEA 1BEV1 2DF7A 4JAAA 1SPPB 1XRUA 3H7JA 5HV0A 3CHXA 1PZ7A 2FCUA 1U0AA 4E2SA 4QPGC 1ZREA 1JUIA 1NCRC 1D4M1 1POV1 1TNFA 4COYA 1IOAA 1BQPA 4YW3A 3I49A 1H1MA 1PK6C 3VB9A 1ULFA 2GNBA 5F32A 1E5HA 5C8CB 1RMU2 5FR3A 1WCUA 4AGVA 3ST7A 2EAAA 5FK8A 1SMVA 2BOIA 1XE0A 3O7OA 2R16A 2WO3A 3AMMA 3PLQA 4HK9A 1D2SA 1WGPA 2YPDA 4IQPA 4AOCA 4K40A 4QX8A 2ZGMA 2BU9A 5IJRA 2XUEA 4DO0A 3LEIA 4WVWA 1GNHA 1LHVA 2B45X 1TG7A 3KT4A 2WLPA 2HEVF 5F3IA 3P6BA 4IE7A 5LRRA 3LFMA 2QKDA 1IS4A 5C9AA 2VNGA 1HB2A 1SLAA 1RHI1 2QQKA 4XBNA 4KBZA 1D0GA 1OLQA 3U78A 4GMP1 2WQ8A 1XBFA 1WMEA 1F31A 1OF4A 2HWB3 5DUVA 1L7LA 2XWJB 3MW2A 3OSDA 3PJQA 4G3YC 1VRH3 1OOPC 1W03A 3HMYA 3QH7A 3RGBA 2G9FA 4JZRA 3NJXA 1COV3 1T6BX 3J8F2 5CZKA 2HWF2 3HAGA 5C3OA 5F9TA 3HN1A 4Y4RA 1GMMA 4QXHA 2TEPA 1U5YA 3WEZA 5FYTA 2J7MA 1GFF2 1OQ1A 1QQP2 1VBD2 2X53S 1O4ZA 3AZXA 3G6JB 4H55A 5CG8A 5FY8A 1LHOA 3PUHA 5FREA 1CAUB 3AZVA 2GH8A 1JN2P 2JDHA 3MIEA 1CAXB 1FOD1 4ISRA 4LMFA 2YMZA 1H9WA 1OMIA 1AYM2 3PHMA 4ZS3A 5T55A 1EV11 1F4AA 3MIDA 2UU8A 2B39A 4XQDA 4XMIA 1ZA7A 3ZXFA 4Y3OA 4BQ3A 5J1XA 1NCQC 3T2OA 1W6PB 3M3CA 5I0RA 1H4HA 4N9IA 2VZUA 2WA3A 1QJZA 4WM8A 4GB33 1RL3A 2WWUA 3LEMA 2GN7A 2QE3A 3WW2A 4CRQA 5FDBA 1WLDA 5A7SA 4AAXA 2QNKA 5JSRA 1YUDA 4NJ4A 2BFUS 2QQVA 1PIV1 1QDCA 2P2KA 4KWJA 1FMD1 2Q1FA 2WJSA 1ULOA 2WKKA 1EY2A 1UPIA 3BIWE 3OY8A 4BIFA 3MIBA 4PLMA 1HJFA 1V00A 2PN5A 1SDWA 2JDYA 3NNLA 3ZYBA 5KHIA 5C3QA 2QQNA 2HEWF 1LOFC 3IWZA 1G6NA 5FY5A 2D40A 5BUVA 3TN93 3WDXA 3X29B 2AEZA 1CJDA 3WQBA 4P5HA 4WV8A
chains in the Genus database with same CATH topology
2Y64A 4MO3M 1J83A 3CZJA 2QQLA 2PQSA 5CYYA 2VR4A 3AC0A 4ZXEA 3J7HA 2W3JA 1L7QA 5DPNA 4CUAA 5JR2A 4KI5M 4LHSA 2W1WA 1UY2A 1IQDC 2YFUA 3ECQA 4A3ZA 3EB7A 1LNSA 3A7QA 1NUKA 3IDAA 2X10A 2V4VA 1JZ3A 1SHWB 4QB6A 3UESA 2VZTA 2YG0A 4D8MA 4ZZ8A 1UY3A 2Y6KA 4ET7A 2BGPA 1UYXA 4QAWA 1GUIA 4RN5A 3MV11 2VO5A 5C7GA 3LPFA 2JD9A 2YB7A 3I3DA 2JE8A 5C71A 3HPNA 2WO1A 3VD3A 4A4AA 4QX1A 2CDPA 1OD3A 5JXIA 1ULPA 4JKKA 1PMJX 3OEAA 5IFPA 2J1EA 3C7EA 1UX7A 4OUEA 2WO2A 4L0PA 3WNKA 2V72A 3ETPA 3T0AA 3VD9A 4XVHA 1CIYA 2WN3A 5EIYB 1UYZA 1UMIA 2W1SA 1JI6A 1H6YA 2ORZA 3C7OA 4OMDA 3VDBA 5IHRA 4UAPA 3GXUA 3GGLA 3FHQA 5LA1A 2QQIA 3WNMA 1I5PA 3ACHA 4HG6B 4JX0A 2EIEA 4Z2AA 3SKJE 1DP0A 1GNYA 3VD5A 2VMFA 3K75B 3VDCA 1NKGA 1JYWA 3I2GA 5IYYA 3EYPA 4JHZA 3C8XA 2QQJA 4BXSV 2YC4A 4DXSA 3HJRA 2X09A 3T0DA 3A21A 3ABZA 4W4ZA 4GWJA 4ZY9A 2Z4FA 1DYOA 2E31A 1US2A 3THDA 2WBKA 2VCCA 2QQMA 2XQXA 2W94A 1WCQA 5JXJA 4RYDA 4W8JA 1JZ5A 2VMEA 1XNTA 4XUPA 1O8PA 1UY0A 4GZ9A 3MUY1 2C9KA 4PF1A 4CVUA 5HPOA 3A22A 3MV01 1JU4A 3D3AA 4BDVB 2EIBA 3I2IA 3WNNA 4OZOA 3VDAA 3K4AA 4XUQA 3F2ZA 2VMDA 3K4ZA 3T2QA 2E26A 4LPLA 1OF3A 2R7EB 4AG4A 1EUUA 2VZVA 3C7GA 1OT5A 2W87A 3FL7A 4A44A 2C4XA 5DMYA 3UNPA 3C7HA 3U37A 5IFTA 4IUGA 1SG3A 1JZ4A 2DCKA 3OGVA 2Y6GA 3NNGA 5JUVA 1JHJA 4ARXA 4BK5A 1F4HA 1UWWA 1UY1A 2W91A 2X05A 4QX3A 2LS6A 3MBWA 1JZ8A 1JYXA 1RYYA 2DDUA 1UY4A 2W1UA 5FUIA 5C70A 1K3IA 2VTFA 4W50A 4QX2A 3T2PA 2W47A 3I97A 2VQTA 2J1VA 4A6OA 1JZ6A 4CU6A 2B4KA 4ARYA 3BGAA 3W5MA 1JZ2A 3WNLA 4E8DA 4CUCA 4P08A 3OGRA 2ZEYA 2VMCA 1JZ7A 1NAEA 3LE0A 3THCA 3JXSA 4KMQA 1W0NA 2E32A 4TTGA 2L9LA 2J1UA 2VQUA 1R64A 3LEGA 1H6XA 4UOJA 1UYYA 4DUXA 3K46A 3MO4A 2W5FA 4DEQA 4DEVA 4QB1A 2Y8KA 2W92A 3VD7A 3BN6A 4DUWA 4M4PA 1JYNA 3WF3A 4UI9L 4BK4A 3HOBA 2VZ3A 1W8NA 2BZDA 2EICA 3I2HA 1J84A 4E8CA 3NQHA 1K12A 2VZPA 4XUTA 5LA2A 3T08A 3GDBA 1MPXA 3CMGA 4PT6A 3WSOA 2XHNA 5EJ1B 1DLCA 3MUZ1 3HN3A 2RVAA 5EJZB 1UMHA 4A41A 1D7PM 4M4RA 2WN2A 3SEEA 2EIDA 3NRUA 1WKYA 3LQCA 2ORXA 4OYUA 3DYPA 2VJXA 1XNAA 4QDQA 2W1QA 3FN9A 1EUTA 2WYSA 4GWIA 3ZM8A 2ID4A 4P5YA 2VZRA 1UZ0A 1P8JA 5A1AA 3LPGA 2HLEA 2JDAA 3VD4A 2JKXA 3GM8A 1O59A 3OBAA 3ACGA 4XUNA 4DXRA 2W46A 2WUHA 2XONA 2ZEXA 4CU7A 2YFZA 2Y6LA 1XC6A 2QBXA 4MGQA 1KGYA 2Y6JA 3IAPA 3NJVA 1GU3A 3I3BA 1NX9A 4LQRA 4QDRA 3SKVA 4DXTA 2VZSA 1JYVA 3OG2A 3OEBA 1HN1A 3CDZB 2DCJA 4CU8A 2J1SA 2J22A 3OGSA 3WNPA 4QX0A 3WF0A 1OH4A 3FHAA 4TXWA 2E33A 4P00B 1SDDB 3SEPA 1UXZA 4OMCA 2VOTA 2QQOA 1K42A 3OB8A 3PUIA 4QB2A 1W99A 1O8SA 1JU3A 3I3EA 3HEIA 3T0BA 4DUVA 1UXXX 4D0QA 1PX4A 3WNOA 2BERA 1PX3A 3WF1A 5DQ0A 5F7UA 1XPWA 5JXHA 2WABA 2WZEA 1CZTA 3E1F1 2W9XA 3WF4A 3DYOA 3WQBA 2OKXA 1GOFA 3HNMA 5DN2A 2KD7A 3HNBM 3I2KA 2ZEZA 2C26A 4XZUG 2VZQA 1T2XA 3I2JA 3WF2A 3ACIA 3IAQA 5G04L 5JXGA 1KEXA 2V5DA 5B4NA 1GOHA 2VL4A 2ZEWA 2W95A 2J1RA 3A23A 3K77A 2B9VA 4LKSA 1GQPA 5G05L 4QPWA 4PQQA 1W9WA 4BJ0A 1PMHX 2WO3A 3UETA 1CZSA 1W9TA 4MADA 5IJRA 3ACFA 1US3A 3LEIA 2YC2A 2WAOA 4A45A 1TG7A 4XURA 2VZOA 1TVGA 3P6BA 2XOMA 3DYMA 1YQ2A 2QQKA 3LEKA 2WZ8A 4MGSA 3CZUA 2WQ8A 2WDBA 1OF4A 2VM9A 2J1TA 3CQOA 3NJXA 5CZKA 2J1AA 3IIIA 4XUOA 1GMMA 3HNYM 3WEZA 3IB3A 2J7MA 1W8OA 4CU9A 4QDSA 2VCBA 1W9SA 4CUBA 3PUHA 4JKMA 5HXMA 3K4DA 5LA0A 5JMOA 1BHGA 1F4AA 5B4XA 2BBAA 3W5NA 4P02B 3I2FA 5J1XA 3T2OA 4KWUA 2RV9A 2VC9A 2VZUA 2BGOA 2RJ2A 3C7FA 2CDOA 2LW8A 3CKHA 4AAXA 5LCWL 1CZVA 4A42A 4MOAA 4YPJA 4JKLA 1K45A 3P1IA 1ULOA 2VZ1A 2VCAA 2Y6HA 1CX1A 1L7RA 2QQNA 4ZZ5A 5I0DA 3T09A 2HYXA 2ZXQA 2WAAA 1GOGA 3CIHA 4FI9A 3DECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y64 A;  4MO3 M;  1J83 A;  3CZJ A;  2QQL A;  2PQS A;  5CYY A;  2VR4 A;  3AC0 A;  4ZXE A;  3J7H A;  2W3J A;  1L7Q A;  5DPN A;  4CUA A;  5JR2 A;  4KI5 M;  4LHS A;  2W1W A;  1UY2 A;  1IQD C;  2YFU A;  3ECQ A;  4A3Z A;  3EB7 A;  1LNS A;  3A7Q A;  1NUK A;  3IDA A;  2X10 A;  2V4V A;  1JZ3 A;  1SHW B;  4QB6 A;  3UES A;  2VZT A;  2YG0 A;  4D8M A;  4ZZ8 A;  1UY3 A;  2Y6K A;  4ET7 A;  2BGP A;  1UYX A;  4QAW A;  1GUI A;  4RN5 A;  3MV1 1;  2VO5 A;  5C7G A;  3LPF A;  2JD9 A;  2YB7 A;  3I3D A;  2JE8 A;  5C71 A;  3HPN A;  2WO1 A;  3VD3 A;  4A4A A;  4QX1 A;  2CDP A;  1OD3 A;  5JXI A;  1ULP A;  4JKK A;  1PMJ X;  3OEA A;  5IFP A;  2J1E A;  3C7E A;  1UX7 A;  4OUE A;  2WO2 A;  4L0P A;  3WNK A;  2V72 A;  3ETP A;  3T0A A;  3VD9 A;  4XVH A;  1CIY A;  2WN3 A;  5EIY B;  1UYZ A;  1UMI A;  2W1S A;  1JI6 A;  1H6Y A;  2ORZ A;  3C7O A;  4OMD A;  3VDB A;  5IHR A;  4UAP A;  3GXU A;  3GGL A;  3FHQ A;  5LA1 A;  2QQI A;  3WNM A;  1I5P A;  3ACH A;  4HG6 B;  4JX0 A;  2EIE A;  4Z2A A;  3SKJ E;  1DP0 A;  1GNY A;  3VD5 A;  2VMF A;  3K75 B;  3VDC A;  1NKG A;  1JYW A;  3I2G A;  5IYY A;  3EYP A;  4JHZ A;  3C8X A;  2QQJ A;  4BXS V;  2YC4 A;  4DXS A;  3HJR A;  2X09 A;  3T0D A;  3A21 A;  3ABZ A;  4W4Z A;  4GWJ A;  4ZY9 A;  2Z4F A;  1DYO A;  2E31 A;  1US2 A;  3THD A;  2WBK A;  2VCC A;  2QQM A;  2XQX A;  2W94 A;  1WCQ A;  5JXJ A;  4RYD A;  4W8J A;  1JZ5 A;  2VME A;  1XNT A;  4XUP A;  1O8P A;  1UY0 A;  4GZ9 A;  3MUY 1;  2C9K A;  4PF1 A;  4CVU A;  5HPO A;  3A22 A;  3MV0 1;  1JU4 A;  3D3A A;  4BDV B;  2EIB A;  3I2I A;  3WNN A;  4OZO A;  3VDA A;  3K4A A;  4XUQ A;  3F2Z A;  2VMD A;  3K4Z A;  3T2Q A;  2E26 A;  4LPL A;  1OF3 A;  2R7E B;  4AG4 A;  1EUU A;  2VZV A;  3C7G A;  1OT5 A;  2W87 A;  3FL7 A;  4A44 A;  2C4X A;  5DMY A;  3UNP A;  3C7H A;  3U37 A;  5IFT A;  4IUG A;  1SG3 A;  1JZ4 A;  2DCK A;  3OGV A;  2Y6G A;  3NNG A;  5JUV A;  1JHJ A;  4ARX A;  4BK5 A;  1F4H A;  1UWW A;  1UY1 A;  2W91 A;  2X05 A;  4QX3 A;  2LS6 A;  3MBW A;  1JZ8 A;  1JYX A;  1RYY A;  2DDU A;  1UY4 A;  2W1U A;  5FUI A;  5C70 A;  1K3I A;  2VTF A;  4W50 A;  4QX2 A;  3T2P A;  2W47 A;  3I97 A;  2VQT A;  2J1V A;  4A6O A;  1JZ6 A;  4CU6 A;  2B4K A;  4ARY A;  3BGA A;  3W5M A;  1JZ2 A;  3WNL A;  4E8D A;  4CUC A;  4P08 A;  3OGR A;  2ZEY A;  2VMC A;  1JZ7 A;  1NAE A;  3LE0 A;  3THC A;  3JXS A;  4KMQ A;  1W0N A;  2E32 A;  4TTG A;  2L9L A;  2J1U A;  2VQU A;  1R64 A;  3LEG A;  1H6X A;  4UOJ A;  1UYY A;  4DUX A;  3K46 A;  3MO4 A;  2W5F A;  4DEQ A;  4DEV A;  4QB1 A;  2Y8K A;  2W92 A;  3VD7 A;  3BN6 A;  4DUW A;  4M4P A;  1JYN A;  3WF3 A;  4UI9 L;  4BK4 A;  3HOB A;  2VZ3 A;  1W8N A;  2BZD A;  2EIC A;  3I2H A;  1J84 A;  4E8C A;  3NQH A;  1K12 A;  2VZP A;  4XUT A;  5LA2 A;  3T08 A;  3GDB A;  1MPX A;  3CMG A;  4PT6 A;  3WSO A;  2XHN A;  5EJ1 B;  1DLC A;  3MUZ 1;  3HN3 A;  2RVA A;  5EJZ B;  1UMH A;  4A41 A;  1D7P M;  4M4R A;  2WN2 A;  3SEE A;  2EID A;  3NRU A;  1WKY A;  3LQC A;  2ORX A;  4OYU A;  3DYP A;  2VJX A;  1XNA A;  4QDQ A;  2W1Q A;  3FN9 A;  1EUT A;  2WYS A;  4GWI A;  3ZM8 A;  2ID4 A;  4P5Y A;  2VZR A;  1UZ0 A;  1P8J A;  5A1A A;  3LPG A;  2HLE A;  2JDA A;  3VD4 A;  2JKX A;  3GM8 A;  1O59 A;  3OBA A;  3ACG A;  4XUN A;  4DXR A;  2W46 A;  2WUH A;  2XON A;  2ZEX A;  4CU7 A;  2YFZ A;  2Y6L A;  1XC6 A;  2QBX A;  4MGQ A;  1KGY A;  2Y6J A;  3IAP A;  3NJV A;  1GU3 A;  3I3B A;  1NX9 A;  4LQR A;  4QDR A;  3SKV A;  4DXT A;  2VZS A;  1JYV A;  3OG2 A;  3OEB A;  1HN1 A;  3CDZ B;  2DCJ A;  4CU8 A;  2J1S A;  2J22 A;  3OGS A;  3WNP A;  4QX0 A;  3WF0 A;  1OH4 A;  3FHA A;  4TXW A;  2E33 A;  4P00 B;  1SDD B;  3SEP A;  1UXZ A;  4OMC A;  2VOT A;  2QQO A;  1K42 A;  3OB8 A;  3PUI A;  4QB2 A;  1W99 A;  1O8S A;  1JU3 A;  3I3E A;  3HEI A;  3T0B A;  4DUV A;  1UXX X;  4D0Q A;  1PX4 A;  3WNO A;  2BER A;  1PX3 A;  3WF1 A;  5DQ0 A;  5F7U A;  1XPW A;  5JXH A;  2WAB A;  2WZE A;  1CZT A;  3E1F 1;  2W9X A;  3WF4 A;  3DYO A;  3WQB A;  2OKX A;  1GOF A;  3HNM A;  5DN2 A;  2KD7 A;  3HNB M;  3I2K A;  2ZEZ A;  2C26 A;  4XZU G;  2VZQ A;  1T2X A;  3I2J A;  3WF2 A;  3ACI A;  3IAQ A;  5G04 L;  5JXG A;  1KEX A;  2V5D A;  5B4N A;  1GOH A;  2VL4 A;  2ZEW A;  2W95 A;  2J1R A;  3A23 A;  3K77 A;  2B9V A;  4LKS A;  1GQP A;  5G05 L;  4QPW A;  4PQQ A;  1W9W A;  4BJ0 A;  1PMH X;  2WO3 A;  3UET A;  1CZS A;  1W9T A;  4MAD A;  5IJR A;  3ACF A;  1US3 A;  3LEI A;  2YC2 A;  2WAO A;  4A45 A;  1TG7 A;  4XUR A;  2VZO A;  1TVG A;  3P6B A;  2XOM A;  3DYM A;  1YQ2 A;  2QQK A;  3LEK A;  2WZ8 A;  4MGS A;  3CZU A;  2WQ8 A;  2WDB A;  1OF4 A;  2VM9 A;  2J1T A;  3CQO A;  3NJX A;  5CZK A;  2J1A A;  3III A;  4XUO A;  1GMM A;  3HNY M;  3WEZ A;  3IB3 A;  2J7M A;  1W8O A;  4CU9 A;  4QDS A;  2VCB A;  1W9S A;  4CUB A;  3PUH A;  4JKM A;  5HXM A;  3K4D A;  5LA0 A;  5JMO A;  1BHG A;  1F4A A;  5B4X A;  2BBA A;  3W5N A;  4P02 B;  3I2F A;  5J1X A;  3T2O A;  4KWU A;  2RV9 A;  2VC9 A;  2VZU A;  2BGO A;  2RJ2 A;  3C7F A;  2CDO A;  2LW8 A;  3CKH A;  4AAX A;  5LCW L;  1CZV A;  4A42 A;  4MOA A;  4YPJ A;  4JKL A;  1K45 A;  3P1I A;  1ULO A;  2VZ1 A;  2VCA A;  2Y6H A;  1CX1 A;  1L7R A;  2QQN A;  4ZZ5 A;  5I0D A;  3T09 A;  2HYX A;  2ZXQ A;  2WAA A;  1GOG A;  3CIH A;  4FI9 A;  3DEC A; 
#chains in the Genus database with same CATH topology
 5KC6 A;  3MHZ A;  1MZF A;  4RFT 0;  4HON A;  1FAY A;  1V6M A;  4K21 A;  4NN0 A;  4URT A;  3VKL A;  1BMV 2;  4UFJ A;  3ZO0 B;  1PO2 3;  5FZA A;  2ZZJ A;  2HBT A;  3NV2 A;  3PVB B;  2A75 A;  2RMU 1;  1RUI 2;  2VR4 A;  3AC0 A;  2H6C A;  2A73 B;  2ARE A;  4YRD A;  3A4U A;  3NAP A;  5JR2 A;  3NV1 A;  3UGF A;  3UGG A;  4S2H A;  5IK5 A;  4A3Z A;  1UF2 C;  4O7X A;  3V0A B;  4NHY A;  4NOT A;  4AI3 A;  2DWR A;  2RS3 2;  2FDH A;  1RIN A;  3LIG A;  4CDQ C;  5JZG A;  1KS5 A;  4M3C B;  3HBZ A;  3KB5 A;  2XKO A;  2X10 A;  4Y4Y A;  3TB0 A;  4YVS A;  3ZSM A;  3JU9 A;  2VXR A;  2AEN A;  4OI4 A;  1DQ6 A;  4CA9 A;  3KHC A;  2VGD A;  2VTX A;  3VBO C;  4QB6 A;  5ABJ B;  4D8M A;  4GXL A;  1GYK A;  5AC9 1;  3U4S A;  5BNN A;  3AL5 A;  4JQR A;  4EWD A;  5GLW A;  5KC5 A;  4QAW A;  1NZC A;  1QIQ A;  2Z69 A;  3NST A;  2R1D A;  1GUI A;  2LUW A;  2W68 A;  3MV1 1;  2W39 A;  4FP3 A;  4PCR A;  3BIE A;  4F8A A;  5FZ3 A;  2EXH A;  2LRO A;  3JQX A;  5FYV A;  2VUL A;  3VBR C;  3I2O A;  1J59 A;  5C8C A;  4N43 B;  4CCM A;  1DYK A;  1R09 1;  2DYC A;  1MEC 2;  1B35 C;  1MQT C;  2DTW A;  3N9Q A;  4YG0 A;  5F3E A;  5F8P A;  2P6H A;  1HQW A;  2CDP A;  4A4A A;  5M0T A;  2VMI A;  4JKK A;  1N3Q A;  3LOB A;  3N9L A;  4YW4 A;  4CP2 A;  1UX7 A;  3PDQ A;  5A6Q A;  5D8A B;  1OI6 A;  4YZ5 A;  1AX0 A;  2VTX J;  1ZRI A;  2GNT A;  4OUL A;  1ENR A;  2X8K A;  3WNK A;  1D2Q A;  3ZFE B;  4AHX A;  3VD9 A;  1JYT A;  4XVH A;  4AVT A;  3PJY A;  3KZ4 C;  4S2F A;  1S55 A;  1RUH 3;  3S5A A;  2FCT A;  1UMI A;  1ZVF A;  2PXJ A;  2WS9 1;  4TLF A;  3POJ A;  4PDW B;  2R04 2;  5IAT A;  2OXB A;  2ARC A;  3NJY A;  2CYF A;  4XF3 A;  5LZ6 A;  1MR5 A;  4UF0 B;  5CIR A;  5E6H A;  2KM2 A;  3VKM A;  4DXZ A;  2D6L X;  5A32 B;  1BBT 3;  4BHP A;  1G86 A;  1QOS A;  2VVE A;  1RUD 3;  2WNU C;  2FDF A;  1SLT A;  2JD4 A;  1REE A;  1V6K A;  2B7Y A;  2WSV A;  4YM1 A;  3SKJ E;  1MAC A;  4QPI B;  5EP9 A;  2G9Z A;  3WHU A;  1RUJ 3;  2DU1 A;  3K75 B;  4QM8 A;  2GU9 A;  2PFW A;  3VDC A;  1F8V A;  1Q8V A;  3OD0 A;  1AR6 2;  3GBG A;  2EF6 A;  1ZBE 2;  1CAU A;  2AR6 A;  4QU2 A;  5FPV A;  2GAL A;  2V5Y A;  5CKQ A;  2E6V A;  2EXI A;  1PGW 1;  4KG8 A;  4MSV A;  4MXW A;  4TN7 A;  1DHK B;  4XIK A;  4BXS V;  3L9J T;  4DXS A;  3H7Y A;  1QJU 2;  1DZT A;  3HD8 B;  4WM7 A;  5ISL A;  3B5L B;  4GA9 A;  4CXW A;  3AJZ A;  4U2A A;  3WY6 A;  4GWJ A;  1UAI A;  2Z4F A;  2A71 A;  3IPV B;  4XBQ A;  2WBK A;  5KBF A;  4AR2 A;  2HWF 1;  4XQ4 A;  2W94 A;  2DCY A;  5JAX A;  1CPN A;  4FP2 A;  3PVO A;  2H0V A;  1ASJ 1;  3RJR A;  1C4R A;  1W6N A;  4RYD A;  1AR9 1;  1VBD 1;  3VHP A;  1A34 A;  1SLB A;  1JZ5 A;  3WG4 A;  4HVO A;  3FHI B;  4QKB A;  4LO4 B;  4AFA A;  1GZW A;  4XAE A;  4V2V A;  1UZY A;  1UY0 A;  3ZPY A;  4GZ9 A;  4QT6 A;  2E9Q A;  5JI7 A;  4BE3 A;  4KL1 A;  3MV0 1;  1WW7 A;  3LDR A;  5FYM A;  3WNN A;  4BDV B;  1YFU A;  2BYV E;  2PAK A;  2YDE A;  4Q4V 3;  1VAK A;  4KG0 A;  4ZXK A;  3AP6 A;  1O7F A;  3K4Z A;  3T2Q A;  3DKQ A;  2E26 A;  3MF6 A;  3T3Y A;  3H1Y A;  1BEV 3;  5EV7 A;  1EUU A;  4XAB A;  1OT5 A;  4GWM A;  2WR9 A;  2ATF A;  4KQ7 A;  4AFC A;  4AHW A;  2IUW A;  4ASM B;  3EHK A;  4IEY A;  4OUS A;  1D4M 3;  1TQ5 A;  1SG3 A;  3OOX A;  1UZV A;  5IFT A;  3V0A A;  1N3P A;  1XYN A;  3CU7 A;  3I8T A;  3OGV A;  1GP5 A;  2RDQ A;  4MV2 A;  1W2N A;  5C9A C;  4M3C A;  2VE1 A;  1I6X A;  4FPY A;  1SCR A;  1OFN A;  5J96 B;  2Y6F A;  4ARX A;  1UWW A;  2YGM A;  3HWJ A;  2LS6 A;  1AXY A;  1UY4 A;  2W1U A;  2A6V A;  2R6Q A;  3M1H A;  2IFW A;  3VDD A;  5K7P A;  2DUO A;  5EHD A;  1AR7 1;  2VTF A;  1FAT A;  4QX2 A;  1LCL A;  1RUI 1;  3N36 A;  3POB A;  4LA3 A;  2VQT A;  4P9I A;  5CFC B;  3AKT A;  5JLV A;  1PMI A;  1VR3 A;  1UW8 A;  4EV0 A;  5FZH A;  4ZKT B;  1JZ6 A;  3FLP A;  3PTY A;  3ENR A;  3VBU B;  4FOW A;  3ZMN A;  4E8D A;  4CUC A;  4PHZ A;  2UWA A;  3N4M A;  2VQ0 A;  2YYO A;  5A7P A;  1EPZ A;  3OGR A;  4GMP 3;  5EYY A;  3BTA A;  5LBB A;  3ZFG C;  3I3M A;  1AHS A;  1ND2 B;  1NAE A;  4B1L A;  2MEV 3;  2ARX A;  1ZRD A;  1ZM1 A;  2R06 2;  4N43 A;  4KMQ A;  2E32 A;  5DAB A;  5FY1 A;  4TTG A;  4K8R B;  1W0P A;  4CDU B;  2C5D A;  3ALQ A;  4I01 A;  3O0W A;  1UU4 A;  2RS1 2;  3F95 A;  4XFB A;  1R64 A;  3LEG A;  4XMA A;  1LJ7 A;  5EWS A;  5FO7 B;  5JDB A;  1H6X A;  3J7L A;  3ORJ A;  1UYY A;  2VQA A;  2NYY A;  4WM8 C;  3K46 A;  2JJ6 A;  3MO4 A;  1LAJ A;  2VXJ A;  3TBD A;  4DEV A;  2BUK A;  4YM2 A;  4LIT A;  3J7N A;  3VD7 A;  1POV 0;  2P17 A;  2RR1 2;  1G9A A;  2HWD 2;  5I0S A;  4LK7 A;  2ZX4 A;  2VBP A;  1JOP A;  2OYZ A;  5IVF A;  5LW9 A;  1JYN A;  4UI9 L;  1W8F A;  3BYW A;  3RMY A;  2D5H A;  3HOB A;  5BY5 A;  2VZ3 A;  1W8N A;  1A3K A;  4IER A;  1STM A;  2XKP A;  2BZD A;  4PDW A;  1KDK A;  1J84 A;  1LHU A;  2P4E A;  2VNO A;  3CEW A;  3FBM A;  2ARB A;  4UF0 A;  4LO7 A;  3DKW A;  2ILM A;  5L73 A;  2YV8 A;  4MGZ E;  5A80 A;  3T08 A;  5FZ8 A;  2ZGQ A;  4FOY A;  1H2K A;  3BOP A;  5A32 A;  1VBB 2;  1MPX A;  3CMG A;  4IEZ A;  2D5F A;  1F5J A;  5JCT A;  1DZR A;  3R6S A;  2LRP A;  5I93 A;  1FMD 3;  1TMF 2;  2O8Q A;  3MUZ 1;  2A70 A;  2Y0O A;  3HN3 A;  1FNY A;  1MS8 A;  1VB2 A;  3GHN A;  4QPI A;  5SV5 A;  1F5F A;  5FYU A;  4A41 A;  2VMH A;  1W2U A;  1V9U 2;  2WN2 A;  2WQ4 A;  3NRU A;  4UW4 A;  3FZ3 A;  2ET1 A;  4OYU A;  4GMP 0;  5HCB A;  5HCF A;  4PI2 A;  1D4V B;  4IGP A;  4LOS A;  1VBA 2;  3WUD A;  4JGY B;  4CDX C;  1XYP A;  1BK0 A;  4CCD A;  4P5Y A;  4ES9 A;  1ZBA 1;  5A1A A;  3HT1 A;  3NL1 A;  3LPG A;  1W8W A;  3JBG 2;  2JKX A;  4JGZ B;  1RUE 2;  2DTY A;  5DDJ 1;  1W9Y A;  3CJX A;  1G9B A;  2ZEX A;  3VN4 A;  1HV1 A;  5C3R A;  2ZGN A;  2YFZ A;  1AR8 3;  1MS0 A;  3PIG A;  3E5U A;  4NO4 A;  1XC6 A;  1PNG A;  1IS5 A;  1QOT A;  4LE4 A;  5FOB B;  3KF5 A;  3POY A;  2Y6J A;  4YZ4 A;  4CPB D;  4ONU A;  3POF A;  4LO6 B;  3OCP A;  4CP9 B;  1VBC 1;  4Q4X 3;  1LU1 A;  3OPW A;  1UNB A;  5KXE A;  3AL6 A;  3GJA A;  2RJL A;  1GZT A;  2VOV A;  5C8C C;  4K1Y A;  3O5S A;  1OH4 A;  2PHD A;  1RTV A;  4ZS2 A;  1LKN A;  2ZGR A;  2XHK A;  1YJL A;  3ZXD A;  1UXZ A;  3WHT A;  2JG9 B;  1O4T A;  3MIC A;  3VBS C;  3O1T A;  1O3T A;  2WRA A;  1UIJ A;  2JDM A;  4L2N A;  1QJY 3;  4NPM A;  2PLV 1;  4M3C F;  1DU3 D;  2W0X A;  4CCC A;  4UBG A;  5BNP C;  5JXH A;  1O8S A;  4XFI A;  3I3E A;  5FZK A;  3JD7 1;  4XJU A;  5JR7 B;  1FPN 1;  2ZKN A;  3HR9 A;  4UFL A;  2YU1 A;  1RVF 2;  4L97 A;  3W58 A;  5J48 A;  1PX4 A;  2X5I C;  1W8H A;  4BQ5 A;  2BER A;  2QQW A;  1PX3 A;  1SAC A;  3DF0 A;  3OD4 A;  3RZK A;  4AW7 A;  1QWR A;  1XPW A;  4S2G A;  4CXY A;  5CKN A;  2WAB A;  1UU5 A;  3E1F 1;  4WZF A;  4D7T A;  4FCA A;  2W9X A;  4CE8 A;  3B9I A;  1DF0 A;  2OKX A;  4ERO A;  3OBZ A;  4AL9 A;  1HRI 1;  1GOF A;  3LFI A;  1RUC 1;  3TAY A;  5DAP A;  1L3J A;  2JKB A;  4K3U A;  3VBU A;  2CGN A;  3KWV A;  1XB9 A;  3FE5 A;  4TYS A;  4YZ3 A;  2GMP A;  4B7K A;  1S0J A;  4L9B A;  3WF2 A;  3APB A;  2XVK A;  1ZYB A;  4YAR A;  3ZIW A;  1ND2 A;  2A7A A;  3RSJ A;  2A1X A;  4BMB A;  1RMU 3;  4HVQ A;  2AAC A;  3LAG A;  2V5D A;  1GOH A;  3B3Q E;  2P34 A;  1S0D A;  2OUJ A;  2RDS A;  1RHI 2;  2J1R A;  3A23 A;  3WG2 A;  4LOT A;  4G9S B;  4I0A A;  1RXF A;  1S0B A;  3D4K A;  4FXK B;  5ERL A;  5A1L A;  4YM0 A;  5GZD A;  3AXE A;  1WWY A;  5DG2 A;  1IKQ A;  5HXV A;  5KHK A;  4UBH A;  2TNF A;  2ZAC A;  2Q1M A;  5FO8 B;  1YIF A;  4TSV A;  1X8E A;  4I2O A;  3GBF A;  4HZF A;  1WCD J;  3UET A;  1W9T A;  4NE9 A;  1LGC A;  1V6L A;  3AKS A;  5A3N A;  4E4D X;  4F83 A;  2A3W A;  1YI7 A;  2VVD A;  1CN1 A;  1US3 A;  3VZM A;  3BPZ A;  4AVA A;  4CCJ A;  4A45 A;  1FX5 A;  3AP7 A;  2E7A A;  2HWF 3;  1FOD 2;  2RS1 1;  3KV6 A;  1F9K A;  1YEW A;  1EV1 2;  2R1B A;  4P9J A;  2Q8O A;  1SLC A;  3P5B A;  1RJ8 A;  1QNY A;  1VBD 3;  1OA3 A;  2KXL A;  4IGQ A;  2JIC A;  4UFH A;  2LM3 A;  2YY1 A;  4J1X A;  4ISQ A;  4NPL A;  1DQ2 A;  2YUE A;  5GKA C;  3OJB A;  2VM9 A;  3WV6 A;  1A8D A;  4Y24 A;  2XJV A;  1WMX A;  2LTN A;  3H8X A;  4MGY E;  4AYU A;  1PHM A;  2NPI A;  2J1A A;  3BU7 A;  4HKW A;  2JDN A;  3DXT A;  3III A;  4JGY A;  4W65 A;  2ZML A;  3V65 A;  1PIV 2;  1S4C A;  2BQP A;  1TEI A;  2Q4S A;  4UFK A;  2XJR A;  5C3S A;  1REF A;  1YO8 A;  1UIK A;  3MW4 A;  3IZO A;  4Q8L A;  1LHW A;  1YWK A;  4PIZ A;  1Y3T A;  3HIF A;  1LOB A;  1W9S A;  2QZ3 A;  2RDN A;  4IV1 A;  4ZON A;  4CPB A;  5HXM A;  1ULC A;  3PME A;  4Q29 A;  2WNE A;  4LOR A;  4Y1U A;  1CAW B;  3ZYF A;  5B4X A;  1RUN A;  1J1L A;  5F6K A;  1IS6 A;  4R9A A;  3MDP A;  2RMU 2;  4RS5 C;  2MHF A;  1NY7 1;  2RV9 A;  1YRZ A;  3FC0 A;  4CP9 A;  4DZG A;  2RS5 1;  3URF A;  4EN8 B;  4NAM A;  3GZA A;  5FV3 A;  3VBH A;  1XNC A;  3RZJ A;  4FBF A;  2LW8 A;  3CKH A;  1PM7 A;  3BTY A;  4L99 A;  5LCW L;  4MOA A;  4NAO A;  4N43 C;  1XND A;  1WBL A;  4JKL A;  4XJW A;  5A6X A;  1AR7 3;  2GNM A;  2JWP A;  2VZ1 A;  2VCA A;  2XJP A;  4HKL A;  1RUI 3;  4JQT A;  5FPU A;  4ZHN A;  1ZNP A;  2JG9 A;  3JBG 1;  3VKN A;  2OX0 A;  5T5J A;  4Q8K A;  2D3S A;  4ZZ5 A;  4KNC A;  2FMY A;  3N9M A;  5FYC A;  1VE0 A;  2ZAA A;  3VV1 A;  2VW0 A;  1O3S A;  4EWA A;  2WAA A;  4EZH A;  4O65 A;  4AVV A;  5D8A C;  1GOG A;  2HWE 1;  3DEC A;  3ZXA C;  3C2U A;  4ZPI A;  3ZFE C;  2RS3 3;  1ZZ8 A;  4TLG A;  1QMJ A;  1QY4 A;  2AZ5 A;  5AC9 2;  1HB4 A;  3WDW A;  2GP3 A;  1J83 A;  5IAX A;  2MPF A;  2E7T A;  3DXU A;  3CZJ A;  2PQS A;  4DMI A;  2QVS B;  2ZGK A;  3ZYI B;  3PUQ A;  4EJR A;  4ZXE A;  1AF9 A;  3U0Z A;  4PDW C;  3NAP B;  1ZZB A;  3WW3 A;  4C8D A;  4YW2 A;  1AXK A;  4XXA A;  2YFU A;  5LY2 A;  5J98 B;  5ACA 1;  2DU0 A;  2AEY A;  5AFE A;  4RGK A;  3MZH A;  5EQU A;  4LO5 B;  5JZG B;  3M3O A;  2OII A;  3IKW A;  1GWL A;  1X82 A;  1R09 2;  5GLZ A;  1UKG A;  4IEO A;  3TEX A;  3BI3 A;  4AI8 A;  4YVS B;  4LTA A;  3IDA A;  3CNA A;  2VOK A;  3UKT A;  1VMJ A;  4MZU A;  4Q1R A;  4QPI C;  5DZF A;  3WDV A;  2FZ2 A;  1PGS A;  1SHW B;  5CIS A;  2FCV A;  4O9E A;  4OHZ A;  3UES A;  2OZ6 A;  4AK3 A;  5FP7 A;  2F6B A;  2J42 A;  2YG0 A;  2A3Y A;  4HKO A;  1WLW A;  3ZFF A;  4YFW A;  1W90 A;  3HQX A;  1FNZ A;  1MEC 3;  2XGX A;  3KVA A;  4XJZ A;  1AJK A;  4ET7 A;  3LZZ A;  1YQC A;  5LRS A;  3PU3 A;  3ME2 A;  5A3T A;  4BME A;  1OC1 A;  3SH4 A;  1LOE A;  1UL9 A;  1OQE A;  1O4Y A;  2WS9 2;  1Q8O A;  3SHR A;  2BTV C;  1VAL A;  2XVL A;  1VMH A;  2ZGO A;  1NA1 A;  4RN5 A;  4AFB A;  5AFB A;  4Q4W 1;  2Z2S B;  1ODM A;  3LPF A;  3M70 A;  2JD9 A;  3Q8F A;  3ZYG A;  3GJB A;  5AVA A;  2Y26 A;  2IXK A;  3I3D A;  5F5I A;  2PA7 A;  2WO1 A;  3JCI A;  3VD3 A;  3CLP A;  3KD4 A;  1C5I A;  3AYC A;  2HBU A;  3ZXK A;  1XQN A;  2D43 A;  2VNV A;  4Y1V A;  1S0C A;  2R04 3;  1XNB A;  3N9N A;  4D6S A;  3USU A;  3LDK A;  3RI8 A;  1C1F A;  5IFP A;  1TME 1;  3UYJ A;  1A78 A;  4OUE A;  4R9D A;  1DGW X;  3WDY A;  4OI1 A;  1QOO A;  2GND A;  2VVF A;  2WO2 A;  2C1F A;  2CV6 A;  4FOQ A;  4IE6 A;  4IET A;  4GH4 C;  3S7E A;  5IK7 A;  3NVC A;  3AMN A;  3ETP A;  5IAV A;  1CIY A;  1PGW 2;  5APA A;  1YHF A;  1FYU A;  5EIY B;  3FBY A;  4K7J A;  5FZC A;  1JI6 A;  1RED A;  2WT0 A;  3KT7 A;  1H6Y A;  2R49 A;  4PLO A;  2VUA A;  4XDP A;  4M3C E;  3O1U A;  1AR6 3;  4OMD A;  3C7O A;  5IK8 A;  1S0G A;  3VDB A;  1LGN A;  1ZBE 3;  1MZ5 A;  2OPW A;  3AP4 A;  4E4H A;  5BNO A;  5C3P A;  4UAP A;  4ZU5 A;  4BIS A;  3ZSL A;  4KWK A;  3RZL A;  2WO7 A;  3KS7 A;  1M06 G;  2QQI A;  1HKD A;  4IES A;  4JTO A;  3OF1 A;  1ASJ 2;  1DQ1 A;  4COW A;  3ACH A;  4XF4 A;  5H9Q A;  5C4W B;  2IXH A;  1QJU 3;  4HG6 B;  2EIE A;  1AR9 2;  2PHR A;  3BVC A;  3CL1 A;  1WCS A;  2B42 B;  3LOI A;  1GNY A;  4LLO A;  4WBB A;  4AED C;  5KXB A;  2N7G A;  5I0U A;  1YFY A;  2BP6 A;  2IXJ A;  4XDO A;  1G8W A;  4N7U A;  3VKO A;  4MX3 A;  1I5Z A;  1JYW A;  5DAV A;  3KGZ A;  4NHM A;  1Y7B A;  2CL2 A;  1XSQ A;  2V4A A;  4JRL A;  5IYY A;  3AYD A;  3EYP A;  4QKF A;  3C8X A;  2MNG A;  2PLV 3;  4MXW B;  1CAW A;  1QGL A;  1UN1 A;  3GCW A;  5CFC C;  2ZHK A;  5A7W A;  5FYI A;  4YGC A;  3ILF A;  4WM7 B;  1FPN 3;  3FFQ A;  5LBE A;  2X09 A;  3LSE A;  5HBA A;  1G9C A;  2NLR A;  5LEK A;  5GLU A;  3A21 A;  1SBD A;  5DAX A;  5FXW A;  5IUQ A;  4MGT A;  4NID A;  1J3R A;  1DYO A;  1OVS A;  4B4R A;  1G9D A;  2D98 A;  4FTB A;  2XQX A;  4YFZ A;  4YGD A;  1ND2 C;  1SZB A;  3H9A A;  4COZ A;  1ZX5 A;  2ZMK A;  4YW6 A;  3B94 A;  1KS4 A;  1W6N B;  2Y60 A;  1PZ9 A;  4CDU C;  3M8L A;  3BOD A;  1ONA A;  4D7S A;  3FLT A;  1NQD A;  3Q8E A;  3VBF B;  1GZW B;  2VME A;  4YZ1 A;  1XNT A;  1N3O A;  2WT2 A;  3IDE A;  4H14 A;  2ZJC A;  1O8P A;  2JEN A;  3RS6 A;  4ORF A;  3OGG A;  3MUY 1;  4PF1 A;  3QLQ A;  4IE0 A;  3D0S A;  2W2I A;  4RFR B;  4B4Q A;  3ZYJ B;  3ES4 A;  5FKC A;  3QOP A;  1WZX A;  1MS5 A;  2OT7 A;  3VDA A;  4EN7 B;  2NM1 A;  5EZW A;  4JCK A;  4XUQ A;  1AR7 2;  5K0U A;  4Q1P A;  3F2Z A;  5GLT A;  4QQ2 A;  5GZF A;  1OF3 A;  3FMG A;  3WQ7 A;  4AG4 A;  4OI2 A;  3FL7 A;  3C7G A;  2W87 A;  4LHN A;  5FP9 A;  5L7O A;  5KHG A;  3BOW A;  3KHB A;  3SLI A;  4EN6 B;  1HIX A;  2CWM A;  4AFM A;  5K8S A;  3RZM A;  1V6N A;  2C6S A;  4Z92 B;  1GNZ A;  2Q1Z B;  5FUN A;  5HCA A;  4HN1 A;  1XOY A;  3AFG A;  2ZX2 A;  3PMS A;  4QMA A;  3VGI A;  1JTZ X;  3ROU A;  1F4H A;  1UY1 A;  1CIW A;  1AL2 2;  2VNR A;  2R07 2;  3WR0 A;  2D6N A;  1V0A A;  1JZ8 A;  1SEF A;  2VAU A;  3VDD B;  1JYX A;  5J09 A;  5A3W A;  2R06 3;  3DPR A;  5FP4 A;  2K2S A;  4W50 A;  4JGY C;  1C8M 1;  3AZW A;  3T2P A;  2W47 A;  1W04 A;  2RS1 3;  2J1V A;  1BKZ A;  4AEJ A;  3MLJ A;  5C33 A;  1LHN A;  2PHU A;  5FZ0 A;  2VPV A;  3BGA A;  2A6Y A;  2FDJ A;  3WNL A;  3LF7 A;  4JGZ C;  4LXL A;  3PUR A;  3T4H B;  2RR1 3;  2F4P A;  2HWD 3;  2ZMN A;  1JZ7 A;  4C0B A;  5FZB A;  1O3R A;  2CGP A;  4Z82 A;  3RI9 A;  4I3P A;  4GAZ A;  4CCL A;  5FQ0 B;  4AF9 A;  1LOG A;  2JG8 A;  3B00 A;  2BGC A;  2FBE A;  2P5B A;  2IC1 A;  3A0K A;  2XQR A;  3S5Q A;  4UOJ A;  3KQR A;  4Y5Z 0;  1YNA A;  2XWB B;  1H30 A;  1RUG 1;  4DUX A;  1HXS 1;  1SFN A;  1N47 A;  3NJZ A;  4XQW A;  3SQO A;  4YNI A;  3SCG A;  4COU A;  5IVV A;  2E51 A;  2QDR A;  4QB1 A;  2Y8K A;  5E88 A;  4R52 A;  2PAM A;  5FZD A;  1VBB 3;  2VBD A;  1C8N A;  3M3I A;  4XE9 A;  1TMF 3;  2PQQ A;  4A2U A;  3B69 A;  4LLF A;  1D0H A;  4LBQ D;  4MUV A;  2JG9 C;  1OBN A;  1X9T A;  2I07 B;  4XW3 A;  3POG A;  4AQ6 A;  2EIC A;  4GUL A;  4B29 A;  5L9V A;  3ZYP A;  1ZBA 2;  2FZ1 A;  3I2H A;  4E8C A;  1V9U 3;  3BCW A;  2IVJ A;  3NQH A;  1Q3E A;  2GAU A;  1K12 A;  5F6L B;  2XUM A;  1H8T A;  1ST8 A;  5DUU A;  5LA2 A;  4HBN A;  4NIA A;  1QJE A;  3VHN A;  1VBA 3;  2QQU A;  2YRO A;  5DDJ 2;  5FK7 A;  4AI0 A;  4X6R B;  1QXR A;  2BNN A;  5C4W A;  2JB4 A;  2UY9 A;  1VIW B;  1ENQ A;  1IZ3 A;  1DLC A;  4HXC A;  4NRM A;  5J37 A;  2RVA A;  5FFO C;  1OA4 A;  3D6E A;  3JBG 3;  4Q26 A;  1H8V A;  1VBC 2;  2XL7 A;  5FZG A;  2P3K A;  1RUE 3;  4I09 A;  1J3Q A;  2ORX A;  3LQC A;  4JVA A;  1J1T A;  4MYE A;  1NLR A;  2HWE 3;  2VJX A;  3LGR A;  4R9C A;  3TEW A;  1HN0 A;  1XNA A;  3MF9 A;  4QDQ A;  4FAG A;  3BTX A;  1AYN 1;  1ZZC A;  2E63 A;  3ZM8 A;  4XFG A;  3ZN6 B;  4EN9 B;  4AEK A;  2B5H A;  2VZR A;  3W59 A;  1YFX A;  3AYE A;  1UZ0 A;  1P8J A;  2K0G A;  4ZU4 A;  1CES A;  2HWC 2;  3GM8 A;  4E4S A;  1VAV A;  4XUN A;  4QXC A;  1AVB A;  2W46 A;  4AQT A;  2PLV 2;  1OLM E;  2WUH A;  2A6Z A;  2RM2 1;  3KGL A;  3R4D B;  1Q8Q A;  3AP5 A;  4AGR A;  4CU7 A;  1JOD A;  2FMD A;  2ZGT A;  2F4L A;  3INA A;  5FY9 A;  4OHW A;  1DFQ A;  3KV5 A;  3JD7 2;  4J1W A;  1JOB A;  1KGY A;  2YXS A;  1FPN 2;  3WP3 A;  4YLZ A;  3I3B A;  3VBF A;  4MLO A;  2ZX1 A;  1CWP A;  5FY0 A;  4W6X A;  5JIU A;  4NHX A;  3EQE A;  1A6C A;  5ABJ A;  4P9L A;  4DXT A;  2VZS A;  1BZW A;  3OG2 A;  3ZSE A;  5H9R A;  1ND3 A;  2WWS A;  4FPG A;  1HN1 A;  3D8C A;  5DZG A;  4QPG B;  4CU8 A;  5A6Y A;  1BVP 1;  2J22 A;  4A7K A;  3ZN4 A;  3WNP A;  2UY8 A;  3WIN E;  1NLS A;  4XIO A;  1GWM A;  1PK6 B;  1GP6 A;  1RVF 3;  2DUQ A;  4RHV 2;  1WW6 A;  1HRI 2;  2VOT A;  4OMC A;  5HI0 A;  1RC6 A;  1RUC 2;  2QQO A;  4D6Q A;  3HVD A;  5CFD A;  1K42 A;  4Y1Z A;  1GZ9 A;  4LBL A;  4EWE A;  3OB8 A;  2DCT A;  1Q43 A;  1NXM A;  1POV 3;  4YZ2 A;  1W99 A;  2DV9 A;  4YVW A;  1BXH A;  1VP6 A;  3IBM A;  4AGG A;  4Q0U A;  3LCP A;  3VHR A;  5IT6 A;  3HBK A;  3O0X A;  4NIH A;  2B8M A;  3E5X A;  3OPZ A;  1PO1 1;  4AFD A;  1UXX X;  5CB7 A;  1S0I A;  3GCX A;  3OBR A;  2Z79 A;  2XB6 C;  2ZHM A;  4JHT A;  1VBE 1;  3WT3 A;  4CCK A;  4LJH A;  5FYY A;  1TME 3;  5A3P A;  4OLL A;  3VZO A;  5F1R A;  1G7Y A;  3DYO A;  1B09 A;  2XLF A;  4KBB A;  5EXO A;  5F2W A;  3S7I A;  3IDB B;  1LOC A;  5A7O A;  4LKF A;  3HNM A;  1RHI 3;  1V6J A;  3UL2 A;  5DN2 A;  2KD7 A;  1C5H A;  3S57 A;  4AHZ A;  1BLZ A;  1HJG A;  1FT9 A;  3HNB M;  1APN A;  5FKB A;  1WBF A;  1JW6 A;  2SBA A;  4IEQ A;  1PVC 1;  4LT5 A;  1T2X A;  4AWD A;  2ZZQ A;  4HPK A;  3T4V A;  3POS A;  4OFG A;  5JXG A;  1WA4 A;  2XJS A;  3ZR5 A;  4BIO A;  4PLN A;  4CEW B;  3R4U A;  5FQ0 A;  1XU1 A;  4E9K A;  2PYT A;  3GNE A;  2DVG A;  5F3G A;  3T1M A;  2VL4 A;  1AL2 1;  2QTW B;  2R07 1;  2ZTN A;  5GJ6 A;  3H8R A;  3K77 A;  3WXP A;  2VD7 A;  2OUH A;  5LAT A;  1Y9G A;  1Y9Q A;  4LBQ A;  5F37 A;  2B9V A;  4LKS A;  4UW3 A;  1FOD 3;  1HQL A;  1LOD A;  1GQP A;  1X50 A;  1ZZ6 A;  4Q4Y 1;  3QCW A;  4ITC A;  1EV1 3;  2XXZ A;  4K20 A;  4IEV A;  4XFA A;  5G05 L;  5DG1 A;  4QPW A;  2YHJ A;  3BUC A;  2OS2 A;  1W9W A;  1MVE A;  4JDO A;  3PTR B;  1V6O A;  1WD4 A;  3U11 A;  4BJ0 A;  1PMH X;  2JEM A;  1CZS A;  3BU0 A;  2XBO 1;  3ZPO A;  4MAD A;  3RZH A;  4XTP A;  5A6Z A;  3RVH A;  2WFF 1;  1CVN A;  3U75 A;  5JOX A;  1NLQ A;  1JBC A;  1LGB A;  3GZE A;  1R1Z A;  1WW4 A;  2VZO A;  4FPJ A;  1R08 2;  2DVD A;  4IXL A;  1PIV 3;  2XOM A;  5HV4 A;  1NOV A;  2JDK A;  4I3G A;  4BLI A;  1HV0 A;  5JOW A;  3POE A;  4C90 A;  4MGS A;  4XBL A;  3U14 A;  1LOA A;  3HQU A;  3NAP C;  1NY7 2;  1DQ4 A;  2TUN A;  2RS5 2;  1LES A;  1EYB A;  4N53 B;  4CSW A;  5A3O A;  2J1T A;  3BPS A;  4LUM A;  4RGA A;  1C28 A;  4LK6 A;  3LKJ A;  3AVS A;  1AUY A;  5JZG C;  4RR3 A;  1W05 A;  4XUO A;  4GAL A;  2XJQ A;  2RMU 3;  1UYP A;  1C3H A;  3HNY M;  4LE3 A;  4YVS C;  3ZN6 A;  1H1I A;  1W8O A;  5FMO L;  5KXD A;  1ZRR A;  4IV1 B;  4AHY A;  5EFU A;  2P1B A;  5LEJ A;  4JKM A;  4DOU A;  5LK5 A;  2HWE 2;  5BNN C;  5JMO A;  4AAP A;  5IVB A;  4FSJ A;  2C0Z A;  5JPN B;  4FPF A;  1BHG A;  3CBN A;  4XHB A;  1IGO A;  1YXW A;  3H3U A;  4I30 A;  5JSO A;  1J3P A;  2D3R A;  1S2K A;  4XXP A;  3FUO A;  1UPS A;  3TNQ A;  4CDW B;  1QEX A;  2VC9 A;  4RSU A;  3VBH B;  1HDK A;  5FCC A;  3QH6 A;  2BGO A;  1XU2 A;  3GYD A;  4QPG A;  3SNM A;  4QGL A;  1NCR A;  4GIQ A;  2CDO A;  2E53 A;  2GN3 A;  1CZV A;  1EAH 2;  3JB4 C;  5F5A A;  4A42 A;  3POI A;  4AI1 A;  3NKT A;  3RZZ A;  4BXF A;  5ACA 2;  5AC9 3;  1PK6 A;  2CAU A;  4UT5 A;  3P1I A;  4A7Z A;  1CGP A;  4JTN A;  4E4Z A;  2Y6H A;  2QUO A;  1HB3 A;  3O0V A;  2R30 A;  4K1Z A;  1L7R A;  2OW4 A;  4Q0Q A;  1Y4W A;  2HWC 1;  3N7L A;  1W28 A;  2UYB A;  4CP1 A;  5I0D A;  2HYX A;  2ZXQ A;  2GC1 A;  1PNF A;  2RG4 A;  4HK8 A;  2AC1 A;  4BZ4 A;  2HWB 1;  3CIH A;  4FI9 A;  4J25 A;  4FOV A;  1VRH 1;  1RGS A;  1QXJ A;  2BWC A;  2P6C A;  2XDV A;  5FZ1 A;  3SCF A;  3K51 A;  3WW4 A;  2FHR A;  4YG3 A;  3J7M A;  3K2O A;  4MO3 M;  1R09 3;  5JIA A;  3ES1 A;  4XDQ A;  5C8W A;  5LBC A;  3LD8 A;  4R8H A;  5E89 A;  2G4I A;  4GQ7 A;  4LKD A;  2D6P A;  1LEM A;  3J7H A;  1IKP A;  3PUS A;  4QHZ A;  5DXD A;  3PL0 A;  3J26 N;  4MH0 E;  4HN0 A;  3OTF A;  1JOJ A;  5DPN A;  3V0B A;  4KI5 M;  4LHS A;  4FFF A;  4Q4W 2;  4D6R A;  3ECQ A;  2EAK A;  4OVE A;  1CJP A;  2XJU A;  4WZC A;  1OVP A;  2C24 A;  3V64 A;  2RJK A;  4OCT A;  1W6O B;  4RHV 1;  2PHF A;  2GC3 A;  1NUK A;  1UOB A;  2WS9 3;  2A3X A;  1NXD 1;  5JSP A;  4NPR A;  1NE4 A;  5FZF A;  4AQ2 A;  2V4V A;  1O91 A;  2ZAB A;  3TYJ A;  4XEZ A;  3L2H A;  3U10 A;  1TME 2;  3RJ2 X;  3ZFF B;  1UOG A;  4BLJ A;  5D21 A;  4BYY A;  3N9P A;  3FWE A;  4ZZ8 A;  1DGR N;  3I4I A;  1DZQ A;  1UY3 A;  4CEW A;  2UUR A;  1S0E A;  2Y6K A;  4ASK A;  5FYS A;  4WM7 C;  5FPA A;  4QQP A;  1UYX A;  4CZS A;  1VB4 A;  1NA1 B;  5SV8 A;  1OLM A;  1RJ7 A;  3LWC A;  5C7G A;  1OSG A;  1WMF A;  5FJH A;  5JWP A;  2XVG A;  3ATG A;  5BXX A;  1SLI A;  1AXZ A;  4P9W A;  1JXN A;  2JE8 A;  1F35 A;  2K46 A;  4YW1 A;  3E6C C;  1AYN 3;  3VBF C;  1OD3 A;  5JXI A;  3SH5 A;  1CPM A;  1ULP A;  1X9P A;  2JE7 A;  2WT1 A;  3DGT A;  5FZ9 A;  3USU B;  5FO9 B;  2EXJ A;  5E16 A;  2CWS A;  4YYO A;  3L2Y A;  2XL9 A;  3SCH A;  5F5Q A;  1WW5 A;  4QM9 A;  1QH6 A;  3WG1 A;  4C1X A;  2XG3 A;  1GWK A;  4BQ1 A;  3P3N A;  1ASJ 3;  3AXD A;  1QXP A;  5C5T A;  2WN3 A;  2ZPX A;  5FBJ A;  4Y22 A;  1AR9 3;  2VBB A;  1UYZ A;  1O5L A;  2JE9 A;  4AE2 A;  2OQ6 A;  1W39 A;  4R4Z A;  3ZMO A;  4PBO A;  3EO6 A;  1XXN A;  2ORZ A;  1BK1 A;  3G7D A;  5BNO B;  2O8O A;  5H9P A;  4N53 A;  5DZE A;  1ULG A;  2BVB A;  5T5P A;  5IHR A;  4PI0 A;  3GXU A;  5IVE A;  3GGL A;  4FQ4 A;  3FHQ A;  3W20 A;  4JV4 A;  4OHX A;  4ASL A;  4E2Q A;  1GBG A;  1IG0 A;  1I5P A;  5FAX A;  2R0F A;  3N9O A;  2FDK A;  2KR2 A;  4JX0 A;  4Z2A A;  4BQW A;  4FTE A;  1DP0 A;  4H7M A;  4AI2 A;  4B8E A;  4DNY A;  2VMF A;  1MVQ A;  1V6I A;  3OYW B;  4P9X A;  5FBZ A;  4FPL A;  4AXO A;  1NG0 A;  2GMM A;  5FLJ A;  3VDD C;  2BNO A;  3VBO A;  4JHZ A;  3NMB A;  1R08 1;  4Q0V A;  4DB5 A;  1YCI A;  1E5S A;  2Q30 A;  1Z0H A;  2QQJ A;  3A0N A;  2VUD A;  3IIA A;  1Z78 A;  3H3Z A;  3KLS A;  4RGG A;  5FZ4 A;  5A7W B;  3WW1 A;  4URA A;  2VY0 A;  3NW4 A;  4FXG B;  4CDW A;  4IND A;  3ABZ A;  5JI9 A;  1NYW A;  1OHF A;  3O14 A;  4AVS A;  2XPJ A;  1US2 A;  4YG6 A;  3NV4 A;  2RHP A;  2VCC A;  2IXI A;  3H42 B;  5A33 B;  2XLA A;  1E57 A;  1Z7S 1;  3GZU C;  4JDM A;  4HVR A;  2FDG A;  1SBF A;  4N7I A;  1F15 A;  2B9U A;  3VBR A;  1Q56 A;  4W8J A;  3VZN A;  3Q9O A;  1B35 A;  4LBM A;  3MIG A;  4NII A;  4XUP A;  5C5U A;  3M7A A;  4ATF A;  5A1F A;  5H9S A;  4BM8 A;  1LTE A;  2C9K A;  2I45 A;  4NWW A;  4AEM A;  4CVU A;  3A22 A;  4BQ4 A;  5HPO A;  5AVP A;  3WD5 A;  4FPH A;  1JU4 A;  1UMZ A;  4HAN A;  1WLC A;  1X8M A;  5K0U B;  3QAC A;  3O1R A;  1C8M 2;  4BCU A;  2G19 A;  5LAS A;  4MHR A;  1YC6 1;  1K5J A;  1HRV 2;  3SIT A;  5L7O B;  1AL2 3;  1MZ6 A;  2R07 3;  5FMC A;  2VZV A;  3R05 A;  2JDP A;  2VU9 A;  3ILN A;  2C4X A;  3NV3 A;  1NQJ A;  3FLR A;  5DMY A;  3UNP A;  3CF6 E;  1EAH 1;  1MZE A;  4QX5 A;  4V2W A;  4LA2 A;  1W06 A;  4XCA A;  2ES3 A;  1T6G C;  3BAL A;  1LUL A;  2DCK A;  2UWC A;  1W6O A;  4Z07 A;  5A3L A;  4G4F A;  3NNG A;  1IS3 A;  5JUV A;  1JS9 A;  4SBV A;  3ZN5 A;  1LEN A;  3E5Q A;  4BK5 A;  3ZKY A;  3B7M A;  3LA2 A;  2W91 A;  2X05 A;  1RUG 2;  3R4S A;  2Z42 A;  4CYD A;  1UU6 A;  1HXS 2;  3AB0 A;  2WYF A;  3MGU A;  4QX3 A;  3RZG A;  3U1X A;  2DDU A;  1O3Q A;  5J36 A;  3DPR B;  3AFK A;  5GZC A;  4B7E A;  4IV3 B;  2YPJ A;  1K3I A;  1TNR A;  1AZD A;  1ENX A;  2D44 A;  3GHM A;  3I97 A;  4DS0 A;  4FT8 A;  3TEZ A;  2DBN A;  2ZOE B;  4BQY A;  1SLL A;  2G9G A;  3UJQ A;  3VL9 A;  1OKQ A;  5FXX A;  3W5M A;  1JZ2 A;  3K3O A;  4HL0 A;  4P08 A;  3ZXE A;  1VAM A;  4MET A;  1DYP A;  1QHD A;  4C91 A;  3TRS B;  5CNA A;  2FDI A;  2PHX A;  5A3U A;  2ZEY A;  2VMC A;  4MGI E;  4PIX A;  5FYB A;  4IEW A;  4BU2 A;  3JXS A;  4LNV A;  3AZY A;  4Q4V 1;  2JG8 B;  1GV9 A;  2H6B A;  2VQU A;  1W8U A;  5L19 A;  3WP5 A;  1ZBA 3;  2YU2 A;  3NO8 A;  3B9C A;  4NHK A;  1DDL A;  2PHT A;  4B4P A;  2VW1 A;  1ULD A;  2P3Y A;  4FPE A;  2VUJ A;  2WNO A;  4XJA A;  2G1M A;  3RFR A;  5DDJ 3;  4RA0 A;  3LB9 A;  3BN6 A;  4XAC A;  5IW0 A;  5IVJ A;  4DUW A;  5FPZ A;  1W9F A;  1W3V A;  3WF3 A;  3GBW A;  1UO9 A;  4QX7 A;  2DBI A;  4BK4 A;  1OPO A;  4QHB A;  3WDT A;  5FIX A;  1AYN 2;  2CNA A;  4S2D A;  1CR7 A;  1J58 A;  1WUV A;  2OZJ A;  3H0O A;  3I3Q A;  1BYH A;  1VBC 3;  3LIH A;  1W3X A;  4L92 A;  1DQ5 A;  3VBS B;  1IPK A;  1H8T B;  3DV8 A;  4MG2 A;  2W08 A;  2VZP A;  3WCS A;  1K5M B;  1CX1 A;  2HJI A;  2O1Q A;  1XYO A;  2ZS6 B;  3E97 A;  1UOJ A;  1WMD A;  4FO9 A;  2CTV A;  5FZE A;  3VZL A;  3W9A A;  2RM2 2;  1KD7 A;  3GDB A;  5BNP B;  1C1L A;  4IL7 A;  4PT6 A;  4R9B A;  4JDN A;  2JEC A;  3UJO A;  2XHN A;  3H1W A;  4IEU A;  5EJ1 B;  2XJT A;  5ANN A;  4XFH A;  5I91 A;  4JC1 A;  4DY3 A;  2X5I B;  2HWC 3;  1MS1 A;  3OYW A;  1UMH A;  1VJ2 A;  1QNW A;  4D7Y A;  5FWE A;  2D93 A;  4H7L A;  1WKY A;  2NMN A;  4KU8 A;  2BPA 2;  1RUF 1;  4Y20 A;  5LY1 A;  1U5Z A;  1CD3 G;  2VG9 A;  5J7M A;  1G9F A;  2MEV 1;  4YW7 A;  3JD7 3;  2W52 A;  2WZR 1;  2W1Q A;  1O5U A;  4CTE A;  1EUT A;  4GWI A;  5FPX A;  2QZ2 A;  2ID4 A;  3VBU C;  2A5Z A;  2BW8 A;  4I0W B;  2P37 A;  4QQO A;  1W2T A;  2JDA A;  3VD4 A;  1O59 A;  3OBA A;  4OQ9 A;  5FLH A;  4DXR A;  3JB8 A;  5A33 A;  2WA4 A;  2D7F A;  2D6O X;  2Y0I A;  3DN7 A;  1QJX 1;  5JPM B;  4M01 A;  2XON A;  3KCC A;  5A7Q A;  3ZFG A;  3TWI A;  4CEW C;  2CSG A;  2SLI A;  2QBX A;  1YIP A;  4AVB A;  3PU8 A;  4RHV 3;  1HRI 3;  3IAP A;  3NJV A;  1Y9M A;  3VLB B;  1RUC 3;  1NX9 A;  1PO1 2;  1RB8 G;  2ET7 A;  5E8A A;  2AYH A;  1DG6 A;  5FJK A;  4XF0 A;  3UKV A;  3LA7 A;  2O14 A;  3SKV A;  5BV6 A;  4Y1X A;  1ND3 B;  1S2B A;  1JYV A;  3OEB A;  1UKR A;  1VBE 2;  1TZO A;  2DCJ A;  3DEM A;  3RG0 A;  3ZYR A;  3IMM A;  3OGS A;  2HEY F;  5CG9 A;  5A3M A;  4HSJ A;  4QX0 A;  4EN0 A;  4TXW A;  2PHL A;  2E33 A;  4P00 B;  5EYX A;  3WOG A;  5LBF A;  3SEP A;  4BPZ A;  3EJK A;  4O61 A;  3T2T A;  5A7N A;  5CFD B;  3MPB A;  2D97 A;  4Q0P A;  4DY5 A;  5J3U A;  3I59 A;  3AKP A;  2ZAH A;  1OFS A;  3ZX7 A;  1ULE A;  5LB6 A;  3ITQ A;  4YVW B;  3PUI A;  1OA2 A;  3ZIX A;  1R1A 2;  4YM3 A;  2QJV A;  1PVC 2;  3BB6 A;  4BQX A;  4CEY B;  1I9R A;  4YGB A;  4E27 A;  4XOG A;  4DUV A;  1LU2 A;  4NRP A;  2ERF A;  1S1A A;  4Q5O A;  2ZKL A;  2DVF A;  1WLT A;  4OI0 A;  1JYI A;  1Q5O A;  1HW5 A;  3WNX A;  3AZZ A;  2O0O A;  2R32 A;  4DPN A;  3WF1 A;  4N53 C;  4LBO A;  5F7U A;  4QGN A;  3ZDS A;  3RNS A;  2GC0 A;  3AMQ A;  2IXC A;  2XH6 A;  2WZE A;  2KA3 A;  3CJI B;  2HKX A;  3VKF C;  2BEO A;  4IV3 A;  2D6M A;  4RD7 A;  5CKM A;  1AR8 1;  1KIT A;  3MI8 A;  4Q4Y 2;  1ZA4 A;  5I0T A;  1OXC A;  2UWB A;  3THT A;  1DGW A;  3RWK X;  4U36 A;  3WG3 A;  3WF4 A;  1HRV 1;  4M0N A;  4SLI A;  2VCM A;  3ZKU A;  3O1V A;  4P9Y A;  3FUQ A;  4OZX A;  4CDX A;  2ZHL A;  3LA3 A;  5CVR A;  1OKO A;  4HET A;  4Q4X 1;  4XYX A;  1UZZ A;  2C26 A;  2WLQ A;  2ZEZ A;  4IV1 C;  4CXX A;  3VZJ A;  1I1E A;  3WP4 A;  2XBO 2;  4HPK B;  3I2J A;  3ACI A;  2WFF 2;  1W6Q B;  2DFC A;  3IAQ A;  4LUL A;  1KJR A;  3ZOI A;  4QQL A;  2FQP A;  1N1T A;  3OUI A;  4QPY A;  3KVB A;  4GJY A;  1OH3 A;  3ZSK A;  2OA2 A;  4MGK E;  3SIS A;  2ZEW A;  1S2E A;  2W95 A;  2WNV B;  4WVM B;  1MS9 A;  4A6S A;  4CDW C;  4RS5 B;  3VBH C;  1SPP A;  2GC2 A;  1TE1 B;  3NNJ A;  1YI9 A;  3OUJ A;  4LBQ B;  5KHH A;  2EXK A;  1QJY 1;  2HYK A;  1NE6 A;  4QQH A;  3MPP G;  1ZRC A;  4UYB A;  3O1M A;  3MLK A;  1R08 3;  3RRD A;  2WC2 A;  2E7Q A;  2JXA A;  4PQQ A;  1RIT A;  3I7D A;  1U12 A;  1IHM A;  4CCE A;  1SFY A;  4NHL A;  3K48 A;  2Q8D A;  2RS5 3;  5L9R A;  2NMO A;  3RQ0 A;  5GZG A;  2IWG B;  3VBS A;  1ODN A;  3ACF A;  3KCY A;  1VRB A;  2VH9 A;  3OGJ A;  1K5M A;  4QXK A;  2YC2 A;  1YYN A;  2WAO A;  3EXU A;  3KV9 A;  1PGL 1;  1RUO A;  2P3J A;  4R4X A;  4XUR A;  1Z7S 3;  5T50 A;  4EQV A;  1PVX A;  5BNP A;  2Q5T A;  3FFZ A;  1TVG A;  4LBK A;  3AKQ A;  3K3N A;  5FP3 A;  3DYM A;  3Q8B A;  2NN8 A;  1GAN A;  1YQ2 A;  3UKN A;  4H3W A;  2BWA A;  3AM2 A;  1NT0 A;  3LEK A;  2IVI B;  2WZ8 A;  2ZHN A;  1VLN A;  4V1P A;  1M4W A;  2X5I A;  4KGG A;  1DQ0 A;  1XE7 A;  5D2A A;  4FPC A;  3MLL A;  3CZU A;  4QWN A;  5T52 A;  2WDB A;  3UK9 A;  4BH9 A;  3B01 A;  3WCR A;  1UD1 A;  4RL7 A;  4C1W A;  2ZCW A;  3CQO A;  4BOW A;  5K4L A;  5T3N A;  5DUW A;  3GZT B;  3THP A;  1WA6 X;  4FTS A;  1RMU 1;  4RR3 B;  4ZU7 A;  5L36 A;  1LB2 A;  3H8O A;  3ZXL A;  5CAZ A;  3B93 A;  1HB1 A;  4X8N A;  5JOY A;  2WIN B;  3IB3 A;  4I02 A;  1ACC A;  3WX5 A;  3H3L A;  4CU9 A;  4QDS A;  2PEL A;  2VCB A;  4OUM A;  4CUB A;  1E5I A;  2QDN A;  4GKY A;  3U4X A;  3K4D A;  3OBT A;  1EAH 3;  1SQ4 A;  2HWB 2;  4H2A A;  3ZFF C;  5ACA 3;  2BV4 A;  3M3Q A;  1VRH 2;  3ON7 A;  5FZO B;  1X7N A;  1CAX A;  4IEP A;  1COV 2;  3AK0 A;  4KH9 A;  3W5N A;  2BBA A;  2BNM A;  2OQ7 A;  4RQP B;  4FFI A;  4P02 B;  2ZGP A;  1EPW A;  3D5O A;  3I2F A;  3KQ4 B;  4Y26 A;  1A8M A;  3CO2 A;  4KWU A;  5IWF A;  1NA1 C;  1GP4 A;  1W6P A;  1QJF A;  2D3P A;  2P3I A;  5JOZ A;  2QQP A;  4LEJ A;  4BA6 A;  4N90 A;  4EYU A;  2ZBJ A;  1NCR B;  2RJ2 A;  2WII B;  2GSY A;  3C7F A;  5ANQ A;  4CP0 A;  4Q27 A;  3J8F 1;  3KM5 A;  4AVC A;  4YPJ A;  5FOJ B;  1K45 A;  5FUP A;  5D1I A;  2DVB A;  5LA0 A;  3WP6 A;  4IGO A;  4WVV A;  4A3X A;  1AL0 G;  1GSL A;  1QQP 1;  4JRA A;  2LAL A;  4PJY A;  3KSC A;  2GDF A;  4E2G A;  3J9S A;  3T09 A;  1SCS A;  3P3P A;  4Q4W 3;  3ZVX A;  3VZK A;  4GB3 2;  4D0Q A;  4CEY A;  5EPA A;  1AYM 1;  3JZV A;  2Y64 A;  5F3C A;  5HCH A;  2QFE A;  4GH4 B;  2YBK A;  2IZW A;  3PUA A;  3S6P A;  2EVX A;  2QQL A;  4YGE A;  1OPM A;  5CYY A;  3ZR6 A;  2Y38 A;  1FV3 A;  2Q8E A;  4QU1 A;  2NP0 A;  4OHY A;  5FPL A;  2W3J A;  5FTT C;  3V0B B;  1UZW A;  1L7Q A;  3O1P A;  4CUA A;  5BNO C;  5T5O A;  3J4U H;  4XF9 A;  2W1W A;  1UY2 A;  1IQD C;  3MIH A;  3TN9 2;  3UT0 A;  3PVE A;  4QKN A;  3LDB A;  1N1S A;  5FLI A;  4EE2 A;  1OOP B;  3CJI A;  3EB7 A;  5A70 A;  3N35 A;  2OVU A;  5C6C A;  5I8S A;  3QBQ A;  5CAD A;  4Y1Y A;  4B3N A;  1C57 A;  1VPH A;  2AUY A;  1X36 A;  1LNS A;  1YQ6 A;  1XE8 A;  3A7Q A;  4HOO A;  1PO2 2;  4MVT A;  4DIN B;  3RDI A;  4X6Q B;  1XSR A;  1LRH A;  1DLL A;  4COV A;  4F7Z A;  3ETQ A;  4CUG A;  3WLU A;  1ZZ9 A;  4AED B;  4LBJ A;  1R1A 1;  4PF5 A;  1JZ3 A;  5KHJ A;  1S0F A;  1AX2 A;  2VZT A;  1W6Q A;  1WCK A;  2Z5W A;  2XR4 A;  1BMV 1;  1U5X A;  3VHO A;  4GJZ A;  3AJY A;  4QGM A;  5LWB A;  2V73 A;  4P14 A;  2BGP A;  5FPB A;  2EIG A;  5LA9 A;  3VL8 A;  5JVV A;  1QU0 A;  1YQ5 A;  4QXB A;  1NCQ B;  5FXV A;  4WVZ A;  1CON A;  2WNV A;  3HT2 A;  4WVM A;  1GZC A;  4RS5 A;  1W6M B;  2VO5 A;  2WWJ A;  1H0B A;  5FZI A;  3TEY A;  1YJK A;  3MEP A;  3EBR A;  2YB7 A;  3WDU A;  1RUF 3;  2RS3 1;  3HQR A;  3S30 A;  3H1M A;  5FY7 A;  2BOJ A;  1IPJ A;  2YC0 A;  4DFS A;  5C71 A;  3HPN A;  2CU5 A;  2ADE A;  3VUO A;  2WZR 3;  3BKZ A;  4QX1 A;  5GZE A;  1JYC A;  4IE4 A;  3WQ0 A;  2YGL A;  2DUR A;  2IFR A;  5GLV A;  3SXW A;  1PMJ X;  4QD2 A;  4F3J A;  3O1O A;  3OEA A;  4N8M A;  2JB8 A;  2J1E A;  3C7E A;  1W0O A;  3SC7 X;  4FAH A;  3NKG A;  2WZP P;  1ALY A;  3OPT A;  3AX4 A;  4L0P A;  4CCO A;  5D8A A;  3WUC A;  4QHO A;  1QJX 3;  2V72 A;  4PBP A;  3T0A A;  5K0U C;  4IEX A;  3ZFE A;  2K9Z A;  3LSD A;  3C3V A;  4Y22 B;  2WL1 A;  4W6Y A;  2I74 A;  1GLH A;  1F2N A;  2W1S A;  5L7O C;  1DGL A;  2CAV A;  4N9H A;  4HSL A;  1BCX A;  1JHN A;  4EZ4 A;  1BJQ A;  4XJ8 A;  4FPO B;  5FRA A;  4KU7 A;  2JDZ A;  3AMP A;  4K9S A;  2Y34 A;  1Z7S 2;  4LO8 A;  3WNM A;  5LA1 A;  2JDU A;  1MEC 1;  4HFS A;  2ZX0 A;  3UGH A;  4CDQ B;  3NNM A;  1RUH 2;  2V09 A;  2ARA A;  1KJL A;  5FXZ A;  3VD5 A;  4Q2F A;  1NKG A;  5JMC A;  5CBL A;  2OPK A;  3I2G A;  3VBO B;  4UXA A;  4IDZ A;  2ADD A;  3DPR C;  3KT1 A;  4IV3 C;  5FZO A;  2D6K A;  4UW5 A;  1BBT 2;  3FJS A;  1I3H A;  2H0B A;  4FPK A;  4RQP A;  2YC4 A;  4XC9 A;  4XJ9 A;  4UWD A;  4Z8B A;  1RUD 2;  3HJR A;  3PVN A;  4GD4 A;  3USS A;  5CA6 A;  5I8T A;  2A6X A;  4NRO A;  4UFI A;  4YSF A;  1IPS A;  2R04 1;  3T0D A;  4W4Z A;  1QH7 A;  4ZY9 A;  2RDR A;  3M3E A;  4A7Y A;  1RUJ 2;  2E31 A;  3NNF A;  3THD A;  1KDM A;  4DRR A;  1UOF A;  4BWO A;  4HMZ A;  1GIC A;  2XLG A;  3IPV A;  2XML A;  2QQM A;  3ZSJ A;  1FI2 A;  2A6W A;  1WCQ A;  4LHK A;  5F5C A;  1XJA A;  5JXJ A;  3VBR B;  2JG8 C;  1C8M 3;  1GR3 A;  2ENR A;  1RIR A;  4NUB A;  1B35 B;  1MQT B;  2YBS A;  1HRV 3;  1ZZ7 A;  2C9A A;  5FWJ A;  1OUR A;  2VMG A;  1H4G A;  2ZGU A;  3MIF A;  4IE5 A;  3I54 A;  2RE9 A;  1AR6 1;  2IXL A;  3WZ1 A;  2VOW A;  1HQN A;  3NWK A;  1ZBE 1;  5KWR A;  1MS3 A;  1COV 1;  2DFB A;  3D3A A;  2EIB A;  3I2I A;  1V70 A;  1UX6 A;  4OZO A;  5GM0 A;  5FZM A;  3DUI A;  4GH4 A;  3K4A A;  1H9P A;  1Y43 B;  2VMD A;  5BYN A;  1QJU 1;  3PNA A;  4NWV A;  2WSU A;  1KFX L;  3M2M A;  5IVC A;  1HLC A;  3KV4 A;  4LPL A;  2R7E B;  5F2S A;  4XET A;  1RUG 3;  1JH5 A;  1H1A A;  1HXS 3;  4XTM A;  1LEC A;  4A44 A;  4B1M A;  1H8T C;  1CAV B;  3C7H A;  1K5M C;  3U37 A;  3BTZ A;  4IUG A;  1DGR A;  1OOP A;  2AGS A;  3FX3 A;  1JZ4 A;  2TBV A;  2X29 A;  5C4W C;  2Y6G A;  2GP5 A;  3DL3 A;  3AKR A;  2WNU B;  4Q4V 2;  4CCN A;  1OQD A;  4NR1 A;  4Y33 A;  1JHJ A;  4OQ8 A;  3T1L A;  3RYK A;  2EA7 A;  4GB3 1;  1BEV 2;  1HX6 A;  4AED A;  2PAE A;  4AI9 A;  1W8T A;  1DIW A;  1UQX A;  1QDO A;  3MBW A;  5GAL A;  3E6B A;  1H2L A;  1RYY A;  3E6D A;  5FUI A;  5C70 A;  4O9G A;  1D4M 2;  4FFH A;  1XNK A;  4LUK A;  2VOX A;  1AX1 A;  4Z1V A;  1VMF A;  1KFU L;  1W8Z A;  3B02 A;  5CFC A;  3AP9 A;  1NCQ A;  5DAW A;  4A6O A;  4CU6 A;  2B4K A;  3ZYH A;  1N1Y A;  4M00 A;  3I2D A;  1AJO A;  5FZL A;  4ARY A;  3TNP B;  1SFP A;  1W6M A;  3TN9 1;  1X33 A;  4Z2W A;  4K8F A;  1E5R A;  2ZGS A;  4FFG A;  2HH9 A;  4M0H A;  3O1S A;  5FMO S;  3H50 A;  5T5L A;  3LE0 A;  1PO2 1;  2B46 X;  3THC A;  5FMB A;  1W0N A;  5BNQ A;  2L9L A;  2CY6 A;  4LIU A;  2J1U A;  4LR4 A;  4CDU A;  3JQW A;  2BBV A;  3IDC B;  3D0J A;  1N1V A;  1MS4 A;  1UCX A;  4LHL A;  3IT8 A;  4NRQ A;  5ABJ C;  3N7M A;  1GQG A;  1LOF A;  1ND3 C;  1JUH A;  3ZDV A;  5K9Y A;  2W5F A;  2FD8 A;  5FY4 A;  2JIJ A;  3Q8C A;  3R0R A;  2PHW A;  5KXC A;  4DEQ A;  4PQ9 A;  2W92 A;  1RUF 2;  2RM2 3;  5TSW A;  4YW5 A;  4D94 A;  2MEV 2;  4M4P A;  1W2O A;  2DCZ A;  2WZR 2;  4FQZ A;  4C0H A;  1OUS A;  3ZXG A;  4ES8 A;  2YBP A;  2NZ9 A;  5CFD C;  4OHV A;  3ZLI A;  1FV2 A;  1QF3 A;  2JIG A;  4MHU A;  2AH2 A;  2VEC A;  4XFC A;  1IG3 A;  3D82 A;  5B2G B;  4GWN A;  3MW3 A;  4YWA A;  4YVW C;  4XUT A;  5FZ6 A;  5T54 A;  4CEY C;  4HLT A;  4XHX A;  2GZW A;  2R0H A;  2R06 1;  4D3W A;  3QD6 A;  1QJX 2;  3J8F 3;  2ZX3 A;  5FYZ A;  1DBN A;  5DAQ A;  1NZI A;  5E1R A;  5C9A B;  5F39 A;  4Q0S A;  3WSO A;  4CDQ A;  4P9G A;  4NVP A;  1GQH A;  3IN9 A;  1POQ A;  2ZA9 A;  5EJZ B;  4D69 A;  1QQP 3;  3GAL A;  2QCS B;  4L8Q A;  2PMW B;  1URX A;  5FMD A;  5BPX A;  1D7P M;  4M4R A;  3ZXJ A;  2VUC A;  3SEE A;  2EID A;  4Y20 B;  1LED A;  4HT1 T;  1OUX A;  4X8P A;  2RR1 1;  2BRT A;  3CJI C;  3MYX A;  2HWD 1;  4KGQ A;  3N7J A;  3DYP A;  1AYM 3;  3RYR A;  2F17 A;  2Y33 A;  5KR7 A;  4AZZ A;  3FN9 A;  2NQY A;  2WYS A;  3KCX A;  1PO1 3;  1QKQ A;  3IM0 A;  3TOJ A;  4PIY A;  1FMD 2;  3GF6 A;  3KMH A;  3UV9 A;  3RPQ A;  2BJS A;  3Q8A A;  2CHH A;  3W21 A;  3S0M A;  2HLE A;  1CX4 A;  2JX9 A;  1ZRF A;  1VBE 3;  3ACG A;  2BDR A;  3H8U A;  1H2N A;  4JGZ A;  3AYA A;  3ZFG B;  4XIL A;  3OUH A;  4Y5T A;  5I8Y A;  1VBB 1;  2Y6L A;  4TWT A;  1RUH 1;  4LIV A;  5L9B A;  1TMF 1;  4MGQ A;  1MQT A;  4Y5S A;  4GKX A;  1GU3 A;  2PTM A;  2DUP A;  3AVR A;  2Q8C A;  2WNV C;  5FP8 A;  1KRI A;  4LQR A;  3ACL A;  3MFA A;  4WM8 B;  4QDR A;  1CQ9 A;  1V9U 1;  4DQA A;  1Q8S A;  3AMH A;  1R1A 3;  1PVC 3;  5EJ3 A;  3CDZ B;  1FXZ A;  2J1S A;  4W6W A;  4NIG A;  2ZGL A;  3V56 A;  1VBA 1;  1BBT 1;  3WF0 A;  1RUD 1;  1OD5 A;  1AR8 2;  3FHA A;  5CEH A;  1WD3 A;  3SMH A;  3WVJ A;  2EAL A;  1SDD B;  2GME A;  3DCQ A;  3OY8 B;  4LBN A;  3T30 A;  1PM4 A;  3M4F A;  3PIJ A;  4UFM A;  3U07 A;  1RUJ 1;  3I59 B;  2CGO A;  4K6B A;  4I0B A;  4Q4X 2;  1PZ8 A;  1CAV A;  1RUE 1;  5IVY A;  4QB2 A;  4BQ2 A;  3MFC A;  1EP0 A;  1U5I A;  1W2A X;  4KWL A;  4NMI A;  3RMX A;  4Q4Y 3;  1JU3 A;  3ILR A;  3HEI A;  5FZ7 A;  3T0B A;  2I2S A;  3N3H A;  2WNU A;  3KF3 A;  3JUU A;  4XFF A;  4XAA A;  4DRV A;  5CU1 A;  3WNO A;  1YLL A;  1KQR A;  4XPV A;  4XZP A;  5IK4 A;  2XBO 3;  2BVV A;  1OLR A;  5DQ0 A;  2WFF 3;  1YFW A;  1QJY 2;  1O6U A;  3WQ1 A;  1CZT A;  1Q8P A;  3SH3 A;  4RR3 C;  3POW A;  4J6G A;  4DIQ A;  1DCS A;  1BVV A;  1ENS A;  4ATE A;  4CDX B;  4TZD A;  1JMU B;  5FYH A;  1KXG A;  2UYA A;  1IQA A;  3N7K A;  2VW2 A;  3I2K A;  4UW6 A;  1SBE A;  4XZU G;  2BFU L;  5DUX A;  1RXG A;  3IMN A;  2VZQ A;  4FVV A;  2GH2 A;  4XCB A;  3ASI A;  3RWN A;  4MXV A;  4XF1 A;  5G04 L;  2WQZ C;  1PGL 2;  4IW3 A;  2WFP A;  4AQS A;  1LR5 A;  2DVA A;  4BB3 A;  5BNN B;  1KEX A;  4QKD A;  5LK7 B;  1YQ8 A;  3ELN A;  3O12 A;  4RQP C;  3RYP A;  1H2M A;  1RVF 1;  2YZ4 A;  5B4N A;  4L11 A;  2Q0A A;  2ETE A;  1GKB A;  3EMR A;  4LKE A;  1BEV 1;  2DF7 A;  4JAA A;  1SPP B;  1XRU A;  3H7J A;  5HV0 A;  3CHX A;  1PZ7 A;  2FCU A;  1U0A A;  4E2S A;  4QPG C;  1ZRE A;  1JUI A;  1NCR C;  1D4M 1;  1POV 1;  1TNF A;  4COY A;  1IOA A;  1BQP A;  4YW3 A;  3I49 A;  1H1M A;  1PK6 C;  3VB9 A;  1ULF A;  2GNB A;  5F32 A;  1E5H A;  5C8C B;  1RMU 2;  5FR3 A;  1WCU A;  4AGV A;  3ST7 A;  2EAA A;  5FK8 A;  1SMV A;  2BOI A;  1XE0 A;  3O7O A;  2R16 A;  2WO3 A;  3AMM A;  3PLQ A;  4HK9 A;  1D2S A;  1WGP A;  2YPD A;  4IQP A;  4AOC A;  4K40 A;  4QX8 A;  2ZGM A;  2BU9 A;  5IJR A;  2XUE A;  4DO0 A;  3LEI A;  4WVW A;  1GNH A;  1LHV A;  2B45 X;  1TG7 A;  3KT4 A;  2WLP A;  2HEV F;  5F3I A;  3P6B A;  4IE7 A;  5LRR A;  3LFM A;  2QKD A;  1IS4 A;  5C9A A;  2VNG A;  1HB2 A;  1SLA A;  1RHI 1;  2QQK A;  4XBN A;  4KBZ A;  1D0G A;  1OLQ A;  3U78 A;  4GMP 1;  2WQ8 A;  1XBF A;  1WME A;  1F31 A;  1OF4 A;  2HWB 3;  5DUV A;  1L7L A;  2XWJ B;  3MW2 A;  3OSD A;  3PJQ A;  4G3Y C;  1VRH 3;  1OOP C;  1W03 A;  3HMY A;  3QH7 A;  3RGB A;  2G9F A;  4JZR A;  3NJX A;  1COV 3;  1T6B X;  3J8F 2;  5CZK A;  2HWF 2;  3HAG A;  5C3O A;  5F9T A;  3HN1 A;  4Y4R A;  1GMM A;  4QXH A;  2TEP A;  1U5Y A;  3WEZ A;  5FYT A;  2J7M A;  1GFF 2;  1OQ1 A;  1QQP 2;  1VBD 2;  2X53 S;  1O4Z A;  3AZX A;  3G6J B;  4H55 A;  5CG8 A;  5FY8 A;  1LHO A;  3PUH A;  5FRE A;  1CAU B;  3AZV A;  2GH8 A;  1JN2 P;  2JDH A;  3MIE A;  1CAX B;  1FOD 1;  4ISR A;  4LMF A;  2YMZ A;  1H9W A;  1OMI A;  1AYM 2;  3PHM A;  4ZS3 A;  5T55 A;  1EV1 1;  1F4A A;  3MID A;  2UU8 A;  2B39 A;  4XQD A;  4XMI A;  1ZA7 A;  3ZXF A;  4Y3O A;  4BQ3 A;  5J1X A;  1NCQ C;  3T2O A;  1W6P B;  3M3C A;  5I0R A;  1H4H A;  4N9I A;  2VZU A;  2WA3 A;  1QJZ A;  4WM8 A;  4GB3 3;  1RL3 A;  2WWU A;  3LEM A;  2GN7 A;  2QE3 A;  3WW2 A;  4CRQ A;  5FDB A;  1WLD A;  5A7S A;  4AAX A;  2QNK A;  5JSR A;  1YUD A;  4NJ4 A;  2BFU S;  2QQV A;  1PIV 1;  1QDC A;  2P2K A;  4KWJ A;  1FMD 1;  2Q1F A;  2WJS A;  1ULO A;  2WKK A;  1EY2 A;  1UPI A;  3BIW E;  3OY8 A;  4BIF A;  3MIB A;  4PLM A;  1HJF A;  1V00 A;  2PN5 A;  1SDW A;  2JDY A;  3NNL A;  3ZYB A;  5KHI A;  5C3Q A;  2QQN A;  2HEW F;  1LOF C;  3IWZ A;  1G6N A;  5FY5 A;  2D40 A;  5BUV A;  3TN9 3;  3WDX A;  3X29 B;  2AEZ A;  1CJD A;  3WQB A;  4P5H A;  4WV8 A; 
#chains in the Genus database with same CATH homology
 2Y64 A;  4MO3 M;  1J83 A;  3CZJ A;  2QQL A;  2PQS A;  5CYY A;  2VR4 A;  3AC0 A;  4ZXE A;  3J7H A;  2W3J A;  1L7Q A;  5DPN A;  4CUA A;  5JR2 A;  4KI5 M;  4LHS A;  2W1W A;  1UY2 A;  1IQD C;  2YFU A;  3ECQ A;  4A3Z A;  3EB7 A;  1LNS A;  3A7Q A;  1NUK A;  3IDA A;  2X10 A;  2V4V A;  1JZ3 A;  1SHW B;  4QB6 A;  3UES A;  2VZT A;  2YG0 A;  4D8M A;  4ZZ8 A;  1UY3 A;  2Y6K A;  4ET7 A;  2BGP A;  1UYX A;  4QAW A;  1GUI A;  4RN5 A;  3MV1 1;  2VO5 A;  5C7G A;  3LPF A;  2JD9 A;  2YB7 A;  3I3D A;  2JE8 A;  5C71 A;  3HPN A;  2WO1 A;  3VD3 A;  4A4A A;  4QX1 A;  2CDP A;  1OD3 A;  5JXI A;  1ULP A;  4JKK A;  1PMJ X;  3OEA A;  5IFP A;  2J1E A;  3C7E A;  1UX7 A;  4OUE A;  2WO2 A;  4L0P A;  3WNK A;  2V72 A;  3ETP A;  3T0A A;  3VD9 A;  4XVH A;  1CIY A;  2WN3 A;  5EIY B;  1UYZ A;  1UMI A;  2W1S A;  1JI6 A;  1H6Y A;  2ORZ A;  3C7O A;  4OMD A;  3VDB A;  5IHR A;  4UAP A;  3GXU A;  3GGL A;  3FHQ A;  5LA1 A;  2QQI A;  3WNM A;  1I5P A;  3ACH A;  4HG6 B;  4JX0 A;  2EIE A;  4Z2A A;  3SKJ E;  1DP0 A;  1GNY A;  3VD5 A;  2VMF A;  3K75 B;  3VDC A;  1NKG A;  1JYW A;  3I2G A;  5IYY A;  3EYP A;  4JHZ A;  3C8X A;  2QQJ A;  4BXS V;  2YC4 A;  4DXS A;  3HJR A;  2X09 A;  3T0D A;  3A21 A;  3ABZ A;  4W4Z A;  4GWJ A;  4ZY9 A;  2Z4F A;  1DYO A;  2E31 A;  1US2 A;  3THD A;  2WBK A;  2VCC A;  2QQM A;  2XQX A;  2W94 A;  1WCQ A;  5JXJ A;  4RYD A;  4W8J A;  1JZ5 A;  2VME A;  1XNT A;  4XUP A;  1O8P A;  1UY0 A;  4GZ9 A;  3MUY 1;  2C9K A;  4PF1 A;  4CVU A;  5HPO A;  3A22 A;  3MV0 1;  1JU4 A;  3D3A A;  4BDV B;  2EIB A;  3I2I A;  3WNN A;  4OZO A;  3VDA A;  3K4A A;  4XUQ A;  3F2Z A;  2VMD A;  3K4Z A;  3T2Q A;  2E26 A;  4LPL A;  1OF3 A;  2R7E B;  4AG4 A;  1EUU A;  2VZV A;  3C7G A;  1OT5 A;  2W87 A;  3FL7 A;  4A44 A;  2C4X A;  5DMY A;  3UNP A;  3C7H A;  3U37 A;  5IFT A;  4IUG A;  1SG3 A;  1JZ4 A;  2DCK A;  3OGV A;  2Y6G A;  3NNG A;  5JUV A;  1JHJ A;  4ARX A;  4BK5 A;  1F4H A;  1UWW A;  1UY1 A;  2W91 A;  2X05 A;  4QX3 A;  2LS6 A;  3MBW A;  1JZ8 A;  1JYX A;  1RYY A;  2DDU A;  1UY4 A;  2W1U A;  5FUI A;  5C70 A;  1K3I A;  2VTF A;  4W50 A;  4QX2 A;  3T2P A;  2W47 A;  3I97 A;  2VQT A;  2J1V A;  4A6O A;  1JZ6 A;  4CU6 A;  2B4K A;  4ARY A;  3BGA A;  3W5M A;  1JZ2 A;  3WNL A;  4E8D A;  4CUC A;  4P08 A;  3OGR A;  2ZEY A;  2VMC A;  1JZ7 A;  1NAE A;  3LE0 A;  3THC A;  3JXS A;  4KMQ A;  1W0N A;  2E32 A;  4TTG A;  2L9L A;  2J1U A;  2VQU A;  1R64 A;  3LEG A;  1H6X A;  4UOJ A;  1UYY A;  4DUX A;  3K46 A;  3MO4 A;  2W5F A;  4DEQ A;  4DEV A;  4QB1 A;  2Y8K A;  2W92 A;  3VD7 A;  3BN6 A;  4DUW A;  4M4P A;  1JYN A;  3WF3 A;  4UI9 L;  4BK4 A;  3HOB A;  2VZ3 A;  1W8N A;  2BZD A;  2EIC A;  3I2H A;  1J84 A;  4E8C A;  3NQH A;  1K12 A;  2VZP A;  4XUT A;  5LA2 A;  3T08 A;  3GDB A;  1MPX A;  3CMG A;  4PT6 A;  3WSO A;  2XHN A;  5EJ1 B;  1DLC A;  3MUZ 1;  3HN3 A;  2RVA A;  5EJZ B;  1UMH A;  4A41 A;  1D7P M;  4M4R A;  2WN2 A;  3SEE A;  2EID A;  3NRU A;  1WKY A;  3LQC A;  2ORX A;  4OYU A;  3DYP A;  2VJX A;  1XNA A;  4QDQ A;  2W1Q A;  3FN9 A;  1EUT A;  2WYS A;  4GWI A;  3ZM8 A;  2ID4 A;  4P5Y A;  2VZR A;  1UZ0 A;  1P8J A;  5A1A A;  3LPG A;  2HLE A;  2JDA A;  3VD4 A;  2JKX A;  3GM8 A;  1O59 A;  3OBA A;  3ACG A;  4XUN A;  4DXR A;  2W46 A;  2WUH A;  2XON A;  2ZEX A;  4CU7 A;  2YFZ A;  2Y6L A;  1XC6 A;  2QBX A;  4MGQ A;  1KGY A;  2Y6J A;  3IAP A;  3NJV A;  1GU3 A;  3I3B A;  1NX9 A;  4LQR A;  4QDR A;  3SKV A;  4DXT A;  2VZS A;  1JYV A;  3OG2 A;  3OEB A;  1HN1 A;  3CDZ B;  2DCJ A;  4CU8 A;  2J1S A;  2J22 A;  3OGS A;  3WNP A;  4QX0 A;  3WF0 A;  1OH4 A;  3FHA A;  4TXW A;  2E33 A;  4P00 B;  1SDD B;  3SEP A;  1UXZ A;  4OMC A;  2VOT A;  2QQO A;  1K42 A;  3OB8 A;  3PUI A;  4QB2 A;  1W99 A;  1O8S A;  1JU3 A;  3I3E A;  3HEI A;  3T0B A;  4DUV A;  1UXX X;  4D0Q A;  1PX4 A;  3WNO A;  2BER A;  1PX3 A;  3WF1 A;  5DQ0 A;  5F7U A;  1XPW A;  5JXH A;  2WAB A;  2WZE A;  1CZT A;  3E1F 1;  2W9X A;  3WF4 A;  3DYO A;  3WQB A;  2OKX A;  1GOF A;  3HNM A;  5DN2 A;  2KD7 A;  3HNB M;  3I2K A;  2ZEZ A;  2C26 A;  4XZU G;  2VZQ A;  1T2X A;  3I2J A;  3WF2 A;  3ACI A;  3IAQ A;  5G04 L;  5JXG A;  1KEX A;  2V5D A;  5B4N A;  1GOH A;  2VL4 A;  2ZEW A;  2W95 A;  2J1R A;  3A23 A;  3K77 A;  2B9V A;  4LKS A;  1GQP A;  5G05 L;  4QPW A;  4PQQ A;  1W9W A;  4BJ0 A;  1PMH X;  2WO3 A;  3UET A;  1CZS A;  1W9T A;  4MAD A;  5IJR A;  3ACF A;  1US3 A;  3LEI A;  2YC2 A;  2WAO A;  4A45 A;  1TG7 A;  4XUR A;  2VZO A;  1TVG A;  3P6B A;  2XOM A;  3DYM A;  1YQ2 A;  2QQK A;  3LEK A;  2WZ8 A;  4MGS A;  3CZU A;  2WQ8 A;  2WDB A;  1OF4 A;  2VM9 A;  2J1T A;  3CQO A;  3NJX A;  5CZK A;  2J1A A;  3III A;  4XUO A;  1GMM A;  3HNY M;  3WEZ A;  3IB3 A;  2J7M A;  1W8O A;  4CU9 A;  4QDS A;  2VCB A;  1W9S A;  4CUB A;  3PUH A;  4JKM A;  5HXM A;  3K4D A;  5LA0 A;  5JMO A;  1BHG A;  1F4A A;  5B4X A;  2BBA A;  3W5N A;  4P02 B;  3I2F A;  5J1X A;  3T2O A;  4KWU A;  2RV9 A;  2VC9 A;  2VZU A;  2BGO A;  2RJ2 A;  3C7F A;  2CDO A;  2LW8 A;  3CKH A;  4AAX A;  5LCW L;  1CZV A;  4A42 A;  4MOA A;  4YPJ A;  4JKL A;  1K45 A;  3P1I A;  1ULO A;  2VZ1 A;  2VCA A;  2Y6H A;  1CX1 A;  1L7R A;  2QQN A;  4ZZ5 A;  5I0D A;  3T09 A;  2HYX A;  2ZXQ A;  2WAA A;  1GOG A;  3CIH A;  4FI9 A;  3DEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...