1W9SA

Structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
DLKNPYERIQAEAYDAMSGIQTEGTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLLGDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0236 PROTEIN
publication title Family 6 Carbohydrate Binding Modules Recognize the Non-Reducing End of Beta-1,3-Linked Glucans by Presenting a Unique Ligand Binding Surface
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
total genus 30
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1w9sA00
4QAWA 5JXHA 1CZSA 4HG6B 5HXMA 4XUTA 4MOAA 4Z2AA 2QQKA 3NNGA 4M4PA 1WCQA 1JZ6A 3HOBA 4AG4A 4XUPA 1CX1A 5IHRA 2VOTA 2QBXA 1F4AA 3VD9A 4KWUA 3I97A 5JUVA 1NX9A 3VDAA 2VC9A 3MV01 2CDOA 3A23A 3VD3A 4D8MA 3HEIA 3E1F1 4KI5M 4XURA 2J22A 2J1UA 2VMCA 3ABZA 2W46A 2WDBA 3P6BA 4QDQA 4E8CA 2W3JA 3EYPA 2WUHA 3K4AA 4JX0A 2B9VA 2HYXA 3NRUA 3C7HA 2DCKA 3D3AA 4LQRA 5J1XA 4MGQA 1OD3A 3DYPA 3W5NA 1P8JA 3OG2A 4BXSV 1YQ2A 3LEGA 4TXWA 1NKGA 3JXSA 3K75B 2LW8A 4XUOA 5I0DA 3VD7A 3HNBM 2W91A 2VM9A 1JHJA 2C9KA 4JKLA 1F4HA 2X10A 3UESA 3I2KA 2QQIA 4A45A 4CU7A 5CZKA 4RYDA 3IDAA 4ZY9A 2ORZA 3HN3A 3I2GA 3WF0A 2YG0A 4CU9A 2J1RA 4CU6A 1K12A 1JZ4A 3VDBA 1GOFA 1GNYA 2YFZA 1JU3A 2J1VA 2YC4A 1UYYA 2WN3A 4P02B 5EJZB 5C70A 4DEQA 3C7FA 2XONA 2PQSA 4ZZ8A 3OBAA 4XVHA 5DQ0A 2LS6A 2J1AA 4UI9L 5JR2A 3CIHA 4XUNA 3T09A 4ARYA 4DXSA 3FL7A 4ZZ5A 4XUQA 2VQUA 4DUXA 2VZPA 3EB7A 2WZEA 5G04L 1W9TA 5JXIA 2WO3A 4GWJA 3ZM8A 2VZ1A 2VMFA 4OMCA 1JYXA 1UY2A 3SEPA 2WBKA 3A21A 3OEBA 4ARXA 2WZ8A 4P00B 1TG7A 3I3BA 3T08A 1DLCA 1K3IA 2Y6JA 3LPFA 5LCWL 5C7GA 4A6OA 1JZ8A 3FN9A 3SKVA 2W1SA 3CMGA 4D0QA 3IIIA 2BBAA 1I5PA 1OF4A 4KMQA 4QB2A 5IFPA 4OZOA 4UAPA 3DYMA 1HN1A 2VTFA 3CQOA 5B4NA 3A22A 2ZEZA 3VD5A 1H6YA 4LKSA 4QX1A 1JYWA 3ACFA 2W94A 4MGSA 4W8JA 3K46A 2WAAA 1RYYA 4CVUA 4FI9A 3I2FA 5FUIA 2VCAA 5LA2A 4A4AA 3K4ZA 3OEAA 2EIBA 2W1WA 2Y6HA 3WF1A 2KD7A 2WN2A 3WNPA 4QX0A 4BDVB 3SKJE 3SEEA 2W92A 2CDPA 4CUBA 2W47A 1NAEA 2WO2A 1O8PA 3MUZ1 4L0PA 3I3EA 1PMHX 2QQLA 3MBWA 5G05L 2WQ8A 1GOGA 1UZ0A 1K45A 2V4VA 3GGLA 1L7RA 2WO1A 4A44A 1UY1A 1XNTA 1US3A 3HNYM 1JZ7A 3ECQA 1NUKA 1UY0A 3C8XA 2BERA 3GDBA 2J1EA 2ZXQA 3DYOA 3OGVA 3I2JA 1TVGA 3T2PA 3ACHA 3OGRA 3C7GA 3MUY1 2QQOA 3OB8A 3AC0A 1UXXX 1L7QA 2J1TA 3WNOA 3VDCA 4A41A 3NJXA 1W8OA 1GQPA 1SDDB 2VZVA 3U37A 3PUIA 4OMDA 2VZQA 3LE0A 2VO5A 2L9LA 2RJ2A 4P08A 3LEKA 3GM8A 3OGSA 4W50A 4JHZA 1PMJX 3P1IA 2RVAA 1W8NA 1J84A 2W1UA 4CU8A 2VZUA 3NQHA 2E26A 5B4XA 4PT6A 3CDZB 3UETA 3T0AA 2VMDA 4YPJA 1UY4A 2E32A 2JDAA 1UMHA 5EJ1B 2E33A 1W99A 1WKYA 2W5FA 4XZUG 2V5DA 3IAPA 5JMOA 2DDUA 3THDA 4OUEA 1EUUA 1GOHA 3WF4A 5DPNA 2WYSA 1GUIA 5IFTA 2E31A 1CIYA 2EICA 5CYYA 1H6XA 3WF2A 2Y6LA 2Z4FA 3FHAA 2ID4A 3LQCA 3NJVA 1JZ5A 2OKXA 4A42A 2QQMA 4BJ0A 4CUCA 4GZ9A 2BGOA 4JKKA 3IB3A 1MPXA 4OYUA 5C71A 3CZUA 3THCA 3T2OA 1OF3A 3WF3A 3T0DA 3WEZA 5JXGA 3CKHA 3CZJA 2ZEXA 4M4RA 2VZTA 1XC6A 2BGPA 2X09A 1KEXA 4JKMA 1DYOA 4LHSA 2WABA 1XNAA 1O59A 1JZ2A 3ACGA 2JE8A 2DCJA 3BGAA 1W9SA 2VCCA 1R64A 1JI6A 3K77A 3HPNA 2X05A 4QDRA 4A3ZA 1UXZA 3I3DA 2RV9A 1SHWB 1JYNA 3FHQA 2VJXA 2XHNA 4P5YA 3W5MA 2VZSA 2VQTA 2HLEA 4QX2A 1BHGA 4TTGA 3F2ZA 2Y6KA 4ZXEA 1W9WA 2VMEA 4LPLA 1D7PM 3I2HA 3I2IA 3ETPA 1UWWA 1ULPA 2VCBA 3HNMA 3C7OA 3PUHA 1JU4A 4IUGA 4PF1A 2VZ3A 2XQXA 1IQDC 1OT5A 2ORXA 3T2QA 5LA1A 2QQNA 1UY3A 2XOMA 3ACIA 4UOJA 1UX7A 4QPWA 2Y8KA 3LPGA 4RN5A 3LEIA 4ET7A 2W95A 5IJRA 4DEVA 4MADA 4QB1A 4E8DA 1XPWA 3T0BA 3WSOA 1JZ3A 2VZRA 4DUWA 1UMIA 1DP0A 2VL4A 3WNMA 4PQQA 2B4KA 3J7HA 3WNLA 5LA0A 1W0NA 2BZDA 2JKXA 3GXUA 2W9XA 2W1QA 2EIEA 5IYYA 2QQJA 2YC2A 5A1AA 1CZVA 2VR4A 2YFUA 2VZOA 4AAXA 1GU3A 4MO3M 4QDSA 3UNPA 1O8SA 1CZTA 4GWIA 2ZEYA 3MO4A 2C26A 1EUTA 1KGYA 2J1SA 1ULOA 1PX3A 2ZEWA 2W87A 3WNNA 1K42A 3HJRA 4W4ZA 1LNSA 2Y6GA 4BK4A 5EIYB 3VD4A 3DECA 1UYXA 2J7MA 2EIDA 3K4DA 5F7UA 4CUAA 3A7QA 4BK5A 4DXRA 3WQBA 2Y64A 3C7EA 4QX3A 5HPOA 1GMMA 4DUVA 3WNKA 5DN2A 5JXJA 2WAOA 2R7EB 5DMYA 2YB7A 4QB6A 1UYZA 2C4XA 3BN6A 3MV11 2V72A 1J83A 3IAQA 1SG3A 1OH4A 1PX4A 1T2XA 4DXTA 2JD9A 1US2A 1JYVA
chains in the Genus database with same CATH superfamily
4LO6B 4C91A 1Z0HA 5L9RA 5IK8A 1L7LA 4LBQD 5LW9A 2R042 5CISA 4QHZA 4MOAA 4XBLA 2G1MA 1DZRA 2YPJA 4K8FA 4M4PA 4DRRA 5AVAA 1RUJ1 4ZS2A 3SLIA 2D7FA 3ZYRA 4AWDA 5JOYA 5HV4A 3LD8A 4LK7A 2RS31 2R6QA 1PVXA 1C8M2 3LIHA 2ZGTA 1W6OB 4EN9B 2VVFA 3I97A 2QQVA 1BZWA 1CVNA 3U0ZA 4FPKA 3AL5A 1IOAA 4WVZA 1S2BA 5I0UA 1MQTA 1W6PA 1YCIA 3ILFA 2VC9A 3NNLA 3WXPA 1CAWB 1ZRIA 3QACA 3WP6A 3E1F1 1ZYBA 4IEVA 2Q1FA 3POEA 1AVBA 4J1WA 4F83A 1AX2A 2AUYA 3M70A 1YYNA 2J1UA 2CSGA 5JAXA 4P9XA 3RZZA 4KWJA 3U10A 1ULEA 1AX1A 2W46A 1SACA 3N35A 5K9YA 4AI8A 2XJQA 4LKDA 3MEPA 3AYEA 3VBRB 2Z5WA 1HRV1 4KL1A 5JZGA 1Z78A 2WUHA 2RJLA 1RUG3 5FZAA 1V6OA 1K5MA 3IM0A 5LB6A 3OUHA 1YC61 4MUVA 4AHZA 2WNVA 4XHBA 1RJ7A 1XRUA 1E5RA 3U14A 4LT5A 1AR93 1QXRA 5T5OA 1REDA 1U5IA 1ZZ6A 4QXHA 3C7HA 2DVGA 2DCKA 3LIGA 1C1FA 4PLMA 5DUUA 2RDSA 3V65A 3ZFGC 1VP6A 5J1XA 3W5NA 4GH4C 1HQLA 1CQ9A 3AP6A 5LRSA 1P8JA 2ZAHA 5D8AA 4QU1A 5F6LB 1NKGA 4E4SA 1O5LA 1DQ5A 4UF0A 1NY72 4A3XA 4XUOA 4EJRA 5JSRA 1MZEA 5FZ3A 1D2SA 4XAAA 4Y1VA 2ARCA 2Q30A 3GALA 1BVP1 1SLCA 4IGQA 3EHKA 4LBLA 3WDWA 4QPYA 5A70A 3RZJA 2DTWA 5FZGA 4S2GA 4UFKA 4CEYB 2GP5A 4RQPB 5L9VA 5FPZA 2K9ZA 3KT1A 2CY6A 3UESA 3I2KA 1S0BA 1Y9GA 2XUMA 2P2KA 2R0HA 3UKVA 4FBFA 1H8VA 1XNBA 4PI2A 5J98B 3SH4A 3KQRA 5FYSA 3VHOA 3N4MA 2O1QA 4ZY9A 1D0HA 1X36A 2ORZA 3MICA 3WF0A 4NIHA 2CNAA 5DAXA 1KS5A 1N1SA 3T1LA 1O91A 4Y22B 1W6MA 3WX5A 1X33A 2D6MA 3ZN4A 3O1OA 1APNA 2J1RA 4CU6A 3V0BA 2K2SA 4E2QA 3I7DA 5FYZA 4YGBA 5FP4A 2FBEA 1RVF1 3RZHA 1UPSA 1VBA3 3GZTB 4IGOA 4AVAA 2WL1A 1W8TA 4N43A 2UYBA 3IKWA 2WN3A 4DIQA 1RTVA 1O3SA 1FI2A 3B7MA 4PDWB 5DAQA 3S7IA 1LOFC 4QKBA 1KJLA 1VE0A 4DEQA 5C70A 4BMEA 5H9PA 2XBO1 5IYYA 3HVDA 1BYHA 1YLLA 4XVHA 4Y33A 1OUSA 4DS0A 5JR2A 2UY9A 3CIHA 3T09A 1YHFA 4XYXA 4ARYA 4QGNA 4ZZ5A 3O0XA 1AR92 2CU5A 2AACA 3ST7A 2R071 2WA3A 4LTAA 2GMEA 5L7OB 3E5XA 4CDWB 4P9GA 5C3OA 1RUI1 4DUXA 1OH3A 2I45A 2LALA 3EB7A 2NMNA 1RJ8A 4NWVA 4AQ6A 3TNPB 4A7YA 1FPN2 4BQXA 3ZM8A 2ZTNA 4LO5B 4JHTA 1PM7A 1BBT2 4YYOA 3SNMA 1UW8A 1RUD2 4ARXA 2WZ8A 2WZR1 4XF0A 3WW3A 1PK6C 4XCAA 4K1YA 1T6BX 4QQOA 1H1MA 3WDXA 1K3IA 1QJY1 3O7OA 4UFHA 1YQ8A 2GP3A 1AF9A 1BEV3 2G9GA 5AFBA 3CMGA 4NIAA 1AXKA 3CBNA 4D0QA 1NCQA 4XF3A 2BQPA 4OQ9A 4AI1A 2BBAA 5BNPB 3R4SA 4RSUA 1COV1 1DQ0A 1UPIA 1YWKA 2AYHA 1PZ7A 4L92A 5FYVA 3RGBA 3MIBA 4OZOA 1HN1A 3CQOA 4JDMA 1FOD2 3ZKUA 4IGPA 3T1MA 5FP3A 1SPPB 4Y26A 3WCRA 4EWDA 3B3QE 3A22A 1J3QA 1UU4A 1LGBA 2ZEZA 1PO12 2XPJA 5K0UC 1IGOA 1JH5A 2ARAA 1H6YA 2VTXA 3IN9A 2D3RA 4M0HA 5KHGA 4XMIA 2W94A 5A3WA 4W8JA 5JI7A 4AF9A 1S0FA 4B1LA 1POV3 3K51A 4BPZA 3FWEA 2JD4A 1WLDA 5DABA 3I2FA 3E97A 4N7UA 5FQ0A 4LKEA 1SMVA 2VCAA 2ZX1A 3KCYA 3WUDA 4AFBA 5BV6A 2Y6HA 3WF1A 2KD7A 2WN2A 5BNQA 2DCTA 4XJWA 3SEEA 3TAYA 1W3XA 5FZHA 1W04A 3SCHA 2DTYA 3JCIA 4CUBA 2W47A 2PHTA 1N3OA 2D6PA 3JB4C 5EHDA 5CEHA 2PAEA 4AFDA 1IPSA 5DDJ2 2VMHA 4JGZC 5G05L 5ABJC 1XYPA 1K45A 1GV9A 1UO9A 4CDQA 3O1PA 3MPBA 2H6CA 3GHNA 3H9AA 3UGHA 3SCFA 3O14A 4IE7A 5AVPA 1UY1A 1B35C 1JODA 2QQWA 2VPVA 3R05A 4QGLA 2YC0A 4WM8B 4E2GA 1BLZA 1VB4A 1SLLA 1WLCA 2VUDA 3RWKX 3C8XA 4QQLA 2WNUB 4Q1RA 5FAXA 3VN4A 5JVVA 4LBNA 4EN6B 4XFGA 1IZ3A 4CUGA 4PQ9A 3GZAA 3OGVA 4H7MA 5A7NA 1QJU1 3VZMA 2BFUL 5F5IA 2FMDA 1PM4A 3R4UA 2QQOA 2PHLA 3KV4A 5E8AA 2LUWA 1UXXX 3EBRA 4I3GA 3WNOA 2BNNA 2RS12 5F3GA 4A41A 2WKKA 5JDBA 1W8OA 1GQPA 1VAKA 2WLPA 4LBQB 2ZGSA 2PXJA 4BMBA 1OKQA 2IC1A 4RGGA 2W68A 1Q8OA 2W52A 3VZJA 4OMDA 1UX6A 3MW3A 1J58A 1YFUA 4Q27A 4RR3B 5J09A 3RZMA 2YY1A 4J25A 1H8TB 2L9LA 1CPNA 2VBDA 3TN91 4LLFA 4B4RA 2DV9A 1MEC2 1D4M3 1R082 3P1IA 3MIEA 2RVAA 5FZOB 2V5YA 1W9YA 1W8NA 1SLBA 4LIUA 1WA6X 1RUF1 5LASA 1CPMA 1MQTC 4IV1A 3UETA 3ILRA 1HV0A 1J1LA 1OD5A 4BHPA 1BXHA 3U07A 1BMV1 1IG0A 4Z1VA 2E32A 4K6BA 4L2NA 3VUOA 3ACLA 5CFDB 1UMHA 5EJ1B 3H1YA 3B94A 1QJFA 2IVJA 1FMD1 3GNEA 4XZUG 4MG2A 5I91A 2HWF3 3AKRA 5JMOA 2DDUA 1O7FA 5C8CB 1AYN2 3THDA 1ZA4A 5D21A 2YBPA 2P3KA 5A7QA 4UFMA 3V0AB 1QJX1 3Q8EA 1MS5A 1XJAA 4XW3A 2GC1A 3KT4A 3OPTA 4WM7C 5FYIA 3S30A 1MS1A 1AUYA 1NQDA 2EF6A 4AEDB 2QJVA 3AYCA 5FYYA 2WNVC 4CEYC 3U4XA 5CYYA 5A7PA 3LFMA 3VBHB 1FXZA 1LGCA 2BEOA 2PHRA 2QDNA 4W65A 3H3ZA 3VBUA 1VBE1 3THPA 4Q4W3 4B3NA 2A6ZA 3BPSA 4HVOA 1KDKA 2ZGOA 1JZ5A 3W9AA 1SCRA 2GN7A 2IZWA 4A7KA 4OI4A 2VVEA 4YW5A 3NV3A 4BJ0A 2BJSA 2H0VA 1QMJA 1AR71 4HVRA 5GKAC 1NA1A 1ASJ1 1Y3TA 3C3VA 4W6XA 5C71A 3OJBA 2WT0A 4ZU5A 4XFIA 1AR62 1OVSA 1RUJ2 5D2AA 4E2SA 2EAAA 2RS32 5IVYA 2FDHA 2Q4SA 3KF3A 4FOQA 4M4RA 4WBBA 5EQUA 1H4HA 4KG0A 2OVUA 2ZGUA 4PHZA 5HXVA 2BGPA 2DUOA 2HWD3 2X09A 3CO2A 5FZDA 1ZZCA 5CKMA 4UFLA 1U5XA 2B8MA 2WABA 4XHXA 3SHRA 4HKLA 1VBC1 2JEMA 2A71A 1JZ2A 4JC1A 1RVF3 4CZSA 3RNSA 5HI0A 1W9SA 4DMIA 3MFCA 5LZ6A 4H3WA 5LA9A 1VAMA 3PNAA 2VOKA 4QDRA 1C5HA 4I0WB 2FDIA 3RMYA 3INAA 5A7WB 5FCCA 3LOIA 3RVHA 2MPFA 1CAUB 4JGYA 4QPIB 4N8MA 1SHWB 2QQUA 3D5OA 5GZDA 1JYNA 4AVCA 5CFCB 3B02A 1O3RA 1HRV2 3FZ3A 1AYM1 5C3QA 4IEPA 4RHV1 3OYWA 1POQA 1RUH3 1UZVA 2ZGKA 4HFSA 4IXLA 4NPMA 4LOTA 1O5UA 4IEZA 1K5JA 4OLLA 1S0EA 3GJAA 4FP2A 4Y1UA 3VBOA 1QY4A 2ZGPA 4CRQA 4YWAA 1W2AX 1OOPB 4XC9A 1FAYA 5F5AA 2LTNA 1OFSA 3FBMA 2DWRA 3KZ4C 1S0IA 4ZXEA 3WW1A 5FPVA 3EXUA 2DVAA 1EAH3 2EA7A 3OUJA 4FPOB 5GZGA 5HV0A 3I8TA 3LSEA 3QOPA 5F9TA 1WCUA 2HWB3 4MLOA 2FZ1A 4XJ8A 3O1SA 5K4LA 1GWMA 1FV3A 4HANA 1A3KA 3POYA 1REEA 2UU8A 3URFA 1UWWA 5BNPC 5EXOA 5C5UA 1J1TA 3PUHA 4Z2WA 1JU4A 4OQ8A 1GNZA 2XQXA 3PUAA 1GNHA 4Q26A 1I3HA 5JOWA 4Y1ZA 4RS5A 3KCCA 2MHFA 5LA1A 4Q2FA 1ZZ9A 3ACIA 1S0GA 3IT8A 1VRH3 4QPWA 5GLWA 4XAEA 5FY4A 3LPGA 3HT1A 1V0AA 3PIGA 3LDKA 2Z79A 2JENA 1VBB3 5DUXA 4RN5A 4CP1A 5FZ0A 4LHNA 2ARBA 4ET7A 2D3SA 2A1XA 3SC7X 5KHHA 5SV5A 3CF6E 1QU0A 1UNBA 2QCSB 2WA4A 4R9BA 3AZXA 1RHI3 1RVF2 2PFWA 5L19A 1AZDA 1HQWA 1W9FA 3CJIB 2OYZA 3VKMA 4CDXB 1Q8PA 2JE9A 4PQQA 4CDUB 3OPZA 1PGL2 1WLTA 3J7HA 3T2TA 2Y38A 2XJVA 1UF2C 2JKXA 2WR9A 4BQ4A 2W9XA 1TZOA 5A7SA 3ZYIB 3M7AA 4CP9B 5AFEA 2JDKA 2QQJA 2XBO2 2YC2A 2GN3A 1CZVA 4JQRA 3KV9A 5DXDA 5JSPA 2PHDA 5H9QA 1UCXA 4QDSA 1ULCA 3NVCA 3POFA 4Q0QA 2R072 4N7IA 4TWTA 1V6NA 2WWJA 3RMXA 1V6KA 4CCDA 1KGYA 1RUI2 4R9CA 2J1SA 1LCLA 4NAMA 1ZZ7A 2WS91 1V70A 4LE3A 1A8DA 2HWB2 3JD73 4I0BA 3ORJA 2HBUA 3ZR5A 1J3RA 1W03A 1DFQA 5EIYB 3I2DA 5CU1A 3FX3A 1NCRB 3POGA 2R0FA 5JPMB 2DVBA 1NLQA 2EIDA 2WZR2 3ZFGA 4A6SA 3BU0A 3A7QA 1WMDA 1RUG1 4DXRA 4GH4A 4Y1XA 1UZWA 4YZ5A 1T6GC 2PAKA 2SLIA 1QJY2 1WCKA 4QHOA 3MDPA 5DN2A 1W39A 3IDCB 4D69A 4XDQA 3POJA 4RR3C 1IPKA 1A6CA 4CTEA 2GSYA 1H8TC 2F6BA 1PIV3 3OOXA 2Q8DA 5K7PA 5FYTA 5E16A 1COV2 5FZ6A 3APBA 4XZPA 1QXJA 2E53A 4CA9A 2V72A 2VTXJ 3FLPA 3ZMNA 2XH6A 4IESA 1I9RA 1XNKA 3WNXA 4X8PA 1W3VA 4Y4RA 3ZXGA 1LEDA 1OH4A 1PX4A 3CU7A 4YGEA 2JD9A 1JYVA 1NLSA 1GP5A 4ES8A 4QAWA 5FY5A 3NAPB 1DGWA 1M4WA 1GR3A 3D6EA 2XJSA 2OIIA 5FYBA 1CX4A 3CNAA 5CFDC 1VLNA 2B46X 4Z2AA 5A32B 2QQKA 3NNGA 1W6NB 1RUF3 2B39A 2AC1A 4QXCA 1JZ6A 4HL0A 2X5IB 4EWEA 4XFAA 2VOTA 2QBXA 3PMSA 1SBDA 3ZSJA 4F7ZA 5I8YA 3D4KA 1GICA 4AEDC 5JUVA 3VLBB 1NX9A 2XJUA 3KLSA 4UFJA 4CXWA 3AXEA 1ND3C 5GJ6A 3G6JB 1XU2A 2VXJA 3M8LA 4LO7A 1W8FA 3U75A 4KI5M 2VXRA 4XURA 2PHXA 1VBA1 1OLMA 3I3QA 1Q8SA 4O9GA 4PLNA 3ZMOA 1WBFA 1PNFA 4D6QA 2D5FA 3OSDA 3ABZA 2WQZC 3O0VA 5EP9A 2OPKA 4MYEA 3EO6A 3SXWA 2JB8A 2W3JA 1GZCA 3U4SA 3O5SA 2BYVE 3EYPA 1R1ZA 3QD6A 1ALYA 2OT7A 4YLZA 3OY8A 3K4AA 1N1VA 4JX0A 1QJU2 4NN0A 3PVEA 5EWSA 3TEWA 2B9VA 1IS6A 1D2QA 1H1IA 2HYXA 4H2AA 5FZKA 3NRUA 4F8AA 2G9ZA 4ZU7A 4TLFA 2HEYF 1H0BA 3D3AA 2DUPA 4CEWB 2WC2A 2K0GA 2VOXA 4MGQA 1PK6A 3ZXDA 5GLTA 1HW5A 3WCSA 2P17A 3JU9A 1I5ZA 2WO7A 1ST8A 5A3PA 2Y34A 4YNIA 1YFXA 3JXSA 3K75B 4FT8A 2LW8A 3N7MA 4MGKE 3VD7A 5ACA3 2A6XA 3BVCA 1UKRA 1ZM1A 4M3CA 2Q0AA 2GC2A 4N9IA 4AHXA 5IVVA 5CVRA 1F5FA 3PUSA 1KS4A 3TN92 3LF7A 4XBNA 5FK8A 3AZZA 4JKLA 2NN8A 3W59A 5FP9A 1PGW1 2IWGB 1BEV1 5FKBA 1XE8A 4TN7A 1LOEA 1RUF2 2FDKA 3U1XA 4RYDA 5K0UA 5E88A 1HV1A 1OOPC 4MV2A 2JIJA 4OUMA 1BMV2 1RUNA 3FMGA 3I2GA 3VBSA 4CU9A 4D7TA 4D6SA 2VVDA 4MXWB 2H6BA 5C4WC 1OLME 1JYTA 1K12A 3WG2A 4COVA 1DQ4A 1EP0A 1FMD2 3NV2A 4FFGA 1NZIA 2KR2A 2TUNA 1SQ4A 1Y4WA 4SLIA 2DUQA 1NG0A 1X8EA 4N53C 2ZPXA 3H3LA 4KG8A 3VDDC 2ENRA 2GNBA 1BK0A 1QJX2 2J1VA 2RM23 4IEQA 1POV1 3SITA 3JUUA 4B8EA 3QH7A 5FXVA 5EJZB 4XCBA 2HWC3 3NMBA 2JG9B 2XJTA 2XONA 3PTRB 5FY0A 1VBE2 3ZYPA 4JGZA 1RITA 2R30A 5FZ1A 4LKFA 2PHWA 4DY3A 4ZZ8A 5ABJA 3D0JA 2LS6A 1V6JA 3EMRA 4UI9L 4FTEA 3SISA 1LHVA 3ITQA 4DXSA 3FL7A 2HYKA 3LA3A 2D6KA 1H2MA 5IWFA 2VQUA 1AR72 3WT3A 1X7NA 4QKNA 1XB9A 1ASJ2 2VZPA 1VMFA 4DOUA 3WY6A 2WZEA 5G04L 1W9TA 1MS9A 2UYAA 3HQRA 4V2WA 5BNOC 4J6GA 3CJIC 4XE9A 1UMZA 3FUOA 1W6OA 3N9QA 5FPXA 2VZ1A 4CCNA 1W8HA 1S0CA 2BFUS 2Z69A 2WSUA 5FP8A 5T54A 1VB2A 3JQXA 2D40A 4MHRA 5DAVA 3T30A 3Q8CA 2VOWA 5C3PA 1O3TA 1CAWA 1TG7A 2Q5TA 1VBC2 2E7AA 2GH2A 3N7LA 1AR83 2O8OA 5EYYA 3LB9A 4EZ4A 2MEV3 1RGSA 5J36A 5LCWL 1H1AA 1QJZA 5C7GA 2XL9A 1ND2B 5FXXA 4AEJA 5BUVA 1WA4A 1G9FA 2XWBB 4EN0A 5IVFA 2ZMNA 2AH2A 3WG3A 2E7TA 5T5PA 1I5PA 2ZMKA 5T3NA 2GMPA 3LGRA 1ENSA 2AGSA 5HPOA 1AYM2 1CAVB 2PA7A 4RHV2 1QXPA 1R1A3 2YUEA 3JZVA 1DYKA 4LO8A 4GA9A 2ZKLA 3NV1A 3M3CA 5DZEA 3VBFC 5LBBA 4YZ1A 3VD5A 3ZSMA 2YHJA 4UWDA 3B00A 4YSFA 5IK4A 2PMWB 4QXBA 5IVEA 3J26N 4Y4YA 3BB6A 3Q8BA 4ORFA 3BTYA 1D4M1 5C9AB 3MPPG 1YRZA 2WFPA 2WS93 1RYYA 3HIFA 3GCWA 1RUC3 3KMHA 4AL9A 5K8SA 1UL9A 1JOPA 3AP4A 2JJ6A 3E5QA 2BVVA 4NUBA 3KB5A 3SKJE 4WM7A 1REFA 2CWSA 3AKTA 2R063 1NAEA 1BKZA 3MUZ1 1WD4A 4L0PA 2D6OX 4CEYA 5DUVA 2HWF1 1CESA 4BOWA 2BTVC 1GOGA 3GGLA 1L7RA 1DGRN 1YJLA 2WO1A 3TWIA 3AZVA 3CJXA 4A44A 5BNNC 1WBLA 1O4ZA 1US3A 3HNYM 2EXJA 5KC6A 3ECQA 1NUKA 1TNRA 1UY0A 1W28A 1JOJA 4N90A 3BIWE 4Q4W1 1IKQA 1ULDA 1OMIA 2BERA 2IXKA 3GDBA 4E27A 2W39A 5FLIA 2ZXQA 3H7JA 5FYUA 1BJQA 1TVGA 1CAXA 3MLKA 2TEPA 4Z82A 4YW7A 5ISLA 4O9EA 4DB5A 1UD1A 1W6PB 2ZZJA 4FOWA 3OB8A 3AC0A 1L7QA 4C0HA 5GALA 4PDWA 2BWCA 4P9LA 3O1VA 4CP2A 3NJXA 3TRSB 4ZONA 5A6QA 2VMGA 3DV8A 1DHKB 3ON7A 5LBFA 1DGWX 1SDDB 3IPVA 2VZVA 4Q29A 2HWD1 4DY5A 2VBBA 2VU9A 4Y20A 2Q1MA 5FMOL 5F1RA 4NRQA 1YIFA 3BKZA 2YBSA 3M1HA 3NKGA 4NHLA 5E6HA 5JZGB 5L7OA 2VO5A 4WV8A 3O1RA 4FPGA 5FUNA 2RJ2A 4KU8A 1LTEA 3GM8A 2PLV3 5TSWA 3ZN6A 2VULA 4M3CF 3KT7A 2WS92 1PMJX 2ZMLA 5LATA 5JI9A 1LECA 3UK9A 2PTMA 3RYKA 1PGL1 1CJDA 1GLHA 4B29A 4I02A 5C8WA 3CDZB 4CEWC 4Q4V3 4K9SA 3ZO0B 4AHWA 1HDKA 2P5BA 4D6RA 4B4QA 5D8AB 4QT6A 1RUG2 5L9BA 1UY4A 1GZTA 1Q43A 1JBCA 1RUH1 4DFSA 1WMEA 4YVSB 1OLQA 2OX0A 1DLLA 1W8WA 3HD8B 4FPJA 4I30A 5FIXA 5FLJA 3IAPA 1UZZA 4JDNA 4PIXA 4Q5OA 4XBQA 3ZDSA 1YEWA 4BU2A 5FV3A 5BNPA 3OBZA 4XQDA 1KJRA 5DPNA 1EAH1 2WYSA 5IFTA 2HEVF 2E31A 3GHMA 1CIYA 2H0BA 2HWB1 5DZGA 2B7YA 1NT0A 2P6CA 4E4DX 1H6XA 4C8DA 4AGVA 3WF2A 2P37A 1OFNA 1AX0A 2ID4A 3LQCA 3NJVA 2Q1ZB 5I93A 1ZRFA 2LRPA 4XOGA 4EROA 4A42A 5FOBB 2ES3A 4IEYA 5FMCA 4AFCA 4CUCA 3V0BB 3GCXA 4K1ZA 1MVQA 3BOPA 3N9LA 3IB3A 3N9MA 4XETA 3VKOA 5A6XA 1VRH1 3CZUA 3K3OA 3WF3A 2WWUA 3WEZA 5FTTC 4NMIA 5FZEA 1VBB1 3CKHA 3CZJA 2ZEXA 2DYCA 5LY2A 3N3HA 1F5JA 4ZS3A 5IT6A 3IMMA 3AYDA 1G86A 4JV4A 2HEWF 2NQYA 2CGNA 3HWJA 2RMU3 1SLTA 4CXXA 1XNAA 5GM0A 4CYDA 1GZ9A 1RHI1 2JE8A 1PHMA 2IVIB 1L3JA 3CEWA 2XVLA 1VBA2 4UW4A 1AXZA 1N3PA 2YV8A 4BQ1A 3ES4A 3A0NA 3VBSC 2VCCA 1R64A 1JI6A 4BQYA 3LEMA 2IXIA 3I3DA 3QCWA 4S2DA 2WNUA 2RV9A 3V64A 5LK7B 2UURA 1QQP3 1W6QA 4JRAA 2DURA 1HXS3 1E5SA 2AENA 4R9DA 4YW2A 1DQ6A 3ZYJB 1V9U3 5AC91 5A6ZA 1RL3A 5KXEA 3W5MA 4GXLA 5DUWA 3N9OA 2XR4A 2HLEA 1QNWA 4HN1A 3WINE 2ETEA 4TTGA 3H7YA 4PF5A 3QH6A 3OCPA 3DKQA 3L9JT 4RD7A 3ZSKA 4JVAA 4OI1A 4AQSA 3DCQA 4LBQA 4QQPA 2BW8A 3ZFFB 3JD71 1W9WA 2VW2A 3POIA 4JCKA 4FXGB 4AQTA 3LA2A 3RYPA 4OUSA 3MW2A 1ONAA 1NCQB 4RR3A 1D7PM 1UU5A 3I2HA 4LLOA 3S5AA 1ZRCA 1YQCA 3I2IA 1H8TA 2RHPA 4JRLA 4Q8LA 3DXUA 2D44A 3HNMA 1SLIA 2BVBA 3C7OA 3H1MA 3KD4A 4IUGA 4PF1A 2VZ3A 2IUWA 4FPCA 3VKLA 1WZXA 3MI8A 3KVAA 1IQDC 4FVVA 1G9CA 1H2LA 2ORXA 1QKQA 1MACA 5FZOA 1PGW2 2CGPA 1BEV2 2WSVA 1UY3A 3IDBB 3H0OA 4OI0A 4M01A 4UOJA 2C6SA 4A7ZA 2MNGA 2IXLA 1PIV1 4FOVA 3M3OA 4R4ZA 1UU6A 2OXBA 1VPHA 4LUKA 4QKDA 3BODA 3T3YA 3B93A 4ES9A 4M00A 4GD4A 5CFDA 1FT9A 5IJRA 4QQHA 4FPYA 3AMNA 4MADA 5EPAA 4AK3A 4QB1A 3WP3A 2LROA 2B9UA 2G19A 1TME3 3T0BA 2ZACA 3UT0A 3WSOA 3VBRC 1OXCA 1JZ3A 2JDHA 1DQ1A 3SCGA 3GZUC 4HKOA 4AEDA 3CLPA 4PLOA 3RPQA 2P1BA 4Q8KA 3IZOA 1ND3A 4EYUA 4HPKA 4COWA 5LA0A 2GC3A 1W0NA 1UOGA 2VD7A 2W1QA 1ZBA3 4CDQB 4KH9A 3ZPYA 3WQ7A 1OLRA 2YFUA 3KV5A 3NJZA 1Q3EA 3RYRA 2C1FA 1JMUB 1O8SA 2QE3A 4OFGA 4FXKB 1CZTA 5EZWA 1F35A 5SV8A 5C33A 5FPUA 5FWJA 3ZSLA 2C26A 3AJYA 2BGCA 3T4VA 1EUTA 2XLAA 2YPDA 1G9AA 4KBBA 2YGMA 1E5HA 1ULOA 1OPOA 4NHKA 2K46A 3TNQA 2OUJA 3WNNA 4MHUA 4Y1YA 4EWAA 4W4ZA 3MZHA 1LNSA 4G9SB 4MX3A 4AI2A 5LBCA 4RQPC 4BB3A 3VD4A 3DECA 5FZ7A 1QEXA 2NMOA 2J7MA 1IS3A 4AGRA 4BM8A 1JHNA 4CUAA 4BK5A 1MS0A 2Y64A 2OA2A 3C7EA 4QX3A 1W8UA 4DUVA 2E6VA 4AR2A 1SZBA 1S2KA 4E4HA 4HVQA 3TB0A 4CCKA 1AL21 2BU9A 4Q0UA 2JX9A 3PDQA 5A7WA 1PNGA 4QPIA 5FJHA 5DMYA 1RUOA 4QB6A 5CFCA 2YYOA 3PVNA 3USUA 2FCTA 2JDZA 3AXDA 4LOSA 1OURA 2PAMA 1LOCA 5A3LA 4BXFA 4LNVA 3IAQA 2PN5A 1AR63 4UYBA 5ACA1 1VMHA 1XNDA 2V73A 3N36A 4OHWA 1MS4A 3LDBA 4PDWC 4DXTA 1TEIA 1US2A 1VIWB 1OOPA 4NHXA 4C1WA 4FTBA 3BPZA 3O1MA 3WZ1A 1AJOA 2YU2A 1CZSA 1YFWA 3A4UA 4HG6B 1DU3D 1D4M2 5C4WA 1TE1B 5HXMA 3ELNA 5T55A 4JQTA 3ZXAC 4HONA 1WCQA 3IBMA 4MSVA 4A2UA 3AZYA 4P9YA 5L7OC 4PIZA 4CDWC 4N53A 2JG8B 3HQUA 4XUPA 2GH8A 1W2UA 1U12A 4KGQA 3VDDA 4CSWA 2ZX4A 2EAKA 3BTAA 2E7QA 4AZZA 2XDVA 2RDNA 3GBGA 3VBUB 5J96B 3E5UA 4S2HA 4ZKTB 2RDRA 2WYFA 3AP5A 4GJZA 2CDOA 2HWF2 4LXLA 1STMA 2YROA 4GULA 2Q8OA 3HEIA 4MGYE 4GALA 5DG2A 3ZDVA 1PVC1 2P34A 4IL7A 2RM21 4IE6A 4JZRA 2JDUA 3BU7A 4UT5A 1NA1B 3L2YA 4YG3A 4AI3A 1ZRRA 2A6WA 3N7JA 3POSA 2GU9A 4AHYA 2HWC1 3P6BA 4QMAA 4YM1A 4YRDA 5FZ4A 3O0WA 3OPWA 4Q4W2 5T5LA 5J7MA 4EE2A 4XQWA 1H9WA 4LUMA 4HLTA 4LBJA 2HKXA 5BNOA 4BCUA 3CJIA 5DAPA 2PYTA 5CKQA 2FDJA 4B7KA 4QPGB 1NE4A 4L9BA 2ZHNA 1WCDJ 1C4RA 4I2OA 3DYPA 3JBG1 3VKFC 1U5ZA 4N9HA 3OG2A 1YQ2A 2XVKA 2RR13 4TXWA 3LAGA 4V1PA 5FZFA 1CR7A 4RGKA 3WVJA 2HWD2 2PHUA 4NWWA 2D93A 2ZGLA 3K2OA 3HNBM 4BLJA 3C2UA 2W91A 4ZU4A 2VMIA 2VM9A 3OYWB 1AR81 1RUE3 4QGMA 5FP7A 3LWCA 4G3YC 2MEV1 3NNFA 2HWE3 3P3NA 5ANQA 3VHNA 2C9KA 3MF9A 1S1AA 3VBOB 1F4HA 2X10A 2F4LA 3GZEA 2C0ZA 3I4IA 4HBNA 3ROUA 5HCAA 5J37A 3FUQA 1HRI3 5FZ9A 3VBFA 1W2TA 4CU7A 2Y26A 4XIOA 5FZCA 4AGGA 1JUHA 1SEFA 4FPLA 3IDAA 2BPA2 5AC93 1N1TA 3ZLIA 1QF3A 1R1A1 5C6CA 1RUH2 4RFT0 3ZFFC 4YZ4A 1Q56A 3KV6A 1A78A 2BRTA 5T52A 1JZ4A 2CAVA 4WM8C 3VDBA 1GOFA 3DPRB 4LIVA 5A7OA 4ISQA 2CV6A 2WNUC 4QM9A 1LR5A 2ET7A 4BZ4A 1JU3A 4U36A 4BYYA 2GMMA 2EXIA 3N9PA 1WLWA 3VGIA 1XNCA 4FP3A 1M06G 5FK7A 1EAH2 3H8UA 4RS5B 2BNOA 1UYYA 1G9BA 4FOYA 2O8QA 3H8XA 3HT2A 4P02B 3ZVXA 3O1TA 4XJUA 1RUC1 2G4IA 3C7FA 2UY8A 2JECA 1TMF1 4GIQA 4YZ2A 3MIDA 4NPLA 1G9DA 4JAAA 4E4ZA 4GB33 5F3CA 4LA3A 5DQ0A 1PGSA 4QHBA 3GBFA 4XUNA 2D98A 3NAPA 4LEJA 5CIRA 5FYMA 4FAGA 5BNNA 2R061 4Q4Y3 1RMU3 3UYJA 1ULGA 5FKCA 4AXOA 3AMPA 1WMFA 2EVXA 1H30A 4Q4X3 2XKPA 1VRH2 1DQ2A 1RIRA 2A3YA 4YW1A 4AI9A 5A1LA 4PBOA 4AEKA 3TOJA 2WO3A 1EV13 3FBYA 3RI9A 5HCFA 5JMCA 1VBB2 4MGTA 3AK0A 5FO7B 2QQPA 2VMFA 1LOGA 1JYXA 2WBKA 1GBGA 3N7KA 1D4VB 1WW6A 3A21A 3OEBA 4P00B 1KRIA 4LORA 1RC6A 3SH3A 5DZFA 1GWLA 3ZYHA 1IS4A 4XEZA 1RHI2 1DZQA 1IG3A 1LODA 2OQ7A 3I3BA 3MLLA 1QNYA 3ILNA 2QZ2A 3PU8A 4GKYA 2Y6JA 3PJYA 3AL6A 2XJRA 4W6YA 1C1LA 5FZLA 1DGRA 2XGXA 3FN9A 2FHRA 4I01A 4NROA 5FMOS 4GWMA 4AFAA 2B5HA 2RS51 2VUJA 3ZOIA 2NM1A 4GMP0 3I59B 5C8CC 1OF4A 2D5HA 4IV3B 3PTYA 2XMLA 4KMQA 3VZOA 5AC92 3HBKA 2A7AA 2VTFA 2WNEA 2Z2SB 1EPWA 2FQPA 4HMZA 5H9RA 4CCMA 5FFOC 2XJPA 1VMJA 2Z42A 5B4NA 1KITA 1QDOA 4NVPA 1MZFA 4IEWA 3VBHC 4E9KA 2RG4A 3E6CC 1OA3A 4OHZA 1AL0G 3J8F3 4CEWA 4ATFA 1SBFA 3DN7A 3LCPA 4C90A 3WR0A 4LKSA 2PLV1 2A6YA 4QX1A 1JYWA 2PQQA 2VBPA 3ACFA 4MGSA 2VW0A 1Y7BA 1EPZA 3KM5A 3JD72 3RSJA 5F39A 2D6LX 4CVUA 3KQ4B 4WVMA 3I3MA 1LGNA 5LA2A 3FJSA 3K4ZA 1FX5A 5GZFA 3FC0A 2EIBA 4Q4V1 2XXZA 1LENA 4XFFA 3WNPA 4BDVB 4EN7B 2JDPA 2VW1A 1PO23 5E1RA 5FMBA 1R093 2DFCA 5FZIA 4X8NA 4NOTA 2JB4A 3I3EA 3WDVA 1AL23 2XVGA 2XWJB 1UZ0A 4YVWB 3FE5A 1PIV2 4R4XA 4AQ2A 1FNYA 4NR1A 4COUA 4WVWA 4Y5Z0 3NSTA 3J7MA 1O3QA 1SLAA 2ILMA 2KXLA 1S0JA 4Y5TA 4PIYA 4CE8A 3ZN5A 2BBVA 2VOVA 3AP9A 3E6BA 4I09A 5FDBA 5D1IA 1UN1A 1MS8A 1N1YA 1WD3A 2WIIB 3PIJA 4XQ4A 1ZBE3 2YBKA 5I8TA 2J1EA 4DXZA 2CL2A 1PMIA 5J3UA 5FYHA 3GJBA 4QPIC 2E9QA 2FDFA 2ZCWA 2JG8C 5C3RA 1VBD3 3ACHA 4AAPA 5CFCC 4OHYA 2IFRA 2W2IA 1A8MA 5F8PA 2ATFA 3MUY1 3W21A 4OHXA 4XFCA 5F6KA 4UW6A 5KHIA 2J1TA 2JG9A 4H14A 4NO4A 3O12A 4NPRA 2FCVA 3KGZA 2IXJA 2Y33A 2A5ZA 2IXHA 2DCZA 3U37A 2F4PA 3OGGA 5JCTA 1ZZ8A 2RMU1 2VZQA 4OVEA 2WFF3 3LE0A 1Z7S1 1XOYA 4R9AA 1AHSA 3WUCA 3OY8B 4P08A 3ETQA 1X82A 3LEKA 4BH9A 2ZA9A 4UFIA 3RJ2X 4WVVA 4HN0A 1PVC3 1ACCA 2E51A 2QKDA 3FFQA 2R043 2TNFA 3AX4A 3ZYFA 4R8HA 4K3UA 1J84A 4ZHNA 2W1UA 3NQHA 4L97A 4QPGC 4BIFA 2IFWA 4PT6A 5EJ3A 3ZIWA 1QQP1 1U0AA 3AMMA 1HXS1 2YGLA 1JOBA 4XDOA 1UIJA 1V9U1 4S2FA 4YPJA 4PBPA 3SMHA 1OQEA 4BISA 3ZX7A 2I07B 4J1XA 3RDIA 3THTA 4M0NA 2E33A 1W99A 4PJYA 4P9JA 1YFYA 4EZHA 4QKFA 1DYPA 2W5FA 5CAZA 1NE6A 5GZEA 1ZNPA 2V5DA 3VZLA 4Q0SA 4Y5SA 3WD5A 4BIOA 1AL22 3UJOA 2CWMA 4AVSA 1QHDA 2P3IA 5JIAA 1E57A 3A0KA 1H2KA 3JBG3 2R1DA 4INDA 1ZREA 2CTVA 3ZXLA 1F8VA 4XJAA 2ZZQA 2EICA 5FY9A 4CDXC 4M3CE 3RWNA 3ZSEA 3M3QA 4K40A 4OHVA 1RXFA 4CCEA 4XABA 4CDUC 4HK9A 5ACA2 2VQ0A 1NZCA 3ZXKA 2JDMA 3LFIA 3M3IA 3X29B 3BUCA 3W20A 2YDEA 4QU2A 3F95A 1S55A 2WT1A 3LKJA 4IEUA 4KWKA 1J3PA 2OQ6A 1RXGA 2OZ6A 3J7NA 2CYFA 2XUEA 2QQMA 3DL3A 3ZFEB 1LU1A 4GZ9A 2BGOA 2NZ9A 4X6RB 1F9KA 1MPXA 4OYUA 4ASKA 5FO8B 4FTSA 3HBZA 2EIGA 3DPRC 3MIGA 1OF3A 1X50A 3T2OA 3VBRA 4U2AA 1SFPA 5JSOA 4HSLA 3VZNA 1LU2A 5A33B 3TEZA 3MHZA 4GWNA 5T5JA 4HOOA 1KEXA 4JGZB 4FPFA 3RZLA 3KHCA 4IETA 1XYNA 1NCRC 1O59A 1GZWB 1RINA 1TME1 5EYXA 3H8OA 4BWOA 1B35B 1NXD1 2DCJA 3BGAA 4JTNA 1PVC2 2WINB 4FFFA 2RM22 3PJQA 1VALA 2OUHA 3Q8AA 4MXVA 2HWC2 3DUIA 4RGAA 4CPBD 1ZBA1 2QFEA 1S4CA 1OA2A 2WLQA 3QLQA 4P14A 3AFKA 1GSLA 1V6LA 2V09A 1TMF3 1JXNA 1Y9MA 4ITCA 2VJXA 2XHNA 2O14A 2JE7A 5C5TA 4LK6A 2P4EA 2VZSA 1LOBA 2VNGA 2VQTA 5KC5A 3J7LA 4RQPA 2X53S 2VUCA 4P5HA 4NAOA 3MIHA 2Y6KA 1IPJA 5FZ8A 2B45X 2XHKA 1YXWA 3JBG2 2XB6C 4IE4A 5EFUA 3NAPC 4Q0VA 1H2NA 4TLGA 4Y22A 1A34A 4URTA 5BYNA 2VMEA 4LBMA 1CN1A 3B5LB 5CADA 3P5BA 2HJIA 1NLRA 5BXXA 2VCBA 4DQAA 5CA6A 1B09A 2YU1A 3AM2A 4IV3C 2X5IC 1AR82 3AKSA 1GP6A 2MEV2 2EALA 5FPBA 1OVPA 1YNAA 1LHOA 1GP4A 3MF6A 5FY8A 1MQTB 3TYJA 3BTXA 4UBGA 1IKPA 1JYIA 2QQNA 2R49A 5IVBA 2ZGRA 3D8CA 1UX7A 3B9CA 3PVOA 2RS53 5KHKA 1FPN3 1E5IA 3LEIA 4NE9A 5F3EA 2RE9A 4LBKA 1R1A2 5KXDA 3HQXA 1BBT3 3ME2A 4YVSA 5LEJA 1C28A 2DU1A 4CXYA 3OUIA 1AR61 4D7YA 1RUD3 4I3PA 1W06A 2OPWA 3K3NA 5HCBA 3RRDA 4FQ4A 1HIXA 2G9FA 4CDWA 4L11A 1DG6A 2QNKA 4B4PA 4WM7B 2ZAAA 1K5MB 2WNVB 1DP0A 2VL4A 3UL2A 3WNMA 1QH7A 2VH9A 2QVSB 3H42B 2A75A 3WNLA 3GYDA 1RUC2 3MFAA 2EIEA 3FLRA 1TMF2 1URXA 4YVWC 2VR4A 5A1AA 2VZOA 1OUXA 4GQ7A 4AAXA 1GU3A 5A3MA 1QOTA 4MO3M 3WW4A 3KHBA 1FOD3 2RJKA 4META 3UNPA 4NIDA 4UF0B 1WMXA 3AZWA 2R062 2ZX0A 1Q8VA 4GWIA 4XJZA 5A3UA 2ZEYA 3RFRA 2Q8CA 5BPXA 1PO13 3WDUA 4FSJA 4V2VA 4FPEA 2GNTA 2YXSA 4LHLA 4BA6A 4YZ3A 1CAXB 1LJ7A 4COYA 1OKOA 5JPNB 4O65A 4HK8A 5DAWA 1K42A 1VRBA 2BOIA 3TBDA 4OI2A 2VCMA 4GJYA 2BWAA 1HQNA 2Y6GA 3UKNA 4BK4A 2I2SA 4BE3A 4L99A 1SPPA 3IIAA 4KGGA 1JS9A 3IPVB 3WQBA 3IWZA 3M2MA 1WW4A 3OF1A 1CD3G 1VR3A 3J4UH 1W6MB 1GMMA 1QDCA 4LR4A 4Y20B 4NJ4A 3POBA 4ASLA 4IDZA 1LULA 5JXJA 1OA4A 2Q8EA 5GLUA 3SH5A 3M3EA 5DDJ3 3R0RA 2A3WA 2R7EB 2AEZA 3OBRA 4DINB 5IVCA 2ZGQA 2RS52 2P6HA 2YB7A 1MS3A 4Z92B 3AMHA 3ZN6B 4DO0A 5KWRA 2C4XA 3BN6A 3H3UA 3UKTA 1MVEA 4N43B 2RR11 2ZS6B 2W0XA 3BI3A 1SFNA 4HETA 3OD4A 1SG3A 1NQJA 1XBFA 2VNOA 1Y9QA 1MZ5A 4PI0A 5LEKA 2GALA 1T2XA 2JG9C 1Z7S3 5T50A 1UIKA 3VZKA 4WZFA 1RUE1 3RZGA 2BV4A 2PLV2 5KR7A 5JXHA 2HWE1 1WGPA 4YGCA 3ZFFA 1S0DA 5M0TA 2P3JA 4XUTA 2NYYA 5FPAA 4D7SA 5FOJB 1HRI1 2ARXA 1DF0A 4WM8A 2RS13 2TBVA 4GAZA 3HOBA 4AG4A 4Q4V2 1GKBA 1CX1A 4JTOA 3UGFA 5IHRA 1ENXA 1F4AA 3VD9A 4KWUA 3WQ0A 3QBQA 1NYWA 5FZBA 3VDAA 4XF9A 1I1EA 4YM2A 3RZKA 3I2OA 1OI6A 3MV01 3A23A 3OBTA 4QXKA 2OZJA 3VD3A 3IMNA 4D8MA 1WCSA 4L8QA 2J22A 4TSVA 1JUIA 1GQGA 1LHNA 1MEC3 2VMCA 3LDRA 3NJYA 1R083 4MVTA 3UV9A 2FDGA 3ZFEC 4NIGA 2UWBA 2GC0A 5KHJA 1ODMA 2WDBA 2BNMA 1ND2C 4QDQA 1N47A 4XJ9A 4E8CA 1BCXA 4UXAA 1UOFA 1UYPA 2A3XA 4GB31 3VHRA 5ANNA 5CKNA 1CJPA 1KDMA 2KA3A 4AOCA 4Q4Y1 1RMU1 3RQ0A 1W8ZA 3S0MA 4TYSA 1V6MA 1DZTA 4HT1T 4LULA 5F2SA 1DCSA 4LHKA 1G6NA 4Q4X1 3WHTA 2ADDA 1AYN3 3KGLA 3I54A 1CIWA 1Y43B 3B01A 4LQRA 5CB7A 4GMP3 3ZIXA 1TQ5A 1XSRA 1OD3A 1EV11 3WV6A 4G4FA 2DCYA 3POWA 4BXSV 3LEGA 4D94A 1YO8A 2GDFA 2ZBJA 4CCLA 4QD2A 4YG6A 5C9AC 3MLJA 5CNAA 4CPBA 5JOXA 3NNMA 1FYUA 5FQ0B 2RMU2 5I0DA 1W6QB 4BQWA 1Z7S2 3B9IA 3FLTA 5C8CA 1JW6A 2JKBA 3WG4A 2EXHA 1JHJA 3V0AA 2SBAA 1ZRDA 2D97A 3PVBB 1QWRA 2QQIA 3GBWA 3BIEA 5FYCA 4A45A 1OHFA 3VBHA 3BCWA 4AVBA 5CZKA 1RUJ3 1YI7A 5DG1A 3NV4A 3WLUA 1QQP2 4YM0A 1HXS2 2RS33 5I0TA 1ZZBA 3WG1A 5LY1A 2FD8A 1V9U2 3HN3A 2YG0A 3GF6A 5CG8A 2KM2A 3ALQA 5I0RA 1D0GA 1KFXL 4C0BA 2P3YA 1W05A 5FPLA 1W2OA 3J8F1 3T4HB 2VNRA 1GNYA 2YFZA 3ZXEA 2BUKA 1HJGA 4XTMA 2ZX3A 5F5CA 3BYWA 1LKNA 2YC4A 4IEOA 3FFZA 5JIUA 2DVDA 2WRAA 1ZX5A 2R32A 1SBEA 4UW5A 4KWLA 4NRPA 5FWEA 2NP0A 2PQSA 3AMQA 5ERLA 4DZGA 1Q5OA 1XU1A 1HRV3 3OBAA 3UJQA 3WHUA 5LK5A 4FAHA 1BK1A 2J1AA 3WP4A 3ZXJA 4EV0A 2DF7A 2QZ3A 4LO4B 3AVSA 1PO21 3M4FA 3J9SA 5LRRA 4XUQA 1ULFA 4H7LA 1R091 5LBEA 1LRHA 1X9TA 4YW4A 3KVBA 5F37A 1C8NA 1V00A 2PELA 1CAUA 1IHMA 2X29A 3WQ1A 2JG8A 5JZGC 5JXIA 2WZPP 1K5MC 4GWJA 5KXCA 4OMCA 4FCAA 1ND3B 4HPKB 1UY2A 2AR6A 3SEPA 3RJRA 5FRAA 2FMYA 1PZ9A 1QH6A 4IV1B 1ZBE1 2HBTA 4MZUA 4ZPIA 4RL7A 5F3IA 1YJKA 1TME2 1VBD1 2VY0A 4XMAA 1OPMA 1DLCA 3T08A 5A80A 5D8AC 1DBNA 4XXAA 2DFBA 4JDOA 3LPFA 5EV7A 1RB8G 1HX6A 4K20A 5FY1A 5FREA 4HZFA 4A6OA 1JZ8A 4YVSC 3SKVA 2W1SA 3NKTA 1UKGA 3IIIA 1ZBA2 4DPNA 1F15A 4AI0A 2XKOA 1N3QA 2VAUA 4MGZE 4QB2A 5IFPA 3WDTA 4XFBA 4GKXA 5F32A 3H1WA 4UAPA 2VGDA 3DYMA 1WUVA 4H55A 1DGLA 1OSGA 3O1UA 3NNJA 1H9PA 1LESA 2WFF1 3NL1A 4BQ3A 4QPGA 2WNOA 1HKDA 2N7GA 2AZ5A 2ZKNA 3PURA 3S5QA 1LHWA 1UZYA 3S6PA 5FUPA 2ZHKA 3K46A 2R041 4UBHA 1PZ8A 5FO9B 2WAAA 1W90A 2JWPA 2C9AA 2WQ4A 5E89A 3WDYA 2AREA 4FI9A 5FUIA 3VV1A 4A4AA 2BP6A 3OEAA 2XBO3 3ASIA 1VAVA 1C8M1 1V6IA 2W1WA 4IE5A 1JYCA 2OS2A 4QX0A 4ZXKA 3UGGA 3USUB 3VKNA 4EQVA 2DVFA 3KSCA 2W92A 3LZZA 5JOZA 1AXYA 2CDPA 4N43C 4CDXA 2WO2A 4K21A 1O8PA 4BLIA 1J59A 1VJ2A 2R073 2JICA 2ZX2A 5FJKA 2A73B 4QM8A 4CDUA 1PMHX 2QQLA 3MBWA 1RUI3 2WQ8A 2V4VA 3W58A 2AEYA 3KWVA 2R16A 4CP9A 1YUDA 1O6UA 5C4WB 4BQ5A 1OQ1A 1MR5A 1XNTA 1IS5A 2UWCA 2F17A 1HB4A 1JZ7A 3VL9A 4YG0A 2VECA 5H9SA 4OCTA 4FO9A 3E6DA 3KS7A 4IQPA 4XILA 4QX8A 4KNCA 4N53B 4JGYB 2QDRA 3HR9A 4NIIA 2O0OA 2WZR3 3WOGA 4KU7A 2ZJCA 3DPRA 5FMDA 4F3JA 3VDDB 1F2NA 4Y3OA 2VQAA 3DYOA 2VNVA 1NXMA 3I2JA 3T2PA 4D3WA 5JLVA 3OGRA 5JR7B 1QJY3 4XIKA 5IUQA 2BDRA 3C7GA 5A3OA 3NO8A 5CG9A 5J48A 2NPIA 1ODNA 1IQAA 3VDCA 5HCHA 1NCRA 3NW4A 1G8WA 2VE1A 4IW3A 2ZHMA 3BALA 1COV3 3VHPA 2YMZA 4ISRA 3K48A 4I0AA 4YGDA 2ET1A 5C3SA 1C5IA 1NY71 3HN1A 3PUIA 4LITA 5KXBA 1FNZA 5LWBA 3PHMA 1KXGA 1HB1A 1NCQC 1O4YA 1FV2A 2C5DA 2WT2A 2IXCA 3R6SA 5A3NA 5BNOB 1G7YA 1CWPA 3G7DA 3OGSA 3JQWA 4JHZA 3D82A 4W50A 5IK7A 5A6YA 3BTZA 2EXKA 1XQNA 3L2HA 4SBVA 1Q8QA 4CU8A 3LOBA 2VZUA 4EN8B 2E26A 5FY7A 3AFGA 5B4XA 4P9WA 3PL0A 1GQHA 3DXTA 4NHMA 5GLVA 3T0AA 2VMDA 1AJKA 2ADEA 4B7EA 3ATGA 4IE0A 2VUAA 1C3HA 3AVRA 3TEXA 4LA2A 4RA0A 4FQZA 2V4AA 2XLGA 4Z07A 4ASMB 2D6NA 2JDAA 4IEXA 5JWPA 1WKYA 4OZXA 4CCOA 4HSJA 4X6QB 1W0OA 1GANA 4DNYA 1YQ6A 5A32A 4OUEA 1W6NA 2CHHA 4LMFA 3H50A 2I74A 5FZMA 1EUUA 1GOHA 1YIPA 3I59A 4IV3A 3WF4A 2X5IA 3R4DB 4ONUA 4WZCA 1GUIA 1H4GA 5BY5A 4R52A 1POV0 2RR12 3VBFB 4CCJA 2LM3A 1SDWA 4COZA 5FR3A 2Y6LA 2Z4FA 3FHAA 3OGJA 4PCRA 1ZA7A 5IW0A 5L36A 1LAJA 4CDQC 3JB8A 1RUE2 4FPHA 1QJU3 2OKXA 3KF5A 1DDLA 1JTZX 2HWE2 3RI8A 1AR91 2RDQA 3RS6A 2ZGMA 2ZGNA 3AKQA 2Y0IA 4JKKA 3ZKYA 3DGTA 3ZPOA 1HRI2 1SCSA 3THCA 4QWNA 2E63A 3CHXA 3T0DA 1W0PA 1YQ5A 2XL7A 1FPN1 1F31A 3VL8A 5JXGA 4QX5A 4XACA 4MH0E 1WW7A 1X8MA 4XF4A 1BBT1 4DRVA 5FXWA 2VZTA 1XC6A 5F5QA 1RUD1 4JKMA 1DYOA 1OQDA 4LHSA 1HB2A 3ZFGB 1XE7A 2GZWA 3NWKA 1UOBA 3ACGA 4QQ2A 2ZHLA 1W2NA 3PU3A 3OD0A 4LJHA 4GH4B 4O61A 4Q0PA 1OC1A 2Y0OA 4KBZA 4YVWA 5L73A 3TN93 4AYUA 3S57A 5IAVA 1X9PA 4XFHA 3K77A 2JIGA 4XDPA 3LSDA 1JN2P 1WW5A 2JDYA 3HPNA 2X05A 3PLQA 4A3ZA 4B1MA 4OULA 4BQ2A 1UXZA 3I49A 1XSQA 3DKWA 2JXAA 2JDNA 3Q8FA 5FBJA 2GNMA 3N9NA 3FHQA 3BOWA 2XLFA 2YZ4A 2OW4A 4GB32 1ENRA 4Y24A 1NOVA 2DBNA 4YARA 1EY2A 1FOD1 4CCCA 4P5YA 3CL1A 1RMU2 4Q4Y2 1GFF2 4YW3A 1FMD3 1LOFA 4QX2A 4XXPA 4K7JA 1BHGA 1PO11 4AFMA 4HKWA 4IV1C 4Q4X2 4LBOA 2C24A 3F2ZA 3PUQA 4YFWA 1CGPA 3Q9OA 3AYAA 4K8RB 1QJX3 1EV12 3MW4A 4Z8BA 3ZR6A 4URAA 2PHFA 1MZ6A 1CONA 4HXCA 3SQOA 4LE4A 4MXWA 4AVTA 4LPLA 3HAGA 1VBE3 4AVVA 1QJEA 3ETPA 2A6VA 2CGOA 3U11A 1ULPA 4AEMA 2FZ2A 3ZYBA 4XTPA 1ENQA 4ATEA 2XG3A 1QOSA 3AKPA 1OT5A 5BNNB 1QIQA 4KQ7A 5KBFA 1AR73 1EYBA 3T2QA 3KCXA 5DDJ1 3VBUC 2XOMA 1ASJ3 3DEMA 1GWKA 4MGIE 3MIFA 1KD7A 2Y8KA 4FFHA 3AP7A 1BQPA 1LHUA 5FBZA 1S2EA 1UAIA 1LB2A 2VG9A 1QOOA 5GZCA 3LA7A 4WVMB 1XXNA 1NA1C 1UQXA 2W95A 2HH9A 3S7EA 4YW6A 4DEVA 1XYOA 2GAUA 5A3TA 4E8DA 4AW7A 2WJSA 1KFUL 1VBC3 1XPWA 3J8F2 3H8RA 2ZOEB 2VZRA 3EQEA 4DUWA 2UWAA 1UMIA 1HB3A 4C1XA 2BOJA 2QUOA 5FLHA 2B42B 2Y60A 5IATA 3TEYA 2GNDA 2B4KA 2Y6FA 4IERA 2RS11 2BZDA 3GXUA 1I6XA 3VB9A 1PK6B 1O4TA 5IVJA 3USSA 2ERFA 1C8M3 1AYM3 3OTFA 5F2WA 4RHV3 2DU0A 2ZABA 1PO22 5GLZA 3ZFEA 4XPVA 2D43A 1R092 3U78A 2XQRA 4TZDA 2X8KA 1ND2A 2WWSA 3MO4A 5B2GB 4JGYC 4M3CB 3AJZA 3B69A 4O7XA 2NLRA 3FHIB 4P9IA 4UW3A 1SFYA 2A70A 3ES1A 1MEC1 1PX3A 2W87A 1QGLA 2ZEWA 4Q1PA 1R081 4W6WA 3V56A 3IDEA 5HBAA 1CAVA 3HJRA 5A33A 4AE2A 1GYKA 1U5YA 1HJFA 4NHYA 1BVVA 3VBOC 1UYXA 1XE0A 5IAXA 5K0UB 1ZBE2 3K4DA 1GZWA 5F7UA 1LOAA 1ZVFA 2D3PA 3P3PA 1FATA 1VBD2 3VBSB 1B35A 4FFIA 3ZXFA 5I0SA 3WP5A 2R1BA 3ENRA 3MYXA 2W08A 3WNKA 1UOJA 2FCUA 3ZYGA 1HN0A 2QTWB 5C9AA 5FXZA 2WAOA 3HMYA 1YI9A 1AYN1 5A1FA 3PMEA 1WWYA 5IK5A 2CAUA 4GMP1 5I8SA 1LEMA 3MGUA 4YFZA 1UYZA 4CP0A 1C57A 4YM3A 1DIWA 1KQRA 3AB0A 3MV11 3DF0A 4NRMA 4RFRB 3WW2A 1J83A 4RS5C 3D0SA 3EJKA 3RG0A 1HLCA 1TNFA 5CBLA 5APAA 4QX7A 4XF1A 2WFF2 1OBNA 5ABJB 2J42A 2DBIA
chains in the Genus database with same CATH topology
4QAWA 5JXHA 1CZSA 4HG6B 5HXMA 4XUTA 4MOAA 4Z2AA 2QQKA 3NNGA 4M4PA 1WCQA 1JZ6A 3HOBA 4AG4A 4XUPA 1CX1A 5IHRA 2VOTA 2QBXA 1F4AA 3VD9A 4KWUA 3I97A 5JUVA 1NX9A 3VDAA 2VC9A 3MV01 2CDOA 3A23A 3VD3A 4D8MA 3HEIA 3E1F1 4KI5M 4XURA 2J22A 2J1UA 2VMCA 3ABZA 2W46A 2WDBA 3P6BA 4QDQA 4E8CA 2W3JA 3EYPA 2WUHA 3K4AA 4JX0A 2B9VA 2HYXA 3NRUA 3C7HA 2DCKA 3D3AA 4LQRA 5J1XA 4MGQA 1OD3A 3DYPA 3W5NA 1P8JA 3OG2A 4BXSV 1YQ2A 3LEGA 4TXWA 1NKGA 3JXSA 3K75B 2LW8A 4XUOA 5I0DA 3VD7A 3HNBM 2W91A 2VM9A 1JHJA 2C9KA 4JKLA 1F4HA 2X10A 3UESA 3I2KA 2QQIA 4A45A 4CU7A 5CZKA 4RYDA 3IDAA 4ZY9A 2ORZA 3HN3A 3I2GA 3WF0A 2YG0A 4CU9A 2J1RA 4CU6A 1K12A 1JZ4A 3VDBA 1GOFA 1GNYA 2YFZA 1JU3A 2J1VA 2YC4A 1UYYA 2WN3A 4P02B 5EJZB 5C70A 4DEQA 3C7FA 2XONA 2PQSA 4ZZ8A 3OBAA 4XVHA 5DQ0A 2LS6A 2J1AA 4UI9L 5JR2A 3CIHA 4XUNA 3T09A 4ARYA 4DXSA 3FL7A 4ZZ5A 4XUQA 2VQUA 4DUXA 2VZPA 3EB7A 2WZEA 5G04L 1W9TA 5JXIA 2WO3A 4GWJA 3ZM8A 2VZ1A 2VMFA 4OMCA 1JYXA 1UY2A 3SEPA 2WBKA 3A21A 3OEBA 4ARXA 2WZ8A 4P00B 1TG7A 3I3BA 3T08A 1DLCA 1K3IA 2Y6JA 3LPFA 5LCWL 5C7GA 4A6OA 1JZ8A 3FN9A 3SKVA 2W1SA 3CMGA 4D0QA 3IIIA 2BBAA 1I5PA 1OF4A 4KMQA 4QB2A 5IFPA 4OZOA 4UAPA 3DYMA 1HN1A 2VTFA 3CQOA 5B4NA 3A22A 2ZEZA 3VD5A 1H6YA 4LKSA 4QX1A 1JYWA 3ACFA 2W94A 4MGSA 4W8JA 3K46A 2WAAA 1RYYA 4CVUA 4FI9A 3I2FA 5FUIA 2VCAA 5LA2A 4A4AA 3K4ZA 3OEAA 2EIBA 2W1WA 2Y6HA 3WF1A 2KD7A 2WN2A 3WNPA 4QX0A 4BDVB 3SKJE 3SEEA 2W92A 2CDPA 4CUBA 2W47A 1NAEA 2WO2A 1O8PA 3MUZ1 4L0PA 3I3EA 1PMHX 2QQLA 3MBWA 5G05L 2WQ8A 1GOGA 1UZ0A 1K45A 2V4VA 3GGLA 1L7RA 2WO1A 4A44A 1UY1A 1XNTA 1US3A 3HNYM 1JZ7A 3ECQA 1NUKA 1UY0A 3C8XA 2BERA 3GDBA 2J1EA 2ZXQA 3DYOA 3OGVA 3I2JA 1TVGA 3T2PA 3ACHA 3OGRA 3C7GA 3MUY1 2QQOA 3OB8A 3AC0A 1UXXX 1L7QA 2J1TA 3WNOA 3VDCA 4A41A 3NJXA 1W8OA 1GQPA 1SDDB 2VZVA 3U37A 3PUIA 4OMDA 2VZQA 3LE0A 2VO5A 2L9LA 2RJ2A 4P08A 3LEKA 3GM8A 3OGSA 4W50A 4JHZA 1PMJX 3P1IA 2RVAA 1W8NA 1J84A 2W1UA 4CU8A 2VZUA 3NQHA 2E26A 5B4XA 4PT6A 3CDZB 3UETA 3T0AA 2VMDA 4YPJA 1UY4A 2E32A 2JDAA 1UMHA 5EJ1B 2E33A 1W99A 1WKYA 2W5FA 4XZUG 2V5DA 3IAPA 5JMOA 2DDUA 3THDA 4OUEA 1EUUA 1GOHA 3WF4A 5DPNA 2WYSA 1GUIA 5IFTA 2E31A 1CIYA 2EICA 5CYYA 1H6XA 3WF2A 2Y6LA 2Z4FA 3FHAA 2ID4A 3LQCA 3NJVA 1JZ5A 2OKXA 4A42A 2QQMA 4BJ0A 4CUCA 4GZ9A 2BGOA 4JKKA 3IB3A 1MPXA 4OYUA 5C71A 3CZUA 3THCA 3T2OA 1OF3A 3WF3A 3T0DA 3WEZA 5JXGA 3CKHA 3CZJA 2ZEXA 4M4RA 2VZTA 1XC6A 2BGPA 2X09A 1KEXA 4JKMA 1DYOA 4LHSA 2WABA 1XNAA 1O59A 1JZ2A 3ACGA 2JE8A 2DCJA 3BGAA 1W9SA 2VCCA 1R64A 1JI6A 3K77A 3HPNA 2X05A 4QDRA 4A3ZA 1UXZA 3I3DA 2RV9A 1SHWB 1JYNA 3FHQA 2VJXA 2XHNA 4P5YA 3W5MA 2VZSA 2VQTA 2HLEA 4QX2A 1BHGA 4TTGA 3F2ZA 2Y6KA 4ZXEA 1W9WA 2VMEA 4LPLA 1D7PM 3I2HA 3I2IA 3ETPA 1UWWA 1ULPA 2VCBA 3HNMA 3C7OA 3PUHA 1JU4A 4IUGA 4PF1A 2VZ3A 2XQXA 1IQDC 1OT5A 2ORXA 3T2QA 5LA1A 2QQNA 1UY3A 2XOMA 3ACIA 4UOJA 1UX7A 4QPWA 2Y8KA 3LPGA 4RN5A 3LEIA 4ET7A 2W95A 5IJRA 4DEVA 4MADA 4QB1A 4E8DA 1XPWA 3T0BA 3WSOA 1JZ3A 2VZRA 4DUWA 1UMIA 1DP0A 2VL4A 3WNMA 4PQQA 2B4KA 3J7HA 3WNLA 5LA0A 1W0NA 2BZDA 2JKXA 3GXUA 2W9XA 2W1QA 2EIEA 5IYYA 2QQJA 2YC2A 5A1AA 1CZVA 2VR4A 2YFUA 2VZOA 4AAXA 1GU3A 4MO3M 4QDSA 3UNPA 1O8SA 1CZTA 4GWIA 2ZEYA 3MO4A 2C26A 1EUTA 1KGYA 2J1SA 1ULOA 1PX3A 2ZEWA 2W87A 3WNNA 1K42A 3HJRA 4W4ZA 1LNSA 2Y6GA 4BK4A 5EIYB 3VD4A 3DECA 1UYXA 2J7MA 2EIDA 3K4DA 5F7UA 4CUAA 3A7QA 4BK5A 4DXRA 3WQBA 2Y64A 3C7EA 4QX3A 5HPOA 1GMMA 4DUVA 3WNKA 5DN2A 5JXJA 2WAOA 2R7EB 5DMYA 2YB7A 4QB6A 1UYZA 2C4XA 3BN6A 3MV11 2V72A 1J83A 3IAQA 1SG3A 1OH4A 1PX4A 1T2XA 4DXTA 2JD9A 1US2A 1JYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAW A;  5JXH A;  1CZS A;  4HG6 B;  5HXM A;  4XUT A;  4MOA A;  4Z2A A;  2QQK A;  3NNG A;  4M4P A;  1WCQ A;  1JZ6 A;  3HOB A;  4AG4 A;  4XUP A;  1CX1 A;  5IHR A;  2VOT A;  2QBX A;  1F4A A;  3VD9 A;  4KWU A;  3I97 A;  5JUV A;  1NX9 A;  3VDA A;  2VC9 A;  3MV0 1;  2CDO A;  3A23 A;  3VD3 A;  4D8M A;  3HEI A;  3E1F 1;  4KI5 M;  4XUR A;  2J22 A;  2J1U A;  2VMC A;  3ABZ A;  2W46 A;  2WDB A;  3P6B A;  4QDQ A;  4E8C A;  2W3J A;  3EYP A;  2WUH A;  3K4A A;  4JX0 A;  2B9V A;  2HYX A;  3NRU A;  3C7H A;  2DCK A;  3D3A A;  4LQR A;  5J1X A;  4MGQ A;  1OD3 A;  3DYP A;  3W5N A;  1P8J A;  3OG2 A;  4BXS V;  1YQ2 A;  3LEG A;  4TXW A;  1NKG A;  3JXS A;  3K75 B;  2LW8 A;  4XUO A;  5I0D A;  3VD7 A;  3HNB M;  2W91 A;  2VM9 A;  1JHJ A;  2C9K A;  4JKL A;  1F4H A;  2X10 A;  3UES A;  3I2K A;  2QQI A;  4A45 A;  4CU7 A;  5CZK A;  4RYD A;  3IDA A;  4ZY9 A;  2ORZ A;  3HN3 A;  3I2G A;  3WF0 A;  2YG0 A;  4CU9 A;  2J1R A;  4CU6 A;  1K12 A;  1JZ4 A;  3VDB A;  1GOF A;  1GNY A;  2YFZ A;  1JU3 A;  2J1V A;  2YC4 A;  1UYY A;  2WN3 A;  4P02 B;  5EJZ B;  5C70 A;  4DEQ A;  3C7F A;  2XON A;  2PQS A;  4ZZ8 A;  3OBA A;  4XVH A;  5DQ0 A;  2LS6 A;  2J1A A;  4UI9 L;  5JR2 A;  3CIH A;  4XUN A;  3T09 A;  4ARY A;  4DXS A;  3FL7 A;  4ZZ5 A;  4XUQ A;  2VQU A;  4DUX A;  2VZP A;  3EB7 A;  2WZE A;  5G04 L;  1W9T A;  5JXI A;  2WO3 A;  4GWJ A;  3ZM8 A;  2VZ1 A;  2VMF A;  4OMC A;  1JYX A;  1UY2 A;  3SEP A;  2WBK A;  3A21 A;  3OEB A;  4ARX A;  2WZ8 A;  4P00 B;  1TG7 A;  3I3B A;  3T08 A;  1DLC A;  1K3I A;  2Y6J A;  3LPF A;  5LCW L;  5C7G A;  4A6O A;  1JZ8 A;  3FN9 A;  3SKV A;  2W1S A;  3CMG A;  4D0Q A;  3III A;  2BBA A;  1I5P A;  1OF4 A;  4KMQ A;  4QB2 A;  5IFP A;  4OZO A;  4UAP A;  3DYM A;  1HN1 A;  2VTF A;  3CQO A;  5B4N A;  3A22 A;  2ZEZ A;  3VD5 A;  1H6Y A;  4LKS A;  4QX1 A;  1JYW A;  3ACF A;  2W94 A;  4MGS A;  4W8J A;  3K46 A;  2WAA A;  1RYY A;  4CVU A;  4FI9 A;  3I2F A;  5FUI A;  2VCA A;  5LA2 A;  4A4A A;  3K4Z A;  3OEA A;  2EIB A;  2W1W A;  2Y6H A;  3WF1 A;  2KD7 A;  2WN2 A;  3WNP A;  4QX0 A;  4BDV B;  3SKJ E;  3SEE A;  2W92 A;  2CDP A;  4CUB A;  2W47 A;  1NAE A;  2WO2 A;  1O8P A;  3MUZ 1;  4L0P A;  3I3E A;  1PMH X;  2QQL A;  3MBW A;  5G05 L;  2WQ8 A;  1GOG A;  1UZ0 A;  1K45 A;  2V4V A;  3GGL A;  1L7R A;  2WO1 A;  4A44 A;  1UY1 A;  1XNT A;  1US3 A;  3HNY M;  1JZ7 A;  3ECQ A;  1NUK A;  1UY0 A;  3C8X A;  2BER A;  3GDB A;  2J1E A;  2ZXQ A;  3DYO A;  3OGV A;  3I2J A;  1TVG A;  3T2P A;  3ACH A;  3OGR A;  3C7G A;  3MUY 1;  2QQO A;  3OB8 A;  3AC0 A;  1UXX X;  1L7Q A;  2J1T A;  3WNO A;  3VDC A;  4A41 A;  3NJX A;  1W8O A;  1GQP A;  1SDD B;  2VZV A;  3U37 A;  3PUI A;  4OMD A;  2VZQ A;  3LE0 A;  2VO5 A;  2L9L A;  2RJ2 A;  4P08 A;  3LEK A;  3GM8 A;  3OGS A;  4W50 A;  4JHZ A;  1PMJ X;  3P1I A;  2RVA A;  1W8N A;  1J84 A;  2W1U A;  4CU8 A;  2VZU A;  3NQH A;  2E26 A;  5B4X A;  4PT6 A;  3CDZ B;  3UET A;  3T0A A;  2VMD A;  4YPJ A;  1UY4 A;  2E32 A;  2JDA A;  1UMH A;  5EJ1 B;  2E33 A;  1W99 A;  1WKY A;  2W5F A;  4XZU G;  2V5D A;  3IAP A;  5JMO A;  2DDU A;  3THD A;  4OUE A;  1EUU A;  1GOH A;  3WF4 A;  5DPN A;  2WYS A;  1GUI A;  5IFT A;  2E31 A;  1CIY A;  2EIC A;  5CYY A;  1H6X A;  3WF2 A;  2Y6L A;  2Z4F A;  3FHA A;  2ID4 A;  3LQC A;  3NJV A;  1JZ5 A;  2OKX A;  4A42 A;  2QQM A;  4BJ0 A;  4CUC A;  4GZ9 A;  2BGO A;  4JKK A;  3IB3 A;  1MPX A;  4OYU A;  5C71 A;  3CZU A;  3THC A;  3T2O A;  1OF3 A;  3WF3 A;  3T0D A;  3WEZ A;  5JXG A;  3CKH A;  3CZJ A;  2ZEX A;  4M4R A;  2VZT A;  1XC6 A;  2BGP A;  2X09 A;  1KEX A;  4JKM A;  1DYO A;  4LHS A;  2WAB A;  1XNA A;  1O59 A;  1JZ2 A;  3ACG A;  2JE8 A;  2DCJ A;  3BGA A;  1W9S A;  2VCC A;  1R64 A;  1JI6 A;  3K77 A;  3HPN A;  2X05 A;  4QDR A;  4A3Z A;  1UXZ A;  3I3D A;  2RV9 A;  1SHW B;  1JYN A;  3FHQ A;  2VJX A;  2XHN A;  4P5Y A;  3W5M A;  2VZS A;  2VQT A;  2HLE A;  4QX2 A;  1BHG A;  4TTG A;  3F2Z A;  2Y6K A;  4ZXE A;  1W9W A;  2VME A;  4LPL A;  1D7P M;  3I2H A;  3I2I A;  3ETP A;  1UWW A;  1ULP A;  2VCB A;  3HNM A;  3C7O A;  3PUH A;  1JU4 A;  4IUG A;  4PF1 A;  2VZ3 A;  2XQX A;  1IQD C;  1OT5 A;  2ORX A;  3T2Q A;  5LA1 A;  2QQN A;  1UY3 A;  2XOM A;  3ACI A;  4UOJ A;  1UX7 A;  4QPW A;  2Y8K A;  3LPG A;  4RN5 A;  3LEI A;  4ET7 A;  2W95 A;  5IJR A;  4DEV A;  4MAD A;  4QB1 A;  4E8D A;  1XPW A;  3T0B A;  3WSO A;  1JZ3 A;  2VZR A;  4DUW A;  1UMI A;  1DP0 A;  2VL4 A;  3WNM A;  4PQQ A;  2B4K A;  3J7H A;  3WNL A;  5LA0 A;  1W0N A;  2BZD A;  2JKX A;  3GXU A;  2W9X A;  2W1Q A;  2EIE A;  5IYY A;  2QQJ A;  2YC2 A;  5A1A A;  1CZV A;  2VR4 A;  2YFU A;  2VZO A;  4AAX A;  1GU3 A;  4MO3 M;  4QDS A;  3UNP A;  1O8S A;  1CZT A;  4GWI A;  2ZEY A;  3MO4 A;  2C26 A;  1EUT A;  1KGY A;  2J1S A;  1ULO A;  1PX3 A;  2ZEW A;  2W87 A;  3WNN A;  1K42 A;  3HJR A;  4W4Z A;  1LNS A;  2Y6G A;  4BK4 A;  5EIY B;  3VD4 A;  3DEC A;  1UYX A;  2J7M A;  2EID A;  3K4D A;  5F7U A;  4CUA A;  3A7Q A;  4BK5 A;  4DXR A;  3WQB A;  2Y64 A;  3C7E A;  4QX3 A;  5HPO A;  1GMM A;  4DUV A;  3WNK A;  5DN2 A;  5JXJ A;  2WAO A;  2R7E B;  5DMY A;  2YB7 A;  4QB6 A;  1UYZ A;  2C4X A;  3BN6 A;  3MV1 1;  2V72 A;  1J83 A;  3IAQ A;  1SG3 A;  1OH4 A;  1PX4 A;  1T2X A;  4DXT A;  2JD9 A;  1US2 A;  1JYV A; 
#chains in the Genus database with same CATH topology
 4LO6 B;  4C91 A;  1Z0H A;  5L9R A;  5IK8 A;  1L7L A;  4LBQ D;  5LW9 A;  2R04 2;  5CIS A;  4QHZ A;  4MOA A;  4XBL A;  2G1M A;  1DZR A;  2YPJ A;  4K8F A;  4M4P A;  4DRR A;  5AVA A;  1RUJ 1;  4ZS2 A;  3SLI A;  2D7F A;  3ZYR A;  4AWD A;  5JOY A;  5HV4 A;  3LD8 A;  4LK7 A;  2RS3 1;  2R6Q A;  1PVX A;  1C8M 2;  3LIH A;  2ZGT A;  1W6O B;  4EN9 B;  2VVF A;  3I97 A;  2QQV A;  1BZW A;  1CVN A;  3U0Z A;  4FPK A;  3AL5 A;  1IOA A;  4WVZ A;  1S2B A;  5I0U A;  1MQT A;  1W6P A;  1YCI A;  3ILF A;  2VC9 A;  3NNL A;  3WXP A;  1CAW B;  1ZRI A;  3QAC A;  3WP6 A;  3E1F 1;  1ZYB A;  4IEV A;  2Q1F A;  3POE A;  1AVB A;  4J1W A;  4F83 A;  1AX2 A;  2AUY A;  3M70 A;  1YYN A;  2J1U A;  2CSG A;  5JAX A;  4P9X A;  3RZZ A;  4KWJ A;  3U10 A;  1ULE A;  1AX1 A;  2W46 A;  1SAC A;  3N35 A;  5K9Y A;  4AI8 A;  2XJQ A;  4LKD A;  3MEP A;  3AYE A;  3VBR B;  2Z5W A;  1HRV 1;  4KL1 A;  5JZG A;  1Z78 A;  2WUH A;  2RJL A;  1RUG 3;  5FZA A;  1V6O A;  1K5M A;  3IM0 A;  5LB6 A;  3OUH A;  1YC6 1;  4MUV A;  4AHZ A;  2WNV A;  4XHB A;  1RJ7 A;  1XRU A;  1E5R A;  3U14 A;  4LT5 A;  1AR9 3;  1QXR A;  5T5O A;  1RED A;  1U5I A;  1ZZ6 A;  4QXH A;  3C7H A;  2DVG A;  2DCK A;  3LIG A;  1C1F A;  4PLM A;  5DUU A;  2RDS A;  3V65 A;  3ZFG C;  1VP6 A;  5J1X A;  3W5N A;  4GH4 C;  1HQL A;  1CQ9 A;  3AP6 A;  5LRS A;  1P8J A;  2ZAH A;  5D8A A;  4QU1 A;  5F6L B;  1NKG A;  4E4S A;  1O5L A;  1DQ5 A;  4UF0 A;  1NY7 2;  4A3X A;  4XUO A;  4EJR A;  5JSR A;  1MZE A;  5FZ3 A;  1D2S A;  4XAA A;  4Y1V A;  2ARC A;  2Q30 A;  3GAL A;  1BVP 1;  1SLC A;  4IGQ A;  3EHK A;  4LBL A;  3WDW A;  4QPY A;  5A70 A;  3RZJ A;  2DTW A;  5FZG A;  4S2G A;  4UFK A;  4CEY B;  2GP5 A;  4RQP B;  5L9V A;  5FPZ A;  2K9Z A;  3KT1 A;  2CY6 A;  3UES A;  3I2K A;  1S0B A;  1Y9G A;  2XUM A;  2P2K A;  2R0H A;  3UKV A;  4FBF A;  1H8V A;  1XNB A;  4PI2 A;  5J98 B;  3SH4 A;  3KQR A;  5FYS A;  3VHO A;  3N4M A;  2O1Q A;  4ZY9 A;  1D0H A;  1X36 A;  2ORZ A;  3MIC A;  3WF0 A;  4NIH A;  2CNA A;  5DAX A;  1KS5 A;  1N1S A;  3T1L A;  1O91 A;  4Y22 B;  1W6M A;  3WX5 A;  1X33 A;  2D6M A;  3ZN4 A;  3O1O A;  1APN A;  2J1R A;  4CU6 A;  3V0B A;  2K2S A;  4E2Q A;  3I7D A;  5FYZ A;  4YGB A;  5FP4 A;  2FBE A;  1RVF 1;  3RZH A;  1UPS A;  1VBA 3;  3GZT B;  4IGO A;  4AVA A;  2WL1 A;  1W8T A;  4N43 A;  2UYB A;  3IKW A;  2WN3 A;  4DIQ A;  1RTV A;  1O3S A;  1FI2 A;  3B7M A;  4PDW B;  5DAQ A;  3S7I A;  1LOF C;  4QKB A;  1KJL A;  1VE0 A;  4DEQ A;  5C70 A;  4BME A;  5H9P A;  2XBO 1;  5IYY A;  3HVD A;  1BYH A;  1YLL A;  4XVH A;  4Y33 A;  1OUS A;  4DS0 A;  5JR2 A;  2UY9 A;  3CIH A;  3T09 A;  1YHF A;  4XYX A;  4ARY A;  4QGN A;  4ZZ5 A;  3O0X A;  1AR9 2;  2CU5 A;  2AAC A;  3ST7 A;  2R07 1;  2WA3 A;  4LTA A;  2GME A;  5L7O B;  3E5X A;  4CDW B;  4P9G A;  5C3O A;  1RUI 1;  4DUX A;  1OH3 A;  2I45 A;  2LAL A;  3EB7 A;  2NMN A;  1RJ8 A;  4NWV A;  4AQ6 A;  3TNP B;  4A7Y A;  1FPN 2;  4BQX A;  3ZM8 A;  2ZTN A;  4LO5 B;  4JHT A;  1PM7 A;  1BBT 2;  4YYO A;  3SNM A;  1UW8 A;  1RUD 2;  4ARX A;  2WZ8 A;  2WZR 1;  4XF0 A;  3WW3 A;  1PK6 C;  4XCA A;  4K1Y A;  1T6B X;  4QQO A;  1H1M A;  3WDX A;  1K3I A;  1QJY 1;  3O7O A;  4UFH A;  1YQ8 A;  2GP3 A;  1AF9 A;  1BEV 3;  2G9G A;  5AFB A;  3CMG A;  4NIA A;  1AXK A;  3CBN A;  4D0Q A;  1NCQ A;  4XF3 A;  2BQP A;  4OQ9 A;  4AI1 A;  2BBA A;  5BNP B;  3R4S A;  4RSU A;  1COV 1;  1DQ0 A;  1UPI A;  1YWK A;  2AYH A;  1PZ7 A;  4L92 A;  5FYV A;  3RGB A;  3MIB A;  4OZO A;  1HN1 A;  3CQO A;  4JDM A;  1FOD 2;  3ZKU A;  4IGP A;  3T1M A;  5FP3 A;  1SPP B;  4Y26 A;  3WCR A;  4EWD A;  3B3Q E;  3A22 A;  1J3Q A;  1UU4 A;  1LGB A;  2ZEZ A;  1PO1 2;  2XPJ A;  5K0U C;  1IGO A;  1JH5 A;  2ARA A;  1H6Y A;  2VTX A;  3IN9 A;  2D3R A;  4M0H A;  5KHG A;  4XMI A;  2W94 A;  5A3W A;  4W8J A;  5JI7 A;  4AF9 A;  1S0F A;  4B1L A;  1POV 3;  3K51 A;  4BPZ A;  3FWE A;  2JD4 A;  1WLD A;  5DAB A;  3I2F A;  3E97 A;  4N7U A;  5FQ0 A;  4LKE A;  1SMV A;  2VCA A;  2ZX1 A;  3KCY A;  3WUD A;  4AFB A;  5BV6 A;  2Y6H A;  3WF1 A;  2KD7 A;  2WN2 A;  5BNQ A;  2DCT A;  4XJW A;  3SEE A;  3TAY A;  1W3X A;  5FZH A;  1W04 A;  3SCH A;  2DTY A;  3JCI A;  4CUB A;  2W47 A;  2PHT A;  1N3O A;  2D6P A;  3JB4 C;  5EHD A;  5CEH A;  2PAE A;  4AFD A;  1IPS A;  5DDJ 2;  2VMH A;  4JGZ C;  5G05 L;  5ABJ C;  1XYP A;  1K45 A;  1GV9 A;  1UO9 A;  4CDQ A;  3O1P A;  3MPB A;  2H6C A;  3GHN A;  3H9A A;  3UGH A;  3SCF A;  3O14 A;  4IE7 A;  5AVP A;  1UY1 A;  1B35 C;  1JOD A;  2QQW A;  2VPV A;  3R05 A;  4QGL A;  2YC0 A;  4WM8 B;  4E2G A;  1BLZ A;  1VB4 A;  1SLL A;  1WLC A;  2VUD A;  3RWK X;  3C8X A;  4QQL A;  2WNU B;  4Q1R A;  5FAX A;  3VN4 A;  5JVV A;  4LBN A;  4EN6 B;  4XFG A;  1IZ3 A;  4CUG A;  4PQ9 A;  3GZA A;  3OGV A;  4H7M A;  5A7N A;  1QJU 1;  3VZM A;  2BFU L;  5F5I A;  2FMD A;  1PM4 A;  3R4U A;  2QQO A;  2PHL A;  3KV4 A;  5E8A A;  2LUW A;  1UXX X;  3EBR A;  4I3G A;  3WNO A;  2BNN A;  2RS1 2;  5F3G A;  4A41 A;  2WKK A;  5JDB A;  1W8O A;  1GQP A;  1VAK A;  2WLP A;  4LBQ B;  2ZGS A;  2PXJ A;  4BMB A;  1OKQ A;  2IC1 A;  4RGG A;  2W68 A;  1Q8O A;  2W52 A;  3VZJ A;  4OMD A;  1UX6 A;  3MW3 A;  1J58 A;  1YFU A;  4Q27 A;  4RR3 B;  5J09 A;  3RZM A;  2YY1 A;  4J25 A;  1H8T B;  2L9L A;  1CPN A;  2VBD A;  3TN9 1;  4LLF A;  4B4R A;  2DV9 A;  1MEC 2;  1D4M 3;  1R08 2;  3P1I A;  3MIE A;  2RVA A;  5FZO B;  2V5Y A;  1W9Y A;  1W8N A;  1SLB A;  4LIU A;  1WA6 X;  1RUF 1;  5LAS A;  1CPM A;  1MQT C;  4IV1 A;  3UET A;  3ILR A;  1HV0 A;  1J1L A;  1OD5 A;  4BHP A;  1BXH A;  3U07 A;  1BMV 1;  1IG0 A;  4Z1V A;  2E32 A;  4K6B A;  4L2N A;  3VUO A;  3ACL A;  5CFD B;  1UMH A;  5EJ1 B;  3H1Y A;  3B94 A;  1QJF A;  2IVJ A;  1FMD 1;  3GNE A;  4XZU G;  4MG2 A;  5I91 A;  2HWF 3;  3AKR A;  5JMO A;  2DDU A;  1O7F A;  5C8C B;  1AYN 2;  3THD A;  1ZA4 A;  5D21 A;  2YBP A;  2P3K A;  5A7Q A;  4UFM A;  3V0A B;  1QJX 1;  3Q8E A;  1MS5 A;  1XJA A;  4XW3 A;  2GC1 A;  3KT4 A;  3OPT A;  4WM7 C;  5FYI A;  3S30 A;  1MS1 A;  1AUY A;  1NQD A;  2EF6 A;  4AED B;  2QJV A;  3AYC A;  5FYY A;  2WNV C;  4CEY C;  3U4X A;  5CYY A;  5A7P A;  3LFM A;  3VBH B;  1FXZ A;  1LGC A;  2BEO A;  2PHR A;  2QDN A;  4W65 A;  3H3Z A;  3VBU A;  1VBE 1;  3THP A;  4Q4W 3;  4B3N A;  2A6Z A;  3BPS A;  4HVO A;  1KDK A;  2ZGO A;  1JZ5 A;  3W9A A;  1SCR A;  2GN7 A;  2IZW A;  4A7K A;  4OI4 A;  2VVE A;  4YW5 A;  3NV3 A;  4BJ0 A;  2BJS A;  2H0V A;  1QMJ A;  1AR7 1;  4HVR A;  5GKA C;  1NA1 A;  1ASJ 1;  1Y3T A;  3C3V A;  4W6X A;  5C71 A;  3OJB A;  2WT0 A;  4ZU5 A;  4XFI A;  1AR6 2;  1OVS A;  1RUJ 2;  5D2A A;  4E2S A;  2EAA A;  2RS3 2;  5IVY A;  2FDH A;  2Q4S A;  3KF3 A;  4FOQ A;  4M4R A;  4WBB A;  5EQU A;  1H4H A;  4KG0 A;  2OVU A;  2ZGU A;  4PHZ A;  5HXV A;  2BGP A;  2DUO A;  2HWD 3;  2X09 A;  3CO2 A;  5FZD A;  1ZZC A;  5CKM A;  4UFL A;  1U5X A;  2B8M A;  2WAB A;  4XHX A;  3SHR A;  4HKL A;  1VBC 1;  2JEM A;  2A71 A;  1JZ2 A;  4JC1 A;  1RVF 3;  4CZS A;  3RNS A;  5HI0 A;  1W9S A;  4DMI A;  3MFC A;  5LZ6 A;  4H3W A;  5LA9 A;  1VAM A;  3PNA A;  2VOK A;  4QDR A;  1C5H A;  4I0W B;  2FDI A;  3RMY A;  3INA A;  5A7W B;  5FCC A;  3LOI A;  3RVH A;  2MPF A;  1CAU B;  4JGY A;  4QPI B;  4N8M A;  1SHW B;  2QQU A;  3D5O A;  5GZD A;  1JYN A;  4AVC A;  5CFC B;  3B02 A;  1O3R A;  1HRV 2;  3FZ3 A;  1AYM 1;  5C3Q A;  4IEP A;  4RHV 1;  3OYW A;  1POQ A;  1RUH 3;  1UZV A;  2ZGK A;  4HFS A;  4IXL A;  4NPM A;  4LOT A;  1O5U A;  4IEZ A;  1K5J A;  4OLL A;  1S0E A;  3GJA A;  4FP2 A;  4Y1U A;  3VBO A;  1QY4 A;  2ZGP A;  4CRQ A;  4YWA A;  1W2A X;  1OOP B;  4XC9 A;  1FAY A;  5F5A A;  2LTN A;  1OFS A;  3FBM A;  2DWR A;  3KZ4 C;  1S0I A;  4ZXE A;  3WW1 A;  5FPV A;  3EXU A;  2DVA A;  1EAH 3;  2EA7 A;  3OUJ A;  4FPO B;  5GZG A;  5HV0 A;  3I8T A;  3LSE A;  3QOP A;  5F9T A;  1WCU A;  2HWB 3;  4MLO A;  2FZ1 A;  4XJ8 A;  3O1S A;  5K4L A;  1GWM A;  1FV3 A;  4HAN A;  1A3K A;  3POY A;  1REE A;  2UU8 A;  3URF A;  1UWW A;  5BNP C;  5EXO A;  5C5U A;  1J1T A;  3PUH A;  4Z2W A;  1JU4 A;  4OQ8 A;  1GNZ A;  2XQX A;  3PUA A;  1GNH A;  4Q26 A;  1I3H A;  5JOW A;  4Y1Z A;  4RS5 A;  3KCC A;  2MHF A;  5LA1 A;  4Q2F A;  1ZZ9 A;  3ACI A;  1S0G A;  3IT8 A;  1VRH 3;  4QPW A;  5GLW A;  4XAE A;  5FY4 A;  3LPG A;  3HT1 A;  1V0A A;  3PIG A;  3LDK A;  2Z79 A;  2JEN A;  1VBB 3;  5DUX A;  4RN5 A;  4CP1 A;  5FZ0 A;  4LHN A;  2ARB A;  4ET7 A;  2D3S A;  2A1X A;  3SC7 X;  5KHH A;  5SV5 A;  3CF6 E;  1QU0 A;  1UNB A;  2QCS B;  2WA4 A;  4R9B A;  3AZX A;  1RHI 3;  1RVF 2;  2PFW A;  5L19 A;  1AZD A;  1HQW A;  1W9F A;  3CJI B;  2OYZ A;  3VKM A;  4CDX B;  1Q8P A;  2JE9 A;  4PQQ A;  4CDU B;  3OPZ A;  1PGL 2;  1WLT A;  3J7H A;  3T2T A;  2Y38 A;  2XJV A;  1UF2 C;  2JKX A;  2WR9 A;  4BQ4 A;  2W9X A;  1TZO A;  5A7S A;  3ZYI B;  3M7A A;  4CP9 B;  5AFE A;  2JDK A;  2QQJ A;  2XBO 2;  2YC2 A;  2GN3 A;  1CZV A;  4JQR A;  3KV9 A;  5DXD A;  5JSP A;  2PHD A;  5H9Q A;  1UCX A;  4QDS A;  1ULC A;  3NVC A;  3POF A;  4Q0Q A;  2R07 2;  4N7I A;  4TWT A;  1V6N A;  2WWJ A;  3RMX A;  1V6K A;  4CCD A;  1KGY A;  1RUI 2;  4R9C A;  2J1S A;  1LCL A;  4NAM A;  1ZZ7 A;  2WS9 1;  1V70 A;  4LE3 A;  1A8D A;  2HWB 2;  3JD7 3;  4I0B A;  3ORJ A;  2HBU A;  3ZR5 A;  1J3R A;  1W03 A;  1DFQ A;  5EIY B;  3I2D A;  5CU1 A;  3FX3 A;  1NCR B;  3POG A;  2R0F A;  5JPM B;  2DVB A;  1NLQ A;  2EID A;  2WZR 2;  3ZFG A;  4A6S A;  3BU0 A;  3A7Q A;  1WMD A;  1RUG 1;  4DXR A;  4GH4 A;  4Y1X A;  1UZW A;  4YZ5 A;  1T6G C;  2PAK A;  2SLI A;  1QJY 2;  1WCK A;  4QHO A;  3MDP A;  5DN2 A;  1W39 A;  3IDC B;  4D69 A;  4XDQ A;  3POJ A;  4RR3 C;  1IPK A;  1A6C A;  4CTE A;  2GSY A;  1H8T C;  2F6B A;  1PIV 3;  3OOX A;  2Q8D A;  5K7P A;  5FYT A;  5E16 A;  1COV 2;  5FZ6 A;  3APB A;  4XZP A;  1QXJ A;  2E53 A;  4CA9 A;  2V72 A;  2VTX J;  3FLP A;  3ZMN A;  2XH6 A;  4IES A;  1I9R A;  1XNK A;  3WNX A;  4X8P A;  1W3V A;  4Y4R A;  3ZXG A;  1LED A;  1OH4 A;  1PX4 A;  3CU7 A;  4YGE A;  2JD9 A;  1JYV A;  1NLS A;  1GP5 A;  4ES8 A;  4QAW A;  5FY5 A;  3NAP B;  1DGW A;  1M4W A;  1GR3 A;  3D6E A;  2XJS A;  2OII A;  5FYB A;  1CX4 A;  3CNA A;  5CFD C;  1VLN A;  2B46 X;  4Z2A A;  5A32 B;  2QQK A;  3NNG A;  1W6N B;  1RUF 3;  2B39 A;  2AC1 A;  4QXC A;  1JZ6 A;  4HL0 A;  2X5I B;  4EWE A;  4XFA A;  2VOT A;  2QBX A;  3PMS A;  1SBD A;  3ZSJ A;  4F7Z A;  5I8Y A;  3D4K A;  1GIC A;  4AED C;  5JUV A;  3VLB B;  1NX9 A;  2XJU A;  3KLS A;  4UFJ A;  4CXW A;  3AXE A;  1ND3 C;  5GJ6 A;  3G6J B;  1XU2 A;  2VXJ A;  3M8L A;  4LO7 A;  1W8F A;  3U75 A;  4KI5 M;  2VXR A;  4XUR A;  2PHX A;  1VBA 1;  1OLM A;  3I3Q A;  1Q8S A;  4O9G A;  4PLN A;  3ZMO A;  1WBF A;  1PNF A;  4D6Q A;  2D5F A;  3OSD A;  3ABZ A;  2WQZ C;  3O0V A;  5EP9 A;  2OPK A;  4MYE A;  3EO6 A;  3SXW A;  2JB8 A;  2W3J A;  1GZC A;  3U4S A;  3O5S A;  2BYV E;  3EYP A;  1R1Z A;  3QD6 A;  1ALY A;  2OT7 A;  4YLZ A;  3OY8 A;  3K4A A;  1N1V A;  4JX0 A;  1QJU 2;  4NN0 A;  3PVE A;  5EWS A;  3TEW A;  2B9V A;  1IS6 A;  1D2Q A;  1H1I A;  2HYX A;  4H2A A;  5FZK A;  3NRU A;  4F8A A;  2G9Z A;  4ZU7 A;  4TLF A;  2HEY F;  1H0B A;  3D3A A;  2DUP A;  4CEW B;  2WC2 A;  2K0G A;  2VOX A;  4MGQ A;  1PK6 A;  3ZXD A;  5GLT A;  1HW5 A;  3WCS A;  2P17 A;  3JU9 A;  1I5Z A;  2WO7 A;  1ST8 A;  5A3P A;  2Y34 A;  4YNI A;  1YFX A;  3JXS A;  3K75 B;  4FT8 A;  2LW8 A;  3N7M A;  4MGK E;  3VD7 A;  5ACA 3;  2A6X A;  3BVC A;  1UKR A;  1ZM1 A;  4M3C A;  2Q0A A;  2GC2 A;  4N9I A;  4AHX A;  5IVV A;  5CVR A;  1F5F A;  3PUS A;  1KS4 A;  3TN9 2;  3LF7 A;  4XBN A;  5FK8 A;  3AZZ A;  4JKL A;  2NN8 A;  3W59 A;  5FP9 A;  1PGW 1;  2IWG B;  1BEV 1;  5FKB A;  1XE8 A;  4TN7 A;  1LOE A;  1RUF 2;  2FDK A;  3U1X A;  4RYD A;  5K0U A;  5E88 A;  1HV1 A;  1OOP C;  4MV2 A;  2JIJ A;  4OUM A;  1BMV 2;  1RUN A;  3FMG A;  3I2G A;  3VBS A;  4CU9 A;  4D7T A;  4D6S A;  2VVD A;  4MXW B;  2H6B A;  5C4W C;  1OLM E;  1JYT A;  1K12 A;  3WG2 A;  4COV A;  1DQ4 A;  1EP0 A;  1FMD 2;  3NV2 A;  4FFG A;  1NZI A;  2KR2 A;  2TUN A;  1SQ4 A;  1Y4W A;  4SLI A;  2DUQ A;  1NG0 A;  1X8E A;  4N53 C;  2ZPX A;  3H3L A;  4KG8 A;  3VDD C;  2ENR A;  2GNB A;  1BK0 A;  1QJX 2;  2J1V A;  2RM2 3;  4IEQ A;  1POV 1;  3SIT A;  3JUU A;  4B8E A;  3QH7 A;  5FXV A;  5EJZ B;  4XCB A;  2HWC 3;  3NMB A;  2JG9 B;  2XJT A;  2XON A;  3PTR B;  5FY0 A;  1VBE 2;  3ZYP A;  4JGZ A;  1RIT A;  2R30 A;  5FZ1 A;  4LKF A;  2PHW A;  4DY3 A;  4ZZ8 A;  5ABJ A;  3D0J A;  2LS6 A;  1V6J A;  3EMR A;  4UI9 L;  4FTE A;  3SIS A;  1LHV A;  3ITQ A;  4DXS A;  3FL7 A;  2HYK A;  3LA3 A;  2D6K A;  1H2M A;  5IWF A;  2VQU A;  1AR7 2;  3WT3 A;  1X7N A;  4QKN A;  1XB9 A;  1ASJ 2;  2VZP A;  1VMF A;  4DOU A;  3WY6 A;  2WZE A;  5G04 L;  1W9T A;  1MS9 A;  2UYA A;  3HQR A;  4V2W A;  5BNO C;  4J6G A;  3CJI C;  4XE9 A;  1UMZ A;  3FUO A;  1W6O A;  3N9Q A;  5FPX A;  2VZ1 A;  4CCN A;  1W8H A;  1S0C A;  2BFU S;  2Z69 A;  2WSU A;  5FP8 A;  5T54 A;  1VB2 A;  3JQX A;  2D40 A;  4MHR A;  5DAV A;  3T30 A;  3Q8C A;  2VOW A;  5C3P A;  1O3T A;  1CAW A;  1TG7 A;  2Q5T A;  1VBC 2;  2E7A A;  2GH2 A;  3N7L A;  1AR8 3;  2O8O A;  5EYY A;  3LB9 A;  4EZ4 A;  2MEV 3;  1RGS A;  5J36 A;  5LCW L;  1H1A A;  1QJZ A;  5C7G A;  2XL9 A;  1ND2 B;  5FXX A;  4AEJ A;  5BUV A;  1WA4 A;  1G9F A;  2XWB B;  4EN0 A;  5IVF A;  2ZMN A;  2AH2 A;  3WG3 A;  2E7T A;  5T5P A;  1I5P A;  2ZMK A;  5T3N A;  2GMP A;  3LGR A;  1ENS A;  2AGS A;  5HPO A;  1AYM 2;  1CAV B;  2PA7 A;  4RHV 2;  1QXP A;  1R1A 3;  2YUE A;  3JZV A;  1DYK A;  4LO8 A;  4GA9 A;  2ZKL A;  3NV1 A;  3M3C A;  5DZE A;  3VBF C;  5LBB A;  4YZ1 A;  3VD5 A;  3ZSM A;  2YHJ A;  4UWD A;  3B00 A;  4YSF A;  5IK4 A;  2PMW B;  4QXB A;  5IVE A;  3J26 N;  4Y4Y A;  3BB6 A;  3Q8B A;  4ORF A;  3BTY A;  1D4M 1;  5C9A B;  3MPP G;  1YRZ A;  2WFP A;  2WS9 3;  1RYY A;  3HIF A;  3GCW A;  1RUC 3;  3KMH A;  4AL9 A;  5K8S A;  1UL9 A;  1JOP A;  3AP4 A;  2JJ6 A;  3E5Q A;  2BVV A;  4NUB A;  3KB5 A;  3SKJ E;  4WM7 A;  1REF A;  2CWS A;  3AKT A;  2R06 3;  1NAE A;  1BKZ A;  3MUZ 1;  1WD4 A;  4L0P A;  2D6O X;  4CEY A;  5DUV A;  2HWF 1;  1CES A;  4BOW A;  2BTV C;  1GOG A;  3GGL A;  1L7R A;  1DGR N;  1YJL A;  2WO1 A;  3TWI A;  3AZV A;  3CJX A;  4A44 A;  5BNN C;  1WBL A;  1O4Z A;  1US3 A;  3HNY M;  2EXJ A;  5KC6 A;  3ECQ A;  1NUK A;  1TNR A;  1UY0 A;  1W28 A;  1JOJ A;  4N90 A;  3BIW E;  4Q4W 1;  1IKQ A;  1ULD A;  1OMI A;  2BER A;  2IXK A;  3GDB A;  4E27 A;  2W39 A;  5FLI A;  2ZXQ A;  3H7J A;  5FYU A;  1BJQ A;  1TVG A;  1CAX A;  3MLK A;  2TEP A;  4Z82 A;  4YW7 A;  5ISL A;  4O9E A;  4DB5 A;  1UD1 A;  1W6P B;  2ZZJ A;  4FOW A;  3OB8 A;  3AC0 A;  1L7Q A;  4C0H A;  5GAL A;  4PDW A;  2BWC A;  4P9L A;  3O1V A;  4CP2 A;  3NJX A;  3TRS B;  4ZON A;  5A6Q A;  2VMG A;  3DV8 A;  1DHK B;  3ON7 A;  5LBF A;  1DGW X;  1SDD B;  3IPV A;  2VZV A;  4Q29 A;  2HWD 1;  4DY5 A;  2VBB A;  2VU9 A;  4Y20 A;  2Q1M A;  5FMO L;  5F1R A;  4NRQ A;  1YIF A;  3BKZ A;  2YBS A;  3M1H A;  3NKG A;  4NHL A;  5E6H A;  5JZG B;  5L7O A;  2VO5 A;  4WV8 A;  3O1R A;  4FPG A;  5FUN A;  2RJ2 A;  4KU8 A;  1LTE A;  3GM8 A;  2PLV 3;  5TSW A;  3ZN6 A;  2VUL A;  4M3C F;  3KT7 A;  2WS9 2;  1PMJ X;  2ZML A;  5LAT A;  5JI9 A;  1LEC A;  3UK9 A;  2PTM A;  3RYK A;  1PGL 1;  1CJD A;  1GLH A;  4B29 A;  4I02 A;  5C8W A;  3CDZ B;  4CEW C;  4Q4V 3;  4K9S A;  3ZO0 B;  4AHW A;  1HDK A;  2P5B A;  4D6R A;  4B4Q A;  5D8A B;  4QT6 A;  1RUG 2;  5L9B A;  1UY4 A;  1GZT A;  1Q43 A;  1JBC A;  1RUH 1;  4DFS A;  1WME A;  4YVS B;  1OLQ A;  2OX0 A;  1DLL A;  1W8W A;  3HD8 B;  4FPJ A;  4I30 A;  5FIX A;  5FLJ A;  3IAP A;  1UZZ A;  4JDN A;  4PIX A;  4Q5O A;  4XBQ A;  3ZDS A;  1YEW A;  4BU2 A;  5FV3 A;  5BNP A;  3OBZ A;  4XQD A;  1KJR A;  5DPN A;  1EAH 1;  2WYS A;  5IFT A;  2HEV F;  2E31 A;  3GHM A;  1CIY A;  2H0B A;  2HWB 1;  5DZG A;  2B7Y A;  1NT0 A;  2P6C A;  4E4D X;  1H6X A;  4C8D A;  4AGV A;  3WF2 A;  2P37 A;  1OFN A;  1AX0 A;  2ID4 A;  3LQC A;  3NJV A;  2Q1Z B;  5I93 A;  1ZRF A;  2LRP A;  4XOG A;  4ERO A;  4A42 A;  5FOB B;  2ES3 A;  4IEY A;  5FMC A;  4AFC A;  4CUC A;  3V0B B;  3GCX A;  4K1Z A;  1MVQ A;  3BOP A;  3N9L A;  3IB3 A;  3N9M A;  4XET A;  3VKO A;  5A6X A;  1VRH 1;  3CZU A;  3K3O A;  3WF3 A;  2WWU A;  3WEZ A;  5FTT C;  4NMI A;  5FZE A;  1VBB 1;  3CKH A;  3CZJ A;  2ZEX A;  2DYC A;  5LY2 A;  3N3H A;  1F5J A;  4ZS3 A;  5IT6 A;  3IMM A;  3AYD A;  1G86 A;  4JV4 A;  2HEW F;  2NQY A;  2CGN A;  3HWJ A;  2RMU 3;  1SLT A;  4CXX A;  1XNA A;  5GM0 A;  4CYD A;  1GZ9 A;  1RHI 1;  2JE8 A;  1PHM A;  2IVI B;  1L3J A;  3CEW A;  2XVL A;  1VBA 2;  4UW4 A;  1AXZ A;  1N3P A;  2YV8 A;  4BQ1 A;  3ES4 A;  3A0N A;  3VBS C;  2VCC A;  1R64 A;  1JI6 A;  4BQY A;  3LEM A;  2IXI A;  3I3D A;  3QCW A;  4S2D A;  2WNU A;  2RV9 A;  3V64 A;  5LK7 B;  2UUR A;  1QQP 3;  1W6Q A;  4JRA A;  2DUR A;  1HXS 3;  1E5S A;  2AEN A;  4R9D A;  4YW2 A;  1DQ6 A;  3ZYJ B;  1V9U 3;  5AC9 1;  5A6Z A;  1RL3 A;  5KXE A;  3W5M A;  4GXL A;  5DUW A;  3N9O A;  2XR4 A;  2HLE A;  1QNW A;  4HN1 A;  3WIN E;  2ETE A;  4TTG A;  3H7Y A;  4PF5 A;  3QH6 A;  3OCP A;  3DKQ A;  3L9J T;  4RD7 A;  3ZSK A;  4JVA A;  4OI1 A;  4AQS A;  3DCQ A;  4LBQ A;  4QQP A;  2BW8 A;  3ZFF B;  3JD7 1;  1W9W A;  2VW2 A;  3POI A;  4JCK A;  4FXG B;  4AQT A;  3LA2 A;  3RYP A;  4OUS A;  3MW2 A;  1ONA A;  1NCQ B;  4RR3 A;  1D7P M;  1UU5 A;  3I2H A;  4LLO A;  3S5A A;  1ZRC A;  1YQC A;  3I2I A;  1H8T A;  2RHP A;  4JRL A;  4Q8L A;  3DXU A;  2D44 A;  3HNM A;  1SLI A;  2BVB A;  3C7O A;  3H1M A;  3KD4 A;  4IUG A;  4PF1 A;  2VZ3 A;  2IUW A;  4FPC A;  3VKL A;  1WZX A;  3MI8 A;  3KVA A;  1IQD C;  4FVV A;  1G9C A;  1H2L A;  2ORX A;  1QKQ A;  1MAC A;  5FZO A;  1PGW 2;  2CGP A;  1BEV 2;  2WSV A;  1UY3 A;  3IDB B;  3H0O A;  4OI0 A;  4M01 A;  4UOJ A;  2C6S A;  4A7Z A;  2MNG A;  2IXL A;  1PIV 1;  4FOV A;  3M3O A;  4R4Z A;  1UU6 A;  2OXB A;  1VPH A;  4LUK A;  4QKD A;  3BOD A;  3T3Y A;  3B93 A;  4ES9 A;  4M00 A;  4GD4 A;  5CFD A;  1FT9 A;  5IJR A;  4QQH A;  4FPY A;  3AMN A;  4MAD A;  5EPA A;  4AK3 A;  4QB1 A;  3WP3 A;  2LRO A;  2B9U A;  2G19 A;  1TME 3;  3T0B A;  2ZAC A;  3UT0 A;  3WSO A;  3VBR C;  1OXC A;  1JZ3 A;  2JDH A;  1DQ1 A;  3SCG A;  3GZU C;  4HKO A;  4AED A;  3CLP A;  4PLO A;  3RPQ A;  2P1B A;  4Q8K A;  3IZO A;  1ND3 A;  4EYU A;  4HPK A;  4COW A;  5LA0 A;  2GC3 A;  1W0N A;  1UOG A;  2VD7 A;  2W1Q A;  1ZBA 3;  4CDQ B;  4KH9 A;  3ZPY A;  3WQ7 A;  1OLR A;  2YFU A;  3KV5 A;  3NJZ A;  1Q3E A;  3RYR A;  2C1F A;  1JMU B;  1O8S A;  2QE3 A;  4OFG A;  4FXK B;  1CZT A;  5EZW A;  1F35 A;  5SV8 A;  5C33 A;  5FPU A;  5FWJ A;  3ZSL A;  2C26 A;  3AJY A;  2BGC A;  3T4V A;  1EUT A;  2XLA A;  2YPD A;  1G9A A;  4KBB A;  2YGM A;  1E5H A;  1ULO A;  1OPO A;  4NHK A;  2K46 A;  3TNQ A;  2OUJ A;  3WNN A;  4MHU A;  4Y1Y A;  4EWA A;  4W4Z A;  3MZH A;  1LNS A;  4G9S B;  4MX3 A;  4AI2 A;  5LBC A;  4RQP C;  4BB3 A;  3VD4 A;  3DEC A;  5FZ7 A;  1QEX A;  2NMO A;  2J7M A;  1IS3 A;  4AGR A;  4BM8 A;  1JHN A;  4CUA A;  4BK5 A;  1MS0 A;  2Y64 A;  2OA2 A;  3C7E A;  4QX3 A;  1W8U A;  4DUV A;  2E6V A;  4AR2 A;  1SZB A;  1S2K A;  4E4H A;  4HVQ A;  3TB0 A;  4CCK A;  1AL2 1;  2BU9 A;  4Q0U A;  2JX9 A;  3PDQ A;  5A7W A;  1PNG A;  4QPI A;  5FJH A;  5DMY A;  1RUO A;  4QB6 A;  5CFC A;  2YYO A;  3PVN A;  3USU A;  2FCT A;  2JDZ A;  3AXD A;  4LOS A;  1OUR A;  2PAM A;  1LOC A;  5A3L A;  4BXF A;  4LNV A;  3IAQ A;  2PN5 A;  1AR6 3;  4UYB A;  5ACA 1;  1VMH A;  1XND A;  2V73 A;  3N36 A;  4OHW A;  1MS4 A;  3LDB A;  4PDW C;  4DXT A;  1TEI A;  1US2 A;  1VIW B;  1OOP A;  4NHX A;  4C1W A;  4FTB A;  3BPZ A;  3O1M A;  3WZ1 A;  1AJO A;  2YU2 A;  1CZS A;  1YFW A;  3A4U A;  4HG6 B;  1DU3 D;  1D4M 2;  5C4W A;  1TE1 B;  5HXM A;  3ELN A;  5T55 A;  4JQT A;  3ZXA C;  4HON A;  1WCQ A;  3IBM A;  4MSV A;  4A2U A;  3AZY A;  4P9Y A;  5L7O C;  4PIZ A;  4CDW C;  4N53 A;  2JG8 B;  3HQU A;  4XUP A;  2GH8 A;  1W2U A;  1U12 A;  4KGQ A;  3VDD A;  4CSW A;  2ZX4 A;  2EAK A;  3BTA A;  2E7Q A;  4AZZ A;  2XDV A;  2RDN A;  3GBG A;  3VBU B;  5J96 B;  3E5U A;  4S2H A;  4ZKT B;  2RDR A;  2WYF A;  3AP5 A;  4GJZ A;  2CDO A;  2HWF 2;  4LXL A;  1STM A;  2YRO A;  4GUL A;  2Q8O A;  3HEI A;  4MGY E;  4GAL A;  5DG2 A;  3ZDV A;  1PVC 1;  2P34 A;  4IL7 A;  2RM2 1;  4IE6 A;  4JZR A;  2JDU A;  3BU7 A;  4UT5 A;  1NA1 B;  3L2Y A;  4YG3 A;  4AI3 A;  1ZRR A;  2A6W A;  3N7J A;  3POS A;  2GU9 A;  4AHY A;  2HWC 1;  3P6B A;  4QMA A;  4YM1 A;  4YRD A;  5FZ4 A;  3O0W A;  3OPW A;  4Q4W 2;  5T5L A;  5J7M A;  4EE2 A;  4XQW A;  1H9W A;  4LUM A;  4HLT A;  4LBJ A;  2HKX A;  5BNO A;  4BCU A;  3CJI A;  5DAP A;  2PYT A;  5CKQ A;  2FDJ A;  4B7K A;  4QPG B;  1NE4 A;  4L9B A;  2ZHN A;  1WCD J;  1C4R A;  4I2O A;  3DYP A;  3JBG 1;  3VKF C;  1U5Z A;  4N9H A;  3OG2 A;  1YQ2 A;  2XVK A;  2RR1 3;  4TXW A;  3LAG A;  4V1P A;  5FZF A;  1CR7 A;  4RGK A;  3WVJ A;  2HWD 2;  2PHU A;  4NWW A;  2D93 A;  2ZGL A;  3K2O A;  3HNB M;  4BLJ A;  3C2U A;  2W91 A;  4ZU4 A;  2VMI A;  2VM9 A;  3OYW B;  1AR8 1;  1RUE 3;  4QGM A;  5FP7 A;  3LWC A;  4G3Y C;  2MEV 1;  3NNF A;  2HWE 3;  3P3N A;  5ANQ A;  3VHN A;  2C9K A;  3MF9 A;  1S1A A;  3VBO B;  1F4H A;  2X10 A;  2F4L A;  3GZE A;  2C0Z A;  3I4I A;  4HBN A;  3ROU A;  5HCA A;  5J37 A;  3FUQ A;  1HRI 3;  5FZ9 A;  3VBF A;  1W2T A;  4CU7 A;  2Y26 A;  4XIO A;  5FZC A;  4AGG A;  1JUH A;  1SEF A;  4FPL A;  3IDA A;  2BPA 2;  5AC9 3;  1N1T A;  3ZLI A;  1QF3 A;  1R1A 1;  5C6C A;  1RUH 2;  4RFT 0;  3ZFF C;  4YZ4 A;  1Q56 A;  3KV6 A;  1A78 A;  2BRT A;  5T52 A;  1JZ4 A;  2CAV A;  4WM8 C;  3VDB A;  1GOF A;  3DPR B;  4LIV A;  5A7O A;  4ISQ A;  2CV6 A;  2WNU C;  4QM9 A;  1LR5 A;  2ET7 A;  4BZ4 A;  1JU3 A;  4U36 A;  4BYY A;  2GMM A;  2EXI A;  3N9P A;  1WLW A;  3VGI A;  1XNC A;  4FP3 A;  1M06 G;  5FK7 A;  1EAH 2;  3H8U A;  4RS5 B;  2BNO A;  1UYY A;  1G9B A;  4FOY A;  2O8Q A;  3H8X A;  3HT2 A;  4P02 B;  3ZVX A;  3O1T A;  4XJU A;  1RUC 1;  2G4I A;  3C7F A;  2UY8 A;  2JEC A;  1TMF 1;  4GIQ A;  4YZ2 A;  3MID A;  4NPL A;  1G9D A;  4JAA A;  4E4Z A;  4GB3 3;  5F3C A;  4LA3 A;  5DQ0 A;  1PGS A;  4QHB A;  3GBF A;  4XUN A;  2D98 A;  3NAP A;  4LEJ A;  5CIR A;  5FYM A;  4FAG A;  5BNN A;  2R06 1;  4Q4Y 3;  1RMU 3;  3UYJ A;  1ULG A;  5FKC A;  4AXO A;  3AMP A;  1WMF A;  2EVX A;  1H30 A;  4Q4X 3;  2XKP A;  1VRH 2;  1DQ2 A;  1RIR A;  2A3Y A;  4YW1 A;  4AI9 A;  5A1L A;  4PBO A;  4AEK A;  3TOJ A;  2WO3 A;  1EV1 3;  3FBY A;  3RI9 A;  5HCF A;  5JMC A;  1VBB 2;  4MGT A;  3AK0 A;  5FO7 B;  2QQP A;  2VMF A;  1LOG A;  1JYX A;  2WBK A;  1GBG A;  3N7K A;  1D4V B;  1WW6 A;  3A21 A;  3OEB A;  4P00 B;  1KRI A;  4LOR A;  1RC6 A;  3SH3 A;  5DZF A;  1GWL A;  3ZYH A;  1IS4 A;  4XEZ A;  1RHI 2;  1DZQ A;  1IG3 A;  1LOD A;  2OQ7 A;  3I3B A;  3MLL A;  1QNY A;  3ILN A;  2QZ2 A;  3PU8 A;  4GKY A;  2Y6J A;  3PJY A;  3AL6 A;  2XJR A;  4W6Y A;  1C1L A;  5FZL A;  1DGR A;  2XGX A;  3FN9 A;  2FHR A;  4I01 A;  4NRO A;  5FMO S;  4GWM A;  4AFA A;  2B5H A;  2RS5 1;  2VUJ A;  3ZOI A;  2NM1 A;  4GMP 0;  3I59 B;  5C8C C;  1OF4 A;  2D5H A;  4IV3 B;  3PTY A;  2XML A;  4KMQ A;  3VZO A;  5AC9 2;  3HBK A;  2A7A A;  2VTF A;  2WNE A;  2Z2S B;  1EPW A;  2FQP A;  4HMZ A;  5H9R A;  4CCM A;  5FFO C;  2XJP A;  1VMJ A;  2Z42 A;  5B4N A;  1KIT A;  1QDO A;  4NVP A;  1MZF A;  4IEW A;  3VBH C;  4E9K A;  2RG4 A;  3E6C C;  1OA3 A;  4OHZ A;  1AL0 G;  3J8F 3;  4CEW A;  4ATF A;  1SBF A;  3DN7 A;  3LCP A;  4C90 A;  3WR0 A;  4LKS A;  2PLV 1;  2A6Y A;  4QX1 A;  1JYW A;  2PQQ A;  2VBP A;  3ACF A;  4MGS A;  2VW0 A;  1Y7B A;  1EPZ A;  3KM5 A;  3JD7 2;  3RSJ A;  5F39 A;  2D6L X;  4CVU A;  3KQ4 B;  4WVM A;  3I3M A;  1LGN A;  5LA2 A;  3FJS A;  3K4Z A;  1FX5 A;  5GZF A;  3FC0 A;  2EIB A;  4Q4V 1;  2XXZ A;  1LEN A;  4XFF A;  3WNP A;  4BDV B;  4EN7 B;  2JDP A;  2VW1 A;  1PO2 3;  5E1R A;  5FMB A;  1R09 3;  2DFC A;  5FZI A;  4X8N A;  4NOT A;  2JB4 A;  3I3E A;  3WDV A;  1AL2 3;  2XVG A;  2XWJ B;  1UZ0 A;  4YVW B;  3FE5 A;  1PIV 2;  4R4X A;  4AQ2 A;  1FNY A;  4NR1 A;  4COU A;  4WVW A;  4Y5Z 0;  3NST A;  3J7M A;  1O3Q A;  1SLA A;  2ILM A;  2KXL A;  1S0J A;  4Y5T A;  4PIY A;  4CE8 A;  3ZN5 A;  2BBV A;  2VOV A;  3AP9 A;  3E6B A;  4I09 A;  5FDB A;  5D1I A;  1UN1 A;  1MS8 A;  1N1Y A;  1WD3 A;  2WII B;  3PIJ A;  4XQ4 A;  1ZBE 3;  2YBK A;  5I8T A;  2J1E A;  4DXZ A;  2CL2 A;  1PMI A;  5J3U A;  5FYH A;  3GJB A;  4QPI C;  2E9Q A;  2FDF A;  2ZCW A;  2JG8 C;  5C3R A;  1VBD 3;  3ACH A;  4AAP A;  5CFC C;  4OHY A;  2IFR A;  2W2I A;  1A8M A;  5F8P A;  2ATF A;  3MUY 1;  3W21 A;  4OHX A;  4XFC A;  5F6K A;  4UW6 A;  5KHI A;  2J1T A;  2JG9 A;  4H14 A;  4NO4 A;  3O12 A;  4NPR A;  2FCV A;  3KGZ A;  2IXJ A;  2Y33 A;  2A5Z A;  2IXH A;  2DCZ A;  3U37 A;  2F4P A;  3OGG A;  5JCT A;  1ZZ8 A;  2RMU 1;  2VZQ A;  4OVE A;  2WFF 3;  3LE0 A;  1Z7S 1;  1XOY A;  4R9A A;  1AHS A;  3WUC A;  3OY8 B;  4P08 A;  3ETQ A;  1X82 A;  3LEK A;  4BH9 A;  2ZA9 A;  4UFI A;  3RJ2 X;  4WVV A;  4HN0 A;  1PVC 3;  1ACC A;  2E51 A;  2QKD A;  3FFQ A;  2R04 3;  2TNF A;  3AX4 A;  3ZYF A;  4R8H A;  4K3U A;  1J84 A;  4ZHN A;  2W1U A;  3NQH A;  4L97 A;  4QPG C;  4BIF A;  2IFW A;  4PT6 A;  5EJ3 A;  3ZIW A;  1QQP 1;  1U0A A;  3AMM A;  1HXS 1;  2YGL A;  1JOB A;  4XDO A;  1UIJ A;  1V9U 1;  4S2F A;  4YPJ A;  4PBP A;  3SMH A;  1OQE A;  4BIS A;  3ZX7 A;  2I07 B;  4J1X A;  3RDI A;  3THT A;  4M0N A;  2E33 A;  1W99 A;  4PJY A;  4P9J A;  1YFY A;  4EZH A;  4QKF A;  1DYP A;  2W5F A;  5CAZ A;  1NE6 A;  5GZE A;  1ZNP A;  2V5D A;  3VZL A;  4Q0S A;  4Y5S A;  3WD5 A;  4BIO A;  1AL2 2;  3UJO A;  2CWM A;  4AVS A;  1QHD A;  2P3I A;  5JIA A;  1E57 A;  3A0K A;  1H2K A;  3JBG 3;  2R1D A;  4IND A;  1ZRE A;  2CTV A;  3ZXL A;  1F8V A;  4XJA A;  2ZZQ A;  2EIC A;  5FY9 A;  4CDX C;  4M3C E;  3RWN A;  3ZSE A;  3M3Q A;  4K40 A;  4OHV A;  1RXF A;  4CCE A;  4XAB A;  4CDU C;  4HK9 A;  5ACA 2;  2VQ0 A;  1NZC A;  3ZXK A;  2JDM A;  3LFI A;  3M3I A;  3X29 B;  3BUC A;  3W20 A;  2YDE A;  4QU2 A;  3F95 A;  1S55 A;  2WT1 A;  3LKJ A;  4IEU A;  4KWK A;  1J3P A;  2OQ6 A;  1RXG A;  2OZ6 A;  3J7N A;  2CYF A;  2XUE A;  2QQM A;  3DL3 A;  3ZFE B;  1LU1 A;  4GZ9 A;  2BGO A;  2NZ9 A;  4X6R B;  1F9K A;  1MPX A;  4OYU A;  4ASK A;  5FO8 B;  4FTS A;  3HBZ A;  2EIG A;  3DPR C;  3MIG A;  1OF3 A;  1X50 A;  3T2O A;  3VBR A;  4U2A A;  1SFP A;  5JSO A;  4HSL A;  3VZN A;  1LU2 A;  5A33 B;  3TEZ A;  3MHZ A;  4GWN A;  5T5J A;  4HOO A;  1KEX A;  4JGZ B;  4FPF A;  3RZL A;  3KHC A;  4IET A;  1XYN A;  1NCR C;  1O59 A;  1GZW B;  1RIN A;  1TME 1;  5EYX A;  3H8O A;  4BWO A;  1B35 B;  1NXD 1;  2DCJ A;  3BGA A;  4JTN A;  1PVC 2;  2WIN B;  4FFF A;  2RM2 2;  3PJQ A;  1VAL A;  2OUH A;  3Q8A A;  4MXV A;  2HWC 2;  3DUI A;  4RGA A;  4CPB D;  1ZBA 1;  2QFE A;  1S4C A;  1OA2 A;  2WLQ A;  3QLQ A;  4P14 A;  3AFK A;  1GSL A;  1V6L A;  2V09 A;  1TMF 3;  1JXN A;  1Y9M A;  4ITC A;  2VJX A;  2XHN A;  2O14 A;  2JE7 A;  5C5T A;  4LK6 A;  2P4E A;  2VZS A;  1LOB A;  2VNG A;  2VQT A;  5KC5 A;  3J7L A;  4RQP A;  2X53 S;  2VUC A;  4P5H A;  4NAO A;  3MIH A;  2Y6K A;  1IPJ A;  5FZ8 A;  2B45 X;  2XHK A;  1YXW A;  3JBG 2;  2XB6 C;  4IE4 A;  5EFU A;  3NAP C;  4Q0V A;  1H2N A;  4TLG A;  4Y22 A;  1A34 A;  4URT A;  5BYN A;  2VME A;  4LBM A;  1CN1 A;  3B5L B;  5CAD A;  3P5B A;  2HJI A;  1NLR A;  5BXX A;  2VCB A;  4DQA A;  5CA6 A;  1B09 A;  2YU1 A;  3AM2 A;  4IV3 C;  2X5I C;  1AR8 2;  3AKS A;  1GP6 A;  2MEV 2;  2EAL A;  5FPB A;  1OVP A;  1YNA A;  1LHO A;  1GP4 A;  3MF6 A;  5FY8 A;  1MQT B;  3TYJ A;  3BTX A;  4UBG A;  1IKP A;  1JYI A;  2QQN A;  2R49 A;  5IVB A;  2ZGR A;  3D8C A;  1UX7 A;  3B9C A;  3PVO A;  2RS5 3;  5KHK A;  1FPN 3;  1E5I A;  3LEI A;  4NE9 A;  5F3E A;  2RE9 A;  4LBK A;  1R1A 2;  5KXD A;  3HQX A;  1BBT 3;  3ME2 A;  4YVS A;  5LEJ A;  1C28 A;  2DU1 A;  4CXY A;  3OUI A;  1AR6 1;  4D7Y A;  1RUD 3;  4I3P A;  1W06 A;  2OPW A;  3K3N A;  5HCB A;  3RRD A;  4FQ4 A;  1HIX A;  2G9F A;  4CDW A;  4L11 A;  1DG6 A;  2QNK A;  4B4P A;  4WM7 B;  2ZAA A;  1K5M B;  2WNV B;  1DP0 A;  2VL4 A;  3UL2 A;  3WNM A;  1QH7 A;  2VH9 A;  2QVS B;  3H42 B;  2A75 A;  3WNL A;  3GYD A;  1RUC 2;  3MFA A;  2EIE A;  3FLR A;  1TMF 2;  1URX A;  4YVW C;  2VR4 A;  5A1A A;  2VZO A;  1OUX A;  4GQ7 A;  4AAX A;  1GU3 A;  5A3M A;  1QOT A;  4MO3 M;  3WW4 A;  3KHB A;  1FOD 3;  2RJK A;  4MET A;  3UNP A;  4NID A;  4UF0 B;  1WMX A;  3AZW A;  2R06 2;  2ZX0 A;  1Q8V A;  4GWI A;  4XJZ A;  5A3U A;  2ZEY A;  3RFR A;  2Q8C A;  5BPX A;  1PO1 3;  3WDU A;  4FSJ A;  4V2V A;  4FPE A;  2GNT A;  2YXS A;  4LHL A;  4BA6 A;  4YZ3 A;  1CAX B;  1LJ7 A;  4COY A;  1OKO A;  5JPN B;  4O65 A;  4HK8 A;  5DAW A;  1K42 A;  1VRB A;  2BOI A;  3TBD A;  4OI2 A;  2VCM A;  4GJY A;  2BWA A;  1HQN A;  2Y6G A;  3UKN A;  4BK4 A;  2I2S A;  4BE3 A;  4L99 A;  1SPP A;  3IIA A;  4KGG A;  1JS9 A;  3IPV B;  3WQB A;  3IWZ A;  3M2M A;  1WW4 A;  3OF1 A;  1CD3 G;  1VR3 A;  3J4U H;  1W6M B;  1GMM A;  1QDC A;  4LR4 A;  4Y20 B;  4NJ4 A;  3POB A;  4ASL A;  4IDZ A;  1LUL A;  5JXJ A;  1OA4 A;  2Q8E A;  5GLU A;  3SH5 A;  3M3E A;  5DDJ 3;  3R0R A;  2A3W A;  2R7E B;  2AEZ A;  3OBR A;  4DIN B;  5IVC A;  2ZGQ A;  2RS5 2;  2P6H A;  2YB7 A;  1MS3 A;  4Z92 B;  3AMH A;  3ZN6 B;  4DO0 A;  5KWR A;  2C4X A;  3BN6 A;  3H3U A;  3UKT A;  1MVE A;  4N43 B;  2RR1 1;  2ZS6 B;  2W0X A;  3BI3 A;  1SFN A;  4HET A;  3OD4 A;  1SG3 A;  1NQJ A;  1XBF A;  2VNO A;  1Y9Q A;  1MZ5 A;  4PI0 A;  5LEK A;  2GAL A;  1T2X A;  2JG9 C;  1Z7S 3;  5T50 A;  1UIK A;  3VZK A;  4WZF A;  1RUE 1;  3RZG A;  2BV4 A;  2PLV 2;  5KR7 A;  5JXH A;  2HWE 1;  1WGP A;  4YGC A;  3ZFF A;  1S0D A;  5M0T A;  2P3J A;  4XUT A;  2NYY A;  5FPA A;  4D7S A;  5FOJ B;  1HRI 1;  2ARX A;  1DF0 A;  4WM8 A;  2RS1 3;  2TBV A;  4GAZ A;  3HOB A;  4AG4 A;  4Q4V 2;  1GKB A;  1CX1 A;  4JTO A;  3UGF A;  5IHR A;  1ENX A;  1F4A A;  3VD9 A;  4KWU A;  3WQ0 A;  3QBQ A;  1NYW A;  5FZB A;  3VDA A;  4XF9 A;  1I1E A;  4YM2 A;  3RZK A;  3I2O A;  1OI6 A;  3MV0 1;  3A23 A;  3OBT A;  4QXK A;  2OZJ A;  3VD3 A;  3IMN A;  4D8M A;  1WCS A;  4L8Q A;  2J22 A;  4TSV A;  1JUI A;  1GQG A;  1LHN A;  1MEC 3;  2VMC A;  3LDR A;  3NJY A;  1R08 3;  4MVT A;  3UV9 A;  2FDG A;  3ZFE C;  4NIG A;  2UWB A;  2GC0 A;  5KHJ A;  1ODM A;  2WDB A;  2BNM A;  1ND2 C;  4QDQ A;  1N47 A;  4XJ9 A;  4E8C A;  1BCX A;  4UXA A;  1UOF A;  1UYP A;  2A3X A;  4GB3 1;  3VHR A;  5ANN A;  5CKN A;  1CJP A;  1KDM A;  2KA3 A;  4AOC A;  4Q4Y 1;  1RMU 1;  3RQ0 A;  1W8Z A;  3S0M A;  4TYS A;  1V6M A;  1DZT A;  4HT1 T;  4LUL A;  5F2S A;  1DCS A;  4LHK A;  1G6N A;  4Q4X 1;  3WHT A;  2ADD A;  1AYN 3;  3KGL A;  3I54 A;  1CIW A;  1Y43 B;  3B01 A;  4LQR A;  5CB7 A;  4GMP 3;  3ZIX A;  1TQ5 A;  1XSR A;  1OD3 A;  1EV1 1;  3WV6 A;  4G4F A;  2DCY A;  3POW A;  4BXS V;  3LEG A;  4D94 A;  1YO8 A;  2GDF A;  2ZBJ A;  4CCL A;  4QD2 A;  4YG6 A;  5C9A C;  3MLJ A;  5CNA A;  4CPB A;  5JOX A;  3NNM A;  1FYU A;  5FQ0 B;  2RMU 2;  5I0D A;  1W6Q B;  4BQW A;  1Z7S 2;  3B9I A;  3FLT A;  5C8C A;  1JW6 A;  2JKB A;  3WG4 A;  2EXH A;  1JHJ A;  3V0A A;  2SBA A;  1ZRD A;  2D97 A;  3PVB B;  1QWR A;  2QQI A;  3GBW A;  3BIE A;  5FYC A;  4A45 A;  1OHF A;  3VBH A;  3BCW A;  4AVB A;  5CZK A;  1RUJ 3;  1YI7 A;  5DG1 A;  3NV4 A;  3WLU A;  1QQP 2;  4YM0 A;  1HXS 2;  2RS3 3;  5I0T A;  1ZZB A;  3WG1 A;  5LY1 A;  2FD8 A;  1V9U 2;  3HN3 A;  2YG0 A;  3GF6 A;  5CG8 A;  2KM2 A;  3ALQ A;  5I0R A;  1D0G A;  1KFX L;  4C0B A;  2P3Y A;  1W05 A;  5FPL A;  1W2O A;  3J8F 1;  3T4H B;  2VNR A;  1GNY A;  2YFZ A;  3ZXE A;  2BUK A;  1HJG A;  4XTM A;  2ZX3 A;  5F5C A;  3BYW A;  1LKN A;  2YC4 A;  4IEO A;  3FFZ A;  5JIU A;  2DVD A;  2WRA A;  1ZX5 A;  2R32 A;  1SBE A;  4UW5 A;  4KWL A;  4NRP A;  5FWE A;  2NP0 A;  2PQS A;  3AMQ A;  5ERL A;  4DZG A;  1Q5O A;  1XU1 A;  1HRV 3;  3OBA A;  3UJQ A;  3WHU A;  5LK5 A;  4FAH A;  1BK1 A;  2J1A A;  3WP4 A;  3ZXJ A;  4EV0 A;  2DF7 A;  2QZ3 A;  4LO4 B;  3AVS A;  1PO2 1;  3M4F A;  3J9S A;  5LRR A;  4XUQ A;  1ULF A;  4H7L A;  1R09 1;  5LBE A;  1LRH A;  1X9T A;  4YW4 A;  3KVB A;  5F37 A;  1C8N A;  1V00 A;  2PEL A;  1CAU A;  1IHM A;  2X29 A;  3WQ1 A;  2JG8 A;  5JZG C;  5JXI A;  2WZP P;  1K5M C;  4GWJ A;  5KXC A;  4OMC A;  4FCA A;  1ND3 B;  4HPK B;  1UY2 A;  2AR6 A;  3SEP A;  3RJR A;  5FRA A;  2FMY A;  1PZ9 A;  1QH6 A;  4IV1 B;  1ZBE 1;  2HBT A;  4MZU A;  4ZPI A;  4RL7 A;  5F3I A;  1YJK A;  1TME 2;  1VBD 1;  2VY0 A;  4XMA A;  1OPM A;  1DLC A;  3T08 A;  5A80 A;  5D8A C;  1DBN A;  4XXA A;  2DFB A;  4JDO A;  3LPF A;  5EV7 A;  1RB8 G;  1HX6 A;  4K20 A;  5FY1 A;  5FRE A;  4HZF A;  4A6O A;  1JZ8 A;  4YVS C;  3SKV A;  2W1S A;  3NKT A;  1UKG A;  3III A;  1ZBA 2;  4DPN A;  1F15 A;  4AI0 A;  2XKO A;  1N3Q A;  2VAU A;  4MGZ E;  4QB2 A;  5IFP A;  3WDT A;  4XFB A;  4GKX A;  5F32 A;  3H1W A;  4UAP A;  2VGD A;  3DYM A;  1WUV A;  4H55 A;  1DGL A;  1OSG A;  3O1U A;  3NNJ A;  1H9P A;  1LES A;  2WFF 1;  3NL1 A;  4BQ3 A;  4QPG A;  2WNO A;  1HKD A;  2N7G A;  2AZ5 A;  2ZKN A;  3PUR A;  3S5Q A;  1LHW A;  1UZY A;  3S6P A;  5FUP A;  2ZHK A;  3K46 A;  2R04 1;  4UBH A;  1PZ8 A;  5FO9 B;  2WAA A;  1W90 A;  2JWP A;  2C9A A;  2WQ4 A;  5E89 A;  3WDY A;  2ARE A;  4FI9 A;  5FUI A;  3VV1 A;  4A4A A;  2BP6 A;  3OEA A;  2XBO 3;  3ASI A;  1VAV A;  1C8M 1;  1V6I A;  2W1W A;  4IE5 A;  1JYC A;  2OS2 A;  4QX0 A;  4ZXK A;  3UGG A;  3USU B;  3VKN A;  4EQV A;  2DVF A;  3KSC A;  2W92 A;  3LZZ A;  5JOZ A;  1AXY A;  2CDP A;  4N43 C;  4CDX A;  2WO2 A;  4K21 A;  1O8P A;  4BLI A;  1J59 A;  1VJ2 A;  2R07 3;  2JIC A;  2ZX2 A;  5FJK A;  2A73 B;  4QM8 A;  4CDU A;  1PMH X;  2QQL A;  3MBW A;  1RUI 3;  2WQ8 A;  2V4V A;  3W58 A;  2AEY A;  3KWV A;  2R16 A;  4CP9 A;  1YUD A;  1O6U A;  5C4W B;  4BQ5 A;  1OQ1 A;  1MR5 A;  1XNT A;  1IS5 A;  2UWC A;  2F17 A;  1HB4 A;  1JZ7 A;  3VL9 A;  4YG0 A;  2VEC A;  5H9S A;  4OCT A;  4FO9 A;  3E6D A;  3KS7 A;  4IQP A;  4XIL A;  4QX8 A;  4KNC A;  4N53 B;  4JGY B;  2QDR A;  3HR9 A;  4NII A;  2O0O A;  2WZR 3;  3WOG A;  4KU7 A;  2ZJC A;  3DPR A;  5FMD A;  4F3J A;  3VDD B;  1F2N A;  4Y3O A;  2VQA A;  3DYO A;  2VNV A;  1NXM A;  3I2J A;  3T2P A;  4D3W A;  5JLV A;  3OGR A;  5JR7 B;  1QJY 3;  4XIK A;  5IUQ A;  2BDR A;  3C7G A;  5A3O A;  3NO8 A;  5CG9 A;  5J48 A;  2NPI A;  1ODN A;  1IQA A;  3VDC A;  5HCH A;  1NCR A;  3NW4 A;  1G8W A;  2VE1 A;  4IW3 A;  2ZHM A;  3BAL A;  1COV 3;  3VHP A;  2YMZ A;  4ISR A;  3K48 A;  4I0A A;  4YGD A;  2ET1 A;  5C3S A;  1C5I A;  1NY7 1;  3HN1 A;  3PUI A;  4LIT A;  5KXB A;  1FNZ A;  5LWB A;  3PHM A;  1KXG A;  1HB1 A;  1NCQ C;  1O4Y A;  1FV2 A;  2C5D A;  2WT2 A;  2IXC A;  3R6S A;  5A3N A;  5BNO B;  1G7Y A;  1CWP A;  3G7D A;  3OGS A;  3JQW A;  4JHZ A;  3D82 A;  4W50 A;  5IK7 A;  5A6Y A;  3BTZ A;  2EXK A;  1XQN A;  3L2H A;  4SBV A;  1Q8Q A;  4CU8 A;  3LOB A;  2VZU A;  4EN8 B;  2E26 A;  5FY7 A;  3AFG A;  5B4X A;  4P9W A;  3PL0 A;  1GQH A;  3DXT A;  4NHM A;  5GLV A;  3T0A A;  2VMD A;  1AJK A;  2ADE A;  4B7E A;  3ATG A;  4IE0 A;  2VUA A;  1C3H A;  3AVR A;  3TEX A;  4LA2 A;  4RA0 A;  4FQZ A;  2V4A A;  2XLG A;  4Z07 A;  4ASM B;  2D6N A;  2JDA A;  4IEX A;  5JWP A;  1WKY A;  4OZX A;  4CCO A;  4HSJ A;  4X6Q B;  1W0O A;  1GAN A;  4DNY A;  1YQ6 A;  5A32 A;  4OUE A;  1W6N A;  2CHH A;  4LMF A;  3H50 A;  2I74 A;  5FZM A;  1EUU A;  1GOH A;  1YIP A;  3I59 A;  4IV3 A;  3WF4 A;  2X5I A;  3R4D B;  4ONU A;  4WZC A;  1GUI A;  1H4G A;  5BY5 A;  4R52 A;  1POV 0;  2RR1 2;  3VBF B;  4CCJ A;  2LM3 A;  1SDW A;  4COZ A;  5FR3 A;  2Y6L A;  2Z4F A;  3FHA A;  3OGJ A;  4PCR A;  1ZA7 A;  5IW0 A;  5L36 A;  1LAJ A;  4CDQ C;  3JB8 A;  1RUE 2;  4FPH A;  1QJU 3;  2OKX A;  3KF5 A;  1DDL A;  1JTZ X;  2HWE 2;  3RI8 A;  1AR9 1;  2RDQ A;  3RS6 A;  2ZGM A;  2ZGN A;  3AKQ A;  2Y0I A;  4JKK A;  3ZKY A;  3DGT A;  3ZPO A;  1HRI 2;  1SCS A;  3THC A;  4QWN A;  2E63 A;  3CHX A;  3T0D A;  1W0P A;  1YQ5 A;  2XL7 A;  1FPN 1;  1F31 A;  3VL8 A;  5JXG A;  4QX5 A;  4XAC A;  4MH0 E;  1WW7 A;  1X8M A;  4XF4 A;  1BBT 1;  4DRV A;  5FXW A;  2VZT A;  1XC6 A;  5F5Q A;  1RUD 1;  4JKM A;  1DYO A;  1OQD A;  4LHS A;  1HB2 A;  3ZFG B;  1XE7 A;  2GZW A;  3NWK A;  1UOB A;  3ACG A;  4QQ2 A;  2ZHL A;  1W2N A;  3PU3 A;  3OD0 A;  4LJH A;  4GH4 B;  4O61 A;  4Q0P A;  1OC1 A;  2Y0O A;  4KBZ A;  4YVW A;  5L73 A;  3TN9 3;  4AYU A;  3S57 A;  5IAV A;  1X9P A;  4XFH A;  3K77 A;  2JIG A;  4XDP A;  3LSD A;  1JN2 P;  1WW5 A;  2JDY A;  3HPN A;  2X05 A;  3PLQ A;  4A3Z A;  4B1M A;  4OUL A;  4BQ2 A;  1UXZ A;  3I49 A;  1XSQ A;  3DKW A;  2JXA A;  2JDN A;  3Q8F A;  5FBJ A;  2GNM A;  3N9N A;  3FHQ A;  3BOW A;  2XLF A;  2YZ4 A;  2OW4 A;  4GB3 2;  1ENR A;  4Y24 A;  1NOV A;  2DBN A;  4YAR A;  1EY2 A;  1FOD 1;  4CCC A;  4P5Y A;  3CL1 A;  1RMU 2;  4Q4Y 2;  1GFF 2;  4YW3 A;  1FMD 3;  1LOF A;  4QX2 A;  4XXP A;  4K7J A;  1BHG A;  1PO1 1;  4AFM A;  4HKW A;  4IV1 C;  4Q4X 2;  4LBO A;  2C24 A;  3F2Z A;  3PUQ A;  4YFW A;  1CGP A;  3Q9O A;  3AYA A;  4K8R B;  1QJX 3;  1EV1 2;  3MW4 A;  4Z8B A;  3ZR6 A;  4URA A;  2PHF A;  1MZ6 A;  1CON A;  4HXC A;  3SQO A;  4LE4 A;  4MXW A;  4AVT A;  4LPL A;  3HAG A;  1VBE 3;  4AVV A;  1QJE A;  3ETP A;  2A6V A;  2CGO A;  3U11 A;  1ULP A;  4AEM A;  2FZ2 A;  3ZYB A;  4XTP A;  1ENQ A;  4ATE A;  2XG3 A;  1QOS A;  3AKP A;  1OT5 A;  5BNN B;  1QIQ A;  4KQ7 A;  5KBF A;  1AR7 3;  1EYB A;  3T2Q A;  3KCX A;  5DDJ 1;  3VBU C;  2XOM A;  1ASJ 3;  3DEM A;  1GWK A;  4MGI E;  3MIF A;  1KD7 A;  2Y8K A;  4FFH A;  3AP7 A;  1BQP A;  1LHU A;  5FBZ A;  1S2E A;  1UAI A;  1LB2 A;  2VG9 A;  1QOO A;  5GZC A;  3LA7 A;  4WVM B;  1XXN A;  1NA1 C;  1UQX A;  2W95 A;  2HH9 A;  3S7E A;  4YW6 A;  4DEV A;  1XYO A;  2GAU A;  5A3T A;  4E8D A;  4AW7 A;  2WJS A;  1KFU L;  1VBC 3;  1XPW A;  3J8F 2;  3H8R A;  2ZOE B;  2VZR A;  3EQE A;  4DUW A;  2UWA A;  1UMI A;  1HB3 A;  4C1X A;  2BOJ A;  2QUO A;  5FLH A;  2B42 B;  2Y60 A;  5IAT A;  3TEY A;  2GND A;  2B4K A;  2Y6F A;  4IER A;  2RS1 1;  2BZD A;  3GXU A;  1I6X A;  3VB9 A;  1PK6 B;  1O4T A;  5IVJ A;  3USS A;  2ERF A;  1C8M 3;  1AYM 3;  3OTF A;  5F2W A;  4RHV 3;  2DU0 A;  2ZAB A;  1PO2 2;  5GLZ A;  3ZFE A;  4XPV A;  2D43 A;  1R09 2;  3U78 A;  2XQR A;  4TZD A;  2X8K A;  1ND2 A;  2WWS A;  3MO4 A;  5B2G B;  4JGY C;  4M3C B;  3AJZ A;  3B69 A;  4O7X A;  2NLR A;  3FHI B;  4P9I A;  4UW3 A;  1SFY A;  2A70 A;  3ES1 A;  1MEC 1;  1PX3 A;  2W87 A;  1QGL A;  2ZEW A;  4Q1P A;  1R08 1;  4W6W A;  3V56 A;  3IDE A;  5HBA A;  1CAV A;  3HJR A;  5A33 A;  4AE2 A;  1GYK A;  1U5Y A;  1HJF A;  4NHY A;  1BVV A;  3VBO C;  1UYX A;  1XE0 A;  5IAX A;  5K0U B;  1ZBE 2;  3K4D A;  1GZW A;  5F7U A;  1LOA A;  1ZVF A;  2D3P A;  3P3P A;  1FAT A;  1VBD 2;  3VBS B;  1B35 A;  4FFI A;  3ZXF A;  5I0S A;  3WP5 A;  2R1B A;  3ENR A;  3MYX A;  2W08 A;  3WNK A;  1UOJ A;  2FCU A;  3ZYG A;  1HN0 A;  2QTW B;  5C9A A;  5FXZ A;  2WAO A;  3HMY A;  1YI9 A;  1AYN 1;  5A1F A;  3PME A;  1WWY A;  5IK5 A;  2CAU A;  4GMP 1;  5I8S A;  1LEM A;  3MGU A;  4YFZ A;  1UYZ A;  4CP0 A;  1C57 A;  4YM3 A;  1DIW A;  1KQR A;  3AB0 A;  3MV1 1;  3DF0 A;  4NRM A;  4RFR B;  3WW2 A;  1J83 A;  4RS5 C;  3D0S A;  3EJK A;  3RG0 A;  1HLC A;  1TNF A;  5CBL A;  5APA A;  4QX7 A;  4XF1 A;  2WFF 2;  1OBN A;  5ABJ B;  2J42 A;  2DBI A; 
#chains in the Genus database with same CATH homology
 4QAW A;  5JXH A;  1CZS A;  4HG6 B;  5HXM A;  4XUT A;  4MOA A;  4Z2A A;  2QQK A;  3NNG A;  4M4P A;  1WCQ A;  1JZ6 A;  3HOB A;  4AG4 A;  4XUP A;  1CX1 A;  5IHR A;  2VOT A;  2QBX A;  1F4A A;  3VD9 A;  4KWU A;  3I97 A;  5JUV A;  1NX9 A;  3VDA A;  2VC9 A;  3MV0 1;  2CDO A;  3A23 A;  3VD3 A;  4D8M A;  3HEI A;  3E1F 1;  4KI5 M;  4XUR A;  2J22 A;  2J1U A;  2VMC A;  3ABZ A;  2W46 A;  2WDB A;  3P6B A;  4QDQ A;  4E8C A;  2W3J A;  3EYP A;  2WUH A;  3K4A A;  4JX0 A;  2B9V A;  2HYX A;  3NRU A;  3C7H A;  2DCK A;  3D3A A;  4LQR A;  5J1X A;  4MGQ A;  1OD3 A;  3DYP A;  3W5N A;  1P8J A;  3OG2 A;  4BXS V;  1YQ2 A;  3LEG A;  4TXW A;  1NKG A;  3JXS A;  3K75 B;  2LW8 A;  4XUO A;  5I0D A;  3VD7 A;  3HNB M;  2W91 A;  2VM9 A;  1JHJ A;  2C9K A;  4JKL A;  1F4H A;  2X10 A;  3UES A;  3I2K A;  2QQI A;  4A45 A;  4CU7 A;  5CZK A;  4RYD A;  3IDA A;  4ZY9 A;  2ORZ A;  3HN3 A;  3I2G A;  3WF0 A;  2YG0 A;  4CU9 A;  2J1R A;  4CU6 A;  1K12 A;  1JZ4 A;  3VDB A;  1GOF A;  1GNY A;  2YFZ A;  1JU3 A;  2J1V A;  2YC4 A;  1UYY A;  2WN3 A;  4P02 B;  5EJZ B;  5C70 A;  4DEQ A;  3C7F A;  2XON A;  2PQS A;  4ZZ8 A;  3OBA A;  4XVH A;  5DQ0 A;  2LS6 A;  2J1A A;  4UI9 L;  5JR2 A;  3CIH A;  4XUN A;  3T09 A;  4ARY A;  4DXS A;  3FL7 A;  4ZZ5 A;  4XUQ A;  2VQU A;  4DUX A;  2VZP A;  3EB7 A;  2WZE A;  5G04 L;  1W9T A;  5JXI A;  2WO3 A;  4GWJ A;  3ZM8 A;  2VZ1 A;  2VMF A;  4OMC A;  1JYX A;  1UY2 A;  3SEP A;  2WBK A;  3A21 A;  3OEB A;  4ARX A;  2WZ8 A;  4P00 B;  1TG7 A;  3I3B A;  3T08 A;  1DLC A;  1K3I A;  2Y6J A;  3LPF A;  5LCW L;  5C7G A;  4A6O A;  1JZ8 A;  3FN9 A;  3SKV A;  2W1S A;  3CMG A;  4D0Q A;  3III A;  2BBA A;  1I5P A;  1OF4 A;  4KMQ A;  4QB2 A;  5IFP A;  4OZO A;  4UAP A;  3DYM A;  1HN1 A;  2VTF A;  3CQO A;  5B4N A;  3A22 A;  2ZEZ A;  3VD5 A;  1H6Y A;  4LKS A;  4QX1 A;  1JYW A;  3ACF A;  2W94 A;  4MGS A;  4W8J A;  3K46 A;  2WAA A;  1RYY A;  4CVU A;  4FI9 A;  3I2F A;  5FUI A;  2VCA A;  5LA2 A;  4A4A A;  3K4Z A;  3OEA A;  2EIB A;  2W1W A;  2Y6H A;  3WF1 A;  2KD7 A;  2WN2 A;  3WNP A;  4QX0 A;  4BDV B;  3SKJ E;  3SEE A;  2W92 A;  2CDP A;  4CUB A;  2W47 A;  1NAE A;  2WO2 A;  1O8P A;  3MUZ 1;  4L0P A;  3I3E A;  1PMH X;  2QQL A;  3MBW A;  5G05 L;  2WQ8 A;  1GOG A;  1UZ0 A;  1K45 A;  2V4V A;  3GGL A;  1L7R A;  2WO1 A;  4A44 A;  1UY1 A;  1XNT A;  1US3 A;  3HNY M;  1JZ7 A;  3ECQ A;  1NUK A;  1UY0 A;  3C8X A;  2BER A;  3GDB A;  2J1E A;  2ZXQ A;  3DYO A;  3OGV A;  3I2J A;  1TVG A;  3T2P A;  3ACH A;  3OGR A;  3C7G A;  3MUY 1;  2QQO A;  3OB8 A;  3AC0 A;  1UXX X;  1L7Q A;  2J1T A;  3WNO A;  3VDC A;  4A41 A;  3NJX A;  1W8O A;  1GQP A;  1SDD B;  2VZV A;  3U37 A;  3PUI A;  4OMD A;  2VZQ A;  3LE0 A;  2VO5 A;  2L9L A;  2RJ2 A;  4P08 A;  3LEK A;  3GM8 A;  3OGS A;  4W50 A;  4JHZ A;  1PMJ X;  3P1I A;  2RVA A;  1W8N A;  1J84 A;  2W1U A;  4CU8 A;  2VZU A;  3NQH A;  2E26 A;  5B4X A;  4PT6 A;  3CDZ B;  3UET A;  3T0A A;  2VMD A;  4YPJ A;  1UY4 A;  2E32 A;  2JDA A;  1UMH A;  5EJ1 B;  2E33 A;  1W99 A;  1WKY A;  2W5F A;  4XZU G;  2V5D A;  3IAP A;  5JMO A;  2DDU A;  3THD A;  4OUE A;  1EUU A;  1GOH A;  3WF4 A;  5DPN A;  2WYS A;  1GUI A;  5IFT A;  2E31 A;  1CIY A;  2EIC A;  5CYY A;  1H6X A;  3WF2 A;  2Y6L A;  2Z4F A;  3FHA A;  2ID4 A;  3LQC A;  3NJV A;  1JZ5 A;  2OKX A;  4A42 A;  2QQM A;  4BJ0 A;  4CUC A;  4GZ9 A;  2BGO A;  4JKK A;  3IB3 A;  1MPX A;  4OYU A;  5C71 A;  3CZU A;  3THC A;  3T2O A;  1OF3 A;  3WF3 A;  3T0D A;  3WEZ A;  5JXG A;  3CKH A;  3CZJ A;  2ZEX A;  4M4R A;  2VZT A;  1XC6 A;  2BGP A;  2X09 A;  1KEX A;  4JKM A;  1DYO A;  4LHS A;  2WAB A;  1XNA A;  1O59 A;  1JZ2 A;  3ACG A;  2JE8 A;  2DCJ A;  3BGA A;  1W9S A;  2VCC A;  1R64 A;  1JI6 A;  3K77 A;  3HPN A;  2X05 A;  4QDR A;  4A3Z A;  1UXZ A;  3I3D A;  2RV9 A;  1SHW B;  1JYN A;  3FHQ A;  2VJX A;  2XHN A;  4P5Y A;  3W5M A;  2VZS A;  2VQT A;  2HLE A;  4QX2 A;  1BHG A;  4TTG A;  3F2Z A;  2Y6K A;  4ZXE A;  1W9W A;  2VME A;  4LPL A;  1D7P M;  3I2H A;  3I2I A;  3ETP A;  1UWW A;  1ULP A;  2VCB A;  3HNM A;  3C7O A;  3PUH A;  1JU4 A;  4IUG A;  4PF1 A;  2VZ3 A;  2XQX A;  1IQD C;  1OT5 A;  2ORX A;  3T2Q A;  5LA1 A;  2QQN A;  1UY3 A;  2XOM A;  3ACI A;  4UOJ A;  1UX7 A;  4QPW A;  2Y8K A;  3LPG A;  4RN5 A;  3LEI A;  4ET7 A;  2W95 A;  5IJR A;  4DEV A;  4MAD A;  4QB1 A;  4E8D A;  1XPW A;  3T0B A;  3WSO A;  1JZ3 A;  2VZR A;  4DUW A;  1UMI A;  1DP0 A;  2VL4 A;  3WNM A;  4PQQ A;  2B4K A;  3J7H A;  3WNL A;  5LA0 A;  1W0N A;  2BZD A;  2JKX A;  3GXU A;  2W9X A;  2W1Q A;  2EIE A;  5IYY A;  2QQJ A;  2YC2 A;  5A1A A;  1CZV A;  2VR4 A;  2YFU A;  2VZO A;  4AAX A;  1GU3 A;  4MO3 M;  4QDS A;  3UNP A;  1O8S A;  1CZT A;  4GWI A;  2ZEY A;  3MO4 A;  2C26 A;  1EUT A;  1KGY A;  2J1S A;  1ULO A;  1PX3 A;  2ZEW A;  2W87 A;  3WNN A;  1K42 A;  3HJR A;  4W4Z A;  1LNS A;  2Y6G A;  4BK4 A;  5EIY B;  3VD4 A;  3DEC A;  1UYX A;  2J7M A;  2EID A;  3K4D A;  5F7U A;  4CUA A;  3A7Q A;  4BK5 A;  4DXR A;  3WQB A;  2Y64 A;  3C7E A;  4QX3 A;  5HPO A;  1GMM A;  4DUV A;  3WNK A;  5DN2 A;  5JXJ A;  2WAO A;  2R7E B;  5DMY A;  2YB7 A;  4QB6 A;  1UYZ A;  2C4X A;  3BN6 A;  3MV1 1;  2V72 A;  1J83 A;  3IAQ A;  1SG3 A;  1OH4 A;  1PX4 A;  1T2X A;  4DXT A;  2JD9 A;  1US2 A;  1JYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...