1W9SA

Structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
DLKNPYERIQAEAYDAMSGIQTEGTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLLGDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Family 6 Carbohydrate Binding Modules Recognize the Non-Reducing End of Beta-1,3-Linked Glucans by Presenting a Unique Ligand Binding Surface
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
molecule keywords BH0236 PROTEIN
total genus 30
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1w9sA00
1WKYA 2ZXQA 3VD7A 4LHSA 3OB8A 1SG3A 1W9SA 2VMEA 4TXWA 1W9WA 1I5PA 1R64A 2QQNA 3A7QA 4CUBA 2PQSA 1O8PA 2XHNA 3EYPA 2BZDA 2VZTA 3GGLA 4A42A 2VJXA 5A1AA 2DCJA 2QQMA 3C7FA 3WNNA 3UETA 3BN6A 1XNTA 2YB7A 2E26A 4BK4A 3DYOA 2B4KA 3OGVA 1H6YA 3CQOA 3SKVA 5EIYB 2WQ8A 2J22A 2Z4FA 1NAEA 4CVUA 4W4ZA 4CUCA 3P6BA 2E33A 2VOTA 3WF4A 3HNYM 1K45A 3W5NA 2EIEA 4PQQA 3I3EA 3I3BA 2CDPA 4P5YA 2J1TA 2VTFA 4QB2A 3UNPA 3ABZA 3WF2A 1YQ2A 5LA2A 1SDDB 4HG6B 4DXTA 2R7EB 4ARYA 3MV11 2VZ1A 4CUAA 3C7OA 4XZUG 1W8NA 1JZ4A 2BERA 1UYZA 2X10A 5F7UA 2VM9A 2VMCA 2JE8A 5JXGA 3P1IA 3I2KA 1L7QA 1UY2A 3WEZA 3I2GA 3THCA 4ZZ8A 2WYSA 2W94A 3CDZB 2WZEA 4CU6A 1JI6A 4D8MA 5C71A 1JYVA 1PMHX 2E31A 4DXSA 3K75B 1XC6A 4OMDA 2QQJA 3W5MA 3AC0A 3ACGA 1RYYA 1GUIA 4JKMA 1DLCA 5JMOA 2VZUA 2VCCA 1UMHA 3ACHA 5IJRA 3OBAA 3VD9A 2WO3A 2WDBA 2J7MA 4XUNA 3VD5A 1W8OA 4XUPA 3BGAA 2VC9A 3WNOA 5CZKA 2WN2A 2W91A 2WAOA 3LEKA 4A45A 2HYXA 3ACIA 3MO4A 3T0BA 3T08A 3MBWA 3UESA 4QDQA 3NJXA 4QX3A 1CX1A 3WNLA 2ZEXA 3CMGA 2WO1A 3WF3A 2VZPA 1CIYA 3WSOA 3VD4A 1BHGA 2E32A 1W9TA 2W1QA 3FN9A 4P08A 3A22A 2XONA 1UYYA 3VD3A 2VZQA 2X05A 4UOJA 3HEIA 2WO2A 3HJRA 3DYPA 3DYMA 4QB6A 2HLEA 5G05L 1UXXX 3GDBA 4PT6A 1GOFA 4KWUA 5LA1A 2VQUA 3SKJE 2BGOA 3K46A 1JU4A 3I3DA 1UY0A 3I2JA 1PX3A 2BGPA 2ORXA 4UAPA 4MGQA 2WBKA 5HXMA 4CU7A 2EIBA 4MADA 2J1AA 4IUGA 1UYXA 3CZUA 4OZOA 1UX7A 1DYOA 2EIDA 2QQOA 2VZRA 3OGSA 2ID4A 3IAQA 2WZ8A 4QDSA 3T0AA 5DQ0A 3I2HA 5HPOA 1JYNA 4M4RA 1GMMA 1UWWA 5EJ1B 3C7EA 4OUEA 2KD7A 1UZ0A 3T2PA 1F4AA 4A41A 3HOBA 4MOAA 3FHQA 4QX0A 1JZ3A 2QQLA 2XOMA 1P8JA 4LKSA 2W1WA 2W9XA 4P02B 4DEQA 4L0PA 1US3A 4KI5M 5C7GA 4PF1A 5B4XA 3K4DA 5JR2A 3HNMA 5DPNA 2VMFA 2Y6GA 4QPWA 4DEVA 5IFTA 2VZ3A 4E8DA 3NRUA 1GQPA 3GXUA 1O8SA 3I2IA 4E8CA 3LEGA 4A3ZA 2V72A 2W92A 2J1RA 2XQXA 2J1EA 1OT5A 1GNYA 1J83A 1US2A 1DP0A 3VDCA 3ECQA 2WABA 2RVAA 2Y6HA 3ACFA 2W1UA 4YPJA 1K12A 4BJ0A 3LPFA 1KGYA 2EICA 2VZOA 3IAPA 5DN2A 5DMYA 1EUTA 1CZTA 1OF3A 2WUHA 4CU8A 2VZSA 1LNSA 1MPXA 2ZEYA 3PUHA 2W87A 3CZJA 2J1UA 4QB1A 5EJZB 1HN1A 3HPNA 1H6XA 2RV9A 4LPLA 4BXSV 1CZVA 4P00B 3THDA 3OEAA 1ULPA 2W5FA 3VDBA 2ZEWA 2DCKA 2V5DA 1JU3A 1JZ7A 3NJVA 4M4PA 1UY4A 1OD3A 4XUOA 2QBXA 4XVHA 3PUIA 4ZY9A 4BK5A 4A6OA 4ZXEA 1K3IA 1EUUA 2WAAA 3WNPA 1JZ5A 2LS6A 5JXJA 3D3AA 1JHJA 3T2QA 3LE0A 4FI9A 1KEXA 2LW8A 3IDAA 1XNAA 3EB7A 3DECA 2YC4A 3K4AA 2VO5A 2YFZA 3GM8A 3A21A 2V4VA 2J1VA 5B4NA 4GWJA 2RJ2A 1L7RA 3LEIA 4AAXA 2W3JA 4QAWA 3ETPA 3HN3A 1WCQA 1JZ2A 3CIHA 2L9LA 3I2FA 2W1SA 3ZM8A 2JD9A 2Y6LA 1NX9A 1CZSA 3C7GA 5LA0A 2Y6KA 3NQHA 2QQKA 2VMDA 4MGSA 2ORZA 5JXHA 5I0DA 5LCWL 4XURA 3MV01 1UY1A 1GOGA 4RYDA 4JX0A 4JKLA 3T2OA 1JYXA 2YFUA 4GWIA 4XUTA 5C70A 4AG4A 2VR4A 4UI9L 1O59A 3FL7A 3F2ZA 4ARXA 3MUZ1 1F4HA 2VCAA 3E1F1 4D0QA 4TTGA 4W50A 4KMQA 2Y6JA 5JXIA 1NKGA 1JZ8A 4CU9A 1D7PM 3NNGA 3HNBM 5IYYA 1GU3A 3IIIA 5CYYA 1K42A 1TVGA 4A4AA 3FHAA 2BBAA 4JHZA 3WQBA 1PMJX 4ET7A 5FUIA 2JKXA 2VZVA 2C26A 1NUKA 2CDOA 3LQCA 3WF1A 3K77A 4ZZ5A 3WNMA 3JXSA 1GOHA 3SEPA 4QX2A 4MO3M 1TG7A 3C7HA 3IB3A 4BDVB 1IQDC 4RN5A 2WN3A 1W99A 4OMCA 3T09A 4A44A 4Z2AA 4QX1A 1OH4A 1OF4A 5JUVA 1UXZA 5IHRA 3A23A 1JZ6A 1UY3A 5IFPA 4JKKA 2ZEZA 4GZ9A 4W8JA 1XPWA 2VCBA 4XUQA 1J84A 2W46A 2X09A 3I97A 2W95A 2W47A 3CKHA 3J7HA 3OEBA 3WF0A 2QQIA 2VQTA 2C9KA 3WNKA 3U37A 3LPGA 4LQRA 2J1SA 3OG2A 4DUVA 1JYWA 3K4ZA 4DXRA 1PX4A 1SHWB 3VDAA 2YG0A 3MUY1 2DDUA 2OKXA 5G04L 5J1XA 3T0DA 3SEEA 2VL4A 2B9VA 2YC2A 4QDRA 3C8XA 2C4XA 3OGRA 1ULOA 2Y8KA 1UMIA 1T2XA 4DUXA 4DUWA 1W0NA 2Y64A 4OYUA 2JDAA
chains in the Genus database with same CATH superfamily
1WKYA 3AKSA 4BIOA 3VD7A 2WA3A 3AL5A 2GMMA 3UKVA 5JZGB 3OB8A 4QX8A 4AVAA 3U10A 1CPNA 1PGSA 1SPPB 4XF0A 5DUVA 5JAXA 1ZX5A 1XOYA 2MHFA 2VMEA 1ZRIA 4JHTA 3VBHC 2WWSA 2QQNA 4MGZE 5GKAC 4MGIE 5BPXA 4AE2A 3EYPA 4YWAA 4XIKA 4A42A 1AR91 2VJXA 4AGGA 5A1AA 2QQMA 3C7FA 3WNNA 2Z69A 5T54A 4Y4RA 1N3PA 3JD72 5ABJB 1LHVA 1RMU2 1HQWA 2HWD3 2XMLA 3DYOA 1RUE3 1WLCA 1O5UA 3LWCA 1ND2C 1H6YA 2QQWA 3CQOA 5HCHA 1FV3A 3GCWA 5CVRA 5A7QA 5EPAA 3WDVA 4CCJA 3O0XA 1SLLA 2XJQA 1V6OA 1B35B 1BBT1 2J22A 5H9SA 4P9JA 5F3GA 2ZGTA 1NAEA 2HBUA 1S0IA 3AFGA 4XAEA 5L9RA 4PDWC 2ADEA 1BVP1 4S2DA 4LBMA 3VZJA 1ACCA 1DGLA 2YDEA 2QE3A 5C8CB 2RS13 2R042 1LHUA 5FXZA 3VUOA 1TME3 1W8UA 3FLRA 1KRIA 2Y60A 4P5YA 4QB2A 4ZHNA 2FZ1A 4UFLA 1J3PA 3ABZA 3AZVA 1I9RA 2XBO3 4QQOA 3V64A 1U12A 4KL1A 2KXLA 5I8SA 3HIFA 1OLQA 2JENA 5FY9A 3RZZA 4FTSA 2D44A 1HB1A 5E6HA 3MV11 4NOTA 1ND3B 3H3ZA 3J26N 4R4XA 4CUAA 4NIGA 4CRQA 5FKBA 5T5PA 4CCCA 2X5IB 3KWVA 2VU9A 5CFCA 4QGLA 4CDXA 1YIFA 2BERA 1UYZA 3GYDA 2VMCA 1DZTA 4L97A 2K0GA 3MIDA 1FNYA 3P1IA 2XVLA 1BMV1 5DDJ2 3RI8A 2EXHA 3PU3A 5A32B 1LB2A 1UY2A 5FV3A 3L9JT 2OPWA 5ACA1 2CV6A 5KXCA 1AXKA 3THCA 2PXJA 2YXSA 4WBBA 2MPFA 1AR82 4LEJA 3DPRC 4GMP1 4QWNA 4CU6A 1DGWX 5JOWA 1G9AA 3CJIA 1LODA 2XWBB 1UCXA 2Z2SB 1FMD3 1VAMA 5F2SA 4YM0A 3MIEA 1PMHX 4B4PA 4M3CF 1KS4A 1LULA 2E31A 2WNUB 5HCAA 3MIBA 1LEMA 1CVNA 4D7TA 4DXSA 5EQUA 5JPNB 5AVPA 3NO8A 1RUC3 1PZ7A 4FPFA 1OOPB 2GALA 3ACGA 3AM2A 2WFF2 2A71A 1TEIA 2D93A 1RUF3 2WZR2 4LE3A 3AXDA 4YW7A 2FDGA 5A3WA 4ZONA 5BNOA 3RI9A 4YZ5A 1MS1A 1Q3EA 4HT1T 2XQRA 4CDUC 4FOWA 4PLNA 1QU0A 4BQ3A 1W8OA 1H1IA 4XUPA 1H2KA 1HV1A 1NA1B 1VBA2 2RJKA 2Y0OA 1RUC1 4EJRA 2NM1A 1POV3 1C8M1 3I49A 3ES4A 5CZKA 3TWIA 5C6CA 5A3OA 3M8LA 5LBEA 4BQ2A 3JQXA 4V2VA 4WM8B 1RUF1 4A45A 2BQPA 2MEV2 3ME2A 1HXS1 1AR81 2ZMNA 4OQ9A 3ACIA 5FY0A 3UESA 3WVJA 2ZS6B 4LMFA 2CWMA 2TUNA 2WNVB 4HN0A 4EN6B 4URTA 2HBTA 4D6QA 4H55A 4DRVA 1GNZA 1YRZA 4W6YA 2D3SA 4EN0A 1MS5A 4LK6A 2ZEXA 3CMGA 4XBLA 5FMBA 1WCUA 3I3QA 1CAUA 3LOIA 4MZUA 1CIYA 2VULA 5JSOA 2D40A 3VKOA 1YQ8A 3WSOA 4CP9A 5FZFA 1Z0HA 4EROA 4X6RB 4BQWA 3KF5A 4F8AA 3GNEA 2GC0A 5CFDC 3H9AA 3OBZA 4DNYA 4BWOA 5J3UA 4P08A 2JIJA 2YGMA 2GU9A 3CBNA 1EV11 4HZFA 3ZMNA 4QT6A 5JZGC 2ZAAA 3ZDSA 5BYNA 4CDXC 3JZVA 3VD3A 2VZQA 3KD4A 2X05A 3HEIA 5K9YA 3ORJA 2RS32 5FQ0B 3WR0A 5G05L 1UXXX 2K2SA 3HT2A 5FAXA 4BOWA 2GZWA 4BU2A 2C24A 2D7FA 3I59B 1N3QA 4KWUA 1MQTB 1RVF2 1W8TA 4FOVA 4LO8A 1B35A 4AFCA 3SKJE 2HYKA 2ZX1A 4AK3A 4SLIA 1JU4A 5ANQA 3ZFGA 1G9FA 3P3NA 3W20A 5JPMB 1GZTA 2BNMA 4N53C 1UY0A 4MLOA 5FXWA 3T4VA 2VMIA 3I2JA 3RZGA 4MGQA 5ERLA 1HDKA 3POJA 2XL9A 3SNMA 2ARAA 3CJIB 3RJ2X 2ZBJA 2N7GA 4RHV2 3T1MA 2HEYF 4MADA 4YZ3A 1RUE2 2R0FA 4IUGA 1HQLA 5FPLA 1QQP2 3CNAA 4OZOA 2X5IC 4WM8C 4KWJA 1GP4A 2GNBA 2EIDA 4X6QB 2WLQA 2QQOA 2OZJA 1N1SA 1ULDA 4ONUA 3ZXKA 4AAPA 2WZ8A 4QDSA 2Z42A 1VRH3 1FYUA 1QNWA 2NLRA 1U5ZA 5E88A 1UWWA 1XSRA 4OUEA 3AJYA 1UZ0A 2D6NA 1H2MA 2RR12 3HOBA 3ZN6B 3MICA 3VHOA 2A6ZA 2JDPA 4K6BA 5F5AA 4S2FA 1HJFA 4YW1A 1E5HA 4BMBA 1ZRCA 4QX0A 2QQLA 3TEZA 2XOMA 2Y6FA 3AP6A 5A33B 1XSQA 2DF7A 1UN1A 2EXIA 4IE5A 2ZGRA 5A7WA 4DOUA 4HPKB 2E53A 2Y34A 4DEQA 2JG9B 3KCCA 5T55A 4XILA 4H7MA 2FD8A 4Q0PA 3VB9A 1SZBA 1W2OA 4HKLA 4DB5A 3D0JA 4EWEA 3ZIWA 3NAPA 4PF1A 5B4XA 2BTVC 4MX3A 5J48A 3MFCA 1RUH3 4OHWA 1C8M2 2VZ3A 4KG0A 1WW7A 3FC0A 2ZHNA 3GXUA 4Q4V2 3I2IA 4Q0QA 4AEDB 3OBTA 3LEGA 4PI2A 2V72A 2CGPA 4R9CA 2VUCA 2D6PA 4RFRB 2G9GA 3PTYA 4E4ZA 1OFSA 3VBHA 2P37A 2TNFA 1KD7A 1Y7BA 2XQXA 5FYTA 1NYWA 2EALA 4RR3C 3BPSA 3D6EA 3RG0A 4HKWA 5JI7A 4OULA 2IVIB 2RVAA 3LDKA 5K0UC 1UZWA 3A4UA 1NG0A 1UPIA 1KFUL 1FMD2 2ZMKA 1QQP1 5JR7B 5L7OB 5A6ZA 5EYXA 2ZACA 4BJ0A 2D5HA 1VAVA 4MXWA 4RSUA 1OXCA 5FYZA 2HWE1 2PAKA 4NPRA 3M7AA 4MV2A 1YI9A 2XJVA 1ZZ6A 1YHFA 1CZTA 3O1RA 1MS4A 1OF3A 1RUC2 2XUMA 4CU8A 1NZIA 5FREA 1W06A 2ZEYA 2NPIA 1ZZ7A 1ZREA 5A1LA 2DTWA 1LHOA 1JHNA 3FX3A 1MQTA 4TYSA 2GH8A 2JXAA 3T4HB 1Q8SA 3U1XA 2YC0A 1GZCA 4ZU7A 4MUVA 4FPYA 5D2AA 3FFZA 4BXSV 3B3QE 3ZXLA 4XPVA 1CZVA 4P00B 3WUDA 5C3PA 1MEC1 2HWE3 1XB9A 1AX2A 1FPN1 3B93A 3JUUA 3VDBA 3AMMA 5I8TA 2SBAA 2ZEWA 3KCXA 1VBA3 3T30A 3EJKA 3AVSA 4JDOA 1VPHA 1V70A 2V5DA 2WZR1 1JU3A 4Y1ZA 2A6WA 1NE6A 1UX6A 4Z82A 5IATA 1WA6X 2QBXA 3WDTA 2MEV3 3M3CA 4A2UA 5C8WA 3BUCA 4ZY9A 1ND2A 2NMNA 1FOD3 3FBYA 2XGXA 4AHXA 2VAUA 1LOAA 2OUJA 1EUUA 2WAAA 2WR9A 5C33A 1WMEA 4GQ7A 3KHCA 4C0BA 4AQ6A 1S0EA 5E16A 1WLDA 4B8EA 3O1OA 3AMPA 3D3AA 3T2QA 4YRDA 5A33A 3N9MA 4BHPA 1ZYBA 1DG6A 4CYDA 1SLBA 3LB9A 1KEXA 4XQ4A 1QIQA 2LW8A 4OFGA 2A7AA 2OQ7A 5FFOC 5FZOB 2YY1A 4MYEA 4M3CB 3VZMA 1COV2 1S2KA 4RS5A 1W6MA 4K21A 4NE9A 3P5BA 5IVYA 3UT0A 4Q8LA 1PGL1 2R073 2PAMA 2HWB1 3NNMA 4Q4W1 3BOWA 4QPIB 5B4NA 4DIQA 1C28A 4I0AA 2RJ2A 4K8RB 4YW2A 4ASLA 3FUQA 5LB6A 2CGNA 2D5FA 1W0OA 1OA3A 1VAKA 1HRV2 3FLTA 3IZOA 1RVF3 4LE4A 3HN3A 1YO8A 2EXKA 1JZ2A 3CIHA 5BUVA 2L9LA 1C8NA 4O65A 5FZBA 5K0UA 2DBNA 5FLIA 1ZBA3 3BTAA 2F4LA 3I2FA 3VKLA 3LGRA 3WQ1A 2JD9A 3ZM8A 4CDUA 2IFRA 1WZXA 2QZ2A 5BNPC 2R071 4TSVA 1RUG3 1R082 2TBVA 2Y6KA 3ZN6A 3VHNA 3ZSKA 3GZAA 3NQHA 2FQPA 2QQKA 4MGSA 1HLCA 4MH0E 4YFZA 2ORZA 3WP4A 1JUHA 1VE0A 2ES3A 1W8FA 1VP6A 1UYPA 4GMP0 5T5JA 3UGHA 3S5QA 4E2SA 1CJPA 2VMGA 4E4SA 4L11A 5KWRA 3ZFEC 1AX1A 4JX0A 3RS6A 1PK6B 2XVKA 3NAPB 3LFMA 1LECA 2R30A 3GBFA 3KZ4C 4NN0A 5LY2A 4AG4A 3H7JA 1V6LA 3MIGA 1O59A 1F8VA 1Q43A 3FL7A 3F2ZA 3WOGA 4ARXA 1REFA 5FYVA 4DMIA 3GJBA 1RUD1 5I0SA 4I0BA 1J1LA 3K3NA 4IEXA 4Y22A 4PHZA 1OFNA 3LCPA 2R043 3D82A 1BK0A 1X8MA 5HCFA 2A3YA 5BXXA 5CFDA 4FPHA 5FPBA 5GLVA 4AXOA 4J1WA 3KT4A 1D7PM 1RB8G 1QH6A 4COUA 2WSUA 4GWNA 4MG2A 1AR71 5CYYA 3FZ3A 4A4AA 2BBAA 1RUJ1 3THTA 5FPXA 2YMZA 1IOAA 4AL9A 4CEYB 3KGZA 4QKDA 5LATA 1NUKA 3WF1A 3RYPA 5LW9A 5A3MA 4H3WA 2G9FA 2PN5A 4DO0A 4FPGA 4XFHA 3H7YA 2UYAA 4LITA 3WNMA 4LIUA 5C4WB 5CBLA 1GOHA 3SEPA 4QX2A 3ACLA 1AR73 3IB3A 3N9OA 4XXPA 4WM7A 4CDQA 1CX4A 4V2WA 1NLSA 2JB8A 4A44A 4Z2AA 2BV4A 4OHZA 4JDNA 1N1VA 2X29A 1GFF2 1VJ2A 3F95A 4Y5TA 2VW2A 1QJY3 2ZEZA 4IQPA 1YIPA 1FXZA 3USUA 3OYWA 1W6QA 1LHWA 2X09A 1R093 2AEYA 3I97A 1BEV3 1AR92 3J7HA 3OEBA 4PBPA 1VR3A 5E89A 4J1XA 2A5ZA 2BU9A 2H6BA 2XHKA 1C3HA 3PTRB 4YW6A 4Q2FA 3TN92 4XC9A 4RR3A 5ABJC 3AMNA 2W68A 4LQRA 1SBEA 3IN9A 4LHNA 2J1SA 3WV6A 3ZSMA 4B7KA 4DUVA 3M3IA 1LGBA 3K4ZA 4GKXA 1QJU2 2RS11 5FYIA 1L7LA 1LU2A 3VDAA 1RUF2 4OQ8A 1VB2A 4Z1VA 3AX4A 4HETA 2OKXA 2PHDA 4DZGA 2A1XA 2X53S 1QEXA 1NCRA 1H9PA 4AVBA 2ARBA 1LTEA 5J1XA 5KR7A 3KT7A 3T0DA 1WCKA 3AKPA 4IV1A 2VL4A 5JMCA 3THPA 3C8XA 2VVFA 1U0AA 2RDQA 4DQAA 1OLME 2AUYA 4FXGB 1BJQA 3ASIA 5IVVA 1Y9QA 3V65A 1W0NA 2D6KA 3N3HA 1CIWA 4FP3A 1TMF3 4LK7A 5FMOS 5EHDA 5FP3A 1CAVB 1R1ZA 4AHZA 3QCWA 4LHSA 3IDEA 4LBOA 5DAPA 4ATFA 4JGZA 2JDUA 5A80A 3CL1A 1JYIA 3G7DA 4TXWA 4QD2A 3KHBA 1BBT3 1I5PA 1HN0A 4QMAA 4YZ2A 4CUBA 1O91A 1RIRA 2P2KA 1O8PA 2PQSA 5FYBA 2VZTA 3GGLA 4URAA 3RZMA 2WL1A 3OTFA 2DCJA 4EWAA 5HI0A 4CPBD 3VZOA 3RZKA 2BJSA 3UETA 1F2NA 1DGRN 2ZTNA 5A3TA 3BN6A 4HVOA 4BQ5A 1NY71 2YB7A 1IKPA 5GLZA 2E26A 4BK4A 3BTZA 2QNKA 5DDJ1 4EV0A 3RZJA 5FJHA 2B4KA 1H4HA 4BCUA 5C8CA 1NY72 4P14A 2XLGA 1ZRRA 5I0UA 4KNCA 2PQQA 2RMU1 1LKNA 4QQHA 5A3LA 1WBLA 5LEJA 2XBO1 5FO7B 1K5JA 5JDBA 4PLMA 5L36A 4AVSA 1VB4A 3AFKA 4UF0B 4CVUA 1UD1A 2IWGB 4FSJA 2E33A 3RFRA 1FI2A 3H1WA 3HT1A 2VOTA 5FZ9A 2IXIA 5DZFA 4IV3C 3ZVXA 4E4DX 3O1SA 3E5QA 1U5XA 3HD8B 2GN7A 2JG8C 4YSFA 5BV6A 2LUWA 2P6CA 4NR1A 2J1TA 2VTFA 5FZ0A 2ZPXA 4HANA 3H1MA 1LEDA 1PZ9A 1CAWB 2R062 5D8AA 5GM0A 2D6OX 2MNGA 4CPBA 3WT3A 3B00A 1HQNA 1IZ3A 1OUSA 2CWSA 3V0BA 1SDDB 4DXTA 1IPJA 4LA2A 4IL7A 4GKYA 2D43A 5CFDB 3BB6A 3D0SA 4IXLA 1IS6A 4JTNA 4MGYE 4XF1A 1QXPA 5FPZA 1RTVA 1AR83 3R4DB 3EHKA 3O1TA 3B5LB 5C3OA 2VM9A 3VHPA 5A7WB 4FFGA 4K8FA 3B94A 3I2KA 4XHXA 5FXXA 1G86A 1L7QA 4JTOA 2FDHA 4FBFA 3B02A 1QDCA 2DUOA 3Q8AA 2DVBA 4YM1A 1AZDA 2W94A 5FMDA 4AWDA 3NMBA 4NMIA 1X8EA 3V0BB 2A6VA 2CAVA 3J7LA 1RMU1 2Q8DA 5FYMA 1W6PA 2YU1A 5FYSA 2Q1ZB 5CKMA 4AW7A 3ZFGB 5C71A 1BXHA 2GP5A 3NL1A 3OF1A 4OI2A 1JYVA 2VW1A 1EV13 4BIFA 1N3OA 2BWAA 5E8AA 2OIIA 4R9BA 2DVFA 3ZN5A 2NP0A 1HW5A 1XC6A 1SLCA 4OMDA 2GNTA 4RQPA 2JE9A 1C8M3 2B39A 4J6GA 5GALA 4M3CA 1RYYA 1AR63 1WW6A 1W3XA 1D4M1 4GXLA 4Y20A 2RHPA 1JYTA 3S5AA 3O1VA 1RUJ2 1V0AA 3U75A 4AI3A 5J96B 4FFHA 3WHTA 4QPIA 2VTXJ 5FRAA 4BMEA 1J3RA 1AYM2 3SCGA 5FP4A 5FZ7A 1UPSA 1OURA 3BGAA 5T3NA 3WNOA 1D0HA 3K48A 4AEJA 5F3CA 3MIHA 1H1MA 3ZYFA 2Y38A 5EP9A 3N9LA 2W91A 2WAOA 4HPKA 3EO6A 4NIDA 1YWKA 1Y3TA 2PHTA 2HYXA 4RS5C 2HWF1 3WP5A 4CCMA 3BKZA 5HCBA 3MO4A 3T0BA 3TN93 3T08A 4QDQA 2UU8A 3CJIC 3H50A 3RDIA 3SH3A 1WD4A 3VBSB 5IK7A 1ZBE3 1W6NB 2B5HA 1OA4A 4KBBA 2BWCA 3URFA 3WNLA 3WDWA 4D69A 4IGPA 4BXFA 3Q8EA 2BP6A 5LK5A 5DZGA 1H30A 4YVSC 1WUVA 4Q0VA 1SLAA 3I54A 4QGNA 4XTPA 5L9BA 3KQ4B 3POEA 2YZ4A 2SLIA 3FN9A 1ZNPA 4NAOA 5FY4A 3ZYBA 2XR4A 4N53B 3NKGA 3CO2A 1MS3A 4GIQA 4Y1XA 1MZFA 2YYOA 2VCMA 5FP7A 1QOTA 1D4M2 4CSWA 1V6NA 1K5MB 1ZVFA 2HLEA 4OLLA 3VV1A 3AJZA 5FWEA 3ZPYA 4PT6A 4RHV3 1COV1 1XJAA 1FAYA 1SFPA 3RRDA 5IVBA 4F3JA 5LA1A 5FZDA 4HL0A 3POSA 1T6BX 2BGOA 3K46A 4N7UA 5FY1A 1D4VB 1S0FA 5JIAA 3T2TA 3ZR6A 3DCQA 3WDYA 2E7AA 3RMYA 3INAA 3ZKUA 1A6CA 1FT9A 1PX3A 1J1TA 4Z2WA 5HXMA 1KS5A 2CTVA 2IXKA 1MEC2 1QXJA 5F3EA 5IAVA 4J25A 2VVDA 2J1AA 5FCCA 4L99A 4YZ4A 3ZFFA 1PGL2 1NCQA 4RQPC 2H6CA 1COV3 2WNUA 1RHI2 5CG8A 1DYOA 3HAGA 2VZRA 3LA3A 3OGSA 2ID4A 4I09A 5FTTC 3IAQA 2VH9A 3T0AA 4CCNA 1UU6A 2GNMA 2QDRA 3WXPA 5HPOA 2P3JA 1JYNA 4Q29A 3WG2A 4XF9A 4E4HA 1PO12 4HOOA 4INDA 3UKTA 2VNVA 4O61A 3PHMA 5FZEA 5DZEA 2VNOA 2VECA 2XH6A 4IE6A 5JZGA 3POWA 5L9VA 3SITA 1ZZCA 4COWA 1VBE3 1A8MA 3PUQA 5FLHA 1W6QB 2J42A 3AYDA 3HMYA 3KSCA 2QQVA 3O7OA 1VMHA 1NCRC 2P3IA 4YVSB 2UURA 2ZX0A 3GBGA 1W03A 2RM21 3R4UA 4P02B 2YBKA 1O3QA 2IUWA 2KM2A 4CUGA 5FZ8A 1VBA1 1ST8A 1IG3A 3W59A 1W2UA 2WT1A 2XKPA 2P5BA 3MI8A 5DAQA 4XZPA 1B35C 1YQCA 4HK8A 2JD4A 2Y6GA 1TQ5A 4OI0A 4DEVA 5FBZA 3TEYA 4N43A 3RYKA 2Q8EA 2YBSA 1FPN2 2FMDA 2VBBA 3AZZA 1VBE1 2B7YA 3S6PA 2F17A 4A3ZA 2OA2A 2WNVC 2RM23 3JU9A 2AYHA 4EE2A 3M1HA 3CHXA 2JDYA 2JDMA 1V9U1 3AP5A 4M01A 4MXVA 3VZLA 5JSRA 2JG9A 1GNYA 3FUOA 1US2A 3J9SA 3KF3A 1DP0A 2WABA 3OPZA 4PJYA 1W04A 2VQ0A 2Y6HA 3OD4A 4XJZA 3NNLA 1UZVA 3ACFA 1NA1A 5KXEA 2A3WA 1LOBA 3FWEA 4BE3A 1K12A 5HV0A 3JD71 4JVAA 2VZOA 1WWYA 5DN2A 3N9PA 4IV1C 4ITCA 2HWB3 4GB31 4QXCA 2HWE2 4BA6A 2JDHA 1A3KA 3PVOA 2WZR3 1LNSA 1W05A 4BQ4A 1EPWA 2W87A 1QXRA 3IIAA 3I59A 1N47A 4OHYA 1J59A 3RSJA 3WW1A 1H8TB 4FCAA 4Q4Y3 2BYVE 5H9PA 5FK7A 4Z8BA 5F1RA 1HN1A 2XUEA 4LT5A 1CJDA 3HPNA 3R05A 2UYBA 4IETA 2WINB 5GZFA 2ZX4A 1FOD1 4NIAA 5A32A 4BH9A 2DFBA 3HBZA 3OEAA 5D8AC 3RZHA 3MHZA 4HBNA 3AYEA 1UOFA 2W0XA 5IK8A 1O3SA 1LESA 4RGAA 1JODA 2RR11 3IDBB 2WNUC 3P3PA 1H4GA 1YUDA 3DF0A 4LKEA 3I4IA 2JB4A 1JZ7A 4NIHA 1DQ2A 1NCQB 3AZWA 1UY4A 1OD3A 1F15A 3V0AB 5J98B 5L7OC 4RL7A 1D0GA 3S0MA 3I7DA 4PQ9A 2WKKA 4UWDA 4Z07A 5EWSA 3GZEA 1QJY2 5GZCA 4BK5A 1CAWA 3VBRB 2BRTA 4N90A 2A6XA 3OGGA 1ZBE2 2RS51 2VMHA 1H8VA 1W3VA 2XXZA 1BEV2 4YNIA 2A70A 5GZGA 4QPIC 5A6XA 5BY5A 2LS6A 2ZOEB 4K1ZA 2WT0A 5JXJA 2OW4A 2ZGOA 1NQJA 4LO7A 2YHJA 4E2QA 1JHJA 5FPVA 5DG2A 4AGRA 5EZWA 4WVWA 4AI0A 2ZGSA 3QH6A 3LE0A 2QUOA 2P3KA 3ZKYA 4U2AA 4E27A 2UWBA 4R9AA 5A70A 2O14A 4AQSA 1XNAA 5AC91 2WS93 3OGJA 2ZZQA 4NHKA 1D2SA 4LOSA 2JG8B 3WINE 3J8F2 2J1VA 1POQA 4YGBA 5FK8A 1SMVA 2CY6A 4P9YA 4LBLA 4KU8A 1L7RA 4YYOA 1R083 1QOOA 4AI9A 2TEPA 1OVSA 1TMF2 2IFWA 3VBOC 3DPRB 1O6UA 4IEOA 4D7YA 4UW4A 2CNAA 5SV5A 5F5IA 2O8OA 2GC3A 4H2AA 1Y9GA 4AHWA 3MZHA 2JECA 3MF6A 4RR3B 3NWKA 1CZSA 4RQPB 3C7GA 5F39A 1NXD1 4NRMA 4PF5A 1BVVA 1SFYA 3SXWA 5B2GB 4GD4A 1L3JA 4JRAA 4O9GA 3H8OA 5FJKA 2IXLA 4XMAA 1PVC2 2CHHA 3WW3A 1AX0A 3ETQA 4LBQA 1RHI3 2RS31 5I0DA 2VW0A 4FPJA 2JJ6A 3CEWA 4NHMA 3RVHA 1OOPA 1UY1A 1GOGA 4RYDA 5FZKA 5CKNA 3UJQA 4JKLA 3T2OA 1XNKA 3POGA 2BEOA 1STMA 2GDFA 1MQTC 4M0HA 3M3EA 3ON7A 1DGWA 2QKDA 3CF6E 5IAXA 4WZCA 4AFDA 3MUZ1 1HRI2 1PO21 2VVEA 1VBE2 2BVVA 2XJSA 4D0QA 1ZA4A 4W50A 3PVBB 1RHI1 5JXIA 5FO9B 2Y0IA 4IDZA 3H3LA 1SPPA 5AFEA 1DGRA 1OHFA 1RUI3 2HWC1 5FZIA 2YROA 1S0GA 3NNFA 4CU9A 1JZ8A 5L7OA 2WYFA 4YW4A 1OUXA 3IIIA 1JBCA 5A7PA 2EAKA 1KITA 1LGNA 1RL3A 1TVGA 1W2NA 5T5OA 1A8DA 3FHAA 2BOIA 3VBFB 3WQBA 3D4KA 1PMJX 2GAUA 3NW4A 1YI7A 3GBWA 1Q8QA 1V6IA 1S2EA 2GN3A 4LORA 4AEDC 2RM22 4JZRA 3K77A 3AVRA 4FFIA 5A7OA 3R0RA 5F32A 1SLTA 3AKRA 3ELNA 3NNJA 4FT8A 4ZZ5A 1UKRA 5LASA 1YFUA 4EN9B 4YFWA 4P9WA 3HWJA 1TG7A 1IGOA 2R16A 1QJFA 1W99A 2AGSA 3L2HA 1AR93 2DU0A 4OMCA 3T09A 2I2SA 1G8WA 2ZCWA 1OH4A 4YZ1A 4DPNA 1DQ6A 1PMIA 2DWRA 4NJ4A 1BLZA 1HKDA 2PLV3 2VBPA 2XL7A 3A0KA 3A23A 4LOTA 1O3TA 4I3GA 2HWD1 4WVZA 5M0TA 3BTYA 4YM2A 4GZ9A 4KU7A 4AVTA 5FY5A 4PIZA 2VCBA 4PIYA 5ISLA 4XUQA 5I0RA 5IK4A 1DZQA 2W46A 4R9DA 4QPGC 1CGPA 1ULCA 3VBOA 1KXGA 3IM0A 2QQIA 3N35A 5CU1A 2VQTA 2E51A 1LAJA 2BUKA 3WNKA 4XCAA 4Q4Y2 3LPGA 3U37A 4B3NA 1KFXL 2RDSA 4QGMA 4I01A 5BNNB 4GH4B 3OG2A 5GLTA 2GH2A 1AR62 4UFIA 2KR2A 1PX4A 3E97A 4RA0A 3IT8A 3VBRA 1SHWB 1W9FA 1X50A 3MUY1 1GWMA 1TME1 1REDA 1NLRA 4QHOA 3LEMA 1UL9A 4I2OA 2ZZJA 4CUCA 1JS9A 2ETEA 4S2HA 1Q8PA 1NLQA 3UK9A 2FMYA 3H1YA 4COYA 4CE8A 2VNGA 4KWKA 4LXLA 2RE9A 2YC2A 5LA9A 3WQ0A 5FWJA 4XFIA 2K46A 3M4FA 2ZGUA 4NUBA 4QQ2A 1BBT2 4ASMB 4XACA 2WNEA 4YG3A 4DUWA 4AOCA 2OUHA 1AXZA 1KJLA 1R1A2 1OBNA 3ZSJA 1PK6C 1LOEA 5K7PA 2FCVA 5F5QA 2E7QA 2JIGA 5FZLA 5J7MA 3HN1A 1LOFC 4LBJA 1W9SA 2R0HA 5CG9A 1RJ8A 2C9AA 5EYYA 4XBQA 5GLUA 2DVDA 2XJTA 5ACA3 4NPLA 1F9KA 3KQRA 1DU3D 5CAZA 2BZDA 4AEMA 1OQEA 1CAXB 2VD7A 3AP9A 1IS4A 3J4UH 2VXJA 3MDPA 4CA9A 5IW0A 4TZDA 3T3YA 3OGVA 3BALA 4PDWB 3DXTA 1H8TC 4B29A 4AEDA 2WQ8A 3OY8B 5DG1A 5FY8A 1W9YA 4UBHA 2HKXA 4XW3A 3GCXA 2FZ2A 1UAIA 1ZBA2 1PGW2 1AR61 1W6OA 2B9UA 4FQZA 2DVAA 1D4M3 3P6BA 5DAXA 2ZKNA 1ND2B 2AR6A 3ZYPA 3WF4A 2XB6C 1K45A 1RUG2 3B9CA 3W5NA 3RPQA 1QJX2 1VBB3 2YV8A 3GJAA 5C4WC 1G7YA 2EXJA 3I3BA 1JOJA 2CDPA 4QHZA 3UV9A 1EY2A 4XJ9A 2XJUA 3BIWE 4QU2A 4BPZA 4Q8KA 3VKFC 1DQ4A 3VL8A 4CEWB 4D6RA 3N9QA 4HG6B 4Q4W2 4TLFA 4CCLA 1W2TA 4IEPA 5A7NA 3JB8A 4AR2A 4ARYA 4UFJA 2VZ1A 2JEMA 1YXWA 5F8PA 3ZR5A 2WRAA 3HBKA 5FOBB 5H9RA 2QFEA 1PM7A 3CLPA 1TNFA 5F7UA 3JBG2 1GP6A 5A3NA 2JE8A 1DLLA 1H0BA 1HRI3 1ZBE1 2FHRA 2GNDA 2RS52 3HQXA 3NV2A 2WIIB 4EN7B 4GB32 4O9EA 1CQ9A 2WYSA 1QHDA 3PLQA 4KWLA 3CDZB 4YLZA 3ZLIA 5D21A 1U5YA 4HONA 3JQWA 1AJKA 3PIGA 4LHLA 4YVWA 4AFMA 3MPBA 1F31A 1HB4A 1XXNA 2GC2A 4D8MA 5A3UA 3NV4A 1GP5A 2WQZC 4DFSA 1WMFA 1AYN2 1NOVA 2LALA 2V09A 4FVVA 1HRI1 1PNFA 3USUB 3K75B 5BNOB 4MGTA 4CXXA 3BPZA 4UT5A 1LOCA 2QQJA 3W5MA 1Z7S1 1UIKA 4DINB 1NQDA 3AC0A 1N1YA 4XQWA 1GUIA 1AVBA 1Z78A 2QJVA 5LBCA 5JMOA 2VZUA 2VCCA 2BNOA 1LHNA 2EA7A 5IT6A 2ZGLA 1B09A 1YFXA 2PHXA 5BNPA 2ZAHA 1NT0A 1GANA 3T1LA 3VD9A 4A3XA 3FLPA 1W6PB 4FOYA 2J7MA 2NN8A 4XUNA 3VD5A 1ZRFA 5C8CC 1XYNA 4Q0SA 5FO8B 3LAGA 3PURA 4LHKA 1Z7S3 2Q1MA 4Y5Z0 1R092 5CIRA 2WN2A 2DCYA 3H42B 2Q8CA 3FHIB 2W2IA 3ZYIB 1C4RA 5KHKA 5LBFA 3HQRA 3ZYRA 1VBC3 5FBJA 5F2WA 3B01A 1GQGA 2D6MA 5EJ3A 3LDRA 4LO4B 3MBWA 1QJZA 4NO4A 4FAGA 2CL2A 4A7ZA 4LBKA 1XBFA 2I07B 4B1LA 1W6OB 4PIXA 3IMMA 4JGZB 1DFQA 4QX3A 2ZHKA 4XIOA 2B8MA 1FX5A 3TRSB 1DQ1A 3ZPOA 4WM8A 4YGCA 1XU1A 4IEWA 2WO1A 3VZKA 3DKQA 4CDWA 5FPUA 1W28A 1MZ5A 2F6BA 2LTNA 3PJYA 3AYCA 2EF6A 3W9AA 4GMP3 1PO22 4ISQA 2UY9A 3VBHB 4LLOA 1W9TA 5A7SA 4DY3A 3VD4A 1ALYA 3SMHA 2W1QA 4CEWA 3ENRA 3O12A 1FMD1 1LGCA 1YJLA 2GC1A 4XOGA 3OPTA 3A22A 1OPMA 2OX0A 2XONA 1QNYA 1RITA 2DYCA 3BIEA 1RUH1 1ULGA 1UYYA 1X36A 5BNOC 1I1EA 3MLLA 3LDBA 3ZXFA 1VMFA 3H3UA 1R1A3 2WO2A 3HJRA 3DYPA 3DYMA 4XFGA 5JVVA 1RUOA 5A6YA 4QB6A 3JB4C 1AL21 1PIV2 4FPOB 3RQ0A 4IW3A 2B45X 5HXVA 2ZX3A 3ALQA 1ZZBA 1VALA 2JDKA 4XJAA 2AH2A 4Y1UA 2OQ6A 5FYYA 1XE8A 4BQYA 4NRQA 2ZMLA 4WM7C 3KT1A 4CDQC 1E5RA 4D94A 1OC1A 4XQDA 3I3DA 1GLHA 1EYBA 4XCBA 4YM3A 3KV4A 4DY5A 2BGPA 1NXMA 2ORXA 4HVQA 4GJZA 1PO13 1EAH3 2BFUS 1OLRA 2WBKA 2P3YA 1JOPA 2GMPA 5A6QA 1QOSA 1LCLA 1POV1 1UNBA 4OI4A 2QTWB 2JX9A 2ARCA 5C9AC 1UYXA 1SBDA 2PHUA 2D6LX 3BU0A 2Q30A 3MLJA 3VBUC 3IDCB 2YBPA 2DCZA 2LRPA 3DL3A 5CFCB 4JGYC 3I2HA 4Q4X2 4M4RA 1GMMA 2ADDA 2UWAA 4PI0A 1UZYA 3C7EA 3MGUA 2KD7A 1S55A 2R49A 1VBD2 3PNAA 4C1WA 4A41A 1EAH1 4B4QA 5FZCA 4WVVA 5I93A 3ATGA 4IV3B 2R063 1OH3A 2HWF2 1EP0A 5FMCA 3W58A 4FAHA 5AFBA 1UW8A 2OXBA 1FPN3 4KG8A 3NSTA 4KI5M 5FZAA 3ZXDA 3WW2A 3ZX7A 5LY1A 2D98A 3VGIA 4XFCA 3ZFEB 4Y24A 4N9IA 4YG0A 5C7GA 3K4DA 2WJSA 1PZ8A 1QJX1 2GMEA 3HNMA 3IPVB 1S4CA 2VMFA 2ET7A 4RGKA 2WO7A 4H14A 4B7EA 2RJLA 3ZN4A 3POBA 2WWUA 4E8DA 5K8SA 2R061 3NRUA 2BPA2 4Z92B 1GQPA 1SBFA 1VLNA 1O8SA 4XFAA 2DU1A 1W8ZA 5DUUA 2Q4SA 4AQ2A 4E8CA 4FTEA 2RS53 3VBSA 1J58A 4NAMA 4QPGA 4OUSA 2W92A 3ZFFC 1O4YA 1NCQC 4CTEA 4GB33 3GZUC 1V6KA 2J1EA 3KV6A 1OT5A 3TBDA 3BI3A 2HWB2 1J83A 4Y22B 2ZGPA 3MFAA 1OVPA 3N7MA 4Q4X1 3B9IA 3ECQA 4WZFA 4Y33A 3UGFA 1GICA 3VDCA 2E9QA 2V5YA 1EV12 4UW6A 3IBMA 5FYCA 3APBA 1SCSA 3PMSA 4IEYA 4Q4Y1 4YPJA 3VDDC 1GWLA 4XMIA 4CDUB 1GWKA 1H8TA 3BCWA 4EZ4A 4HXCA 4UXAA 2EICA 5KC6A 3IAPA 3KCYA 4JV4A 3OSDA 2PAEA 1H9WA 3U4SA 3K51A 4COVA 1OQDA 2JWPA 1CAXA 2VZSA 3LSEA 5D1IA 3SC7X 2YGLA 4FO9A 4X8PA 1TZOA 1R081 4OZXA 5IUQA 4TWTA 4MHRA 4QB1A 5C3QA 1RJ7A 4A7YA 3EBRA 1RVF1 4Y4YA 4UW3A 1ASJ3 3JCIA 5EJZB 1POV0 4A6SA 5FZ3A 1H6XA 2RV9A 4KBZA 4LPLA 1W0PA 2VUDA 2VNRA 3O1PA 2QQPA 1LOFA 1UKGA 3M3QA 3THDA 3I2OA 2DFCA 5C3RA 2W5FA 1XRUA 3WDUA 1BQPA 1TE1B 4U36A 1DIWA 1WLWA 3QD6A 1Z7S2 3J7MA 3PMEA 3RNSA 2DCKA 5DUWA 5I91A 3ITQA 2ZGNA 3NJVA 4YGDA 3AP7A 2H0BA 3KS7A 3WW4A 3JBG1 2JG9C 4LUMA 4B1MA 4NRPA 1VIWB 4D7SA 4IE4A 2ZHMA 1XYPA 3PUIA 2F4PA 5JWPA 4A6OA 4ZXEA 4LULA 2VXRA 2W52A 2WS91 3OOXA 3AP4A 5T50A 4NWWA 1YQ5A 2C6SA 4LNVA 1GQHA 1MS9A 1JZ5A 3VKNA 4M0NA 5A1FA 2WS92 5JIUA 1WLTA 4EN8B 1DF0A 2HJIA 3FE5A 3PVNA 4HSJA 3IMNA 1KDKA 2Q0AA 3QLQA 5IWFA 3J8F3 1QDOA 3AKQA 3LIHA 4BLIA 1SQ4A 5JOZA 1HV0A 4FI9A 2ET1A 3D8CA 1NCRB 3J7NA 3IDAA 4PBOA 3B69A 3SH4A 1ODMA 1MZEA 2YC4A 3K4AA 5FIXA 2VO5A 2YFZA 5GLWA 3GM8A 1BYHA 2DVGA 3C2UA 4AGVA 2PFWA 4R4ZA 2V4VA 1S0DA 4P5HA 3UL2A 3O5SA 2VUAA 4QKBA 4XDPA 3VBSC 1QJEA 2YU2A 3E6CC 4BM8A 5J37A 3LEIA 2DBIA 3GHMA 1BCXA 5E1RA 2W3JA 4QAWA 3ETPA 1ENXA 5KXDA 2WQ4A 2BVBA 1WCQA 2C5DA 3BTXA 4HFSA 5FLJA 3DXUA 4UFKA 3VL9A 2W1SA 5K4LA 1MEC3 3DEMA 4BQXA 2QQUA 1NX9A 2Y6LA 1W8HA 4WVMA 3VHRA 3VDDA 5IVCA 5JLVA 4PLOA 1WGPA 5JOYA 3WZ1A 5KXBA 2LROA 4N9HA 5EV7A 2BDRA 3O14A 1S2BA 5A3PA 1F5FA 5LCWL 3LZZA 3OCPA 3MV01 4XURA 1MVQA 3MW2A 4IGQA 5GZDA 1LENA 2XWJB 2VOXA 2HEVF 5FP9A 1JYXA 4IV1B 1X7NA 2YFUA 3AL6A 4GWIA 5I8YA 4XUTA 1C5HA 1RUI2 1GNHA 1IS3A 1VBD3 2Q1FA 2UY8A 1QGLA 2VR4A 2XLFA 4QM8A 4UI9L 3WDXA 4NWVA 3ZSEA 1D2QA 1QY4A 4AYUA 1F4HA 1HRV1 2VCAA 1V00A 4C1XA 3RYRA 3M70A 1UIJA 2R6QA 2VUJA 1X82A 2Y6JA 4QU1A 3KV9A 2OPKA 4QPYA 1RGSA 2BOJA 1WW4A 4CXWA 4D3WA 1C5IA 1VBB2 1NKGA 1ODNA 2JKBA 4Y1YA 2FDIA 5EFUA 3CU7A 3L2YA 3HNBM 4K1YA 1GU3A 1O7FA 1T6GC 4K7JA 2CYFA 4JGYA 1VBD1 1AHSA 1IS5A 4YGEA 3UKNA 3WHUA 1PIV1 3B7MA 3N9NA 2ZA9A 1XE0A 2R1BA 1O5LA 4Q4W3 3ZFFB 3ZXJA 4CXYA 1TMF1 2CAUA 2PLV1 1WMXA 3PUSA 4MHUA 5AC92 2CDOA 2OZ6A 4FFFA 5FOJB 3TEWA 3BODA 2P1BA 1E5IA 2BBVA 4JRLA 3KV5A 4CP9B 3E6DA 1MACA 1ZBA1 2A73B 3LA7A 3C7HA 4MO3M 3E5UA 1LOGA 4QM9A 1W6MB 3PDQA 3OYWB 4FOQA 5LRRA 3N36A 3OUJA 3ZFGC 2R1DA 4N53A 4QX1A 5KHIA 1OF4A 4Q27A 5JUVA 1ONAA 4FXKB 2VOKA 4E9KA 2CGOA 3S30A 4LKDA 1JZ6A 4RFT0 2ATFA 3MEPA 3MW4A 3ZSLA 5DAVA 1Y4WA 3LKJA 2FCTA 4W8JA 1E57A 4EYUA 1XNBA 1K5MA 3FBMA 1UMZA 2PHLA 2X5IA 3WP6A 1AYN3 1XYOA 2RMU3 2W47A 2W95A 3CKHA 4YW5A 3WF0A 3DN7A 4C0HA 3SLIA 3V56A 1WBFA 1ENRA 3AKTA 4BLJA 1W2AX 2C9KA 1SDWA 1ASJ2 4AI2A 4Q26A 3TB0A 1CN1A 3I8TA 1RUD3 2PHRA 3SCFA 4I0WB 4DXRA 3RWNA 1XQNA 1JYWA 3QBQA 4ZU5A 2HWC2 2E7TA 4FPLA 3Q8BA 2DDUA 1Y9MA 3IKWA 1Q8OA 5G04L 3GHNA 4XFBA 3SEEA 3WD5A 2VQAA 3H8RA 1RXGA 3U11A 3NV3A 3ES1A 1Y43B 3OGRA 1ENQA 4IV3A 4LA3A 4LBQB 4QXBA 1ULOA 3UYJA 2P4EA 2Y64A 2NZ9A 1UOGA 2P34A 2XVGA 2E32A 4OYUA 3AB0A 2ZXQA 1BKZA 2WNVA 3PVEA 5C5UA 1EPZA 3LA2A 4AFBA 2JICA 1SG3A 2W39A 2WFF1 3KVAA 4JCKA 4Q0UA 4XXAA 1IPKA 4IEZA 1SLIA 2Q8OA 5FUNA 5BNQA 1W9WA 2KA3A 5C3SA 1R64A 1AXYA 2DUQA 3A7QA 1OKQA 4AVVA 2XHNA 5FXVA 2XPJA 1OMIA 3EQEA 3KM5A 2WT2A 4Y20B 1WD3A 5CFCC 3ZMOA 4P9XA 2G1MA 1OPOA 1XNTA 4AEKA 1RUNA 4BZ4A 4Y26A 1PM4A 4QXKA 2RDRA 2C0ZA 1ZRDA 4AHYA 2YUEA 4WVMB 3VBRC 3R4SA 3SKVA 5EIYB 1H1AA 1R091 4L2NA 4QX7A 4G9SB 4RD7A 3VBFC 4AI1A 3U0ZA 3OBRA 1HXS2 3LF7A 1UF2C 4NHYA 2P6HA 3G6JB 2Z4FA 3ZOIA 4E2GA 1W90A 4UW5A 4HK9A 1MS8A 4W4ZA 5CISA 1OKOA 2YPJA 3BVCA 1VRH2 5H9QA 2JE7A 4NHXA 4DRRA 4CCDA 3AZYA 3HNYM 1S0JA 5APAA 1WA4A 2FDJA 4OCTA 1ULEA 4UFHA 3ZXGA 2EIEA 1CAUB 4PQQA 5KC5A 3I3EA 2Y26A 4KGQA 3UNPA 4GJYA 3H8XA 1JYCA 2A75A 1PVC3 1NZCA 3WF2A 1HJGA 3WG3A 3LSDA 3GZTB 4UF0A 3WX5A 1HX6A 4COZA 1GV9A 1YQ2A 2PTMA 4K9SA 4OUMA 5LA2A 2R7EB 2B46X 4X8NA 5FZOA 1QJU1 2RS12 1APNA 3EXUA 1VBC1 1TNRA 3C7OA 1LR5A 1W8NA 3QACA 4XZUG 2FCUA 1V6MA 5L73A 4BYYA 1JZ4A 3ZDVA 1ZZ8A 3TN91 3VBOB 2WSVA 2X10A 3HVDA 4MGKE 5FPAA 1X9TA 2V73A 5JXGA 4AQTA 1ULFA 5DAWA 1GZ9A 3UJOA 3WEZA 3I2GA 4HVRA 2XLAA 3MW3A 4Y1VA 4ZZ8A 4LO6B 2JDZA 2WZEA 2R32A 1I5ZA 1DDLA 2XDVA 1JI6A 4XEZA 2QDNA 4XFFA 4CP1A 5DDJ3 3VN4A 3WP3A 3W21A 1RUE1 4AZZA 1OSGA 3RJRA 3H8UA 1MVEA 2P17A 3N7JA 4GALA 5IVFA 3NV1A 1OI6A 1AF9A 3VKMA 1R1A1 4ZS2A 4YARA 5F6LB 3POYA 4XYXA 5T52A 2G4IA 3ZYHA 4JKMA 1GKBA 1PNGA 1DLCA 4MVTA 4RHV1 2IVJA 5FZHA 3FFQA 1UMHA 3R6SA 1KJRA 3ACHA 5IJRA 4K40A 1URXA 3A0NA 4QQLA 3OBAA 5CADA 3U14A 3OJBA 1VBC2 2WO3A 2WDBA 2PLV2 1JN2P 1UQXA 4HKOA 2VG9A 3PIJA 5GZEA 1V6JA 4LO5B 2VC9A 3KMHA 2B42B 1UO9A 3PL0A 4LLFA 3E6BA 3RWKX 2WC2A 3O0VA 3LEKA 4XJUA 3WG1A 1I3HA 5L19A 1PHMA 2AEZA 4HN1A 3WY6A 3ZFEA 5LK7B 2BFUL 4XDOA 2PA7A 3NJXA 4YVWC 2W08A 5FR3A 1OA2A 2BW8A 2AENA 4HLTA 4ES8A 4F7ZA 5FZ4A 4XBNA 3LD8A 4LJHA 2GP3A 1CX1A 4CEYC 4GH4C 3NJZA 2WLPA 2A3XA 1HB2A 4QQPA 3WF3A 1AL23 2VZPA 1VRBA 4OVEA 4AVCA 1RMU3 1BHGA 2HWD2 3QH7A 5FP8A 1M4WA 4WM7B 4CDQB 1ND3C 1XE7A 2ILMA 1DCSA 1K5MC 3LIGA 3N7LA 4CZSA 1CONA 1GYKA 5FY7A 1IKQA 4CCOA 4K3UA 1ZA7A 1AJOA 2O8QA 4GAZA 3DGTA 4UOJA 3ROUA 1PO11 1YC61 4Q5OA 4ZPIA 3TOJA 3ZIXA 4META 2WZPP 1H2NA 4LBQD 3RZLA 1EAH2 3GDBA 5FZ1A 5ACA2 1W39A 1Q5OA 2A6YA 4JQRA 1GOFA 1CESA 1TME2 3NAPC 3PU8A 5JI9A 4JGYB 1U5IA 2K9ZA 2CSGA 2VQUA 3VZNA 1GZWB 5CA6A 1V9U3 1Q56A 4TLGA 1OQ1A 2AREA 4IEQA 2XBO2 4GA9A 4QKNA 4BQ1A 2X8KA 3PUAA 4Q4X3 5LRSA 1CWPA 1RINA 4UAPA 2QVSB 3WLUA 1LU1A 2D3RA 1SEFA 4AFAA 4CU7A 3AXEA 2EIBA 1O4TA 2VOVA 2G9ZA 2GSYA 4H7LA 4P9IA 4KGGA 4LUKA 3O0WA 1CR7A 1WMDA 1O4ZA 2RG4A 3CZUA 1REEA 1UX7A 4C8DA 2IXHA 2HWF3 2OT7A 1HXS3 5DQ0A 3DKWA 4YVSA 1QWRA 4N7IA 1DYKA 2PELA 4FPEA 2IXJA 4SBVA 5EJ1B 1LJ7A 1QJX3 4A7KA 3T2PA 5I0TA 2ENRA 2D97A 3NKTA 3VDDB 1F4AA 2O0OA 1GBGA 4MOAA 4BISA 3FHQA 1XNCA 1JZ3A 5K0UB 1IPSA 4PCRA 4CDXB 1P8JA 3M2MA 5F3IA 4LKSA 2W1WA 1C1LA 4XHBA 2W9XA 2CU5A 4L0PA 1CPMA 1US3A 1AL0G 1WCDJ 1VRH1 4L9BA 3ILFA 2ZKLA 5F9TA 2RR13 3ILRA 4XJ8A 1DYPA 4EQVA 4C91A 5JR2A 5DPNA 4ASKA 4ZXKA 2Y33A 4JDMA 1MR5A 1FNZA 3JBG3 4IESA 4IE7A 3KGLA 1YCIA 4IEUA 4QPWA 5IFTA 5KHJA 1PK6A 3HQUA 1ZZ9A 2WWJA 4V1PA 3WCRA 4GH4A 4IE0A 3WG4A 2OS2A 4G3YC 3OY8A 4DXZA 1SACA 4LKFA 4IEVA 4MSVA 1JH5A 3H0OA 2J1RA 5C9AA 4JGZC 4F83A 5BNPB 1J3QA 4XE9A 4CDWB 2ZGMA 3OPWA 4CEWC 2OYZA 4Q4V3 3ZO0B 1AUYA 3X29B 2FBEA 5JSPA 3LFIA 4KH9A 1DBNA 5F37A 1AR72 1ASJ1 3IPVA 2BNNA 4OHVA 2Q5TA 2W1UA 5FQ0A 4N8MA 3LPFA 4ES9A 5C5TA 4JQTA 1KGYA 2H0VA 2XJPA 3KVBA 5FYHA 4XTMA 2AACA 5DMYA 1CAVA 1EUTA 4P9LA 3NJYA 4NPMA 4Y3OA 2WUHA 4M3CE 1RXFA 2UWCA 1JW6A 5D8AB 1MPXA 5FDBA 3PUHA 3Q9OA 4Q4V1 3CZJA 2J1UA 4I3PA 4W6WA 4EWDA 1O3RA 1JUIA 1S0CA 5C4WA 2NQYA 1FV2A 4PDWA 5DXDA 4L92A 3V0AA 5GJ6A 1UU4A 4AI8A 3ST7A 4ATEA 1VMJA 4KQ7A 4N43C 2ZHLA 2AZ5A 1ULPA 2AC1A 2PHFA 2IXCA 1IG0A 3Q8CA 4NIIA 3GALA 5FZ6A 4IGOA 3VBUA 1QKQA 4XF4A 3FMGA 4YVWB 3J8F1 2NMOA 1E5SA 4M4PA 4R52A 4NROA 1X33A 5FZGA 2RS33 5HBAA 4LBNA 4XUOA 5J36A 1WW5A 3S7EA 1PVXA 1YYNA 4ORFA 3TNPB 4XVHA 1G9DA 1YQ6A 1C1FA 1Q8VA 4FQ4A 1QF3A 3SHRA 4M00A 1XNDA 4BB3A 5LWBA 1BMV2 1NA1C 2D3PA 1K3IA 3VBFA 3WNPA 4ZKTB 1PO23 1GR3A 4NHLA 4D6SA 1AL22 4HSLA 1LRHA 5SV8A 1F5JA 2ZX2A 4QXHA 1RUD2 4QHBA 2DUPA 4UYBA 3BU7A 4FTBA 1FOD2 3I2DA 1W8WA 2HWC3 4YW3A 2E63A 2IZWA 1QQP3 2LM3A 2V4AA 2ZGQA 4G4FA 2C1FA 2BGCA 1YFYA 5F6KA 3EB7A 2HEWF 3DECA 4CCKA 1JTZX 1S0BA 1UZZA 2RDNA 3AK0A 3JD73 2JDNA 4XABA 3A21A 1FATA 1JOBA 1PIV3 1JXNA 4ISRA 3POFA 4YG6A 4UFMA 3S57A 4GWJA 2FDKA 1NE4A 3ZXEA 4AAXA 5DUXA 2DTYA 2EVXA 2VTXA 4LIVA 1IQAA 4RS5B 3AZXA 4RGGA 3AYAA 1V9U2 1HIXA 2R072 1G9CA 1W6NA 2O1QA 1G6NA 1QMJA 2G19A 4MXWB 1DQ5A 3DUIA 4XETA 5LA0A 1S1AA 2ARXA 3ZXAC 1YNAA 3QOPA 4EZHA 3MLKA 3TYJA 1RUH2 1HRV3 2VMDA 2I45A 4WV8A 1DHKB 1H2LA 1UOBA 5FKCA 3RGBA 4AF9A 4O7XA 1YLLA 3DPRA 5JXHA 1MS0A 5AVAA 4OHXA 2WNOA 4FPCA 2MEV1 3EMRA 4XJWA 3AMHA 1HB3A 4NVPA 2Z5WA 5LEKA 2Z79A 5BNNC 2EAAA 3SH5A 4GWMA 4R8HA 3UGGA 1AYN1 3N4MA 2QZ3A 1MZ6A 2VBDA 2HH9A 2PHWA 3IWZA 3SISA 3MF9A 1YEWA 3AMQA 4CP0A 3POIA 1GSLA 3U4XA 3MPPG 5KHGA 4CEYA 3M3OA 4JC1A 3ZYJB 2ZABA 4QX5A 4CDWC 1OLMA 4IERA 2VGDA 3E1F1 5ANNA 5J09A 5FYUA 4TTGA 3VLBB 4XAAA 5C70A 1OD5A 3WNXA 4KMQA 2PMWB 2ZJCA 1ND3A 5FUPA 3RMXA 5JOXA 5C9AB 2QCSB 3NNGA 5IYYA 5AC93 5IK5A 1RC6A 4I02A 3VBUB 2VOWA 2OVUA 3U78A 5ABJA 2DV9A 1K42A 1X9PA 2IC1A 1BZWA 3NVCA 4LR4A 2DURA 3U07A 5CB7A 5LBBA 4Q1RA 4UBGA 4JHZA 5LZ6A 4ET7A 4XF3A 5FUIA 2JKXA 4OI1A 3WQ7A 5FZMA 3K3OA 1IHMA 2ZGKA 2VZVA 1UOJA 2C26A 4TN7A 3O1UA 1I6XA 3WCSA 3LQCA 2WFF3 1YJKA 5FMOL 4CP2A 3KB5A 2WFPA 3JXSA 4K20A 4DS0A 1XU2A 5JCTA 4ZS3A 1BK1A 2I74A 4W6XA 1OOPC 2WA4A 2ERFA 3CJXA 4QKFA 4Y5SA 4BDVB 1IQDC 5CEHA 3TNQA 4RN5A 3MIFA 2WN3A 4FPKA 3D5OA 1RUG1 4S2GA 2RMU2 1RUJ3 4Q1PA 1WCSA 2VE1A 2JG8A 1KQRA 4LTAA 3S7IA 1YFWA 1A34A 5TSWA 4W65A 1UXZA 5IHRA 4HMZA 1CD3G 5KBFA 1UY3A 1AYM3 2PYTA 5IFPA 1KDMA 3I3MA 4JKKA 1GZWA 1XPWA 3N7KA 1C57A 5HV4A 1J84A 1ENSA 3SCHA 4ZU4A 3O1MA 2XJRA 5IVJA 1F35A 3ILNA 4N43B 5DABA 3TEXA 5EXOA 3USSA 1SFNA 1G9BA 3FJSA 1SCRA 4JAAA 2VPVA 1N1TA 2DCTA 3GF6A 4P9GA 3BYWA 3OUIA 1DQ0A 3OD0A 2YPDA 4L8QA 3TAYA 3KLSA 4QPGB 2VY0A 3K2OA 1VBB1 2YG0A 1AYM1 1JMUB 3PJQA 4FP2A 4I30A 1QJY1 3Q8FA 2R041 2EIGA 5IVEA 1RUI1 3DV8A 1PVC1 5CNAA 2XG3A 1A78A 5F5CA 1UU5A 3SQOA 1BEV1 3OUHA 2FDFA 3ZYGA 1QH7A 4XDQA 1DZRA 3MYXA 2B9VA 2XKOA 1ZM1A 4QDRA 2C4XA 3C3VA 3HR9A 5KHHA 4CCEA 5BNNA 2Y8KA 2NYYA 1QJU3 1UMIA 5CKQA 2E6VA 3BOPA 3WUCA 1M06G 3LOBA 1T2XA 4GULA 5T5LA 4B4RA 4DUXA 4C90A 2JDAA 3E5XA 1PGW1
chains in the Genus database with same CATH topology
1WKYA 2ZXQA 3VD7A 4LHSA 3OB8A 1SG3A 1W9SA 2VMEA 4TXWA 1W9WA 1I5PA 1R64A 2QQNA 3A7QA 4CUBA 2PQSA 1O8PA 2XHNA 3EYPA 2BZDA 2VZTA 3GGLA 4A42A 2VJXA 5A1AA 2DCJA 2QQMA 3C7FA 3WNNA 3UETA 3BN6A 1XNTA 2YB7A 2E26A 4BK4A 3DYOA 2B4KA 3OGVA 1H6YA 3CQOA 3SKVA 5EIYB 2WQ8A 2J22A 2Z4FA 1NAEA 4CVUA 4W4ZA 4CUCA 3P6BA 2E33A 2VOTA 3WF4A 3HNYM 1K45A 3W5NA 2EIEA 4PQQA 3I3EA 3I3BA 2CDPA 4P5YA 2J1TA 2VTFA 4QB2A 3UNPA 3ABZA 3WF2A 1YQ2A 5LA2A 1SDDB 4HG6B 4DXTA 2R7EB 4ARYA 3MV11 2VZ1A 4CUAA 3C7OA 4XZUG 1W8NA 1JZ4A 2BERA 1UYZA 2X10A 5F7UA 2VM9A 2VMCA 2JE8A 5JXGA 3P1IA 3I2KA 1L7QA 1UY2A 3WEZA 3I2GA 3THCA 4ZZ8A 2WYSA 2W94A 3CDZB 2WZEA 4CU6A 1JI6A 4D8MA 5C71A 1JYVA 1PMHX 2E31A 4DXSA 3K75B 1XC6A 4OMDA 2QQJA 3W5MA 3AC0A 3ACGA 1RYYA 1GUIA 4JKMA 1DLCA 5JMOA 2VZUA 2VCCA 1UMHA 3ACHA 5IJRA 3OBAA 3VD9A 2WO3A 2WDBA 2J7MA 4XUNA 3VD5A 1W8OA 4XUPA 3BGAA 2VC9A 3WNOA 5CZKA 2WN2A 2W91A 2WAOA 3LEKA 4A45A 2HYXA 3ACIA 3MO4A 3T0BA 3T08A 3MBWA 3UESA 4QDQA 3NJXA 4QX3A 1CX1A 3WNLA 2ZEXA 3CMGA 2WO1A 3WF3A 2VZPA 1CIYA 3WSOA 3VD4A 1BHGA 2E32A 1W9TA 2W1QA 3FN9A 4P08A 3A22A 2XONA 1UYYA 3VD3A 2VZQA 2X05A 4UOJA 3HEIA 2WO2A 3HJRA 3DYPA 3DYMA 4QB6A 2HLEA 5G05L 1UXXX 3GDBA 4PT6A 1GOFA 4KWUA 5LA1A 2VQUA 3SKJE 2BGOA 3K46A 1JU4A 3I3DA 1UY0A 3I2JA 1PX3A 2BGPA 2ORXA 4UAPA 4MGQA 2WBKA 5HXMA 4CU7A 2EIBA 4MADA 2J1AA 4IUGA 1UYXA 3CZUA 4OZOA 1UX7A 1DYOA 2EIDA 2QQOA 2VZRA 3OGSA 2ID4A 3IAQA 2WZ8A 4QDSA 3T0AA 5DQ0A 3I2HA 5HPOA 1JYNA 4M4RA 1GMMA 1UWWA 5EJ1B 3C7EA 4OUEA 2KD7A 1UZ0A 3T2PA 1F4AA 4A41A 3HOBA 4MOAA 3FHQA 4QX0A 1JZ3A 2QQLA 2XOMA 1P8JA 4LKSA 2W1WA 2W9XA 4P02B 4DEQA 4L0PA 1US3A 4KI5M 5C7GA 4PF1A 5B4XA 3K4DA 5JR2A 3HNMA 5DPNA 2VMFA 2Y6GA 4QPWA 4DEVA 5IFTA 2VZ3A 4E8DA 3NRUA 1GQPA 3GXUA 1O8SA 3I2IA 4E8CA 3LEGA 4A3ZA 2V72A 2W92A 2J1RA 2XQXA 2J1EA 1OT5A 1GNYA 1J83A 1US2A 1DP0A 3VDCA 3ECQA 2WABA 2RVAA 2Y6HA 3ACFA 2W1UA 4YPJA 1K12A 4BJ0A 3LPFA 1KGYA 2EICA 2VZOA 3IAPA 5DN2A 5DMYA 1EUTA 1CZTA 1OF3A 2WUHA 4CU8A 2VZSA 1LNSA 1MPXA 2ZEYA 3PUHA 2W87A 3CZJA 2J1UA 4QB1A 5EJZB 1HN1A 3HPNA 1H6XA 2RV9A 4LPLA 4BXSV 1CZVA 4P00B 3THDA 3OEAA 1ULPA 2W5FA 3VDBA 2ZEWA 2DCKA 2V5DA 1JU3A 1JZ7A 3NJVA 4M4PA 1UY4A 1OD3A 4XUOA 2QBXA 4XVHA 3PUIA 4ZY9A 4BK5A 4A6OA 4ZXEA 1K3IA 1EUUA 2WAAA 3WNPA 1JZ5A 2LS6A 5JXJA 3D3AA 1JHJA 3T2QA 3LE0A 4FI9A 1KEXA 2LW8A 3IDAA 1XNAA 3EB7A 3DECA 2YC4A 3K4AA 2VO5A 2YFZA 3GM8A 3A21A 2V4VA 2J1VA 5B4NA 4GWJA 2RJ2A 1L7RA 3LEIA 4AAXA 2W3JA 4QAWA 3ETPA 3HN3A 1WCQA 1JZ2A 3CIHA 2L9LA 3I2FA 2W1SA 3ZM8A 2JD9A 2Y6LA 1NX9A 1CZSA 3C7GA 5LA0A 2Y6KA 3NQHA 2QQKA 2VMDA 4MGSA 2ORZA 5JXHA 5I0DA 5LCWL 4XURA 3MV01 1UY1A 1GOGA 4RYDA 4JX0A 4JKLA 3T2OA 1JYXA 2YFUA 4GWIA 4XUTA 5C70A 4AG4A 2VR4A 4UI9L 1O59A 3FL7A 3F2ZA 4ARXA 3MUZ1 1F4HA 2VCAA 3E1F1 4D0QA 4TTGA 4W50A 4KMQA 2Y6JA 5JXIA 1NKGA 1JZ8A 4CU9A 1D7PM 3NNGA 3HNBM 5IYYA 1GU3A 3IIIA 5CYYA 1K42A 1TVGA 4A4AA 3FHAA 2BBAA 4JHZA 3WQBA 1PMJX 4ET7A 5FUIA 2JKXA 2VZVA 2C26A 1NUKA 2CDOA 3LQCA 3WF1A 3K77A 4ZZ5A 3WNMA 3JXSA 1GOHA 3SEPA 4QX2A 4MO3M 1TG7A 3C7HA 3IB3A 4BDVB 1IQDC 4RN5A 2WN3A 1W99A 4OMCA 3T09A 4A44A 4Z2AA 4QX1A 1OH4A 1OF4A 5JUVA 1UXZA 5IHRA 3A23A 1JZ6A 1UY3A 5IFPA 4JKKA 2ZEZA 4GZ9A 4W8JA 1XPWA 2VCBA 4XUQA 1J84A 2W46A 2X09A 3I97A 2W95A 2W47A 3CKHA 3J7HA 3OEBA 3WF0A 2QQIA 2VQTA 2C9KA 3WNKA 3U37A 3LPGA 4LQRA 2J1SA 3OG2A 4DUVA 1JYWA 3K4ZA 4DXRA 1PX4A 1SHWB 3VDAA 2YG0A 3MUY1 2DDUA 2OKXA 5G04L 5J1XA 3T0DA 3SEEA 2VL4A 2B9VA 2YC2A 4QDRA 3C8XA 2C4XA 3OGRA 1ULOA 2Y8KA 1UMIA 1T2XA 4DUXA 4DUWA 1W0NA 2Y64A 4OYUA 2JDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKY A;  2ZXQ A;  3VD7 A;  4LHS A;  3OB8 A;  1SG3 A;  1W9S A;  2VME A;  4TXW A;  1W9W A;  1I5P A;  1R64 A;  2QQN A;  3A7Q A;  4CUB A;  2PQS A;  1O8P A;  2XHN A;  3EYP A;  2BZD A;  2VZT A;  3GGL A;  4A42 A;  2VJX A;  5A1A A;  2DCJ A;  2QQM A;  3C7F A;  3WNN A;  3UET A;  3BN6 A;  1XNT A;  2YB7 A;  2E26 A;  4BK4 A;  3DYO A;  2B4K A;  3OGV A;  1H6Y A;  3CQO A;  3SKV A;  5EIY B;  2WQ8 A;  2J22 A;  2Z4F A;  1NAE A;  4CVU A;  4W4Z A;  4CUC A;  3P6B A;  2E33 A;  2VOT A;  3WF4 A;  3HNY M;  1K45 A;  3W5N A;  2EIE A;  4PQQ A;  3I3E A;  3I3B A;  2CDP A;  4P5Y A;  2J1T A;  2VTF A;  4QB2 A;  3UNP A;  3ABZ A;  3WF2 A;  1YQ2 A;  5LA2 A;  1SDD B;  4HG6 B;  4DXT A;  2R7E B;  4ARY A;  3MV1 1;  2VZ1 A;  4CUA A;  3C7O A;  4XZU G;  1W8N A;  1JZ4 A;  2BER A;  1UYZ A;  2X10 A;  5F7U A;  2VM9 A;  2VMC A;  2JE8 A;  5JXG A;  3P1I A;  3I2K A;  1L7Q A;  1UY2 A;  3WEZ A;  3I2G A;  3THC A;  4ZZ8 A;  2WYS A;  2W94 A;  3CDZ B;  2WZE A;  4CU6 A;  1JI6 A;  4D8M A;  5C71 A;  1JYV A;  1PMH X;  2E31 A;  4DXS A;  3K75 B;  1XC6 A;  4OMD A;  2QQJ A;  3W5M A;  3AC0 A;  3ACG A;  1RYY A;  1GUI A;  4JKM A;  1DLC A;  5JMO A;  2VZU A;  2VCC A;  1UMH A;  3ACH A;  5IJR A;  3OBA A;  3VD9 A;  2WO3 A;  2WDB A;  2J7M A;  4XUN A;  3VD5 A;  1W8O A;  4XUP A;  3BGA A;  2VC9 A;  3WNO A;  5CZK A;  2WN2 A;  2W91 A;  2WAO A;  3LEK A;  4A45 A;  2HYX A;  3ACI A;  3MO4 A;  3T0B A;  3T08 A;  3MBW A;  3UES A;  4QDQ A;  3NJX A;  4QX3 A;  1CX1 A;  3WNL A;  2ZEX A;  3CMG A;  2WO1 A;  3WF3 A;  2VZP A;  1CIY A;  3WSO A;  3VD4 A;  1BHG A;  2E32 A;  1W9T A;  2W1Q A;  3FN9 A;  4P08 A;  3A22 A;  2XON A;  1UYY A;  3VD3 A;  2VZQ A;  2X05 A;  4UOJ A;  3HEI A;  2WO2 A;  3HJR A;  3DYP A;  3DYM A;  4QB6 A;  2HLE A;  5G05 L;  1UXX X;  3GDB A;  4PT6 A;  1GOF A;  4KWU A;  5LA1 A;  2VQU A;  3SKJ E;  2BGO A;  3K46 A;  1JU4 A;  3I3D A;  1UY0 A;  3I2J A;  1PX3 A;  2BGP A;  2ORX A;  4UAP A;  4MGQ A;  2WBK A;  5HXM A;  4CU7 A;  2EIB A;  4MAD A;  2J1A A;  4IUG A;  1UYX A;  3CZU A;  4OZO A;  1UX7 A;  1DYO A;  2EID A;  2QQO A;  2VZR A;  3OGS A;  2ID4 A;  3IAQ A;  2WZ8 A;  4QDS A;  3T0A A;  5DQ0 A;  3I2H A;  5HPO A;  1JYN A;  4M4R A;  1GMM A;  1UWW A;  5EJ1 B;  3C7E A;  4OUE A;  2KD7 A;  1UZ0 A;  3T2P A;  1F4A A;  4A41 A;  3HOB A;  4MOA A;  3FHQ A;  4QX0 A;  1JZ3 A;  2QQL A;  2XOM A;  1P8J A;  4LKS A;  2W1W A;  2W9X A;  4P02 B;  4DEQ A;  4L0P A;  1US3 A;  4KI5 M;  5C7G A;  4PF1 A;  5B4X A;  3K4D A;  5JR2 A;  3HNM A;  5DPN A;  2VMF A;  2Y6G A;  4QPW A;  4DEV A;  5IFT A;  2VZ3 A;  4E8D A;  3NRU A;  1GQP A;  3GXU A;  1O8S A;  3I2I A;  4E8C A;  3LEG A;  4A3Z A;  2V72 A;  2W92 A;  2J1R A;  2XQX A;  2J1E A;  1OT5 A;  1GNY A;  1J83 A;  1US2 A;  1DP0 A;  3VDC A;  3ECQ A;  2WAB A;  2RVA A;  2Y6H A;  3ACF A;  2W1U A;  4YPJ A;  1K12 A;  4BJ0 A;  3LPF A;  1KGY A;  2EIC A;  2VZO A;  3IAP A;  5DN2 A;  5DMY A;  1EUT A;  1CZT A;  1OF3 A;  2WUH A;  4CU8 A;  2VZS A;  1LNS A;  1MPX A;  2ZEY A;  3PUH A;  2W87 A;  3CZJ A;  2J1U A;  4QB1 A;  5EJZ B;  1HN1 A;  3HPN A;  1H6X A;  2RV9 A;  4LPL A;  4BXS V;  1CZV A;  4P00 B;  3THD A;  3OEA A;  1ULP A;  2W5F A;  3VDB A;  2ZEW A;  2DCK A;  2V5D A;  1JU3 A;  1JZ7 A;  3NJV A;  4M4P A;  1UY4 A;  1OD3 A;  4XUO A;  2QBX A;  4XVH A;  3PUI A;  4ZY9 A;  4BK5 A;  4A6O A;  4ZXE A;  1K3I A;  1EUU A;  2WAA A;  3WNP A;  1JZ5 A;  2LS6 A;  5JXJ A;  3D3A A;  1JHJ A;  3T2Q A;  3LE0 A;  4FI9 A;  1KEX A;  2LW8 A;  3IDA A;  1XNA A;  3EB7 A;  3DEC A;  2YC4 A;  3K4A A;  2VO5 A;  2YFZ A;  3GM8 A;  3A21 A;  2V4V A;  2J1V A;  5B4N A;  4GWJ A;  2RJ2 A;  1L7R A;  3LEI A;  4AAX A;  2W3J A;  4QAW A;  3ETP A;  3HN3 A;  1WCQ A;  1JZ2 A;  3CIH A;  2L9L A;  3I2F A;  2W1S A;  3ZM8 A;  2JD9 A;  2Y6L A;  1NX9 A;  1CZS A;  3C7G A;  5LA0 A;  2Y6K A;  3NQH A;  2QQK A;  2VMD A;  4MGS A;  2ORZ A;  5JXH A;  5I0D A;  5LCW L;  4XUR A;  3MV0 1;  1UY1 A;  1GOG A;  4RYD A;  4JX0 A;  4JKL A;  3T2O A;  1JYX A;  2YFU A;  4GWI A;  4XUT A;  5C70 A;  4AG4 A;  2VR4 A;  4UI9 L;  1O59 A;  3FL7 A;  3F2Z A;  4ARX A;  3MUZ 1;  1F4H A;  2VCA A;  3E1F 1;  4D0Q A;  4TTG A;  4W50 A;  4KMQ A;  2Y6J A;  5JXI A;  1NKG A;  1JZ8 A;  4CU9 A;  1D7P M;  3NNG A;  3HNB M;  5IYY A;  1GU3 A;  3III A;  5CYY A;  1K42 A;  1TVG A;  4A4A A;  3FHA A;  2BBA A;  4JHZ A;  3WQB A;  1PMJ X;  4ET7 A;  5FUI A;  2JKX A;  2VZV A;  2C26 A;  1NUK A;  2CDO A;  3LQC A;  3WF1 A;  3K77 A;  4ZZ5 A;  3WNM A;  3JXS A;  1GOH A;  3SEP A;  4QX2 A;  4MO3 M;  1TG7 A;  3C7H A;  3IB3 A;  4BDV B;  1IQD C;  4RN5 A;  2WN3 A;  1W99 A;  4OMC A;  3T09 A;  4A44 A;  4Z2A A;  4QX1 A;  1OH4 A;  1OF4 A;  5JUV A;  1UXZ A;  5IHR A;  3A23 A;  1JZ6 A;  1UY3 A;  5IFP A;  4JKK A;  2ZEZ A;  4GZ9 A;  4W8J A;  1XPW A;  2VCB A;  4XUQ A;  1J84 A;  2W46 A;  2X09 A;  3I97 A;  2W95 A;  2W47 A;  3CKH A;  3J7H A;  3OEB A;  3WF0 A;  2QQI A;  2VQT A;  2C9K A;  3WNK A;  3U37 A;  3LPG A;  4LQR A;  2J1S A;  3OG2 A;  4DUV A;  1JYW A;  3K4Z A;  4DXR A;  1PX4 A;  1SHW B;  3VDA A;  2YG0 A;  3MUY 1;  2DDU A;  2OKX A;  5G04 L;  5J1X A;  3T0D A;  3SEE A;  2VL4 A;  2B9V A;  2YC2 A;  4QDR A;  3C8X A;  2C4X A;  3OGR A;  1ULO A;  2Y8K A;  1UMI A;  1T2X A;  4DUX A;  4DUW A;  1W0N A;  2Y64 A;  4OYU A;  2JDA A; 
#chains in the Genus database with same CATH topology
 1WKY A;  3AKS A;  4BIO A;  3VD7 A;  2WA3 A;  3AL5 A;  2GMM A;  3UKV A;  5JZG B;  3OB8 A;  4QX8 A;  4AVA A;  3U10 A;  1CPN A;  1PGS A;  1SPP B;  4XF0 A;  5DUV A;  5JAX A;  1ZX5 A;  1XOY A;  2MHF A;  2VME A;  1ZRI A;  4JHT A;  3VBH C;  2WWS A;  2QQN A;  4MGZ E;  5GKA C;  4MGI E;  5BPX A;  4AE2 A;  3EYP A;  4YWA A;  4XIK A;  4A42 A;  1AR9 1;  2VJX A;  4AGG A;  5A1A A;  2QQM A;  3C7F A;  3WNN A;  2Z69 A;  5T54 A;  4Y4R A;  1N3P A;  3JD7 2;  5ABJ B;  1LHV A;  1RMU 2;  1HQW A;  2HWD 3;  2XML A;  3DYO A;  1RUE 3;  1WLC A;  1O5U A;  3LWC A;  1ND2 C;  1H6Y A;  2QQW A;  3CQO A;  5HCH A;  1FV3 A;  3GCW A;  5CVR A;  5A7Q A;  5EPA A;  3WDV A;  4CCJ A;  3O0X A;  1SLL A;  2XJQ A;  1V6O A;  1B35 B;  1BBT 1;  2J22 A;  5H9S A;  4P9J A;  5F3G A;  2ZGT A;  1NAE A;  2HBU A;  1S0I A;  3AFG A;  4XAE A;  5L9R A;  4PDW C;  2ADE A;  1BVP 1;  4S2D A;  4LBM A;  3VZJ A;  1ACC A;  1DGL A;  2YDE A;  2QE3 A;  5C8C B;  2RS1 3;  2R04 2;  1LHU A;  5FXZ A;  3VUO A;  1TME 3;  1W8U A;  3FLR A;  1KRI A;  2Y60 A;  4P5Y A;  4QB2 A;  4ZHN A;  2FZ1 A;  4UFL A;  1J3P A;  3ABZ A;  3AZV A;  1I9R A;  2XBO 3;  4QQO A;  3V64 A;  1U12 A;  4KL1 A;  2KXL A;  5I8S A;  3HIF A;  1OLQ A;  2JEN A;  5FY9 A;  3RZZ A;  4FTS A;  2D44 A;  1HB1 A;  5E6H A;  3MV1 1;  4NOT A;  1ND3 B;  3H3Z A;  3J26 N;  4R4X A;  4CUA A;  4NIG A;  4CRQ A;  5FKB A;  5T5P A;  4CCC A;  2X5I B;  3KWV A;  2VU9 A;  5CFC A;  4QGL A;  4CDX A;  1YIF A;  2BER A;  1UYZ A;  3GYD A;  2VMC A;  1DZT A;  4L97 A;  2K0G A;  3MID A;  1FNY A;  3P1I A;  2XVL A;  1BMV 1;  5DDJ 2;  3RI8 A;  2EXH A;  3PU3 A;  5A32 B;  1LB2 A;  1UY2 A;  5FV3 A;  3L9J T;  2OPW A;  5ACA 1;  2CV6 A;  5KXC A;  1AXK A;  3THC A;  2PXJ A;  2YXS A;  4WBB A;  2MPF A;  1AR8 2;  4LEJ A;  3DPR C;  4GMP 1;  4QWN A;  4CU6 A;  1DGW X;  5JOW A;  1G9A A;  3CJI A;  1LOD A;  2XWB B;  1UCX A;  2Z2S B;  1FMD 3;  1VAM A;  5F2S A;  4YM0 A;  3MIE A;  1PMH X;  4B4P A;  4M3C F;  1KS4 A;  1LUL A;  2E31 A;  2WNU B;  5HCA A;  3MIB A;  1LEM A;  1CVN A;  4D7T A;  4DXS A;  5EQU A;  5JPN B;  5AVP A;  3NO8 A;  1RUC 3;  1PZ7 A;  4FPF A;  1OOP B;  2GAL A;  3ACG A;  3AM2 A;  2WFF 2;  2A71 A;  1TEI A;  2D93 A;  1RUF 3;  2WZR 2;  4LE3 A;  3AXD A;  4YW7 A;  2FDG A;  5A3W A;  4ZON A;  5BNO A;  3RI9 A;  4YZ5 A;  1MS1 A;  1Q3E A;  4HT1 T;  2XQR A;  4CDU C;  4FOW A;  4PLN A;  1QU0 A;  4BQ3 A;  1W8O A;  1H1I A;  4XUP A;  1H2K A;  1HV1 A;  1NA1 B;  1VBA 2;  2RJK A;  2Y0O A;  1RUC 1;  4EJR A;  2NM1 A;  1POV 3;  1C8M 1;  3I49 A;  3ES4 A;  5CZK A;  3TWI A;  5C6C A;  5A3O A;  3M8L A;  5LBE A;  4BQ2 A;  3JQX A;  4V2V A;  4WM8 B;  1RUF 1;  4A45 A;  2BQP A;  2MEV 2;  3ME2 A;  1HXS 1;  1AR8 1;  2ZMN A;  4OQ9 A;  3ACI A;  5FY0 A;  3UES A;  3WVJ A;  2ZS6 B;  4LMF A;  2CWM A;  2TUN A;  2WNV B;  4HN0 A;  4EN6 B;  4URT A;  2HBT A;  4D6Q A;  4H55 A;  4DRV A;  1GNZ A;  1YRZ A;  4W6Y A;  2D3S A;  4EN0 A;  1MS5 A;  4LK6 A;  2ZEX A;  3CMG A;  4XBL A;  5FMB A;  1WCU A;  3I3Q A;  1CAU A;  3LOI A;  4MZU A;  1CIY A;  2VUL A;  5JSO A;  2D40 A;  3VKO A;  1YQ8 A;  3WSO A;  4CP9 A;  5FZF A;  1Z0H A;  4ERO A;  4X6R B;  4BQW A;  3KF5 A;  4F8A A;  3GNE A;  2GC0 A;  5CFD C;  3H9A A;  3OBZ A;  4DNY A;  4BWO A;  5J3U A;  4P08 A;  2JIJ A;  2YGM A;  2GU9 A;  3CBN A;  1EV1 1;  4HZF A;  3ZMN A;  4QT6 A;  5JZG C;  2ZAA A;  3ZDS A;  5BYN A;  4CDX C;  3JZV A;  3VD3 A;  2VZQ A;  3KD4 A;  2X05 A;  3HEI A;  5K9Y A;  3ORJ A;  2RS3 2;  5FQ0 B;  3WR0 A;  5G05 L;  1UXX X;  2K2S A;  3HT2 A;  5FAX A;  4BOW A;  2GZW A;  4BU2 A;  2C24 A;  2D7F A;  3I59 B;  1N3Q A;  4KWU A;  1MQT B;  1RVF 2;  1W8T A;  4FOV A;  4LO8 A;  1B35 A;  4AFC A;  3SKJ E;  2HYK A;  2ZX1 A;  4AK3 A;  4SLI A;  1JU4 A;  5ANQ A;  3ZFG A;  1G9F A;  3P3N A;  3W20 A;  5JPM B;  1GZT A;  2BNM A;  4N53 C;  1UY0 A;  4MLO A;  5FXW A;  3T4V A;  2VMI A;  3I2J A;  3RZG A;  4MGQ A;  5ERL A;  1HDK A;  3POJ A;  2XL9 A;  3SNM A;  2ARA A;  3CJI B;  3RJ2 X;  2ZBJ A;  2N7G A;  4RHV 2;  3T1M A;  2HEY F;  4MAD A;  4YZ3 A;  1RUE 2;  2R0F A;  4IUG A;  1HQL A;  5FPL A;  1QQP 2;  3CNA A;  4OZO A;  2X5I C;  4WM8 C;  4KWJ A;  1GP4 A;  2GNB A;  2EID A;  4X6Q B;  2WLQ A;  2QQO A;  2OZJ A;  1N1S A;  1ULD A;  4ONU A;  3ZXK A;  4AAP A;  2WZ8 A;  4QDS A;  2Z42 A;  1VRH 3;  1FYU A;  1QNW A;  2NLR A;  1U5Z A;  5E88 A;  1UWW A;  1XSR A;  4OUE A;  3AJY A;  1UZ0 A;  2D6N A;  1H2M A;  2RR1 2;  3HOB A;  3ZN6 B;  3MIC A;  3VHO A;  2A6Z A;  2JDP A;  4K6B A;  5F5A A;  4S2F A;  1HJF A;  4YW1 A;  1E5H A;  4BMB A;  1ZRC A;  4QX0 A;  2QQL A;  3TEZ A;  2XOM A;  2Y6F A;  3AP6 A;  5A33 B;  1XSQ A;  2DF7 A;  1UN1 A;  2EXI A;  4IE5 A;  2ZGR A;  5A7W A;  4DOU A;  4HPK B;  2E53 A;  2Y34 A;  4DEQ A;  2JG9 B;  3KCC A;  5T55 A;  4XIL A;  4H7M A;  2FD8 A;  4Q0P A;  3VB9 A;  1SZB A;  1W2O A;  4HKL A;  4DB5 A;  3D0J A;  4EWE A;  3ZIW A;  3NAP A;  4PF1 A;  5B4X A;  2BTV C;  4MX3 A;  5J48 A;  3MFC A;  1RUH 3;  4OHW A;  1C8M 2;  2VZ3 A;  4KG0 A;  1WW7 A;  3FC0 A;  2ZHN A;  3GXU A;  4Q4V 2;  3I2I A;  4Q0Q A;  4AED B;  3OBT A;  3LEG A;  4PI2 A;  2V72 A;  2CGP A;  4R9C A;  2VUC A;  2D6P A;  4RFR B;  2G9G A;  3PTY A;  4E4Z A;  1OFS A;  3VBH A;  2P37 A;  2TNF A;  1KD7 A;  1Y7B A;  2XQX A;  5FYT A;  1NYW A;  2EAL A;  4RR3 C;  3BPS A;  3D6E A;  3RG0 A;  4HKW A;  5JI7 A;  4OUL A;  2IVI B;  2RVA A;  3LDK A;  5K0U C;  1UZW A;  3A4U A;  1NG0 A;  1UPI A;  1KFU L;  1FMD 2;  2ZMK A;  1QQP 1;  5JR7 B;  5L7O B;  5A6Z A;  5EYX A;  2ZAC A;  4BJ0 A;  2D5H A;  1VAV A;  4MXW A;  4RSU A;  1OXC A;  5FYZ A;  2HWE 1;  2PAK A;  4NPR A;  3M7A A;  4MV2 A;  1YI9 A;  2XJV A;  1ZZ6 A;  1YHF A;  1CZT A;  3O1R A;  1MS4 A;  1OF3 A;  1RUC 2;  2XUM A;  4CU8 A;  1NZI A;  5FRE A;  1W06 A;  2ZEY A;  2NPI A;  1ZZ7 A;  1ZRE A;  5A1L A;  2DTW A;  1LHO A;  1JHN A;  3FX3 A;  1MQT A;  4TYS A;  2GH8 A;  2JXA A;  3T4H B;  1Q8S A;  3U1X A;  2YC0 A;  1GZC A;  4ZU7 A;  4MUV A;  4FPY A;  5D2A A;  3FFZ A;  4BXS V;  3B3Q E;  3ZXL A;  4XPV A;  1CZV A;  4P00 B;  3WUD A;  5C3P A;  1MEC 1;  2HWE 3;  1XB9 A;  1AX2 A;  1FPN 1;  3B93 A;  3JUU A;  3VDB A;  3AMM A;  5I8T A;  2SBA A;  2ZEW A;  3KCX A;  1VBA 3;  3T30 A;  3EJK A;  3AVS A;  4JDO A;  1VPH A;  1V70 A;  2V5D A;  2WZR 1;  1JU3 A;  4Y1Z A;  2A6W A;  1NE6 A;  1UX6 A;  4Z82 A;  5IAT A;  1WA6 X;  2QBX A;  3WDT A;  2MEV 3;  3M3C A;  4A2U A;  5C8W A;  3BUC A;  4ZY9 A;  1ND2 A;  2NMN A;  1FOD 3;  3FBY A;  2XGX A;  4AHX A;  2VAU A;  1LOA A;  2OUJ A;  1EUU A;  2WAA A;  2WR9 A;  5C33 A;  1WME A;  4GQ7 A;  3KHC A;  4C0B A;  4AQ6 A;  1S0E A;  5E16 A;  1WLD A;  4B8E A;  3O1O A;  3AMP A;  3D3A A;  3T2Q A;  4YRD A;  5A33 A;  3N9M A;  4BHP A;  1ZYB A;  1DG6 A;  4CYD A;  1SLB A;  3LB9 A;  1KEX A;  4XQ4 A;  1QIQ A;  2LW8 A;  4OFG A;  2A7A A;  2OQ7 A;  5FFO C;  5FZO B;  2YY1 A;  4MYE A;  4M3C B;  3VZM A;  1COV 2;  1S2K A;  4RS5 A;  1W6M A;  4K21 A;  4NE9 A;  3P5B A;  5IVY A;  3UT0 A;  4Q8L A;  1PGL 1;  2R07 3;  2PAM A;  2HWB 1;  3NNM A;  4Q4W 1;  3BOW A;  4QPI B;  5B4N A;  4DIQ A;  1C28 A;  4I0A A;  2RJ2 A;  4K8R B;  4YW2 A;  4ASL A;  3FUQ A;  5LB6 A;  2CGN A;  2D5F A;  1W0O A;  1OA3 A;  1VAK A;  1HRV 2;  3FLT A;  3IZO A;  1RVF 3;  4LE4 A;  3HN3 A;  1YO8 A;  2EXK A;  1JZ2 A;  3CIH A;  5BUV A;  2L9L A;  1C8N A;  4O65 A;  5FZB A;  5K0U A;  2DBN A;  5FLI A;  1ZBA 3;  3BTA A;  2F4L A;  3I2F A;  3VKL A;  3LGR A;  3WQ1 A;  2JD9 A;  3ZM8 A;  4CDU A;  2IFR A;  1WZX A;  2QZ2 A;  5BNP C;  2R07 1;  4TSV A;  1RUG 3;  1R08 2;  2TBV A;  2Y6K A;  3ZN6 A;  3VHN A;  3ZSK A;  3GZA A;  3NQH A;  2FQP A;  2QQK A;  4MGS A;  1HLC A;  4MH0 E;  4YFZ A;  2ORZ A;  3WP4 A;  1JUH A;  1VE0 A;  2ES3 A;  1W8F A;  1VP6 A;  1UYP A;  4GMP 0;  5T5J A;  3UGH A;  3S5Q A;  4E2S A;  1CJP A;  2VMG A;  4E4S A;  4L11 A;  5KWR A;  3ZFE C;  1AX1 A;  4JX0 A;  3RS6 A;  1PK6 B;  2XVK A;  3NAP B;  3LFM A;  1LEC A;  2R30 A;  3GBF A;  3KZ4 C;  4NN0 A;  5LY2 A;  4AG4 A;  3H7J A;  1V6L A;  3MIG A;  1O59 A;  1F8V A;  1Q43 A;  3FL7 A;  3F2Z A;  3WOG A;  4ARX A;  1REF A;  5FYV A;  4DMI A;  3GJB A;  1RUD 1;  5I0S A;  4I0B A;  1J1L A;  3K3N A;  4IEX A;  4Y22 A;  4PHZ A;  1OFN A;  3LCP A;  2R04 3;  3D82 A;  1BK0 A;  1X8M A;  5HCF A;  2A3Y A;  5BXX A;  5CFD A;  4FPH A;  5FPB A;  5GLV A;  4AXO A;  4J1W A;  3KT4 A;  1D7P M;  1RB8 G;  1QH6 A;  4COU A;  2WSU A;  4GWN A;  4MG2 A;  1AR7 1;  5CYY A;  3FZ3 A;  4A4A A;  2BBA A;  1RUJ 1;  3THT A;  5FPX A;  2YMZ A;  1IOA A;  4AL9 A;  4CEY B;  3KGZ A;  4QKD A;  5LAT A;  1NUK A;  3WF1 A;  3RYP A;  5LW9 A;  5A3M A;  4H3W A;  2G9F A;  2PN5 A;  4DO0 A;  4FPG A;  4XFH A;  3H7Y A;  2UYA A;  4LIT A;  3WNM A;  4LIU A;  5C4W B;  5CBL A;  1GOH A;  3SEP A;  4QX2 A;  3ACL A;  1AR7 3;  3IB3 A;  3N9O A;  4XXP A;  4WM7 A;  4CDQ A;  1CX4 A;  4V2W A;  1NLS A;  2JB8 A;  4A44 A;  4Z2A A;  2BV4 A;  4OHZ A;  4JDN A;  1N1V A;  2X29 A;  1GFF 2;  1VJ2 A;  3F95 A;  4Y5T A;  2VW2 A;  1QJY 3;  2ZEZ A;  4IQP A;  1YIP A;  1FXZ A;  3USU A;  3OYW A;  1W6Q A;  1LHW A;  2X09 A;  1R09 3;  2AEY A;  3I97 A;  1BEV 3;  1AR9 2;  3J7H A;  3OEB A;  4PBP A;  1VR3 A;  5E89 A;  4J1X A;  2A5Z A;  2BU9 A;  2H6B A;  2XHK A;  1C3H A;  3PTR B;  4YW6 A;  4Q2F A;  3TN9 2;  4XC9 A;  4RR3 A;  5ABJ C;  3AMN A;  2W68 A;  4LQR A;  1SBE A;  3IN9 A;  4LHN A;  2J1S A;  3WV6 A;  3ZSM A;  4B7K A;  4DUV A;  3M3I A;  1LGB A;  3K4Z A;  4GKX A;  1QJU 2;  2RS1 1;  5FYI A;  1L7L A;  1LU2 A;  3VDA A;  1RUF 2;  4OQ8 A;  1VB2 A;  4Z1V A;  3AX4 A;  4HET A;  2OKX A;  2PHD A;  4DZG A;  2A1X A;  2X53 S;  1QEX A;  1NCR A;  1H9P A;  4AVB A;  2ARB A;  1LTE A;  5J1X A;  5KR7 A;  3KT7 A;  3T0D A;  1WCK A;  3AKP A;  4IV1 A;  2VL4 A;  5JMC A;  3THP A;  3C8X A;  2VVF A;  1U0A A;  2RDQ A;  4DQA A;  1OLM E;  2AUY A;  4FXG B;  1BJQ A;  3ASI A;  5IVV A;  1Y9Q A;  3V65 A;  1W0N A;  2D6K A;  3N3H A;  1CIW A;  4FP3 A;  1TMF 3;  4LK7 A;  5FMO S;  5EHD A;  5FP3 A;  1CAV B;  1R1Z A;  4AHZ A;  3QCW A;  4LHS A;  3IDE A;  4LBO A;  5DAP A;  4ATF A;  4JGZ A;  2JDU A;  5A80 A;  3CL1 A;  1JYI A;  3G7D A;  4TXW A;  4QD2 A;  3KHB A;  1BBT 3;  1I5P A;  1HN0 A;  4QMA A;  4YZ2 A;  4CUB A;  1O91 A;  1RIR A;  2P2K A;  1O8P A;  2PQS A;  5FYB A;  2VZT A;  3GGL A;  4URA A;  3RZM A;  2WL1 A;  3OTF A;  2DCJ A;  4EWA A;  5HI0 A;  4CPB D;  3VZO A;  3RZK A;  2BJS A;  3UET A;  1F2N A;  1DGR N;  2ZTN A;  5A3T A;  3BN6 A;  4HVO A;  4BQ5 A;  1NY7 1;  2YB7 A;  1IKP A;  5GLZ A;  2E26 A;  4BK4 A;  3BTZ A;  2QNK A;  5DDJ 1;  4EV0 A;  3RZJ A;  5FJH A;  2B4K A;  1H4H A;  4BCU A;  5C8C A;  1NY7 2;  4P14 A;  2XLG A;  1ZRR A;  5I0U A;  4KNC A;  2PQQ A;  2RMU 1;  1LKN A;  4QQH A;  5A3L A;  1WBL A;  5LEJ A;  2XBO 1;  5FO7 B;  1K5J A;  5JDB A;  4PLM A;  5L36 A;  4AVS A;  1VB4 A;  3AFK A;  4UF0 B;  4CVU A;  1UD1 A;  2IWG B;  4FSJ A;  2E33 A;  3RFR A;  1FI2 A;  3H1W A;  3HT1 A;  2VOT A;  5FZ9 A;  2IXI A;  5DZF A;  4IV3 C;  3ZVX A;  4E4D X;  3O1S A;  3E5Q A;  1U5X A;  3HD8 B;  2GN7 A;  2JG8 C;  4YSF A;  5BV6 A;  2LUW A;  2P6C A;  4NR1 A;  2J1T A;  2VTF A;  5FZ0 A;  2ZPX A;  4HAN A;  3H1M A;  1LED A;  1PZ9 A;  1CAW B;  2R06 2;  5D8A A;  5GM0 A;  2D6O X;  2MNG A;  4CPB A;  3WT3 A;  3B00 A;  1HQN A;  1IZ3 A;  1OUS A;  2CWS A;  3V0B A;  1SDD B;  4DXT A;  1IPJ A;  4LA2 A;  4IL7 A;  4GKY A;  2D43 A;  5CFD B;  3BB6 A;  3D0S A;  4IXL A;  1IS6 A;  4JTN A;  4MGY E;  4XF1 A;  1QXP A;  5FPZ A;  1RTV A;  1AR8 3;  3R4D B;  3EHK A;  3O1T A;  3B5L B;  5C3O A;  2VM9 A;  3VHP A;  5A7W B;  4FFG A;  4K8F A;  3B94 A;  3I2K A;  4XHX A;  5FXX A;  1G86 A;  1L7Q A;  4JTO A;  2FDH A;  4FBF A;  3B02 A;  1QDC A;  2DUO A;  3Q8A A;  2DVB A;  4YM1 A;  1AZD A;  2W94 A;  5FMD A;  4AWD A;  3NMB A;  4NMI A;  1X8E A;  3V0B B;  2A6V A;  2CAV A;  3J7L A;  1RMU 1;  2Q8D A;  5FYM A;  1W6P A;  2YU1 A;  5FYS A;  2Q1Z B;  5CKM A;  4AW7 A;  3ZFG B;  5C71 A;  1BXH A;  2GP5 A;  3NL1 A;  3OF1 A;  4OI2 A;  1JYV A;  2VW1 A;  1EV1 3;  4BIF A;  1N3O A;  2BWA A;  5E8A A;  2OII A;  4R9B A;  2DVF A;  3ZN5 A;  2NP0 A;  1HW5 A;  1XC6 A;  1SLC A;  4OMD A;  2GNT A;  4RQP A;  2JE9 A;  1C8M 3;  2B39 A;  4J6G A;  5GAL A;  4M3C A;  1RYY A;  1AR6 3;  1WW6 A;  1W3X A;  1D4M 1;  4GXL A;  4Y20 A;  2RHP A;  1JYT A;  3S5A A;  3O1V A;  1RUJ 2;  1V0A A;  3U75 A;  4AI3 A;  5J96 B;  4FFH A;  3WHT A;  4QPI A;  2VTX J;  5FRA A;  4BME A;  1J3R A;  1AYM 2;  3SCG A;  5FP4 A;  5FZ7 A;  1UPS A;  1OUR A;  3BGA A;  5T3N A;  3WNO A;  1D0H A;  3K48 A;  4AEJ A;  5F3C A;  3MIH A;  1H1M A;  3ZYF A;  2Y38 A;  5EP9 A;  3N9L A;  2W91 A;  2WAO A;  4HPK A;  3EO6 A;  4NID A;  1YWK A;  1Y3T A;  2PHT A;  2HYX A;  4RS5 C;  2HWF 1;  3WP5 A;  4CCM A;  3BKZ A;  5HCB A;  3MO4 A;  3T0B A;  3TN9 3;  3T08 A;  4QDQ A;  2UU8 A;  3CJI C;  3H50 A;  3RDI A;  3SH3 A;  1WD4 A;  3VBS B;  5IK7 A;  1ZBE 3;  1W6N B;  2B5H A;  1OA4 A;  4KBB A;  2BWC A;  3URF A;  3WNL A;  3WDW A;  4D69 A;  4IGP A;  4BXF A;  3Q8E A;  2BP6 A;  5LK5 A;  5DZG A;  1H30 A;  4YVS C;  1WUV A;  4Q0V A;  1SLA A;  3I54 A;  4QGN A;  4XTP A;  5L9B A;  3KQ4 B;  3POE A;  2YZ4 A;  2SLI A;  3FN9 A;  1ZNP A;  4NAO A;  5FY4 A;  3ZYB A;  2XR4 A;  4N53 B;  3NKG A;  3CO2 A;  1MS3 A;  4GIQ A;  4Y1X A;  1MZF A;  2YYO A;  2VCM A;  5FP7 A;  1QOT A;  1D4M 2;  4CSW A;  1V6N A;  1K5M B;  1ZVF A;  2HLE A;  4OLL A;  3VV1 A;  3AJZ A;  5FWE A;  3ZPY A;  4PT6 A;  4RHV 3;  1COV 1;  1XJA A;  1FAY A;  1SFP A;  3RRD A;  5IVB A;  4F3J A;  5LA1 A;  5FZD A;  4HL0 A;  3POS A;  1T6B X;  2BGO A;  3K46 A;  4N7U A;  5FY1 A;  1D4V B;  1S0F A;  5JIA A;  3T2T A;  3ZR6 A;  3DCQ A;  3WDY A;  2E7A A;  3RMY A;  3INA A;  3ZKU A;  1A6C A;  1FT9 A;  1PX3 A;  1J1T A;  4Z2W A;  5HXM A;  1KS5 A;  2CTV A;  2IXK A;  1MEC 2;  1QXJ A;  5F3E A;  5IAV A;  4J25 A;  2VVD A;  2J1A A;  5FCC A;  4L99 A;  4YZ4 A;  3ZFF A;  1PGL 2;  1NCQ A;  4RQP C;  2H6C A;  1COV 3;  2WNU A;  1RHI 2;  5CG8 A;  1DYO A;  3HAG A;  2VZR A;  3LA3 A;  3OGS A;  2ID4 A;  4I09 A;  5FTT C;  3IAQ A;  2VH9 A;  3T0A A;  4CCN A;  1UU6 A;  2GNM A;  2QDR A;  3WXP A;  5HPO A;  2P3J A;  1JYN A;  4Q29 A;  3WG2 A;  4XF9 A;  4E4H A;  1PO1 2;  4HOO A;  4IND A;  3UKT A;  2VNV A;  4O61 A;  3PHM A;  5FZE A;  5DZE A;  2VNO A;  2VEC A;  2XH6 A;  4IE6 A;  5JZG A;  3POW A;  5L9V A;  3SIT A;  1ZZC A;  4COW A;  1VBE 3;  1A8M A;  3PUQ A;  5FLH A;  1W6Q B;  2J42 A;  3AYD A;  3HMY A;  3KSC A;  2QQV A;  3O7O A;  1VMH A;  1NCR C;  2P3I A;  4YVS B;  2UUR A;  2ZX0 A;  3GBG A;  1W03 A;  2RM2 1;  3R4U A;  4P02 B;  2YBK A;  1O3Q A;  2IUW A;  2KM2 A;  4CUG A;  5FZ8 A;  1VBA 1;  1ST8 A;  1IG3 A;  3W59 A;  1W2U A;  2WT1 A;  2XKP A;  2P5B A;  3MI8 A;  5DAQ A;  4XZP A;  1B35 C;  1YQC A;  4HK8 A;  2JD4 A;  2Y6G A;  1TQ5 A;  4OI0 A;  4DEV A;  5FBZ A;  3TEY A;  4N43 A;  3RYK A;  2Q8E A;  2YBS A;  1FPN 2;  2FMD A;  2VBB A;  3AZZ A;  1VBE 1;  2B7Y A;  3S6P A;  2F17 A;  4A3Z A;  2OA2 A;  2WNV C;  2RM2 3;  3JU9 A;  2AYH A;  4EE2 A;  3M1H A;  3CHX A;  2JDY A;  2JDM A;  1V9U 1;  3AP5 A;  4M01 A;  4MXV A;  3VZL A;  5JSR A;  2JG9 A;  1GNY A;  3FUO A;  1US2 A;  3J9S A;  3KF3 A;  1DP0 A;  2WAB A;  3OPZ A;  4PJY A;  1W04 A;  2VQ0 A;  2Y6H A;  3OD4 A;  4XJZ A;  3NNL A;  1UZV A;  3ACF A;  1NA1 A;  5KXE A;  2A3W A;  1LOB A;  3FWE A;  4BE3 A;  1K12 A;  5HV0 A;  3JD7 1;  4JVA A;  2VZO A;  1WWY A;  5DN2 A;  3N9P A;  4IV1 C;  4ITC A;  2HWB 3;  4GB3 1;  4QXC A;  2HWE 2;  4BA6 A;  2JDH A;  1A3K A;  3PVO A;  2WZR 3;  1LNS A;  1W05 A;  4BQ4 A;  1EPW A;  2W87 A;  1QXR A;  3IIA A;  3I59 A;  1N47 A;  4OHY A;  1J59 A;  3RSJ A;  3WW1 A;  1H8T B;  4FCA A;  4Q4Y 3;  2BYV E;  5H9P A;  5FK7 A;  4Z8B A;  5F1R A;  1HN1 A;  2XUE A;  4LT5 A;  1CJD A;  3HPN A;  3R05 A;  2UYB A;  4IET A;  2WIN B;  5GZF A;  2ZX4 A;  1FOD 1;  4NIA A;  5A32 A;  4BH9 A;  2DFB A;  3HBZ A;  3OEA A;  5D8A C;  3RZH A;  3MHZ A;  4HBN A;  3AYE A;  1UOF A;  2W0X A;  5IK8 A;  1O3S A;  1LES A;  4RGA A;  1JOD A;  2RR1 1;  3IDB B;  2WNU C;  3P3P A;  1H4G A;  1YUD A;  3DF0 A;  4LKE A;  3I4I A;  2JB4 A;  1JZ7 A;  4NIH A;  1DQ2 A;  1NCQ B;  3AZW A;  1UY4 A;  1OD3 A;  1F15 A;  3V0A B;  5J98 B;  5L7O C;  4RL7 A;  1D0G A;  3S0M A;  3I7D A;  4PQ9 A;  2WKK A;  4UWD A;  4Z07 A;  5EWS A;  3GZE A;  1QJY 2;  5GZC A;  4BK5 A;  1CAW A;  3VBR B;  2BRT A;  4N90 A;  2A6X A;  3OGG A;  1ZBE 2;  2RS5 1;  2VMH A;  1H8V A;  1W3V A;  2XXZ A;  1BEV 2;  4YNI A;  2A70 A;  5GZG A;  4QPI C;  5A6X A;  5BY5 A;  2LS6 A;  2ZOE B;  4K1Z A;  2WT0 A;  5JXJ A;  2OW4 A;  2ZGO A;  1NQJ A;  4LO7 A;  2YHJ A;  4E2Q A;  1JHJ A;  5FPV A;  5DG2 A;  4AGR A;  5EZW A;  4WVW A;  4AI0 A;  2ZGS A;  3QH6 A;  3LE0 A;  2QUO A;  2P3K A;  3ZKY A;  4U2A A;  4E27 A;  2UWB A;  4R9A A;  5A70 A;  2O14 A;  4AQS A;  1XNA A;  5AC9 1;  2WS9 3;  3OGJ A;  2ZZQ A;  4NHK A;  1D2S A;  4LOS A;  2JG8 B;  3WIN E;  3J8F 2;  2J1V A;  1POQ A;  4YGB A;  5FK8 A;  1SMV A;  2CY6 A;  4P9Y A;  4LBL A;  4KU8 A;  1L7R A;  4YYO A;  1R08 3;  1QOO A;  4AI9 A;  2TEP A;  1OVS A;  1TMF 2;  2IFW A;  3VBO C;  3DPR B;  1O6U A;  4IEO A;  4D7Y A;  4UW4 A;  2CNA A;  5SV5 A;  5F5I A;  2O8O A;  2GC3 A;  4H2A A;  1Y9G A;  4AHW A;  3MZH A;  2JEC A;  3MF6 A;  4RR3 B;  3NWK A;  1CZS A;  4RQP B;  3C7G A;  5F39 A;  1NXD 1;  4NRM A;  4PF5 A;  1BVV A;  1SFY A;  3SXW A;  5B2G B;  4GD4 A;  1L3J A;  4JRA A;  4O9G A;  3H8O A;  5FJK A;  2IXL A;  4XMA A;  1PVC 2;  2CHH A;  3WW3 A;  1AX0 A;  3ETQ A;  4LBQ A;  1RHI 3;  2RS3 1;  5I0D A;  2VW0 A;  4FPJ A;  2JJ6 A;  3CEW A;  4NHM A;  3RVH A;  1OOP A;  1UY1 A;  1GOG A;  4RYD A;  5FZK A;  5CKN A;  3UJQ A;  4JKL A;  3T2O A;  1XNK A;  3POG A;  2BEO A;  1STM A;  2GDF A;  1MQT C;  4M0H A;  3M3E A;  3ON7 A;  1DGW A;  2QKD A;  3CF6 E;  5IAX A;  4WZC A;  4AFD A;  3MUZ 1;  1HRI 2;  1PO2 1;  2VVE A;  1VBE 2;  2BVV A;  2XJS A;  4D0Q A;  1ZA4 A;  4W50 A;  3PVB B;  1RHI 1;  5JXI A;  5FO9 B;  2Y0I A;  4IDZ A;  3H3L A;  1SPP A;  5AFE A;  1DGR A;  1OHF A;  1RUI 3;  2HWC 1;  5FZI A;  2YRO A;  1S0G A;  3NNF A;  4CU9 A;  1JZ8 A;  5L7O A;  2WYF A;  4YW4 A;  1OUX A;  3III A;  1JBC A;  5A7P A;  2EAK A;  1KIT A;  1LGN A;  1RL3 A;  1TVG A;  1W2N A;  5T5O A;  1A8D A;  3FHA A;  2BOI A;  3VBF B;  3WQB A;  3D4K A;  1PMJ X;  2GAU A;  3NW4 A;  1YI7 A;  3GBW A;  1Q8Q A;  1V6I A;  1S2E A;  2GN3 A;  4LOR A;  4AED C;  2RM2 2;  4JZR A;  3K77 A;  3AVR A;  4FFI A;  5A7O A;  3R0R A;  5F32 A;  1SLT A;  3AKR A;  3ELN A;  3NNJ A;  4FT8 A;  4ZZ5 A;  1UKR A;  5LAS A;  1YFU A;  4EN9 B;  4YFW A;  4P9W A;  3HWJ A;  1TG7 A;  1IGO A;  2R16 A;  1QJF A;  1W99 A;  2AGS A;  3L2H A;  1AR9 3;  2DU0 A;  4OMC A;  3T09 A;  2I2S A;  1G8W A;  2ZCW A;  1OH4 A;  4YZ1 A;  4DPN A;  1DQ6 A;  1PMI A;  2DWR A;  4NJ4 A;  1BLZ A;  1HKD A;  2PLV 3;  2VBP A;  2XL7 A;  3A0K A;  3A23 A;  4LOT A;  1O3T A;  4I3G A;  2HWD 1;  4WVZ A;  5M0T A;  3BTY A;  4YM2 A;  4GZ9 A;  4KU7 A;  4AVT A;  5FY5 A;  4PIZ A;  2VCB A;  4PIY A;  5ISL A;  4XUQ A;  5I0R A;  5IK4 A;  1DZQ A;  2W46 A;  4R9D A;  4QPG C;  1CGP A;  1ULC A;  3VBO A;  1KXG A;  3IM0 A;  2QQI A;  3N35 A;  5CU1 A;  2VQT A;  2E51 A;  1LAJ A;  2BUK A;  3WNK A;  4XCA A;  4Q4Y 2;  3LPG A;  3U37 A;  4B3N A;  1KFX L;  2RDS A;  4QGM A;  4I01 A;  5BNN B;  4GH4 B;  3OG2 A;  5GLT A;  2GH2 A;  1AR6 2;  4UFI A;  2KR2 A;  1PX4 A;  3E97 A;  4RA0 A;  3IT8 A;  3VBR A;  1SHW B;  1W9F A;  1X50 A;  3MUY 1;  1GWM A;  1TME 1;  1RED A;  1NLR A;  4QHO A;  3LEM A;  1UL9 A;  4I2O A;  2ZZJ A;  4CUC A;  1JS9 A;  2ETE A;  4S2H A;  1Q8P A;  1NLQ A;  3UK9 A;  2FMY A;  3H1Y A;  4COY A;  4CE8 A;  2VNG A;  4KWK A;  4LXL A;  2RE9 A;  2YC2 A;  5LA9 A;  3WQ0 A;  5FWJ A;  4XFI A;  2K46 A;  3M4F A;  2ZGU A;  4NUB A;  4QQ2 A;  1BBT 2;  4ASM B;  4XAC A;  2WNE A;  4YG3 A;  4DUW A;  4AOC A;  2OUH A;  1AXZ A;  1KJL A;  1R1A 2;  1OBN A;  3ZSJ A;  1PK6 C;  1LOE A;  5K7P A;  2FCV A;  5F5Q A;  2E7Q A;  2JIG A;  5FZL A;  5J7M A;  3HN1 A;  1LOF C;  4LBJ A;  1W9S A;  2R0H A;  5CG9 A;  1RJ8 A;  2C9A A;  5EYY A;  4XBQ A;  5GLU A;  2DVD A;  2XJT A;  5ACA 3;  4NPL A;  1F9K A;  3KQR A;  1DU3 D;  5CAZ A;  2BZD A;  4AEM A;  1OQE A;  1CAX B;  2VD7 A;  3AP9 A;  1IS4 A;  3J4U H;  2VXJ A;  3MDP A;  4CA9 A;  5IW0 A;  4TZD A;  3T3Y A;  3OGV A;  3BAL A;  4PDW B;  3DXT A;  1H8T C;  4B29 A;  4AED A;  2WQ8 A;  3OY8 B;  5DG1 A;  5FY8 A;  1W9Y A;  4UBH A;  2HKX A;  4XW3 A;  3GCX A;  2FZ2 A;  1UAI A;  1ZBA 2;  1PGW 2;  1AR6 1;  1W6O A;  2B9U A;  4FQZ A;  2DVA A;  1D4M 3;  3P6B A;  5DAX A;  2ZKN A;  1ND2 B;  2AR6 A;  3ZYP A;  3WF4 A;  2XB6 C;  1K45 A;  1RUG 2;  3B9C A;  3W5N A;  3RPQ A;  1QJX 2;  1VBB 3;  2YV8 A;  3GJA A;  5C4W C;  1G7Y A;  2EXJ A;  3I3B A;  1JOJ A;  2CDP A;  4QHZ A;  3UV9 A;  1EY2 A;  4XJ9 A;  2XJU A;  3BIW E;  4QU2 A;  4BPZ A;  4Q8K A;  3VKF C;  1DQ4 A;  3VL8 A;  4CEW B;  4D6R A;  3N9Q A;  4HG6 B;  4Q4W 2;  4TLF A;  4CCL A;  1W2T A;  4IEP A;  5A7N A;  3JB8 A;  4AR2 A;  4ARY A;  4UFJ A;  2VZ1 A;  2JEM A;  1YXW A;  5F8P A;  3ZR5 A;  2WRA A;  3HBK A;  5FOB B;  5H9R A;  2QFE A;  1PM7 A;  3CLP A;  1TNF A;  5F7U A;  3JBG 2;  1GP6 A;  5A3N A;  2JE8 A;  1DLL A;  1H0B A;  1HRI 3;  1ZBE 1;  2FHR A;  2GND A;  2RS5 2;  3HQX A;  3NV2 A;  2WII B;  4EN7 B;  4GB3 2;  4O9E A;  1CQ9 A;  2WYS A;  1QHD A;  3PLQ A;  4KWL A;  3CDZ B;  4YLZ A;  3ZLI A;  5D21 A;  1U5Y A;  4HON A;  3JQW A;  1AJK A;  3PIG A;  4LHL A;  4YVW A;  4AFM A;  3MPB A;  1F31 A;  1HB4 A;  1XXN A;  2GC2 A;  4D8M A;  5A3U A;  3NV4 A;  1GP5 A;  2WQZ C;  4DFS A;  1WMF A;  1AYN 2;  1NOV A;  2LAL A;  2V09 A;  4FVV A;  1HRI 1;  1PNF A;  3USU B;  3K75 B;  5BNO B;  4MGT A;  4CXX A;  3BPZ A;  4UT5 A;  1LOC A;  2QQJ A;  3W5M A;  1Z7S 1;  1UIK A;  4DIN B;  1NQD A;  3AC0 A;  1N1Y A;  4XQW A;  1GUI A;  1AVB A;  1Z78 A;  2QJV A;  5LBC A;  5JMO A;  2VZU A;  2VCC A;  2BNO A;  1LHN A;  2EA7 A;  5IT6 A;  2ZGL A;  1B09 A;  1YFX A;  2PHX A;  5BNP A;  2ZAH A;  1NT0 A;  1GAN A;  3T1L A;  3VD9 A;  4A3X A;  3FLP A;  1W6P B;  4FOY A;  2J7M A;  2NN8 A;  4XUN A;  3VD5 A;  1ZRF A;  5C8C C;  1XYN A;  4Q0S A;  5FO8 B;  3LAG A;  3PUR A;  4LHK A;  1Z7S 3;  2Q1M A;  4Y5Z 0;  1R09 2;  5CIR A;  2WN2 A;  2DCY A;  3H42 B;  2Q8C A;  3FHI B;  2W2I A;  3ZYI B;  1C4R A;  5KHK A;  5LBF A;  3HQR A;  3ZYR A;  1VBC 3;  5FBJ A;  5F2W A;  3B01 A;  1GQG A;  2D6M A;  5EJ3 A;  3LDR A;  4LO4 B;  3MBW A;  1QJZ A;  4NO4 A;  4FAG A;  2CL2 A;  4A7Z A;  4LBK A;  1XBF A;  2I07 B;  4B1L A;  1W6O B;  4PIX A;  3IMM A;  4JGZ B;  1DFQ A;  4QX3 A;  2ZHK A;  4XIO A;  2B8M A;  1FX5 A;  3TRS B;  1DQ1 A;  3ZPO A;  4WM8 A;  4YGC A;  1XU1 A;  4IEW A;  2WO1 A;  3VZK A;  3DKQ A;  4CDW A;  5FPU A;  1W28 A;  1MZ5 A;  2F6B A;  2LTN A;  3PJY A;  3AYC A;  2EF6 A;  3W9A A;  4GMP 3;  1PO2 2;  4ISQ A;  2UY9 A;  3VBH B;  4LLO A;  1W9T A;  5A7S A;  4DY3 A;  3VD4 A;  1ALY A;  3SMH A;  2W1Q A;  4CEW A;  3ENR A;  3O12 A;  1FMD 1;  1LGC A;  1YJL A;  2GC1 A;  4XOG A;  3OPT A;  3A22 A;  1OPM A;  2OX0 A;  2XON A;  1QNY A;  1RIT A;  2DYC A;  3BIE A;  1RUH 1;  1ULG A;  1UYY A;  1X36 A;  5BNO C;  1I1E A;  3MLL A;  3LDB A;  3ZXF A;  1VMF A;  3H3U A;  1R1A 3;  2WO2 A;  3HJR A;  3DYP A;  3DYM A;  4XFG A;  5JVV A;  1RUO A;  5A6Y A;  4QB6 A;  3JB4 C;  1AL2 1;  1PIV 2;  4FPO B;  3RQ0 A;  4IW3 A;  2B45 X;  5HXV A;  2ZX3 A;  3ALQ A;  1ZZB A;  1VAL A;  2JDK A;  4XJA A;  2AH2 A;  4Y1U A;  2OQ6 A;  5FYY A;  1XE8 A;  4BQY A;  4NRQ A;  2ZML A;  4WM7 C;  3KT1 A;  4CDQ C;  1E5R A;  4D94 A;  1OC1 A;  4XQD A;  3I3D A;  1GLH A;  1EYB A;  4XCB A;  4YM3 A;  3KV4 A;  4DY5 A;  2BGP A;  1NXM A;  2ORX A;  4HVQ A;  4GJZ A;  1PO1 3;  1EAH 3;  2BFU S;  1OLR A;  2WBK A;  2P3Y A;  1JOP A;  2GMP A;  5A6Q A;  1QOS A;  1LCL A;  1POV 1;  1UNB A;  4OI4 A;  2QTW B;  2JX9 A;  2ARC A;  5C9A C;  1UYX A;  1SBD A;  2PHU A;  2D6L X;  3BU0 A;  2Q30 A;  3MLJ A;  3VBU C;  3IDC B;  2YBP A;  2DCZ A;  2LRP A;  3DL3 A;  5CFC B;  4JGY C;  3I2H A;  4Q4X 2;  4M4R A;  1GMM A;  2ADD A;  2UWA A;  4PI0 A;  1UZY A;  3C7E A;  3MGU A;  2KD7 A;  1S55 A;  2R49 A;  1VBD 2;  3PNA A;  4C1W A;  4A41 A;  1EAH 1;  4B4Q A;  5FZC A;  4WVV A;  5I93 A;  3ATG A;  4IV3 B;  2R06 3;  1OH3 A;  2HWF 2;  1EP0 A;  5FMC A;  3W58 A;  4FAH A;  5AFB A;  1UW8 A;  2OXB A;  1FPN 3;  4KG8 A;  3NST A;  4KI5 M;  5FZA A;  3ZXD A;  3WW2 A;  3ZX7 A;  5LY1 A;  2D98 A;  3VGI A;  4XFC A;  3ZFE B;  4Y24 A;  4N9I A;  4YG0 A;  5C7G A;  3K4D A;  2WJS A;  1PZ8 A;  1QJX 1;  2GME A;  3HNM A;  3IPV B;  1S4C A;  2VMF A;  2ET7 A;  4RGK A;  2WO7 A;  4H14 A;  4B7E A;  2RJL A;  3ZN4 A;  3POB A;  2WWU A;  4E8D A;  5K8S A;  2R06 1;  3NRU A;  2BPA 2;  4Z92 B;  1GQP A;  1SBF A;  1VLN A;  1O8S A;  4XFA A;  2DU1 A;  1W8Z A;  5DUU A;  2Q4S A;  4AQ2 A;  4E8C A;  4FTE A;  2RS5 3;  3VBS A;  1J58 A;  4NAM A;  4QPG A;  4OUS A;  2W92 A;  3ZFF C;  1O4Y A;  1NCQ C;  4CTE A;  4GB3 3;  3GZU C;  1V6K A;  2J1E A;  3KV6 A;  1OT5 A;  3TBD A;  3BI3 A;  2HWB 2;  1J83 A;  4Y22 B;  2ZGP A;  3MFA A;  1OVP A;  3N7M A;  4Q4X 1;  3B9I A;  3ECQ A;  4WZF A;  4Y33 A;  3UGF A;  1GIC A;  3VDC A;  2E9Q A;  2V5Y A;  1EV1 2;  4UW6 A;  3IBM A;  5FYC A;  3APB A;  1SCS A;  3PMS A;  4IEY A;  4Q4Y 1;  4YPJ A;  3VDD C;  1GWL A;  4XMI A;  4CDU B;  1GWK A;  1H8T A;  3BCW A;  4EZ4 A;  4HXC A;  4UXA A;  2EIC A;  5KC6 A;  3IAP A;  3KCY A;  4JV4 A;  3OSD A;  2PAE A;  1H9W A;  3U4S A;  3K51 A;  4COV A;  1OQD A;  2JWP A;  1CAX A;  2VZS A;  3LSE A;  5D1I A;  3SC7 X;  2YGL A;  4FO9 A;  4X8P A;  1TZO A;  1R08 1;  4OZX A;  5IUQ A;  4TWT A;  4MHR A;  4QB1 A;  5C3Q A;  1RJ7 A;  4A7Y A;  3EBR A;  1RVF 1;  4Y4Y A;  4UW3 A;  1ASJ 3;  3JCI A;  5EJZ B;  1POV 0;  4A6S A;  5FZ3 A;  1H6X A;  2RV9 A;  4KBZ A;  4LPL A;  1W0P A;  2VUD A;  2VNR A;  3O1P A;  2QQP A;  1LOF A;  1UKG A;  3M3Q A;  3THD A;  3I2O A;  2DFC A;  5C3R A;  2W5F A;  1XRU A;  3WDU A;  1BQP A;  1TE1 B;  4U36 A;  1DIW A;  1WLW A;  3QD6 A;  1Z7S 2;  3J7M A;  3PME A;  3RNS A;  2DCK A;  5DUW A;  5I91 A;  3ITQ A;  2ZGN A;  3NJV A;  4YGD A;  3AP7 A;  2H0B A;  3KS7 A;  3WW4 A;  3JBG 1;  2JG9 C;  4LUM A;  4B1M A;  4NRP A;  1VIW B;  4D7S A;  4IE4 A;  2ZHM A;  1XYP A;  3PUI A;  2F4P A;  5JWP A;  4A6O A;  4ZXE A;  4LUL A;  2VXR A;  2W52 A;  2WS9 1;  3OOX A;  3AP4 A;  5T50 A;  4NWW A;  1YQ5 A;  2C6S A;  4LNV A;  1GQH A;  1MS9 A;  1JZ5 A;  3VKN A;  4M0N A;  5A1F A;  2WS9 2;  5JIU A;  1WLT A;  4EN8 B;  1DF0 A;  2HJI A;  3FE5 A;  3PVN A;  4HSJ A;  3IMN A;  1KDK A;  2Q0A A;  3QLQ A;  5IWF A;  3J8F 3;  1QDO A;  3AKQ A;  3LIH A;  4BLI A;  1SQ4 A;  5JOZ A;  1HV0 A;  4FI9 A;  2ET1 A;  3D8C A;  1NCR B;  3J7N A;  3IDA A;  4PBO A;  3B69 A;  3SH4 A;  1ODM A;  1MZE A;  2YC4 A;  3K4A A;  5FIX A;  2VO5 A;  2YFZ A;  5GLW A;  3GM8 A;  1BYH A;  2DVG A;  3C2U A;  4AGV A;  2PFW A;  4R4Z A;  2V4V A;  1S0D A;  4P5H A;  3UL2 A;  3O5S A;  2VUA A;  4QKB A;  4XDP A;  3VBS C;  1QJE A;  2YU2 A;  3E6C C;  4BM8 A;  5J37 A;  3LEI A;  2DBI A;  3GHM A;  1BCX A;  5E1R A;  2W3J A;  4QAW A;  3ETP A;  1ENX A;  5KXD A;  2WQ4 A;  2BVB A;  1WCQ A;  2C5D A;  3BTX A;  4HFS A;  5FLJ A;  3DXU A;  4UFK A;  3VL9 A;  2W1S A;  5K4L A;  1MEC 3;  3DEM A;  4BQX A;  2QQU A;  1NX9 A;  2Y6L A;  1W8H A;  4WVM A;  3VHR A;  3VDD A;  5IVC A;  5JLV A;  4PLO A;  1WGP A;  5JOY A;  3WZ1 A;  5KXB A;  2LRO A;  4N9H A;  5EV7 A;  2BDR A;  3O14 A;  1S2B A;  5A3P A;  1F5F A;  5LCW L;  3LZZ A;  3OCP A;  3MV0 1;  4XUR A;  1MVQ A;  3MW2 A;  4IGQ A;  5GZD A;  1LEN A;  2XWJ B;  2VOX A;  2HEV F;  5FP9 A;  1JYX A;  4IV1 B;  1X7N A;  2YFU A;  3AL6 A;  4GWI A;  5I8Y A;  4XUT A;  1C5H A;  1RUI 2;  1GNH A;  1IS3 A;  1VBD 3;  2Q1F A;  2UY8 A;  1QGL A;  2VR4 A;  2XLF A;  4QM8 A;  4UI9 L;  3WDX A;  4NWV A;  3ZSE A;  1D2Q A;  1QY4 A;  4AYU A;  1F4H A;  1HRV 1;  2VCA A;  1V00 A;  4C1X A;  3RYR A;  3M70 A;  1UIJ A;  2R6Q A;  2VUJ A;  1X82 A;  2Y6J A;  4QU1 A;  3KV9 A;  2OPK A;  4QPY A;  1RGS A;  2BOJ A;  1WW4 A;  4CXW A;  4D3W A;  1C5I A;  1VBB 2;  1NKG A;  1ODN A;  2JKB A;  4Y1Y A;  2FDI A;  5EFU A;  3CU7 A;  3L2Y A;  3HNB M;  4K1Y A;  1GU3 A;  1O7F A;  1T6G C;  4K7J A;  2CYF A;  4JGY A;  1VBD 1;  1AHS A;  1IS5 A;  4YGE A;  3UKN A;  3WHU A;  1PIV 1;  3B7M A;  3N9N A;  2ZA9 A;  1XE0 A;  2R1B A;  1O5L A;  4Q4W 3;  3ZFF B;  3ZXJ A;  4CXY A;  1TMF 1;  2CAU A;  2PLV 1;  1WMX A;  3PUS A;  4MHU A;  5AC9 2;  2CDO A;  2OZ6 A;  4FFF A;  5FOJ B;  3TEW A;  3BOD A;  2P1B A;  1E5I A;  2BBV A;  4JRL A;  3KV5 A;  4CP9 B;  3E6D A;  1MAC A;  1ZBA 1;  2A73 B;  3LA7 A;  3C7H A;  4MO3 M;  3E5U A;  1LOG A;  4QM9 A;  1W6M B;  3PDQ A;  3OYW B;  4FOQ A;  5LRR A;  3N36 A;  3OUJ A;  3ZFG C;  2R1D A;  4N53 A;  4QX1 A;  5KHI A;  1OF4 A;  4Q27 A;  5JUV A;  1ONA A;  4FXK B;  2VOK A;  4E9K A;  2CGO A;  3S30 A;  4LKD A;  1JZ6 A;  4RFT 0;  2ATF A;  3MEP A;  3MW4 A;  3ZSL A;  5DAV A;  1Y4W A;  3LKJ A;  2FCT A;  4W8J A;  1E57 A;  4EYU A;  1XNB A;  1K5M A;  3FBM A;  1UMZ A;  2PHL A;  2X5I A;  3WP6 A;  1AYN 3;  1XYO A;  2RMU 3;  2W47 A;  2W95 A;  3CKH A;  4YW5 A;  3WF0 A;  3DN7 A;  4C0H A;  3SLI A;  3V56 A;  1WBF A;  1ENR A;  3AKT A;  4BLJ A;  1W2A X;  2C9K A;  1SDW A;  1ASJ 2;  4AI2 A;  4Q26 A;  3TB0 A;  1CN1 A;  3I8T A;  1RUD 3;  2PHR A;  3SCF A;  4I0W B;  4DXR A;  3RWN A;  1XQN A;  1JYW A;  3QBQ A;  4ZU5 A;  2HWC 2;  2E7T A;  4FPL A;  3Q8B A;  2DDU A;  1Y9M A;  3IKW A;  1Q8O A;  5G04 L;  3GHN A;  4XFB A;  3SEE A;  3WD5 A;  2VQA A;  3H8R A;  1RXG A;  3U11 A;  3NV3 A;  3ES1 A;  1Y43 B;  3OGR A;  1ENQ A;  4IV3 A;  4LA3 A;  4LBQ B;  4QXB A;  1ULO A;  3UYJ A;  2P4E A;  2Y64 A;  2NZ9 A;  1UOG A;  2P34 A;  2XVG A;  2E32 A;  4OYU A;  3AB0 A;  2ZXQ A;  1BKZ A;  2WNV A;  3PVE A;  5C5U A;  1EPZ A;  3LA2 A;  4AFB A;  2JIC A;  1SG3 A;  2W39 A;  2WFF 1;  3KVA A;  4JCK A;  4Q0U A;  4XXA A;  1IPK A;  4IEZ A;  1SLI A;  2Q8O A;  5FUN A;  5BNQ A;  1W9W A;  2KA3 A;  5C3S A;  1R64 A;  1AXY A;  2DUQ A;  3A7Q A;  1OKQ A;  4AVV A;  2XHN A;  5FXV A;  2XPJ A;  1OMI A;  3EQE A;  3KM5 A;  2WT2 A;  4Y20 B;  1WD3 A;  5CFC C;  3ZMO A;  4P9X A;  2G1M A;  1OPO A;  1XNT A;  4AEK A;  1RUN A;  4BZ4 A;  4Y26 A;  1PM4 A;  4QXK A;  2RDR A;  2C0Z A;  1ZRD A;  4AHY A;  2YUE A;  4WVM B;  3VBR C;  3R4S A;  3SKV A;  5EIY B;  1H1A A;  1R09 1;  4L2N A;  4QX7 A;  4G9S B;  4RD7 A;  3VBF C;  4AI1 A;  3U0Z A;  3OBR A;  1HXS 2;  3LF7 A;  1UF2 C;  4NHY A;  2P6H A;  3G6J B;  2Z4F A;  3ZOI A;  4E2G A;  1W90 A;  4UW5 A;  4HK9 A;  1MS8 A;  4W4Z A;  5CIS A;  1OKO A;  2YPJ A;  3BVC A;  1VRH 2;  5H9Q A;  2JE7 A;  4NHX A;  4DRR A;  4CCD A;  3AZY A;  3HNY M;  1S0J A;  5APA A;  1WA4 A;  2FDJ A;  4OCT A;  1ULE A;  4UFH A;  3ZXG A;  2EIE A;  1CAU B;  4PQQ A;  5KC5 A;  3I3E A;  2Y26 A;  4KGQ A;  3UNP A;  4GJY A;  3H8X A;  1JYC A;  2A75 A;  1PVC 3;  1NZC A;  3WF2 A;  1HJG A;  3WG3 A;  3LSD A;  3GZT B;  4UF0 A;  3WX5 A;  1HX6 A;  4COZ A;  1GV9 A;  1YQ2 A;  2PTM A;  4K9S A;  4OUM A;  5LA2 A;  2R7E B;  2B46 X;  4X8N A;  5FZO A;  1QJU 1;  2RS1 2;  1APN A;  3EXU A;  1VBC 1;  1TNR A;  3C7O A;  1LR5 A;  1W8N A;  3QAC A;  4XZU G;  2FCU A;  1V6M A;  5L73 A;  4BYY A;  1JZ4 A;  3ZDV A;  1ZZ8 A;  3TN9 1;  3VBO B;  2WSV A;  2X10 A;  3HVD A;  4MGK E;  5FPA A;  1X9T A;  2V73 A;  5JXG A;  4AQT A;  1ULF A;  5DAW A;  1GZ9 A;  3UJO A;  3WEZ A;  3I2G A;  4HVR A;  2XLA A;  3MW3 A;  4Y1V A;  4ZZ8 A;  4LO6 B;  2JDZ A;  2WZE A;  2R32 A;  1I5Z A;  1DDL A;  2XDV A;  1JI6 A;  4XEZ A;  2QDN A;  4XFF A;  4CP1 A;  5DDJ 3;  3VN4 A;  3WP3 A;  3W21 A;  1RUE 1;  4AZZ A;  1OSG A;  3RJR A;  3H8U A;  1MVE A;  2P17 A;  3N7J A;  4GAL A;  5IVF A;  3NV1 A;  1OI6 A;  1AF9 A;  3VKM A;  1R1A 1;  4ZS2 A;  4YAR A;  5F6L B;  3POY A;  4XYX A;  5T52 A;  2G4I A;  3ZYH A;  4JKM A;  1GKB A;  1PNG A;  1DLC A;  4MVT A;  4RHV 1;  2IVJ A;  5FZH A;  3FFQ A;  1UMH A;  3R6S A;  1KJR A;  3ACH A;  5IJR A;  4K40 A;  1URX A;  3A0N A;  4QQL A;  3OBA A;  5CAD A;  3U14 A;  3OJB A;  1VBC 2;  2WO3 A;  2WDB A;  2PLV 2;  1JN2 P;  1UQX A;  4HKO A;  2VG9 A;  3PIJ A;  5GZE A;  1V6J A;  4LO5 B;  2VC9 A;  3KMH A;  2B42 B;  1UO9 A;  3PL0 A;  4LLF A;  3E6B A;  3RWK X;  2WC2 A;  3O0V A;  3LEK A;  4XJU A;  3WG1 A;  1I3H A;  5L19 A;  1PHM A;  2AEZ A;  4HN1 A;  3WY6 A;  3ZFE A;  5LK7 B;  2BFU L;  4XDO A;  2PA7 A;  3NJX A;  4YVW C;  2W08 A;  5FR3 A;  1OA2 A;  2BW8 A;  2AEN A;  4HLT A;  4ES8 A;  4F7Z A;  5FZ4 A;  4XBN A;  3LD8 A;  4LJH A;  2GP3 A;  1CX1 A;  4CEY C;  4GH4 C;  3NJZ A;  2WLP A;  2A3X A;  1HB2 A;  4QQP A;  3WF3 A;  1AL2 3;  2VZP A;  1VRB A;  4OVE A;  4AVC A;  1RMU 3;  1BHG A;  2HWD 2;  3QH7 A;  5FP8 A;  1M4W A;  4WM7 B;  4CDQ B;  1ND3 C;  1XE7 A;  2ILM A;  1DCS A;  1K5M C;  3LIG A;  3N7L A;  4CZS A;  1CON A;  1GYK A;  5FY7 A;  1IKQ A;  4CCO A;  4K3U A;  1ZA7 A;  1AJO A;  2O8Q A;  4GAZ A;  3DGT A;  4UOJ A;  3ROU A;  1PO1 1;  1YC6 1;  4Q5O A;  4ZPI A;  3TOJ A;  3ZIX A;  4MET A;  2WZP P;  1H2N A;  4LBQ D;  3RZL A;  1EAH 2;  3GDB A;  5FZ1 A;  5ACA 2;  1W39 A;  1Q5O A;  2A6Y A;  4JQR A;  1GOF A;  1CES A;  1TME 2;  3NAP C;  3PU8 A;  5JI9 A;  4JGY B;  1U5I A;  2K9Z A;  2CSG A;  2VQU A;  3VZN A;  1GZW B;  5CA6 A;  1V9U 3;  1Q56 A;  4TLG A;  1OQ1 A;  2ARE A;  4IEQ A;  2XBO 2;  4GA9 A;  4QKN A;  4BQ1 A;  2X8K A;  3PUA A;  4Q4X 3;  5LRS A;  1CWP A;  1RIN A;  4UAP A;  2QVS B;  3WLU A;  1LU1 A;  2D3R A;  1SEF A;  4AFA A;  4CU7 A;  3AXE A;  2EIB A;  1O4T A;  2VOV A;  2G9Z A;  2GSY A;  4H7L A;  4P9I A;  4KGG A;  4LUK A;  3O0W A;  1CR7 A;  1WMD A;  1O4Z A;  2RG4 A;  3CZU A;  1REE A;  1UX7 A;  4C8D A;  2IXH A;  2HWF 3;  2OT7 A;  1HXS 3;  5DQ0 A;  3DKW A;  4YVS A;  1QWR A;  4N7I A;  1DYK A;  2PEL A;  4FPE A;  2IXJ A;  4SBV A;  5EJ1 B;  1LJ7 A;  1QJX 3;  4A7K A;  3T2P A;  5I0T A;  2ENR A;  2D97 A;  3NKT A;  3VDD B;  1F4A A;  2O0O A;  1GBG A;  4MOA A;  4BIS A;  3FHQ A;  1XNC A;  1JZ3 A;  5K0U B;  1IPS A;  4PCR A;  4CDX B;  1P8J A;  3M2M A;  5F3I A;  4LKS A;  2W1W A;  1C1L A;  4XHB A;  2W9X A;  2CU5 A;  4L0P A;  1CPM A;  1US3 A;  1AL0 G;  1WCD J;  1VRH 1;  4L9B A;  3ILF A;  2ZKL A;  5F9T A;  2RR1 3;  3ILR A;  4XJ8 A;  1DYP A;  4EQV A;  4C91 A;  5JR2 A;  5DPN A;  4ASK A;  4ZXK A;  2Y33 A;  4JDM A;  1MR5 A;  1FNZ A;  3JBG 3;  4IES A;  4IE7 A;  3KGL A;  1YCI A;  4IEU A;  4QPW A;  5IFT A;  5KHJ A;  1PK6 A;  3HQU A;  1ZZ9 A;  2WWJ A;  4V1P A;  3WCR A;  4GH4 A;  4IE0 A;  3WG4 A;  2OS2 A;  4G3Y C;  3OY8 A;  4DXZ A;  1SAC A;  4LKF A;  4IEV A;  4MSV A;  1JH5 A;  3H0O A;  2J1R A;  5C9A A;  4JGZ C;  4F83 A;  5BNP B;  1J3Q A;  4XE9 A;  4CDW B;  2ZGM A;  3OPW A;  4CEW C;  2OYZ A;  4Q4V 3;  3ZO0 B;  1AUY A;  3X29 B;  2FBE A;  5JSP A;  3LFI A;  4KH9 A;  1DBN A;  5F37 A;  1AR7 2;  1ASJ 1;  3IPV A;  2BNN A;  4OHV A;  2Q5T A;  2W1U A;  5FQ0 A;  4N8M A;  3LPF A;  4ES9 A;  5C5T A;  4JQT A;  1KGY A;  2H0V A;  2XJP A;  3KVB A;  5FYH A;  4XTM A;  2AAC A;  5DMY A;  1CAV A;  1EUT A;  4P9L A;  3NJY A;  4NPM A;  4Y3O A;  2WUH A;  4M3C E;  1RXF A;  2UWC A;  1JW6 A;  5D8A B;  1MPX A;  5FDB A;  3PUH A;  3Q9O A;  4Q4V 1;  3CZJ A;  2J1U A;  4I3P A;  4W6W A;  4EWD A;  1O3R A;  1JUI A;  1S0C A;  5C4W A;  2NQY A;  1FV2 A;  4PDW A;  5DXD A;  4L92 A;  3V0A A;  5GJ6 A;  1UU4 A;  4AI8 A;  3ST7 A;  4ATE A;  1VMJ A;  4KQ7 A;  4N43 C;  2ZHL A;  2AZ5 A;  1ULP A;  2AC1 A;  2PHF A;  2IXC A;  1IG0 A;  3Q8C A;  4NII A;  3GAL A;  5FZ6 A;  4IGO A;  3VBU A;  1QKQ A;  4XF4 A;  3FMG A;  4YVW B;  3J8F 1;  2NMO A;  1E5S A;  4M4P A;  4R52 A;  4NRO A;  1X33 A;  5FZG A;  2RS3 3;  5HBA A;  4LBN A;  4XUO A;  5J36 A;  1WW5 A;  3S7E A;  1PVX A;  1YYN A;  4ORF A;  3TNP B;  4XVH A;  1G9D A;  1YQ6 A;  1C1F A;  1Q8V A;  4FQ4 A;  1QF3 A;  3SHR A;  4M00 A;  1XND A;  4BB3 A;  5LWB A;  1BMV 2;  1NA1 C;  2D3P A;  1K3I A;  3VBF A;  3WNP A;  4ZKT B;  1PO2 3;  1GR3 A;  4NHL A;  4D6S A;  1AL2 2;  4HSL A;  1LRH A;  5SV8 A;  1F5J A;  2ZX2 A;  4QXH A;  1RUD 2;  4QHB A;  2DUP A;  4UYB A;  3BU7 A;  4FTB A;  1FOD 2;  3I2D A;  1W8W A;  2HWC 3;  4YW3 A;  2E63 A;  2IZW A;  1QQP 3;  2LM3 A;  2V4A A;  2ZGQ A;  4G4F A;  2C1F A;  2BGC A;  1YFY A;  5F6K A;  3EB7 A;  2HEW F;  3DEC A;  4CCK A;  1JTZ X;  1S0B A;  1UZZ A;  2RDN A;  3AK0 A;  3JD7 3;  2JDN A;  4XAB A;  3A21 A;  1FAT A;  1JOB A;  1PIV 3;  1JXN A;  4ISR A;  3POF A;  4YG6 A;  4UFM A;  3S57 A;  4GWJ A;  2FDK A;  1NE4 A;  3ZXE A;  4AAX A;  5DUX A;  2DTY A;  2EVX A;  2VTX A;  4LIV A;  1IQA A;  4RS5 B;  3AZX A;  4RGG A;  3AYA A;  1V9U 2;  1HIX A;  2R07 2;  1G9C A;  1W6N A;  2O1Q A;  1G6N A;  1QMJ A;  2G19 A;  4MXW B;  1DQ5 A;  3DUI A;  4XET A;  5LA0 A;  1S1A A;  2ARX A;  3ZXA C;  1YNA A;  3QOP A;  4EZH A;  3MLK A;  3TYJ A;  1RUH 2;  1HRV 3;  2VMD A;  2I45 A;  4WV8 A;  1DHK B;  1H2L A;  1UOB A;  5FKC A;  3RGB A;  4AF9 A;  4O7X A;  1YLL A;  3DPR A;  5JXH A;  1MS0 A;  5AVA A;  4OHX A;  2WNO A;  4FPC A;  2MEV 1;  3EMR A;  4XJW A;  3AMH A;  1HB3 A;  4NVP A;  2Z5W A;  5LEK A;  2Z79 A;  5BNN C;  2EAA A;  3SH5 A;  4GWM A;  4R8H A;  3UGG A;  1AYN 1;  3N4M A;  2QZ3 A;  1MZ6 A;  2VBD A;  2HH9 A;  2PHW A;  3IWZ A;  3SIS A;  3MF9 A;  1YEW A;  3AMQ A;  4CP0 A;  3POI A;  1GSL A;  3U4X A;  3MPP G;  5KHG A;  4CEY A;  3M3O A;  4JC1 A;  3ZYJ B;  2ZAB A;  4QX5 A;  4CDW C;  1OLM A;  4IER A;  2VGD A;  3E1F 1;  5ANN A;  5J09 A;  5FYU A;  4TTG A;  3VLB B;  4XAA A;  5C70 A;  1OD5 A;  3WNX A;  4KMQ A;  2PMW B;  2ZJC A;  1ND3 A;  5FUP A;  3RMX A;  5JOX A;  5C9A B;  2QCS B;  3NNG A;  5IYY A;  5AC9 3;  5IK5 A;  1RC6 A;  4I02 A;  3VBU B;  2VOW A;  2OVU A;  3U78 A;  5ABJ A;  2DV9 A;  1K42 A;  1X9P A;  2IC1 A;  1BZW A;  3NVC A;  4LR4 A;  2DUR A;  3U07 A;  5CB7 A;  5LBB A;  4Q1R A;  4UBG A;  4JHZ A;  5LZ6 A;  4ET7 A;  4XF3 A;  5FUI A;  2JKX A;  4OI1 A;  3WQ7 A;  5FZM A;  3K3O A;  1IHM A;  2ZGK A;  2VZV A;  1UOJ A;  2C26 A;  4TN7 A;  3O1U A;  1I6X A;  3WCS A;  3LQC A;  2WFF 3;  1YJK A;  5FMO L;  4CP2 A;  3KB5 A;  2WFP A;  3JXS A;  4K20 A;  4DS0 A;  1XU2 A;  5JCT A;  4ZS3 A;  1BK1 A;  2I74 A;  4W6X A;  1OOP C;  2WA4 A;  2ERF A;  3CJX A;  4QKF A;  4Y5S A;  4BDV B;  1IQD C;  5CEH A;  3TNQ A;  4RN5 A;  3MIF A;  2WN3 A;  4FPK A;  3D5O A;  1RUG 1;  4S2G A;  2RMU 2;  1RUJ 3;  4Q1P A;  1WCS A;  2VE1 A;  2JG8 A;  1KQR A;  4LTA A;  3S7I A;  1YFW A;  1A34 A;  5TSW A;  4W65 A;  1UXZ A;  5IHR A;  4HMZ A;  1CD3 G;  5KBF A;  1UY3 A;  1AYM 3;  2PYT A;  5IFP A;  1KDM A;  3I3M A;  4JKK A;  1GZW A;  1XPW A;  3N7K A;  1C57 A;  5HV4 A;  1J84 A;  1ENS A;  3SCH A;  4ZU4 A;  3O1M A;  2XJR A;  5IVJ A;  1F35 A;  3ILN A;  4N43 B;  5DAB A;  3TEX A;  5EXO A;  3USS A;  1SFN A;  1G9B A;  3FJS A;  1SCR A;  4JAA A;  2VPV A;  1N1T A;  2DCT A;  3GF6 A;  4P9G A;  3BYW A;  3OUI A;  1DQ0 A;  3OD0 A;  2YPD A;  4L8Q A;  3TAY A;  3KLS A;  4QPG B;  2VY0 A;  3K2O A;  1VBB 1;  2YG0 A;  1AYM 1;  1JMU B;  3PJQ A;  4FP2 A;  4I30 A;  1QJY 1;  3Q8F A;  2R04 1;  2EIG A;  5IVE A;  1RUI 1;  3DV8 A;  1PVC 1;  5CNA A;  2XG3 A;  1A78 A;  5F5C A;  1UU5 A;  3SQO A;  1BEV 1;  3OUH A;  2FDF A;  3ZYG A;  1QH7 A;  4XDQ A;  1DZR A;  3MYX A;  2B9V A;  2XKO A;  1ZM1 A;  4QDR A;  2C4X A;  3C3V A;  3HR9 A;  5KHH A;  4CCE A;  5BNN A;  2Y8K A;  2NYY A;  1QJU 3;  1UMI A;  5CKQ A;  2E6V A;  3BOP A;  3WUC A;  1M06 G;  3LOB A;  1T2X A;  4GUL A;  5T5L A;  4B4R A;  4DUX A;  4C90 A;  2JDA A;  3E5X A;  1PGW 1; 
#chains in the Genus database with same CATH homology
 1WKY A;  2ZXQ A;  3VD7 A;  4LHS A;  3OB8 A;  1SG3 A;  1W9S A;  2VME A;  4TXW A;  1W9W A;  1I5P A;  1R64 A;  2QQN A;  3A7Q A;  4CUB A;  2PQS A;  1O8P A;  2XHN A;  3EYP A;  2BZD A;  2VZT A;  3GGL A;  4A42 A;  2VJX A;  5A1A A;  2DCJ A;  2QQM A;  3C7F A;  3WNN A;  3UET A;  3BN6 A;  1XNT A;  2YB7 A;  2E26 A;  4BK4 A;  3DYO A;  2B4K A;  3OGV A;  1H6Y A;  3CQO A;  3SKV A;  5EIY B;  2WQ8 A;  2J22 A;  2Z4F A;  1NAE A;  4CVU A;  4W4Z A;  4CUC A;  3P6B A;  2E33 A;  2VOT A;  3WF4 A;  3HNY M;  1K45 A;  3W5N A;  2EIE A;  4PQQ A;  3I3E A;  3I3B A;  2CDP A;  4P5Y A;  2J1T A;  2VTF A;  4QB2 A;  3UNP A;  3ABZ A;  3WF2 A;  1YQ2 A;  5LA2 A;  1SDD B;  4HG6 B;  4DXT A;  2R7E B;  4ARY A;  3MV1 1;  2VZ1 A;  4CUA A;  3C7O A;  4XZU G;  1W8N A;  1JZ4 A;  2BER A;  1UYZ A;  2X10 A;  5F7U A;  2VM9 A;  2VMC A;  2JE8 A;  5JXG A;  3P1I A;  3I2K A;  1L7Q A;  1UY2 A;  3WEZ A;  3I2G A;  3THC A;  4ZZ8 A;  2WYS A;  2W94 A;  3CDZ B;  2WZE A;  4CU6 A;  1JI6 A;  4D8M A;  5C71 A;  1JYV A;  1PMH X;  2E31 A;  4DXS A;  3K75 B;  1XC6 A;  4OMD A;  2QQJ A;  3W5M A;  3AC0 A;  3ACG A;  1RYY A;  1GUI A;  4JKM A;  1DLC A;  5JMO A;  2VZU A;  2VCC A;  1UMH A;  3ACH A;  5IJR A;  3OBA A;  3VD9 A;  2WO3 A;  2WDB A;  2J7M A;  4XUN A;  3VD5 A;  1W8O A;  4XUP A;  3BGA A;  2VC9 A;  3WNO A;  5CZK A;  2WN2 A;  2W91 A;  2WAO A;  3LEK A;  4A45 A;  2HYX A;  3ACI A;  3MO4 A;  3T0B A;  3T08 A;  3MBW A;  3UES A;  4QDQ A;  3NJX A;  4QX3 A;  1CX1 A;  3WNL A;  2ZEX A;  3CMG A;  2WO1 A;  3WF3 A;  2VZP A;  1CIY A;  3WSO A;  3VD4 A;  1BHG A;  2E32 A;  1W9T A;  2W1Q A;  3FN9 A;  4P08 A;  3A22 A;  2XON A;  1UYY A;  3VD3 A;  2VZQ A;  2X05 A;  4UOJ A;  3HEI A;  2WO2 A;  3HJR A;  3DYP A;  3DYM A;  4QB6 A;  2HLE A;  5G05 L;  1UXX X;  3GDB A;  4PT6 A;  1GOF A;  4KWU A;  5LA1 A;  2VQU A;  3SKJ E;  2BGO A;  3K46 A;  1JU4 A;  3I3D A;  1UY0 A;  3I2J A;  1PX3 A;  2BGP A;  2ORX A;  4UAP A;  4MGQ A;  2WBK A;  5HXM A;  4CU7 A;  2EIB A;  4MAD A;  2J1A A;  4IUG A;  1UYX A;  3CZU A;  4OZO A;  1UX7 A;  1DYO A;  2EID A;  2QQO A;  2VZR A;  3OGS A;  2ID4 A;  3IAQ A;  2WZ8 A;  4QDS A;  3T0A A;  5DQ0 A;  3I2H A;  5HPO A;  1JYN A;  4M4R A;  1GMM A;  1UWW A;  5EJ1 B;  3C7E A;  4OUE A;  2KD7 A;  1UZ0 A;  3T2P A;  1F4A A;  4A41 A;  3HOB A;  4MOA A;  3FHQ A;  4QX0 A;  1JZ3 A;  2QQL A;  2XOM A;  1P8J A;  4LKS A;  2W1W A;  2W9X A;  4P02 B;  4DEQ A;  4L0P A;  1US3 A;  4KI5 M;  5C7G A;  4PF1 A;  5B4X A;  3K4D A;  5JR2 A;  3HNM A;  5DPN A;  2VMF A;  2Y6G A;  4QPW A;  4DEV A;  5IFT A;  2VZ3 A;  4E8D A;  3NRU A;  1GQP A;  3GXU A;  1O8S A;  3I2I A;  4E8C A;  3LEG A;  4A3Z A;  2V72 A;  2W92 A;  2J1R A;  2XQX A;  2J1E A;  1OT5 A;  1GNY A;  1J83 A;  1US2 A;  1DP0 A;  3VDC A;  3ECQ A;  2WAB A;  2RVA A;  2Y6H A;  3ACF A;  2W1U A;  4YPJ A;  1K12 A;  4BJ0 A;  3LPF A;  1KGY A;  2EIC A;  2VZO A;  3IAP A;  5DN2 A;  5DMY A;  1EUT A;  1CZT A;  1OF3 A;  2WUH A;  4CU8 A;  2VZS A;  1LNS A;  1MPX A;  2ZEY A;  3PUH A;  2W87 A;  3CZJ A;  2J1U A;  4QB1 A;  5EJZ B;  1HN1 A;  3HPN A;  1H6X A;  2RV9 A;  4LPL A;  4BXS V;  1CZV A;  4P00 B;  3THD A;  3OEA A;  1ULP A;  2W5F A;  3VDB A;  2ZEW A;  2DCK A;  2V5D A;  1JU3 A;  1JZ7 A;  3NJV A;  4M4P A;  1UY4 A;  1OD3 A;  4XUO A;  2QBX A;  4XVH A;  3PUI A;  4ZY9 A;  4BK5 A;  4A6O A;  4ZXE A;  1K3I A;  1EUU A;  2WAA A;  3WNP A;  1JZ5 A;  2LS6 A;  5JXJ A;  3D3A A;  1JHJ A;  3T2Q A;  3LE0 A;  4FI9 A;  1KEX A;  2LW8 A;  3IDA A;  1XNA A;  3EB7 A;  3DEC A;  2YC4 A;  3K4A A;  2VO5 A;  2YFZ A;  3GM8 A;  3A21 A;  2V4V A;  2J1V A;  5B4N A;  4GWJ A;  2RJ2 A;  1L7R A;  3LEI A;  4AAX A;  2W3J A;  4QAW A;  3ETP A;  3HN3 A;  1WCQ A;  1JZ2 A;  3CIH A;  2L9L A;  3I2F A;  2W1S A;  3ZM8 A;  2JD9 A;  2Y6L A;  1NX9 A;  1CZS A;  3C7G A;  5LA0 A;  2Y6K A;  3NQH A;  2QQK A;  2VMD A;  4MGS A;  2ORZ A;  5JXH A;  5I0D A;  5LCW L;  4XUR A;  3MV0 1;  1UY1 A;  1GOG A;  4RYD A;  4JX0 A;  4JKL A;  3T2O A;  1JYX A;  2YFU A;  4GWI A;  4XUT A;  5C70 A;  4AG4 A;  2VR4 A;  4UI9 L;  1O59 A;  3FL7 A;  3F2Z A;  4ARX A;  3MUZ 1;  1F4H A;  2VCA A;  3E1F 1;  4D0Q A;  4TTG A;  4W50 A;  4KMQ A;  2Y6J A;  5JXI A;  1NKG A;  1JZ8 A;  4CU9 A;  1D7P M;  3NNG A;  3HNB M;  5IYY A;  1GU3 A;  3III A;  5CYY A;  1K42 A;  1TVG A;  4A4A A;  3FHA A;  2BBA A;  4JHZ A;  3WQB A;  1PMJ X;  4ET7 A;  5FUI A;  2JKX A;  2VZV A;  2C26 A;  1NUK A;  2CDO A;  3LQC A;  3WF1 A;  3K77 A;  4ZZ5 A;  3WNM A;  3JXS A;  1GOH A;  3SEP A;  4QX2 A;  4MO3 M;  1TG7 A;  3C7H A;  3IB3 A;  4BDV B;  1IQD C;  4RN5 A;  2WN3 A;  1W99 A;  4OMC A;  3T09 A;  4A44 A;  4Z2A A;  4QX1 A;  1OH4 A;  1OF4 A;  5JUV A;  1UXZ A;  5IHR A;  3A23 A;  1JZ6 A;  1UY3 A;  5IFP A;  4JKK A;  2ZEZ A;  4GZ9 A;  4W8J A;  1XPW A;  2VCB A;  4XUQ A;  1J84 A;  2W46 A;  2X09 A;  3I97 A;  2W95 A;  2W47 A;  3CKH A;  3J7H A;  3OEB A;  3WF0 A;  2QQI A;  2VQT A;  2C9K A;  3WNK A;  3U37 A;  3LPG A;  4LQR A;  2J1S A;  3OG2 A;  4DUV A;  1JYW A;  3K4Z A;  4DXR A;  1PX4 A;  1SHW B;  3VDA A;  2YG0 A;  3MUY 1;  2DDU A;  2OKX A;  5G04 L;  5J1X A;  3T0D A;  3SEE A;  2VL4 A;  2B9V A;  2YC2 A;  4QDR A;  3C8X A;  2C4X A;  3OGR A;  1ULO A;  2Y8K A;  1UMI A;  1T2X A;  4DUX A;  4DUW A;  1W0N A;  2Y64 A;  4OYU A;  2JDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...