1W9SA

Structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
DLKNPYERIQAEAYDAMSGIQTEGTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLLGDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Family 6 Carbohydrate Binding Modules Recognize the Non-Reducing End of Beta-1,3-Linked Glucans by Presenting a Unique Ligand Binding Surface
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
molecule keywords BH0236 PROTEIN
total genus 30
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1w9sA00
2E32A 3JXSA 4QX3A 1UWWA 3K75B 1KGYA 4IUGA 4TTGA 5JR2A 5JMOA 3ACGA 3HJRA 3DECA 2V72A 3NRUA 1K42A 3WNNA 3I3EA 2VZQA 1OT5A 3C7FA 4CUCA 4E8CA 3WEZA 1K45A 4CUBA 3CQOA 3C7EA 2EICA 5JXIA 4BK5A 4ZY9A 1CX1A 3A21A 4DEVA 3D3AA 2W46A 3WNKA 4QX2A 1JZ8A 3WNMA 3OGSA 4Z2AA 3VD5A 1JZ3A 3FHQA 3GM8A 4A45A 4XZUG 1CIYA 1H6XA 2W9XA 4BJ0A 1OH4A 3CZJA 4RYDA 2OKXA 2YC2A 4HG6B 2Y8KA 4P02B 2VQUA 5JXGA 1J83A 4OZOA 3T0BA 4BXSV 2VZTA 4D8MA 2J1TA 3SKVA 1GOHA 1L7RA 4OUEA 3C7HA 3OEBA 2KD7A 1JYXA 2C9KA 4XUQA 3A22A 3ECQA 2VOTA 4UOJA 4KI5M 2WYSA 3DYMA 3OG2A 2JD9A 1EUTA 1NAEA 2QQIA 2W95A 3NJXA 3WNOA 4A4AA 4DXSA 3UNPA 3CZUA 2VZVA 3MV11 2ZEWA 5DQ0A 1JYWA 3LPGA 4A44A 5LCWL 4GWJA 2Y64A 4PQQA 5IHRA 3CDZB 4KMQA 3VD9A 1SG3A 1JZ6A 1TVGA 4CU8A 1DLCA 2VO5A 3MO4A 2QBXA 2ZEXA 3DYPA 2W87A 3C8XA 5LA2A 3THDA 4CU9A 3OB8A 3OEAA 3F2ZA 3VDAA 1UZ0A 1W99A 3NNGA 1OF4A 4PT6A 5G05L 3WF4A 1UMHA 2W92A 5C70A 1GQPA 1T2XA 1UX7A 3ACFA 3NJVA 3T2OA 1OF3A 3MUY1 3LEGA 2X09A 2LW8A 1K3IA 3HNBM 4MO3M 4QB1A 1ULPA 3LQCA 2BBAA 2X05A 1P8JA 2W47A 1HN1A 2EIBA 1I5PA 3I2FA 2VL4A 2L9LA 4DXTA 2V5DA 3P6BA 1W8OA 4DUXA 2VMDA 2WAAA 4P08A 5CYYA 2XONA 4DEQA 2VR4A 3LEIA 1W0NA 2CDOA 3T2PA 1XNTA 4AG4A 4A3ZA 2EIDA 4DUVA 3IIIA 2XQXA 2J1UA 1JHJA 2XHNA 4LHSA 3GGLA 1JYNA 1F4HA 1W9TA 3OGRA 4XUNA 2VJXA 2JKXA 4FI9A 3MUZ1 2BGOA 3VD4A 1UMIA 1GUIA 3C7GA 3I2JA 2W91A 4TXWA 1JZ5A 2WN2A 1JYVA 2WN3A 3WQBA 1UY3A 2RVAA 3J7HA 5EJZB 2VZOA 3BN6A 2W1UA 4GWIA 3K4AA 5FUIA 2J22A 3HNYM 1OD3A 2C4XA 4YPJA 1SHWB 5A1AA 1GU3A 2VQTA 2VZ1A 4QDQA 1ULOA 2Y6JA 2BERA 4BK4A 3VDBA 1NX9A 4QDRA 2Y6KA 2BZDA 2VZRA 4UAPA 1UYYA 4LPLA 1DYOA 5JXJA 2Y6LA 1PX4A 5EJ1B 4P5YA 3ACHA 3K4DA 3BGAA 1SDDB 3W5NA 1W9WA 2J1SA 2QQOA 5B4XA 2W1QA 2J1RA 2J7MA 3T2QA 2HYXA 5J1XA 1CZSA 5DMYA 5I0DA 3EB7A 1CZTA 3I2IA 1US3A 4LKSA 3WNLA 1PX3A 2DDUA 4CU7A 2HLEA 2YFZA 3HOBA 1JU3A 1PMHX 3WF3A 1UY1A 3LPFA 4GZ9A 2W1WA 5F7UA 3K77A 3T08A 4OMDA 4KWUA 2YB7A 4QB2A 3CKHA 3WF1A 4ARYA 3MBWA 2DCKA 3T09A 5LA1A 2QQNA 4CVUA 2QQLA 2VCCA 2Z4FA 2DCJA 4XUTA 5G04L 1CZVA 2WZEA 4ZZ8A 3U37A 2C26A 3I2HA 3PUHA 4DXRA 3I2GA 1O8SA 1YQ2A 2J1AA 2VMEA 2WQ8A 4JHZA 2WDBA 1W9SA 3I3DA 2QQJA 5EIYB 3WNPA 1UYZA 3SEPA 2VZPA 1O8PA 3OBAA 3WSOA 4MOAA 5B4NA 3AC0A 1PMJX 3NQHA 3SKJE 5HPOA 2JDAA 2RV9A 4XUPA 3HPNA 1UY2A 4JKMA 1GNYA 3HNMA 3IAPA 1JU4A 4XUOA 1XNAA 4JX0A 1XPWA 2ORXA 1J84A 2R7EB 2CDPA 2J1VA 1EUUA 2W94A 5IYYA 3I2KA 2Y6GA 2PQSA 3ACIA 4CUAA 1KEXA 4P00B 2ID4A 5LA0A 1UY0A 2ZEYA 2VZ3A 1US2A 3VD7A 2WBKA 2JE8A 3PUIA 4JKKA 2ORZA 4A41A 2J1EA 2QQMA 1NUKA 2E33A 4AAXA 1UXZA 3C7OA 3THCA 4A42A 1JZ7A 3SEEA 3I97A 1H6YA 5IJRA 1NKGA 2VCBA 1WCQA 1W8NA 3IDAA 2X10A 4OYUA 4ZXEA 3A23A 3CIHA 2B9VA 2Y6HA 2VZUA 4A6OA 3MV01 4W8JA 3ABZA 2ZXQA 3LE0A 3IB3A 3DYOA 1DP0A 2QQKA 2B4KA 2YG0A 4CU6A 1L7QA 1IQDC 3FHAA 3GXUA 2VCAA 2WUHA 2W1SA 4RN5A 5DN2A 3A7QA 2LS6A 2RJ2A 5C71A 3T0DA 1UYXA 3EYPA 4D0QA 3FL7A 4MADA 4PF1A 3HN3A 4QX1A 2VMCA 4QPWA 4MGQA 1O59A 3I3BA 4QX0A 1JZ4A 4ARXA 1MPXA 5DPNA 3HEIA 3WF2A 3ZM8A 3LEKA 1GMMA 1R64A 3VD3A 1JZ2A 5HXMA 2WO2A 1K12A 3GDBA 4ET7A 4W4ZA 3WF0A 2E31A 2BGPA 4ZZ5A 2YFUA 1RYYA 4QAWA 3UETA 4OMCA 4LQRA 2E26A 3UESA 1LNSA 2WO1A 3E1F1 4BDVB 1GOFA 4JKLA 5IFTA 5IFPA 1JI6A 4E8DA 4QB6A 2VZSA 3ETPA 3W5MA 3K46A 5C7GA 2VC9A 3OGVA 2VTFA 2W3JA 2ZEZA 4W50A 1UY4A 2WABA 5CZKA 4QDSA 2W5FA 5JUVA 1GOGA 2WAOA 4XVHA 4L0PA 2VM9A 5JXHA 3P1IA 2YC4A 1UXXX 3CMGA 4M4RA 2WO3A 3VDCA 3T0AA 1WKYA 1D7PM 2EIEA 3IAQA 4DUWA 2WZ8A 2V4VA 4MGSA 1TG7A 3K4ZA 3FN9A 1BHGA 1F4AA 2XOMA 4M4PA 4UI9L 2VMFA 1XC6A 4XURA
chains in the Genus database with same CATH superfamily
4AFMA 1OLRA 1AR83 3JXSA 1AYN1 1ZNPA 4Q0PA 1J3RA 1LHOA 1SQ4A 2ZMLA 3CF6E 4QX3A 1AR92 2JDKA 5A33A 4C91A 1LOGA 1ZA7A 4MGIE 1VP6A 4TTGA 2PXJA 1NG0A 2JICA 3B01A 1X82A 3MIBA 2RS51 3HJRA 4HK9A 3TOJA 1FNZA 3WP3A 4B3NA 2V72A 3NRUA 4V2VA 3I3EA 4GD4A 1OT5A 5FTTC 3SITA 2WNVB 5H9PA 1QY4A 1K45A 2G1MA 4CUBA 3CQOA 4O9GA 5KXBA 3ZX7A 4XAAA 5KC6A 3SH5A 2W0XA 1LHVA 3SQOA 2PN5A 1VAKA 3ZO0B 4QM9A 3BALA 1O91A 1G9BA 1IG3A 1VJ2A 1S0DA 3WR0A 3WNKA 1GP6A 5APAA 5FYCA 2P6HA 4CPBA 1GP4A 3TB0A 1JZ8A 1W6NA 2CYFA 1QGLA 2ZZQA 3S57A 5KWRA 3POIA 4XILA 1J59A 2WO7A 3OGSA 3AXDA 3THTA 5FZKA 5F8PA 3GM8A 4KBZA 3OCPA 3S7IA 3PDQA 3CJIB 1H6XA 1UYPA 1MEC3 1TME2 2W9XA 4AFCA 4BJ0A 4N8MA 4Q4W3 2YC2A 1OOPC 5FY0A 2DF7A 4OZXA 4YVSA 4ISRA 4OQ9A 4OZOA 4XQ4A 5EQUA 1XYOA 2JG8C 2WIIB 2ZX2A 3QLQA 5A3NA 4IERA 5JMCA 2J1TA 4OUEA 3RDIA 4RA0A 3OEBA 3ZSEA 5A3LA 1JYXA 5ACA2 1HRV1 2BYVE 3LA3A 2Y0IA 1WW6A 1EV13 3M3IA 1AF9A 3J9SA 4Q1PA 1DQ5A 3OG2A 1A3KA 3POSA 4BQYA 1IKPA 1IOAA 3WDYA 4YSFA 1NAEA 1NYWA 2HWC1 5FMCA 5A6QA 1PO22 2OXBA 3NJXA 1HRV3 2E63A 4HSLA 5FPVA 4DXSA 2JG9B 3ZPOA 2HWF3 1ZBA3 4A44A 5A1FA 4GWJA 3GZUC 4AEDB 3VBOB 1PGL1 5LBCA 1OKQA 3Q8BA 1MEC2 1J3PA 1TME3 4MH0E 4RS5B 1YIFA 3NL1A 2VUCA 1Q8PA 4RR3C 4S2HA 4IEQA 1W6QB 4IEYA 4PLNA 3VD9A 1JZ6A 4RFRB 1RUC3 3L9JT 1X8MA 3WG1A 2BVBA 5M0TA 2MEV3 3WT3A 1VBE1 3IT8A 3ZYHA 2KR2A 2QBXA 2OW4A 2WNUC 3J8F3 1RUJ1 5A7OA 5C9AB 4CDWA 5TSWA 5A3PA 1GWMA 3THDA 4WVMA 1AR62 1AR93 1YI9A 3U1XA 3N9NA 4AOCA 3I2OA 2BFUS 2QDRA 3N7JA 1O3RA 1UOJA 2HEYF 2DTWA 5FYUA 1AR82 2QJVA 4ASLA 3WDUA 4ZU7A 4PT6A 3RZGA 3AP6A 1VB4A 3GALA 3P3PA 3USSA 2WFPA 2X8KA 1QF3A 1UMHA 3RMYA 4CDUC 4ZS2A 4LIVA 1V00A 3JB8A 2WYFA 1T2XA 1UX7A 2R071 2WNUA 5FWEA 5JXGA 2UURA 1U0AA 3Q8CA 4Y20A 3MIEA 2P3KA 2RR11 3VBFC 3EXUA 3WG2A 5FPXA 3BYWA 3GCXA 5CFDC 4XJ8A 3BI3A 5FV3A 4GIQA 3HNBM 3WINE 5A3TA 1ULPA 1JS9A 2NMOA 5FYVA 1H2NA 5KXEA 1N1TA 3OY8A 5LK7B 4JRLA 1HB2A 2W47A 3DN7A 3NV3A 2EF6A 2YGMA 3FHIB 4LLFA 3TRSB 5I0SA 3W21A 2V5DA 1QQP2 1QEXA 1VRBA 3JBG1 1X8EA 4DXZA 3RPQA 5JAXA 2ARAA 2WAAA 1QJU2 4L8QA 4SLIA 3RSJA 1ASJ2 5DXDA 4YW1A 1D2QA 1OSGA 4OHWA 4GMP3 2R0HA 1RINA 4JVAA 5KHIA 2P3YA 3VBHC 3TEWA 2Q8OA 2WQZC 5FUNA 4CDXB 2BDRA 4LHSA 1JYNA 2BNOA 1AYM3 4DMIA 1ND3A 4IGOA 4XUNA 2QZ2A 3GZTB 5BNPC 4FI9A 3MUZ1 1QWRA 2LROA 1H1IA 2QVSB 5FO7B 1G9DA 3BPZA 1RHI3 3PUQA 4WM8C 1UMIA 1GUIA 1ZRCA 2DU0A 4PCRA 3V0AB 4YVWC 1VLNA 2RS52 1O7FA 3E6DA 4K21A 4K9SA 1OOPA 1Q5OA 5FLIA 1LOEA 4AVSA 4YM3A 3IWZA 3PU3A 4J1XA 5BNPA 2DVAA 1UY3A 5FQ0B 3AKPA 3BN6A 2W1UA 4QX8A 1DIWA 1YQ8A 3AZWA 1JMUB 5EWSA 1MZ5A 5E16A 4YPJA 5LEJA 4ORFA 4GH4C 1WCKA 2RMU1 4ISQA 2RE9A 4KU7A 2VZ1A 3CNAA 4P9LA 4R52A 2XDVA 1ULOA 3UGFA 1SMVA 3K3OA 4QXKA 4LBNA 1HQNA 1MZEA 1PGW1 4E4HA 4XJZA 3WDVA 2BERA 4PDWA 1X33A 4BK4A 1R092 5C3RA 4FTSA 4D69A 4XDPA 1RJ7A 3O7OA 4FCAA 5AC93 2VZRA 3PJQA 4UAPA 4CCCA 3LGRA 1JYCA 1POV3 1Y9GA 2IWGB 4LPLA 4XMAA 5JXJA 4ZHNA 2YU2A 1VBD1 4Q4W1 3ZFFC 1AJKA 2OPWA 4SBVA 2QUOA 5EJ1B 1I3HA 3POFA 2IVIB 4BQ1A 3BGAA 3CL1A 5JIAA 4D6QA 4LO8A 5A33B 1SLCA 3VKNA 2J1SA 2NYYA 1Q8OA 1RVF3 1C28A 4FAGA 4KGGA 1XNKA 2WNOA 5B4XA 3O1UA 4FT8A 2HWE1 2KXLA 4M01A 4X6QB 3AK0A 1REEA 5GM0A 1VRH3 1MS5A 3HN1A 3OGGA 2QQVA 2AR6A 4XTPA 2RM22 3BTAA 2PYTA 1DQ0A 4E27A 1CZSA 4A6SA 2G9FA 4FOQA 5FK7A 3B9CA 1O5UA 2ZGUA 3V0BB 4RL7A 1RMU1 4CU7A 1N47A 3HOBA 5IK7A 1JU3A 1PMHX 1H1AA 2ZGMA 5AC92 1NY71 1WWYA 2EVXA 2A6ZA 3KHBA 4B4RA 1UU6A 2JDNA 3NNLA 2UY8A 3K77A 5CFDA 4CPBD 4D94A 1H9WA 2YB7A 2EAAA 4LBQD 1PGL2 1CESA 1H2KA 4NUBA 1AHSA 1Q8QA 2IC1A 1GANA 1E5HA 5LA1A 3QBQA 1TNRA 3KZ4C 2VCCA 5FZEA 3NJYA 3OY8B 5EYYA 1XU1A 2RS12 1NOVA 1G6NA 5C9AC 5C3PA 2ZGNA 3ZFGB 4B7EA 2C26A 3VN4A 2JD4A 4AEMA 3FBMA 4CDXC 4LO4B 3Q8EA 4WZCA 4Q0SA 4AI8A 4DXRA 5CKQA 4LR4A 4JHZA 3JBG3 3HQUA 5LK5A 4IE5A 1XQNA 2GDFA 3JD73 4AVTA 4CCJA 3ZXDA 2BWAA 4FBFA 2FDHA 2WFF1 4URAA 3MF6A 4CDQC 1HKDA 2W39A 1VR3A 3AFKA 4CP0A 2E6VA 3BTYA 1RB8G 3FX3A 2B5HA 4AVAA 1W6MB 4E4ZA 4YVWB 3OBAA 4Q4Y1 1I9RA 1POV0 1JH5A 1W06A 2ZGLA 5E6HA 5FY5A 4BB3A 2VNRA 3BCWA 4RHV1 2NM1A 2JG9A 3VKMA 2RV9A 4XUPA 3TN91 4HANA 3HPNA 4LOSA 4PIYA 1WLTA 1ZREA 1V6IA 1YNAA 3B5LB 2QE3A 4M0HA 1SBFA 2ZCWA 4OLLA 4BWOA 4CP2A 1FYUA 3IAPA 4UFMA 5KHJA 1N1SA 1QDCA 4XCBA 3H8RA 1UU5A 4IV3A 4DB5A 4XUOA 1XNAA 2BQPA 2JDYA 1O4YA 1U5XA 4GH4B 5CB7A 3VHPA 2G19A 2FBEA 4CE8A 2ORXA 2PHDA 1W6QA 2G9GA 3T30A 1J58A 1BEV2 1J84A 1H1MA 2YUEA 4V2WA 2J1VA 1EUUA 1K5JA 2HWB1 2W94A 1GSLA 3NJZA 4L92A 4OVEA 5IAXA 2XJQA 5JPNB 5L9VA 4CUAA 2VNGA 3PVOA 4CP9A 1JHNA 1PMIA 2XUMA 1PZ8A 4DIQA 4P00B 1HJFA 4XYXA 4Q4V1 2VQ0A 1UY0A 3ST7A 2KM2A 5ANNA 3VDDC 5LA0A 4BQ3A 4PDWC 5FZ8A 2WT2A 3VD7A 3ZFGC 4Z92B 3AMPA 4COYA 2ORZA 2WZR3 3N36A 3OUJA 3UK9A 4E2SA 3APBA 2BW8A 3UL2A 3B94A 1AR73 1F5FA 5FZ0A 2BNNA 1IS4A 1F15A 5BPXA 2VCBA 3RI9A 1OLME 1OUXA 3K3NA 1SLLA 1WCQA 3H9AA 3IDAA 5IT6A 1B35A 2PHTA 2RDRA 4COVA 1HXS1 5GZCA 5L7OB 2AREA 4BIOA 3N9MA 3KMHA 2R061 3J26N 1SLTA 3CIHA 1N3OA 3N7KA 4FAHA 2VH9A 1DFQA 3VZJA 5DUWA 3O5SA 1F9KA 3T4HB 3ZKUA 4W8JA 2NQYA 2ES3A 5I8TA 1B09A 2R073 1WA4A 2GMPA 4E2QA 1LRHA 1RUD1 4A7ZA 5JDBA 2QQKA 3MYXA 2R041 5ACA1 5ABJB 3UKTA 4FPLA 1W2OA 2A3XA 3FHAA 3GXUA 4IW3A 4ATFA 4HXCA 5D1IA 5DN2A 5K4LA 5KXCA 3A7QA 5IAVA 2LS6A 4E4DX 4UF0B 2VECA 1UAIA 5FY7A 2CAVA 5F37A 2AC1A 4GQ7A 4EQVA 4YW5A 1YCIA 2GALA 3MIDA 4QPWA 1VIWB 1Q3EA 4HPKA 2Y34A 3BPSA 1O59A 3H3LA 4FQZA 4AGVA 1N1VA 1YQ5A 5BY5A 1BEV3 4AW7A 2ADEA 2WS93 3NNJA 5IVBA 3V0AA 5FREA 3ZM8A 5FOJB 1GMMA 1YJLA 4S2FA 1W8ZA 2BJSA 1JBCA 1EPWA 4ET7A 5FIXA 3RJRA 1GV9A 5FXZA 4CDWC 2E31A 3ZXFA 5F2SA 4YZ2A 4L2NA 1PVC2 4BZ4A 4INDA 3HD8B 4JTOA 5J98B 4LQRA 5LB6A 3RGBA 4XF0A 5GLZA 2EIGA 5FY9A 1AL0G 4JKLA 5IFPA 2R16A 5A32B 5FDBA 1BBT3 3NV1A 2ZBJA 4XOGA 3RNSA 3W5MA 1Z7S2 1GWLA 2GAUA 1OUSA 5DZGA 2W2IA 5CFCA 1W6MA 1W28A 5C7GA 5D8AC 2VC9A 2B9UA 3AYAA 1VBC3 4I3GA 5T54A 1IS5A 4KWJA 3G6JB 3NAPA 4AEDC 2W3JA 2ZEZA 4CUGA 1NQJA 4OQ8A 3R05A 5KXDA 5CZKA 2WA4A 3KS7A 2IFWA 5FZ9A 1XE7A 5JUVA 4XBNA 4FOWA 2NP0A 3BUCA 1LJ7A 1YQCA 4XVHA 1O4TA 3R4SA 4QHOA 4CCOA 1VALA 2VM9A 5EJ3A 2R30A 1HQLA 3CMGA 2WO3A 2E53A 4XFGA 1WW5A 3H0OA 1WKYA 5C8CC 2DURA 1D7PM 5GZFA 4A3XA 4AI3A 2PQQA 3IIAA 4Y4YA 5C3QA 3S30A 1U5YA 1AL22 3MIGA 4K40A 4N43C 4GULA 3ZVXA 4CP9B 5CG8A 4GWNA 1OC1A 2WWUA 1LCLA 2B7YA 3N7LA 3OOXA 5FFOC 3J8F2 2EXJA 2RM21 4LE4A 3SC7X 2XOMA 4M4PA 1W03A 2NMNA 4UI9L 1GICA 2SLIA 1XC6A 2R32A 1S0FA 3LIHA 3ZLIA 3AL5A 3BOPA 4E2GA 1C3HA 1QJZA 4XIOA 2OYZA 1J1LA 1EY2A 4I0AA 2I07B 5AC91 2VMHA 3K75B 4WZFA 2XGXA 4AI2A 1H4GA 3HWJA 4QU1A 5JR2A 1ZBE3 2DV9A 2F6BA 4AHZA 5H9RA 4AVBA 1VB2A 3ACGA 4MZUA 4Q4W2 4LKEA 1SFPA 3ILFA 4LUKA 2SBAA 2XHKA 2VZQA 4I0WB 3C7FA 5ERLA 4E8CA 2X29A 3WEZA 1H8TB 4YG6A 1YO8A 5J96B 1YI7A 5F5IA 4Q29A 4HN1A 1X9TA 3HMYA 2VVDA 2XJUA 3I7DA 4ZY9A 1E5IA 2PAEA 2H0BA 2ZA9A 3DV8A 4FPEA 5J36A 1NXMA 2W46A 3SHRA 5GZGA 3PU8A 1AZDA 3RVHA 4O61A 3WNMA 2GNDA 2P4EA 1VRH1 4YGDA 1A8MA 5FCCA 5JI9A 2VVEA 4UWDA 5FZ1A 1QU0A 3D0JA 5FY4A 2HYKA 1PK6A 2WC2A 5C8CB 4QPGA 3O0WA 5A7PA 4IEWA 1ZZBA 4JCKA 1H8VA 1CIYA 4LKFA 3GYDA 2GNMA 4Y1UA 4HPKB 3LWCA 4LBQA 2Z2SB 2ZX4A 2VQUA 2YROA 2AENA 4P02B 2RMU2 4WM7B 1H9PA 4CP1A 3T0BA 5JOWA 1V6LA 3ATGA 4IEPA 2YXSA 4BXSV 3ILRA 4IQPA 1DF0A 4FPGA 3C7HA 4GH4A 3TAYA 2GP3A 1PGSA 2DUQA 2ZOEB 4N9HA 3ON7A 3A22A 5C4WC 5K0UC 5CG9A 5CADA 1RUNA 2WYSA 3UJQA 3WNXA 5AFEA 3SCFA 1U12A 4ZONA 4EYUA 1RMU2 4LT5A 4MXWB 4ATEA 4QQLA 4HFSA 1KFUL 4XFFA 4LE3A 1ZVFA 2W95A 1EP0A 2HWE2 2XUEA 5IATA 3B9IA 3O14A 3TWIA 2VZVA 1OKOA 2D40A 1UIJA 2ZEWA 3ACLA 3IDBB 2CGNA 1UPSA 3ME2A 3KVAA 2JB8A 5DAPA 5F3CA 4P9IA 2ATFA 5FZDA 3DPRB 2OX0A 2VUDA 1YLLA 2YC0A 2FDFA 4NHXA 1L3JA 4FO9A 5IHRA 3I59B 2Z69A 1EAH1 1PK6C 4KQ7A 4LOTA 4KMQA 3ZFFB 3OD4A 3PLQA 3PUAA 4HKLA 2D44A 1QNYA 3GF6A 1TVGA 4LO7A 2XKPA 3MPPG 4LBLA 3PVBB 4AI9A 1DLCA 2GN7A 3ZKYA 4CU8A 1MACA 4NROA 3SISA 5CISA 4TLFA 1EAH2 4HSJA 5A7WA 3ITQA 4HOOA 4UW5A 4XF4A 4R9CA 5GALA 3VB9A 4CU9A 4N7UA 3RYRA 1XYPA 3WLUA 3OEAA 3F2ZA 1D0HA 3JBG2 5HXVA 1K5MB 3NNGA 2JDZA 4FFIA 3FUOA 3H50A 5G05L 3WF4A 2VW0A 1UOBA 1COV1 4PQ9A 4Q1RA 5C70A 2QDNA 3SMHA 1GQPA 4EWDA 2C24A 4MGZE 1NZCA 2GH2A 2ZX3A 2D97A 3JCIA 3NJVA 2QQWA 4N53B 3T2OA 5T50A 3MUY1 5BNNC 4RFT0 4CTEA 5FZAA 2AYHA 1NCRC 3DUIA 3V56A 2F17A 4I2OA 4XW3A 2X05A 1YEWA 4B1LA 1A78A 3ZN6B 2X5IB 5B2GB 4QKNA 4YRDA 3WY6A 5A7SA 1W2NA 3WCRA 3GBFA 1BVVA 4LHKA 1ND2B 2A3WA 2Z42A 2Z79A 2CGOA 2PHLA 4DXTA 1AR81 2GC3A 3O0VA 2Q0AA 1ASJ3 4IV3C 4OI0A 4LBJA 3ZDVA 3U0ZA 4TN7A 3ZXLA 3ZYIB 4XQDA 1UCXA 4P08A 4QPIC 3EO6A 4JZRA 3OJBA 4WV8A 2VR4A 2NLRA 5FOBB 5FYSA 1LGCA 3NKTA 1VBB2 2VU9A 1W0NA 3KQ4B 4OI1A 3EQEA 3VKLA 3U78A 2XLGA 1ZM1A 2EIDA 4AG4A 1GYKA 1ALYA 3HT2A 1W3VA 2P6CA 2PLV2 3MLJA 4UXAA 4Y1YA 5FZHA 2XHNA 1WMEA 3E5UA 1HXS2 1YXWA 1F4HA 4UT5A 4WVVA 5GLUA 1GBGA 3OGRA 4I02A 5T5LA 2WR9A 1PGW2 2JKXA 2YBPA 4FQ4A 2Y0OA 4BISA 4FFGA 2JDUA 3GHNA 3C7GA 3FBYA 1MS3A 5LEKA 2VOXA 3RWNA 1RUF2 4PLMA 5BXXA 2GMMA 1JZ5A 4FPHA 2FDGA 2FMYA 3VHRA 1EAH3 1TME1 4JGYA 2ZHNA 3HQRA 5DABA 3QD6A 1MVQA 2O14A 2WWJA 3KSCA 1BXHA 1SPPA 2VULA 2VZOA 4UFIA 5IWFA 3WXPA 2RDSA 3DL3A 4GJZA 1HJGA 4GWIA 1OMIA 5F6KA 1OURA 2J22A 1VBB3 3HNYM 5FUIA 4BXFA 2C4XA 3KT4A 2IZWA 2OVUA 3RZLA 4XFCA 5A1AA 1OQ1A 3VDDA 3WZ1A 2ZPXA 4MHRA 4XFHA 4KU8A 4XXPA 2HWD2 2LTNA 3VZLA 1O3TA 5IW0A 5BYNA 3S7EA 1O6UA 2AUYA 5JZGC 1NX9A 2VOKA 2Y6KA 4Y1ZA 1W6OB 2BZDA 1DYOA 2PHXA 1Y4WA 2P37A 1GNHA 4XACA 3VLBB 1LOBA 2R49A 4Y22B 5FBZA 4QX5A 4QPYA 1EYBA 2PMWB 5JOYA 1JUHA 1PNFA 4DO0A 4XF3A 3AMHA 1SDDB 4G4FA 2AZ5A 3W5NA 4J6GA 2XMLA 4WM7C 1V6MA 4CEWC 4LEJA 5FZOB 2ADDA 1SEFA 4K3UA 4XPVA 1RXGA 2ET7A 2W1QA 3MW2A 1NCQA 3VBRB 1U5IA 1Z7S1 2P1BA 1XSQA 3GNEA 3MLKA 1SBEA 4H55A 4JDNA 4NMIA 4X8NA 5EV7A 3ZFEB 3ZXJA 5J1XA 5DMYA 3VHOA 4NPMA 3EB7A 1DZRA 1Y9QA 1US3A 3WX5A 5SV5A 1GKBA 5EZWA 3OPTA 4XMIA 3O1SA 4UFKA 4Y5Z0 5FYIA 4XJWA 4W6XA 2R6QA 3AZVA 4N53A 5FY8A 2QNKA 4XAEA 1W39A 4Y33A 4AQ2A 1LOFA 2R072 2W1WA 3ZPYA 1W8FA 1S0CA 4TLGA 4CXYA 3M3EA 2ZMNA 1ZRFA 4YLZA 1UX6A 4Z82A 4J25A 3VBUB 3WF1A 4YYOA 2P3IA 2F4LA 1ZA4A 1N3PA 1PK6B 2DCKA 2JIJA 3P5BA 2YBSA 2XJTA 2OQ7A 3M3CA 2ZAAA 3AP9A 1KJRA 3B69A 5C5TA 1AYN3 2EALA 5DUXA 4D6RA 1QJX2 3T1LA 1RVF1 1IKQA 1CZVA 3HQXA 1AXYA 1L7LA 2CV6A 2WZEA 4K8RB 1NXD1 5KR7A 3U37A 4K20A 3I2HA 3R0RA 3PUHA 1HV1A 1O8SA 1YQ2A 1GLHA 4EN8B 3TBDA 5C33A 2Q8EA 2JB4A 5FP9A 4AR2A 2OA2A 1VPHA 2WLQA 1W9SA 2O8OA 1YFUA 3T1MA 4B29A 2VCMA 2WNVC 4B7KA 1XNDA 1DZQA 1SCSA 4LBMA 5GLVA 4YFWA 2YU1A 2VW2A 2WLPA 3KM5A 1FAYA 1CPMA 1FPN1 4JV4A 4GB31 3PNAA 2OUHA 2AACA 5B4NA 3LDRA 1SLIA 1QIQA 4RSUA 1QXPA 3NV2A 2ZGPA 2EXKA 2JDAA 2C5DA 3MHZA 1W0PA 4F3JA 3M8LA 3S5QA 1Y43B 1UY2A 5HBAA 1MR5A 1GNYA 2GSYA 3HNMA 5KHHA 1AYN2 1JU4A 4JGYC 3UV9A 5CKNA 2TUNA 2VBDA 4JX0A 2ZGKA 2CSGA 1XBFA 1KXGA 3K48A 2QZ3A 3H3UA 4QHZA 4C0HA 4WBBA 1S0EA 5HI0A 3RZHA 1SPPB 5LY2A 4NIHA 5FXWA 4QXBA 5IYYA 1OQDA 5A7WB 2XR4A 2HWC2 1CJDA 3VBHA 1QJU3 1ZX5A 3LDBA 4P14A 5AVPA 5FJKA 3FLPA 4AF9A 1LU2A 3KV6A 5K8SA 4P9YA 4BLJA 3ZYPA 5IK4A 1PIV2 3V65A 2D5FA 4FOVA 3OBZA 3AZYA 4PIXA 1ND3C 4XABA 1ZBA2 2ZACA 3EBRA 2ETEA 3BB6A 4W65A 1US2A 2HBUA 4CEYA 2BRTA 3FFZA 4MG2A 2OIIA 4WM8A 3UYJA 1QJY1 3C7OA 4FFFA 3GJAA 1UW8A 1JZ7A 2XJSA 4META 3SEEA 2OPKA 1YFWA 1H6YA 1W9YA 1RHI2 5I91A 4AHYA 2MEV2 4MYEA 2XBO3 2BV4A 1QJX3 1WW7A 2RS13 1AR72 1RJ8A 3DXUA 4LUMA 4O7XA 2V5YA 1POQA 1X50A 1W0OA 1PO13 2X10A 2ZGRA 4YWAA 2X5IA 4ZXEA 3W58A 4IE4A 1IGOA 2B9VA 2Y6HA 1AYM1 2VZUA 2VY0A 4UBGA 3MV01 4HONA 2P17A 2XWJB 2P3JA 3ABZA 4JRAA 4QQOA 5D2AA 4FPFA 2ZTNA 5J7MA 2ZGQA 4HT1T 1DP0A 5J3UA 2EXHA 2Q5TA 4Y3OA 3MICA 2WZPP 5A3UA 4AK3A 4Q8KA 3M3OA 3O1RA 1F35A 3ORJA 2CWSA 5AVAA 3H1MA 1T6BX 1SDWA 1UMZA 2DVFA 3RMXA 3AKQA 3I49A 3RS6A 5C71A 5JZGB 1UYXA 3ES4A 3KGLA 5GLWA 4ZPIA 4MADA 4PF1A 2D93A 4XCAA 1S2EA 1FOD2 3KD4A 4XZPA 4IE0A 1GZWA 3UGHA 1XJAA 2VMCA 4QGLA 3KV5A 2FZ1A 4QX1A 3RI8A 4XJUA 3RYKA 1D2SA 1IZ3A 2IUWA 4IEVA 1Z78A 3OUIA 1JZ4A 4UW3A 3QCWA 5DPNA 2BUKA 2G9ZA 2JDHA 3I3QA 1OXCA 4JDOA 4COUA 1VE0A 4RR3A 3IPVB 4PBPA 1IS3A 1RUF1 3VBSC 4Y1XA 5FRAA 4I30A 1K12A 4JHTA 1H4HA 2VAUA 3KGZA 4LIUA 4O9EA 5L9RA 1RYYA 4QKFA 4FPOB 3VV1A 5CBLA 4G9SB 1OHFA 3VUOA 3LCPA 4XDOA 4IXLA 4AZZA 2XXZA 1WD4A 4QWNA 3VHNA 1JI6A 1BK0A 2YZ4A 5FPLA 2IXHA 1LOCA 2ARCA 2VTXJ 2VZSA 4QKDA 1OI6A 3ZYFA 4BQ2A 1RUF3 3UKVA 1C8M2 3M2MA 1HRI2 2IXKA 1XYNA 5T55A 3CU7A 3ZR5A 1W6OA 1ENRA 1MQTA 1NT0A 5K9YA 4YGEA 2VTFA 3WDWA 1AVBA 4H2AA 5BNPB 2V4AA 4FXGB 5E89A 4BA6A 1IPJA 1SLBA 3IKWA 2QTWB 1GWKA 3O12A 2ZGOA 3QOPA 4RHV3 1LU1A 3BVCA 4WVMB 3CJXA 3DGTA 1KS4A 2FHRA 4ZU4A 4CXXA 1AXZA 5JXHA 3OD0A 1XE8A 2YC4A 3B3QE 1UPIA 4LO6B 4BM8A 2XBO2 1FT9A 1OA4A 1CAWA 5FO9B 5ACA3 1HIXA 2OQ6A 2D98A 1V6KA 1HXS3 1LR5A 1R093 3H7YA 4TYSA 4MGSA 4UFHA 1R1A1 1TG7A 3ES1A 3M70A 3FN9A 4EN7B 3MF9A 2CL2A 3O1OA 4CEYB 5FZ4A 5DAWA 4NHYA 1VMHA 1VBD3 2XL9A 5FYTA 2VBBA 3N9PA 4OFGA 1MS1A 1CR7A 2N7GA 4JDMA 4BQWA 3UKNA 1UWWA 5C3OA 3NWKA 5BNNB 2GC1A 2WNEA 2QQPA 5BV6A 4QKBA 4C0BA 4AHXA 3VBUA 1DG6A 3H7JA 4R4XA 1SFYA 3VZOA 1CD3G 1WA6X 2EXIA 3DECA 3JQXA 5AFBA 4JQRA 5CNAA 2UY9A 3WNNA 4IEXA 4CUCA 1NE4A 3LFIA 1W8UA 2CGPA 1VAMA 3HBKA 3AXEA 1FXZA 4GMP0 4QU2A 2EICA 4YZ1A 4I01A 5JXIA 4BK5A 3LFMA 2A3YA 1ULFA 4FTBA 3PUSA 1EV12 3JU9A 1HLCA 2JG8B 2WS92 3NO8A 4DEVA 3D3AA 2DUPA 4QMAA 3IDCB 3O1TA 3VKFC 3LKJA 1LEDA 1RUJ2 1ND3B 2IXCA 4QX2A 3TN93 3ROUA 2JDPA 1YRZA 4HVOA 2BGCA 4NIDA 4FFHA 3KCXA 4KNCA 5JZGA 4LBOA 4YM0A 2Q8DA 2YGLA 1JW6A 4AE2A 3VD5A 3ELNA 5A1LA 4GKYA 2BWCA 4XZUG 3VBSB 1CPNA 2DTYA 5LBEA 4AYUA 4XETA 2HWD1 1OH4A 5I0UA 2YPJA 2JEMA 3MGUA 2BOIA 5FYZA 4RYDA 4YZ4A 5EXOA 4HG6B 4RGAA 2XPJA 3AKRA 4N7IA 4Y24A 1J83A 3J4UH 1R1ZA 4GA9A 5H9QA 4DNYA 4D8MA 3TEXA 2QCSB 3SKVA 1L7RA 1S4CA 2KD7A 4RR3B 2ZHMA 5A3WA 2C9KA 4XUQA 3U4SA 2VOTA 4UOJA 2BPA2 5IK8A 3LF7A 5FZIA 3CLPA 3JD71 1S0GA 3VGIA 3WDXA 4XTMA 2DVGA 4IGQA 2JD9A 1EUTA 1OH3A 1QXJA 3D5OA 2WZR1 5FKCA 1XU2A 1YWKA 2QQIA 4FPKA 5IK5A 4EZHA 4ONUA 5CEHA 3O1MA 1FNYA 1GZ9A 4Q0UA 3WNOA 4B4PA 2CWMA 3E5XA 4ZU5A 4A4AA 3UNPA 1UZWA 3CZUA 5DQ0A 2OZJA 3OF1A 3ZSMA 4RQPA 4YGBA 2MHFA 1LGNA 2CNAA 3LOBA 4PQQA 4KG0A 4WM8B 4BCUA 3CDZB 1FMD1 2VG9A 4HMZA 2Y6FA 1FOD3 1R083 1MQTB 3I3MA 5LA9A 3H1WA 5BNOA 2Q8CA 3WD5A 4CDUA 3MO4A 1E5SA 3N7MA 5BNQA 2ZEXA 1AXKA 1JN2P 1WCUA 4NRQA 4OHVA 2YDEA 1RUC2 3DYPA 3OBRA 3RYPA 4JC1A 1UU4A 2XVLA 4QQHA 5LA2A 5LW9A 2TEPA 1UZVA 2JX9A 3RRDA 1UZ0A 2HH9A 2ZX0A 1RMU3 3RFRA 3NSTA 1TNFA 5FZCA 2D5HA 4YG3A 5ABJC 4EE2A 1DGWA 5FJHA 3VBOC 3V0BA 2CAUA 3BOWA 3I2DA 5EHDA 5JLVA 1SLAA 2PFWA 1TE1B 4OULA 5HCFA 1Q8SA 1WGPA 4AAPA 4K1ZA 2P34A 1XNBA 2BTVC 2VOWA 4URTA 1QKQA 1OF3A 3PTRB 1WW4A 2VVFA 2LW8A 1HDKA 1TZOA 2WT0A 4MO3M 5BUVA 1B35B 4QB1A 3LQCA 4QGNA 2BBAA 4ES8A 3PVNA 5FYYA 2R062 2RM23 1P8JA 4IE6A 1FPN3 1WCSA 2JDMA 2XJPA 5CA6A 2R1BA 1QQP3 1DZTA 4OI4A 4QPIA 4E4SA 1W2TA 1HN1A 1R091 4MUVA 3VBUC 1LOAA 1GZWB 2EIBA 1I5PA 4COZA 4FSJA 2VL4A 2L9LA 5CVRA 3RWKX 5F2WA 4P9XA 3P6BA 1QJY3 2OS2A 1W8OA 2R1DA 3PJYA 3RJ2X 2VMDA 3ZFGA 4CVUA 4DUXA 3EHKA 2RR13 3FLRA 4YW4A 4WVWA 1Y3TA 2R0FA 2ZABA 2AEYA 4HK8A 4FPYA 4AFDA 4BQ4A 3T3YA 4DRRA 3KT7A 1FX5A 1AUYA 1R1A3 1YJKA 1MQTC 3LEIA 3TEYA 1HQWA 4U2AA 3MLLA 1DQ4A 3AYEA 1XNTA 3T2PA 4DUVA 4AWDA 4UFLA 3IIIA 2XQXA 1LAJA 2J1UA 3U07A 1JHJA 1W2AX 4YVWA 3PL0A 2VMGA 1VBB1 1UF2C 1AL23 3PURA 2A6YA 2TNFA 2VJXA 3QH7A 5FP3A 3SH4A 1RUG1 1MS0A 2FCUA 4CZSA 1VBE3 3H42B 2BGOA 3OYWB 4RS5C 4XFIA 1HB4A 4IEZA 3LSEA 3HT1A 3KVBA 3D0SA 2W91A 5DDJ2 4AI0A 2H0VA 2Q1ZB 3AJYA 3F95A 4FXKB 4CCDA 5LRRA 1DQ6A 3CJIA 3NMBA 3KLSA 3ZXKA 2UWBA 4XJ9A 5F6LB 2XWBB 1QOSA 1OQEA 4BIFA 3J7HA 2RVAA 4MGTA 5SV8A 2JIGA 4YVSB 3W59A 1C1LA 1FV3A 1V6NA 2D6NA 2ZHKA 2QFEA 3GBWA 5KC5A 2K9ZA 5FP4A 1GQHA 3OPZA 1OD3A 3MIFA 4KH9A 4XEZA 1R082 1C4RA 5FPUA 1ODMA 1GU3A 2IXIA 3D8CA 5C3SA 5JIUA 1BBT2 1OBNA 2D6PA 4QDQA 1VMJA 1PNGA 1TMF3 4Y5SA 1W8WA 2R042 1C8M3 3HAGA 1JYIA 3VDBA 4QPGC 3INAA 4QDRA 1X7NA 2HWC3 2FCVA 1LKNA 1C57A 1UYYA 4L97A 3U14A 2ET1A 3ZN4A 4Z2WA 1DHKB 1GP5A 2D3SA 3FJSA 2LALA 1RXFA 4RD7A 4FPJA 3W20A 3R4UA 1UKRA 3IBMA 4RS5A 5T5OA 3K4DA 3WW1A 3WOGA 1ULEA 2UWAA 4GB32 4LK7A 1W9WA 3KV4A 4L11A 2QQOA 1G9CA 1UO9A 4GWMA 1S55A 5BNOB 1O5LA 1Y7BA 5HCAA 5C4WA 3WDTA 1NA1C 1SZBA 2OT7A 3JQWA 4CSWA 2J1RA 3KHCA 1ZZ8A 3ZOIA 5JSRA 3J8F1 4XC9A 3H3ZA 1E5RA 5ABJA 2DCTA 5I0DA 4COWA 1UD1A 4RQPC 1LECA 1CZTA 1EPZA 1RUC1 3WNLA 5JPMB 4EWEA 1PX3A 5FMDA 1QJEA 2DDUA 1QJX1 1QJFA 4C8DA 4QD2A 2X53S 3ZYRA 4UF0A 3QH6A 2JG8A 3POJA 1SCRA 1JOPA 1UY1A 1T6GC 5IVJA 4Y20B 1RUJ3 3LPFA 4LLOA 4HKWA 3NNFA 1W8HA 2NZ9A 3J7MA 5F7UA 3B93A 1J1TA 2FD8A 4OMDA 4KWUA 2HWB2 4UW6A 3CKHA 1F5JA 4ZXKA 3T09A 5A6YA 4LHLA 3DXTA 1RUG2 2XKOA 5FYMA 2DCJA 1RIRA 1SFNA 4M3CE 5IVYA 3VBSA 3PIGA 3AZZA 2A5ZA 2IVJA 4UFJA 3ZYGA 1YUDA 2XL7A 1ZBA1 2DVDA 3AYCA 3AVSA 4MV2A 4OHZA 1LHNA 4GAZA 5F5AA 3ZR6A 2DWRA 1ZBE1 5T5JA 4OHYA 2XH6A 2VMEA 4AI1A 2IFRA 1KS5A 2OUJA 1ULCA 1OLMA 1MVEA 1TMF2 2JG9C 4BPZA 4QXCA 4A7KA 2QQJA 2B8MA 4UBHA 1URXA 1RTVA 3POWA 4GKXA 4HVQA 2VXJA 4CCNA 1UYZA 3GHMA 3AP4A 4NPRA 3SEPA 3LSDA 5C8CA 1TMF1 4CRQA 1O8PA 4AHWA 4PI0A 5CFCC 3OUHA 5F3GA 2MNGA 3K51A 4DRVA 2PLV1 5GZEA 3SKJE 4DFSA 5DZEA 2RS31 2WRAA 4R9AA 4RQPB 5C6CA 2B39A 3OYWA 4JKMA 2D3RA 4QQ2A 4X8PA 4DY3A 3B00A 2VNVA 5KHGA 1W3XA 2NPIA 1POV1 1XPWA 2WINB 1A34A 1OOPB 2MEV1 4AXOA 2JJ6A 5F9TA 1WLWA 2FMDA 2R7EB 4LNVA 5FBJA 5FQ0A 4CDUB 5HV4A 2GN3A 1GFF2 3ZSLA 3V64A 4EZ4A 4YGCA 4CDWB 2CY6A 1WCDJ 2Y6GA 2PQSA 1MZFA 3OTFA 1HN0A 1QDOA 4NIGA 3AZXA 1RC6A 4ITCA 1WBLA 1S0IA 2G4IA 4MSVA 1D4M1 2D6OX 4TWTA 2Z5WA 4Q4X2 4F83A 3LB9A 2GC2A 4KWLA 5K0UB 1CGPA 4BE3A 4DPNA 2VZ3A 3POBA 3BU0A 2WBKA 4EROA 4KWKA 4Q4X3 3WG4A 4E9KA 4IGPA 1NUKA 1ASJ1 2E33A 1N1YA 2Q1MA 1UXZA 1OLQA 3I59A 1RUH2 1AX0A 3THCA 2JKBA 3ZFFA 4N90A 3FUQA 5ISLA 4NIIA 3B7MA 1DQ2A 4NHKA 5IJRA 1Q43A 1TEIA 1QQP1 1XE0A 4PJYA 4NWVA 1W8NA 1CAVB 2ZAHA 2C1FA 2JE7A 1S0BA 2P2KA 4LKDA 2Y26A 1UNBA 4RGGA 2DCZA 2ARBA 4Y5TA 1HX6A 2VNOA 4QPIB 2CTVA 4LO5B 1W6PB 1H8TA 2D3PA 4NJ4A 4YVSC 4LA2A 5LY1A 4A6OA 2E7AA 5FUPA 4XF9A 1VAVA 4XHBA 3WQ7A 1BZWA 3E5QA 1V0AA 3H1YA 3U11A 1O4ZA 1XXNA 1JXNA 3JD72 1D4VB 3LE0A 1OFNA 2RR12 2BBVA 1COV3 4U36A 5C5UA 4BYYA 2YG0A 1ZRIA 4DQAA 1W90A 4HETA 3SLIA 3BIWE 5L9BA 3M1HA 1XSRA 4CU6A 3N4MA 4CDQB 3RZMA 4DINB 1K5MC 2W68A 2WUHA 3AM2A 2W1SA 2HWD3 3LDKA 4AFBA 4JQTA 4QPGB 3T0DA 1NQDA 3FL7A 3ILNA 3MFCA 3ZN6A 1DBNA 1BCXA 3LZZA 3AJZA 3HN3A 1HB1A 1IPKA 2E51A 2WA3A 1VBA1 4IETA 5CFDB 1ND2A 3M3QA 4I0BA 2ARXA 4Q4V2 3MPBA 1S2BA 1H2MA 4MGQA 1LENA 2GZWA 3I3BA 4S2GA 2Y60A 3FFQA 4QX0A 4WM7A 4ARXA 1MPXA 1UKGA 3OGJA 3TN92 1NCRB 1UQXA 1STMA 1VBA2 1WLCA 2RS53 3HEIA 3WF2A 4DY5A 4N9IA 4NHLA 4R4ZA 1CX4A 1R64A 3AYDA 3WVJA 4UW4A 5HV0A 1RUOA 4AVCA 5HXMA 2WO2A 1G8WA 2VE1A 1OA2A 1LTEA 1FI2A 1ND2C 3GDBA 1WZXA 3WF0A 3WHUA 3MEPA 2MPFA 2BGPA 4C1WA 4ZZ5A 1MS9A 3WCSA 3O0XA 1N3QA 1H30A 2ZMKA 4BH9A 3UESA 2E9QA 2WO1A 3WHTA 3FWEA 2EA7A 1G9FA 1ZRRA 3E1F1 4H7MA 4BDVB 3HR9A 4LK6A 3OBTA 2B45X 2PA7A 4IDZA 3P3NA 3L2YA 2B46X 1HV0A 3DPRA 2O8QA 4L99A 4QB6A 5FZLA 5A7NA 2ZHLA 5FMOL 1LB2A 4RGKA 3CEWA 5DZFA 5FYHA 1WUVA 2VW1A 3K46A 5A6ZA 4XF1A 5A7QA 3CO2A 3AMMA 1XB9A 1PIV3 2DFBA 1PVXA 5I0RA 5JSPA 1KDKA 5ANQA 3USUB 1Z7S3 5EFUA 3WQ1A 3A0NA 4W50A 1UY4A 2WABA 5I8YA 3BTXA 1JOBA 5L7OC 2RS33 1ZZ6A 2XVKA 3N35A 4Q8LA 2YY1A 3ZIWA 2K2SA 3N9LA 1GOGA 2K46A 1KITA 1RUG3 2EAKA 2WAOA 3NNMA 5JWPA 4L0PA 1APNA 4QHBA 2W08A 3VZNA 4KG8A 3P1IA 3H8UA 1QH7A 1RUE2 4M4RA 5IVEA 2A6XA 5E1RA 5FZ6A 2H6BA 3T0AA 5C4WB 1RUH3 3KF3A 3IAQA 3QACA 5LBBA 4DUWA 3DKWA 4FP3A 1AYM2 1PVC1 1CAXB 1RUD3 1GR3A 4L9BA 2R043 2V4VA 4PBOA 4XFBA 5DDJ1 1D4M2 3K4ZA 4HZFA 5FK8A 3AL6A 1BHGA 1F4AA 4Q2FA 2GNBA 1MS8A 5LBFA 1F2NA 4IEUA 4ASKA 1DGRN 5FPAA 2K0GA 2YBKA 3NW4A 2E32A 2VBPA 4R9BA 3ENRA 2YPDA 1AR61 4AEJA 3Q8AA 3CBNA 3WP5A 1KGYA 2RS32 4IUGA 4M3CA 5JR7B 1M4WA 1QOTA 3HIFA 2A6WA 2GMEA 4Z8BA 5JMOA 2XB6C 2DCYA 1RUE1 4JAAA 4ZS3A 5JVVA 1CAVA 1MS4A 1OFSA 1ZYBA 3NKGA 1KD7A 2AH2A 3UT0A 3ASIA 4DOUA 3OSDA 5L7OA 1K42A 2B42B 2BEOA 5F5QA 3SCGA 4CCMA 1ULDA 3C7EA 4LTAA 5I93A 4Q4V3 1QNWA 2WT1A 1F31A 1UZZA 4NHMA 4ZKTB 4F7ZA 4PF5A 2WKKA 1C5IA 1ENSA 4FPCA 1AR63 4AFAA 3ZYBA 1DYKA 1AX2A 2WFF2 1CX1A 2A7AA 4NAMA 3A21A 5I0TA 3BKZA 1F8VA 4KBBA 1PZ7A 5FLHA 4K6BA 2Q1FA 1OVSA 4AQSA 1AX1A 1I6XA 3KT1A 2HWB3 5DUVA 5H9SA 1W8TA 1V9U1 3TYJA 4DZGA 4Z2AA 1M06G 1NCQC 1NLRA 5DUUA 1JZ3A 3FHQA 3LAGA 1BMV1 4A45A 4JGYB 2UYAA 1H8TC 1YQ6A 3CZJA 4YNIA 4NRMA 2X5IC 1LHUA 2HEVF 2OKXA 3LD8A 1UZYA 2Y8KA 1CAUA 4CCEA 4NRPA 5CAZA 5A80A 4MXVA 3FE5A 5FYBA 2VZTA 4FP2A 1SBDA 3M4FA 3FMGA 4IV3B 3H8OA 5A6XA 1GOHA 2FQPA 1C8M1 1CVNA 1FATA 1YIPA 4AEKA 5LATA 1S0JA 3AFGA 4NPLA 4OCTA 3ECQA 2VMIA 5DDJ3 5T52A 5GZDA 2WFF3 3VDDB 3ZSKA 4BMBA 4KI5M 1YYNA 2GNTA 1RUI2 3DYMA 3J7LA 3RZZA 4N43B 1BLZA 3KF5A 1SACA 3LA2A 3R6SA 4GALA 4RHV2 2WWSA 3DEMA 3DCQA 4NR1A 3LIGA 1COV2 2XQRA 3OPWA 1MEC1 4HL0A 3WG3A 4JGZA 4Q26A 5EP9A 3T2TA 2RHPA 3AKSA 3MV11 2I74A 2GH8A 3A4UA 2D6KA 1JYWA 3L2HA 3LPGA 5K0UA 1J3QA 1AR71 5LCWL 1WMDA 2PHUA 3D82A 2Y64A 1CIWA 5T5PA 5GLTA 1H2LA 1PO21 1KJLA 1REDA 3WQ0A 2D6MA 4YG0A 4ASMB 4EN6B 3POEA 4C90A 1E57A 4N53C 1JUIA 3K2OA 4JGZC 5CIRA 1OD5A 1SG3A 1LOFC 3NAPB 4IE7A 5FZOA 2ZKNA 4DS0A 1CONA 2VO5A 5J09A 2Y33A 4ES9A 1ENQA 1G86A 4M0NA 1NCQB 3VBRA 5LASA 3GZEA 3JUUA 2W87A 3C8XA 3OB8A 5D21A 3MIHA 1NE6A 3VDAA 3S5AA 3SH3A 3URFA 1W6PA 1W99A 3D6EA 1V70A 4I09A 5FZBA 2ZGTA 3ZN5A 1OF4A 4PI2A 4P9GA 3DPRC 2VQAA 1I5ZA 2W92A 3B02A 2VTXA 1RUH1 3ACFA 1BK1A 2A75A 4AGGA 4CCKA 1R081 4CDQA 5FR3A 2E7QA 3LEGA 2DUOA 4XIKA 2X09A 5K7PA 3TEZA 1K3IA 1ULGA 5FZ3A 1OPOA 1HRI3 3PTYA 1PO12 2HEWF 2UWCA 4IV1A 4LHNA 4YZ5A 2JXAA 4P5HA 2VOVA 1DGRA 1IG0A 3VZMA 5FP7A 2O0OA 4M3CB 3I2FA 1MZ6A 5LWBA 3WUCA 2RJKA 2Q30A 3JB4C 1BMV2 4CA9A 1BYHA 1PO11 2FCTA 4LBKA 4XXAA 3AMNA 1NY72 2I2SA 1NCRA 5CYYA 2XONA 4DEQA 4EN9B 3IN9A 2E7TA 4NIAA 1QJY2 4X6RB 5JI7A 1VRH2 5F1RA 2CDOA 4XBQA 4EWAA 5A3MA 1PZ9A 3G7DA 4A3ZA 2YHJA 1XOYA 4LULA 4BU2A 4C1XA 1QJU1 1DQ1A 4NO4A 3ZSJA 3POGA 5D8AB 5LZ6A 5DAVA 1GNZA 1WBFA 3GGLA 4K1YA 1CWPA 1W9TA 4TSVA 4WVZA 2LUWA 3U75A 2DU1A 3JZVA 5A32A 5CKMA 3VD4A 1ST8A 3NV4A 4D7TA 3GBGA 1G9AA 4LJHA 4XHXA 3I2JA 2OZ6A 5CFCB 2Q4SA 4TXWA 3C2UA 3GJBA 4CEWA 2WN2A 1JYVA 2UU8A 2WN3A 1FMD3 3USUA 3ZMOA 3WQBA 2BU9A 5J48A 4K8FA 1ZBE2 4IV1C 1LEMA 5EJZB 2D7FA 2RDQA 4LBQB 1CAUB 2TBVA 3ZDSA 3RG0A 2DBNA 3U4XA 4XFAA 3PMSA 2ERFA 3K4AA 4V1PA 4W6WA 2XVGA 3DF0A 4Z1VA 4Z07A 1SHWB 4W6YA 1IQAA 1YFXA 2IXJA 2GU9A 4PHZA 5F32A 5T3NA 3SCHA 4R8HA 3U10A 2C9AA 2J42A 2VQTA 5GKAC 3ZYJB 1BEV1 4S2DA 3E6CC 2VGDA 5LRSA 5JOZA 5JOXA 1CQ9A 4EV0A 4BMEA 2PTMA 1JODA 3E6BA 2Y6JA 1HRI1 4CEYC 5FPZA 1CAXA 2DFCA 2FDKA 1RUI1 4JGZB 3AX4A 3ZFEC 2W52A 4CYDA 4K7JA 2JWPA 1PX4A 2Y6LA 4JTNA 1QOOA 1S1AA 5FZFA 3KCCA 3RZKA 2GC0A 4P5YA 4TZDA 1ONAA 1FMD2 1KQRA 3ACHA 5FWJA 3MW4A 2ENRA 5J37A 1NA1A 1LODA 4D7SA 2I45A 3PVEA 5FZMA 1IS6A 3LA7A 2HJIA 5IVCA 3D4KA 1FV2A 3WV6A 1ZZ7A 4R9DA 4OUSA 5L36A 3MZHA 1V9U3 1NZIA 2RMU3 3H8XA 1CAWB 4G3YC 4BLIA 2J7MA 3T2QA 4QM8A 1RUD2 5FZGA 1XRUA 4MGKE 2HYXA 2YMZA 1C5HA 1K5MA 4H7LA 4LXLA 3I2IA 4LKSA 3WW2A 3ETQA 1G7YA 2HLEA 2Y38A 5DAQA 2YFZA 5FXXA 1FOD1 5KBFA 5JSOA 1AR91 4YARA 1O3SA 2PELA 3WF3A 3WUDA 1PO23 4FVVA 1HRV2 3I8TA 2DBIA 4GZ9A 1Q8VA 2CU5A 2QKDA 3WW4A 3UGGA 5BNNA 4YW6A 2JE9A 3T08A 1I1EA 4GMP1 4QXHA 2ZZJA 4NN0A 1QH6A 4GXLA 2H6CA 3NVCA 4QB2A 4ARYA 4BOWA 3TNPB 1DYPA 3UJOA 3VBRC 2BP6A 3VL8A 3BIEA 1R1A2 1DLLA 3MBWA 2QQNA 2QQUA 4HKOA 4Q0VA 2LM3A 1QHDA 2QQLA 2XLAA 1HW5A 2Z4FA 4LA3A 5FMBA 1ZRDA 3IPVA 2WNVA 4H3WA 5CU1A 4XUTA 4D6SA 4NVPA 5G04L 3I4IA 3Q8FA 4I3PA 3ZXAC 1VBE2 5E8AA 4ZZ8A 4P9WA 1RUE3 5FO8B 4MGYE 1LHWA 1GZTA 2XG3A 2HWF1 3KWVA 3I2GA 1UOGA 5A70A 2F4PA 4Y26A 4AGRA 2J1AA 3HBZA 2XJRA 2WQ8A 3C3VA 2PHFA 3N3HA 4Y1VA 1ENXA 2PAMA 2JECA 2WDBA 3I3DA 2P5BA 4IL7A 5L19A 4LMFA 2AGSA 1W6NB 4NWWA 4QX7A 5EIYB 1KDMA 2UYBA 3WNPA 1EV11 3VBFA 4YM2A 3SXWA 4F8AA 4MX3A 4N43A 4MXWA 3WW3A 3MFAA 1WMFA 2VZPA 2D6LX 5D8AA 1VBA3 3WSOA 1REFA 2HKXA 4MOAA 1HB3A 2ILMA 3AC0A 4NAOA 5FMOS 5I8SA 2WZR2 1PMJX 2ZGSA 1PVC3 3IDEA 1DGWX 3NQHA 4KL1A 4PLOA 5HPOA 3O1PA 2HWF2 4OUMA 1PM4A 1W05A 3ALQA 4YW3A 5F3EA 5F5CA 2WQ4A 1RVF2 2ZJCA 2AEZA 2ZX1A 3ZMNA 2VUJA 4Q4Y2 2FDIA 2WSUA 1DDLA 1YC61 2R063 3A0KA 4CEWB 2C6SA 1IPSA 1JOJA 2PHRA 5FP8A 5C8WA 1YHFA 4Q4Y3 3LOIA 1BBT1 3BODA 4IEOA 5JCTA 2CDPA 1XNCA 4Q5OA 2RDNA 1VMFA 3FLTA 5HCBA 1LESA 4AQTA 4HN0A 5F3IA 1VBC2 1A6CA 3I2KA 3IZOA 3ACIA 1GZCA 3E97A 1BQPA 4OHXA 2NN8A 4A7YA 1D0GA 1KEXA 2ZS6B 3FC0A 4M3CF 4BQ5A 1RGSA 5KHKA 3KQRA 2XJVA 5FY1A 2ID4A 1ZZCA 4XE9A 3IMMA 4MVTA 3PIJA 2ZEYA 2D43A 1JYTA 2XBO1 2JE8A 3PUIA 4JKKA 4KGQA 4A41A 3VZKA 2J1EA 2QQMA 1V6JA 2XLFA 4OI2A 4AAXA 4B8EA 1B35C 3N9OA 3PHMA 3PMEA 1C8NA 4M00A 1BKZA 3O1VA 4Q27A 5IVVA 4A42A 3I97A 5FPBA 1NKGA 3RQ0A 1IHMA 2A1XA 2HBTA 2YYOA 3IMNA 3CHXA 2YV8A 4Y22A 2VUAA 1DGLA 3I54A 1UIKA 4XDQA 1UOFA 2VPVA 4LITA 1CJPA 4OYUA 4IV1B 1D4M3 3A23A 5FAXA 1A8DA 1AL21 2GP5A 2O1QA 1RUI3 3AP5A 2CHHA 1QXRA 2ZXQA 3IB3A 1CN1A 4BHPA 1W9FA 3DYOA 2FZ2A 1DCSA 2B4KA 1Z0HA 3MW3A 4XQWA 3ZFEA 1PHMA 3EMRA 4QQPA 5DG1A 4A2UA 1L7QA 3KCYA 1IQDC 3LEMA 4XBLA 4YW7A 2VCAA 5EYXA 1ODNA 5IVFA 1KFXL 3RZJA 4RN5A 4AQ6A 2BFUL 3GZAA 1BJQA 4UYBA 3ZXGA 2ZKLA 2RJ2A 4J1WA 3EYPA 1UL9A 4D0QA 2A71A 1NLQA 1WMXA 5DG2A 2RS11 1VBD2 4PIZA 1X9PA 2V09A 3AKTA 2A73B 1OVPA 1PIV1 3KB5A 4H14A 4YW2A 3VKOA 1V6OA 1Q56A 4D3WA 2BVVA 2PHWA 1H0BA 4AVVA 2WL1A 1TQ5A 1NLSA 1GQGA 3LEKA 4HBNA 4NE9A 3T4VA 3VD3A 1JZ2A 4EN0A 1KRIA 3N9QA 3ZIXA 3POYA 1W2UA 1LGBA 4YFZA 3KV9A 1PM7A 4W4ZA 4QT6A 3X29B 2V73A 3WP4A 4D7YA 5GJ6A 2WSVA 2BOJA 2YFUA 4LORA 4QAWA 4OMCA 3UETA 4CDXA 1WD3A 2E26A 2LRPA 4IESA 3S6PA 1WLDA 1LNSA 1OPMA 3FZ3A 4HLTA 3DKQA 2IXLA 1GOFA 5DAXA 5IFTA 1W04A 3W9AA 1RL3A 1QMJA 3MDPA 3Q9OA 1BVP1 3M7AA 4Q4X1 5FXVA 3VBFB 4AEDA 4E8DA 3VBOA 3ETPA 5IUQA 2PAKA 4P9JA 2C0ZA 3AMQA 1U5ZA 3MI8A 5F39A 5FLJA 1YFYA 3HVDA 3TNQA 3OGVA 1FPN2 1X36A 1ZZ9A 2WS91 2DVBA 4HVRA 4YM1A 4EJRA 5HCHA 4MLOA 5FKBA 4YZ3A 4QGMA 2HWE3 3S0MA 5BNOC 4QDSA 2W5FA 5C9AA 1O3QA 1RHI1 3VL9A 1NA1B 4AL9A 3R4DB 5A3OA 3NAPC 4GB33 2FDJA 2A70A 2DYCA 4GJYA 2RJLA 1AJOA 3AVRA 3BU7A 3GCWA 3J7NA 4NOTA 1JTZX 1UXXX 5E88A 1OA3A 1V9U2 2BNMA 3VDCA 3WP6A 3ZXEA 3BTZA 2EIEA 1UN1A 4B1MA 2KA3A 5FZ7A 1LULA 3VBHB 2RG4A 2WNUB 4CCLA 4CXWA 4MHUA 2WZ8A 2PLV3 1RITA 4PDWB 5EPAA 3CJIC 1DU3D 4O65A 1S2KA 4BQXA 4Y4RA 4FOYA 3THPA 3IM0A 4Q0QA 4B4QA 2VXRA 3AB0A 3SNMA 1C1FA 2JENA 1VBC1 2WJSA 1ACCA 3EJKA 2VMFA 2VD7A 4XURA 4XJAA 1Y9MA 5L73A 4FTEA 2A6VA 3AP7A
chains in the Genus database with same CATH topology
2E32A 3JXSA 4QX3A 1UWWA 3K75B 1KGYA 4IUGA 4TTGA 5JR2A 5JMOA 3ACGA 3HJRA 3DECA 2V72A 3NRUA 1K42A 3WNNA 3I3EA 2VZQA 1OT5A 3C7FA 4CUCA 4E8CA 3WEZA 1K45A 4CUBA 3CQOA 3C7EA 2EICA 5JXIA 4BK5A 4ZY9A 1CX1A 3A21A 4DEVA 3D3AA 2W46A 3WNKA 4QX2A 1JZ8A 3WNMA 3OGSA 4Z2AA 3VD5A 1JZ3A 3FHQA 3GM8A 4A45A 4XZUG 1CIYA 1H6XA 2W9XA 4BJ0A 1OH4A 3CZJA 4RYDA 2OKXA 2YC2A 4HG6B 2Y8KA 4P02B 2VQUA 5JXGA 1J83A 4OZOA 3T0BA 4BXSV 2VZTA 4D8MA 2J1TA 3SKVA 1GOHA 1L7RA 4OUEA 3C7HA 3OEBA 2KD7A 1JYXA 2C9KA 4XUQA 3A22A 3ECQA 2VOTA 4UOJA 4KI5M 2WYSA 3DYMA 3OG2A 2JD9A 1EUTA 1NAEA 2QQIA 2W95A 3NJXA 3WNOA 4A4AA 4DXSA 3UNPA 3CZUA 2VZVA 3MV11 2ZEWA 5DQ0A 1JYWA 3LPGA 4A44A 5LCWL 4GWJA 2Y64A 4PQQA 5IHRA 3CDZB 4KMQA 3VD9A 1SG3A 1JZ6A 1TVGA 4CU8A 1DLCA 2VO5A 3MO4A 2QBXA 2ZEXA 3DYPA 2W87A 3C8XA 5LA2A 3THDA 4CU9A 3OB8A 3OEAA 3F2ZA 3VDAA 1UZ0A 1W99A 3NNGA 1OF4A 4PT6A 5G05L 3WF4A 1UMHA 2W92A 5C70A 1GQPA 1T2XA 1UX7A 3ACFA 3NJVA 3T2OA 1OF3A 3MUY1 3LEGA 2X09A 2LW8A 1K3IA 3HNBM 4MO3M 4QB1A 1ULPA 3LQCA 2BBAA 2X05A 1P8JA 2W47A 1HN1A 2EIBA 1I5PA 3I2FA 2VL4A 2L9LA 4DXTA 2V5DA 3P6BA 1W8OA 4DUXA 2VMDA 2WAAA 4P08A 5CYYA 2XONA 4DEQA 2VR4A 3LEIA 1W0NA 2CDOA 3T2PA 1XNTA 4AG4A 4A3ZA 2EIDA 4DUVA 3IIIA 2XQXA 2J1UA 1JHJA 2XHNA 4LHSA 3GGLA 1JYNA 1F4HA 1W9TA 3OGRA 4XUNA 2VJXA 2JKXA 4FI9A 3MUZ1 2BGOA 3VD4A 1UMIA 1GUIA 3C7GA 3I2JA 2W91A 4TXWA 1JZ5A 2WN2A 1JYVA 2WN3A 3WQBA 1UY3A 2RVAA 3J7HA 5EJZB 2VZOA 3BN6A 2W1UA 4GWIA 3K4AA 5FUIA 2J22A 3HNYM 1OD3A 2C4XA 4YPJA 1SHWB 5A1AA 1GU3A 2VQTA 2VZ1A 4QDQA 1ULOA 2Y6JA 2BERA 4BK4A 3VDBA 1NX9A 4QDRA 2Y6KA 2BZDA 2VZRA 4UAPA 1UYYA 4LPLA 1DYOA 5JXJA 2Y6LA 1PX4A 5EJ1B 4P5YA 3ACHA 3K4DA 3BGAA 1SDDB 3W5NA 1W9WA 2J1SA 2QQOA 5B4XA 2W1QA 2J1RA 2J7MA 3T2QA 2HYXA 5J1XA 1CZSA 5DMYA 5I0DA 3EB7A 1CZTA 3I2IA 1US3A 4LKSA 3WNLA 1PX3A 2DDUA 4CU7A 2HLEA 2YFZA 3HOBA 1JU3A 1PMHX 3WF3A 1UY1A 3LPFA 4GZ9A 2W1WA 5F7UA 3K77A 3T08A 4OMDA 4KWUA 2YB7A 4QB2A 3CKHA 3WF1A 4ARYA 3MBWA 2DCKA 3T09A 5LA1A 2QQNA 4CVUA 2QQLA 2VCCA 2Z4FA 2DCJA 4XUTA 5G04L 1CZVA 2WZEA 4ZZ8A 3U37A 2C26A 3I2HA 3PUHA 4DXRA 3I2GA 1O8SA 1YQ2A 2J1AA 2VMEA 2WQ8A 4JHZA 2WDBA 1W9SA 3I3DA 2QQJA 5EIYB 3WNPA 1UYZA 3SEPA 2VZPA 1O8PA 3OBAA 3WSOA 4MOAA 5B4NA 3AC0A 1PMJX 3NQHA 3SKJE 5HPOA 2JDAA 2RV9A 4XUPA 3HPNA 1UY2A 4JKMA 1GNYA 3HNMA 3IAPA 1JU4A 4XUOA 1XNAA 4JX0A 1XPWA 2ORXA 1J84A 2R7EB 2CDPA 2J1VA 1EUUA 2W94A 5IYYA 3I2KA 2Y6GA 2PQSA 3ACIA 4CUAA 1KEXA 4P00B 2ID4A 5LA0A 1UY0A 2ZEYA 2VZ3A 1US2A 3VD7A 2WBKA 2JE8A 3PUIA 4JKKA 2ORZA 4A41A 2J1EA 2QQMA 1NUKA 2E33A 4AAXA 1UXZA 3C7OA 3THCA 4A42A 1JZ7A 3SEEA 3I97A 1H6YA 5IJRA 1NKGA 2VCBA 1WCQA 1W8NA 3IDAA 2X10A 4OYUA 4ZXEA 3A23A 3CIHA 2B9VA 2Y6HA 2VZUA 4A6OA 3MV01 4W8JA 3ABZA 2ZXQA 3LE0A 3IB3A 3DYOA 1DP0A 2QQKA 2B4KA 2YG0A 4CU6A 1L7QA 1IQDC 3FHAA 3GXUA 2VCAA 2WUHA 2W1SA 4RN5A 5DN2A 3A7QA 2LS6A 2RJ2A 5C71A 3T0DA 1UYXA 3EYPA 4D0QA 3FL7A 4MADA 4PF1A 3HN3A 4QX1A 2VMCA 4QPWA 4MGQA 1O59A 3I3BA 4QX0A 1JZ4A 4ARXA 1MPXA 5DPNA 3HEIA 3WF2A 3ZM8A 3LEKA 1GMMA 1R64A 3VD3A 1JZ2A 5HXMA 2WO2A 1K12A 3GDBA 4ET7A 4W4ZA 3WF0A 2E31A 2BGPA 4ZZ5A 2YFUA 1RYYA 4QAWA 3UETA 4OMCA 4LQRA 2E26A 3UESA 1LNSA 2WO1A 3E1F1 4BDVB 1GOFA 4JKLA 5IFTA 5IFPA 1JI6A 4E8DA 4QB6A 2VZSA 3ETPA 3W5MA 3K46A 5C7GA 2VC9A 3OGVA 2VTFA 2W3JA 2ZEZA 4W50A 1UY4A 2WABA 5CZKA 4QDSA 2W5FA 5JUVA 1GOGA 2WAOA 4XVHA 4L0PA 2VM9A 5JXHA 3P1IA 2YC4A 1UXXX 3CMGA 4M4RA 2WO3A 3VDCA 3T0AA 1WKYA 1D7PM 2EIEA 3IAQA 4DUWA 2WZ8A 2V4VA 4MGSA 1TG7A 3K4ZA 3FN9A 1BHGA 1F4AA 2XOMA 4M4PA 4UI9L 2VMFA 1XC6A 4XURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E32 A;  3JXS A;  4QX3 A;  1UWW A;  3K75 B;  1KGY A;  4IUG A;  4TTG A;  5JR2 A;  5JMO A;  3ACG A;  3HJR A;  3DEC A;  2V72 A;  3NRU A;  1K42 A;  3WNN A;  3I3E A;  2VZQ A;  1OT5 A;  3C7F A;  4CUC A;  4E8C A;  3WEZ A;  1K45 A;  4CUB A;  3CQO A;  3C7E A;  2EIC A;  5JXI A;  4BK5 A;  4ZY9 A;  1CX1 A;  3A21 A;  4DEV A;  3D3A A;  2W46 A;  3WNK A;  4QX2 A;  1JZ8 A;  3WNM A;  3OGS A;  4Z2A A;  3VD5 A;  1JZ3 A;  3FHQ A;  3GM8 A;  4A45 A;  4XZU G;  1CIY A;  1H6X A;  2W9X A;  4BJ0 A;  1OH4 A;  3CZJ A;  4RYD A;  2OKX A;  2YC2 A;  4HG6 B;  2Y8K A;  4P02 B;  2VQU A;  5JXG A;  1J83 A;  4OZO A;  3T0B A;  4BXS V;  2VZT A;  4D8M A;  2J1T A;  3SKV A;  1GOH A;  1L7R A;  4OUE A;  3C7H A;  3OEB A;  2KD7 A;  1JYX A;  2C9K A;  4XUQ A;  3A22 A;  3ECQ A;  2VOT A;  4UOJ A;  4KI5 M;  2WYS A;  3DYM A;  3OG2 A;  2JD9 A;  1EUT A;  1NAE A;  2QQI A;  2W95 A;  3NJX A;  3WNO A;  4A4A A;  4DXS A;  3UNP A;  3CZU A;  2VZV A;  3MV1 1;  2ZEW A;  5DQ0 A;  1JYW A;  3LPG A;  4A44 A;  5LCW L;  4GWJ A;  2Y64 A;  4PQQ A;  5IHR A;  3CDZ B;  4KMQ A;  3VD9 A;  1SG3 A;  1JZ6 A;  1TVG A;  4CU8 A;  1DLC A;  2VO5 A;  3MO4 A;  2QBX A;  2ZEX A;  3DYP A;  2W87 A;  3C8X A;  5LA2 A;  3THD A;  4CU9 A;  3OB8 A;  3OEA A;  3F2Z A;  3VDA A;  1UZ0 A;  1W99 A;  3NNG A;  1OF4 A;  4PT6 A;  5G05 L;  3WF4 A;  1UMH A;  2W92 A;  5C70 A;  1GQP A;  1T2X A;  1UX7 A;  3ACF A;  3NJV A;  3T2O A;  1OF3 A;  3MUY 1;  3LEG A;  2X09 A;  2LW8 A;  1K3I A;  3HNB M;  4MO3 M;  4QB1 A;  1ULP A;  3LQC A;  2BBA A;  2X05 A;  1P8J A;  2W47 A;  1HN1 A;  2EIB A;  1I5P A;  3I2F A;  2VL4 A;  2L9L A;  4DXT A;  2V5D A;  3P6B A;  1W8O A;  4DUX A;  2VMD A;  2WAA A;  4P08 A;  5CYY A;  2XON A;  4DEQ A;  2VR4 A;  3LEI A;  1W0N A;  2CDO A;  3T2P A;  1XNT A;  4AG4 A;  4A3Z A;  2EID A;  4DUV A;  3III A;  2XQX A;  2J1U A;  1JHJ A;  2XHN A;  4LHS A;  3GGL A;  1JYN A;  1F4H A;  1W9T A;  3OGR A;  4XUN A;  2VJX A;  2JKX A;  4FI9 A;  3MUZ 1;  2BGO A;  3VD4 A;  1UMI A;  1GUI A;  3C7G A;  3I2J A;  2W91 A;  4TXW A;  1JZ5 A;  2WN2 A;  1JYV A;  2WN3 A;  3WQB A;  1UY3 A;  2RVA A;  3J7H A;  5EJZ B;  2VZO A;  3BN6 A;  2W1U A;  4GWI A;  3K4A A;  5FUI A;  2J22 A;  3HNY M;  1OD3 A;  2C4X A;  4YPJ A;  1SHW B;  5A1A A;  1GU3 A;  2VQT A;  2VZ1 A;  4QDQ A;  1ULO A;  2Y6J A;  2BER A;  4BK4 A;  3VDB A;  1NX9 A;  4QDR A;  2Y6K A;  2BZD A;  2VZR A;  4UAP A;  1UYY A;  4LPL A;  1DYO A;  5JXJ A;  2Y6L A;  1PX4 A;  5EJ1 B;  4P5Y A;  3ACH A;  3K4D A;  3BGA A;  1SDD B;  3W5N A;  1W9W A;  2J1S A;  2QQO A;  5B4X A;  2W1Q A;  2J1R A;  2J7M A;  3T2Q A;  2HYX A;  5J1X A;  1CZS A;  5DMY A;  5I0D A;  3EB7 A;  1CZT A;  3I2I A;  1US3 A;  4LKS A;  3WNL A;  1PX3 A;  2DDU A;  4CU7 A;  2HLE A;  2YFZ A;  3HOB A;  1JU3 A;  1PMH X;  3WF3 A;  1UY1 A;  3LPF A;  4GZ9 A;  2W1W A;  5F7U A;  3K77 A;  3T08 A;  4OMD A;  4KWU A;  2YB7 A;  4QB2 A;  3CKH A;  3WF1 A;  4ARY A;  3MBW A;  2DCK A;  3T09 A;  5LA1 A;  2QQN A;  4CVU A;  2QQL A;  2VCC A;  2Z4F A;  2DCJ A;  4XUT A;  5G04 L;  1CZV A;  2WZE A;  4ZZ8 A;  3U37 A;  2C26 A;  3I2H A;  3PUH A;  4DXR A;  3I2G A;  1O8S A;  1YQ2 A;  2J1A A;  2VME A;  2WQ8 A;  4JHZ A;  2WDB A;  1W9S A;  3I3D A;  2QQJ A;  5EIY B;  3WNP A;  1UYZ A;  3SEP A;  2VZP A;  1O8P A;  3OBA A;  3WSO A;  4MOA A;  5B4N A;  3AC0 A;  1PMJ X;  3NQH A;  3SKJ E;  5HPO A;  2JDA A;  2RV9 A;  4XUP A;  3HPN A;  1UY2 A;  4JKM A;  1GNY A;  3HNM A;  3IAP A;  1JU4 A;  4XUO A;  1XNA A;  4JX0 A;  1XPW A;  2ORX A;  1J84 A;  2R7E B;  2CDP A;  2J1V A;  1EUU A;  2W94 A;  5IYY A;  3I2K A;  2Y6G A;  2PQS A;  3ACI A;  4CUA A;  1KEX A;  4P00 B;  2ID4 A;  5LA0 A;  1UY0 A;  2ZEY A;  2VZ3 A;  1US2 A;  3VD7 A;  2WBK A;  2JE8 A;  3PUI A;  4JKK A;  2ORZ A;  4A41 A;  2J1E A;  2QQM A;  1NUK A;  2E33 A;  4AAX A;  1UXZ A;  3C7O A;  3THC A;  4A42 A;  1JZ7 A;  3SEE A;  3I97 A;  1H6Y A;  5IJR A;  1NKG A;  2VCB A;  1WCQ A;  1W8N A;  3IDA A;  2X10 A;  4OYU A;  4ZXE A;  3A23 A;  3CIH A;  2B9V A;  2Y6H A;  2VZU A;  4A6O A;  3MV0 1;  4W8J A;  3ABZ A;  2ZXQ A;  3LE0 A;  3IB3 A;  3DYO A;  1DP0 A;  2QQK A;  2B4K A;  2YG0 A;  4CU6 A;  1L7Q A;  1IQD C;  3FHA A;  3GXU A;  2VCA A;  2WUH A;  2W1S A;  4RN5 A;  5DN2 A;  3A7Q A;  2LS6 A;  2RJ2 A;  5C71 A;  3T0D A;  1UYX A;  3EYP A;  4D0Q A;  3FL7 A;  4MAD A;  4PF1 A;  3HN3 A;  4QX1 A;  2VMC A;  4QPW A;  4MGQ A;  1O59 A;  3I3B A;  4QX0 A;  1JZ4 A;  4ARX A;  1MPX A;  5DPN A;  3HEI A;  3WF2 A;  3ZM8 A;  3LEK A;  1GMM A;  1R64 A;  3VD3 A;  1JZ2 A;  5HXM A;  2WO2 A;  1K12 A;  3GDB A;  4ET7 A;  4W4Z A;  3WF0 A;  2E31 A;  2BGP A;  4ZZ5 A;  2YFU A;  1RYY A;  4QAW A;  3UET A;  4OMC A;  4LQR A;  2E26 A;  3UES A;  1LNS A;  2WO1 A;  3E1F 1;  4BDV B;  1GOF A;  4JKL A;  5IFT A;  5IFP A;  1JI6 A;  4E8D A;  4QB6 A;  2VZS A;  3ETP A;  3W5M A;  3K46 A;  5C7G A;  2VC9 A;  3OGV A;  2VTF A;  2W3J A;  2ZEZ A;  4W50 A;  1UY4 A;  2WAB A;  5CZK A;  4QDS A;  2W5F A;  5JUV A;  1GOG A;  2WAO A;  4XVH A;  4L0P A;  2VM9 A;  5JXH A;  3P1I A;  2YC4 A;  1UXX X;  3CMG A;  4M4R A;  2WO3 A;  3VDC A;  3T0A A;  1WKY A;  1D7P M;  2EIE A;  3IAQ A;  4DUW A;  2WZ8 A;  2V4V A;  4MGS A;  1TG7 A;  3K4Z A;  3FN9 A;  1BHG A;  1F4A A;  2XOM A;  4M4P A;  4UI9 L;  2VMF A;  1XC6 A;  4XUR A; 
#chains in the Genus database with same CATH topology
 4AFM A;  1OLR A;  1AR8 3;  3JXS A;  1AYN 1;  1ZNP A;  4Q0P A;  1J3R A;  1LHO A;  1SQ4 A;  2ZML A;  3CF6 E;  4QX3 A;  1AR9 2;  2JDK A;  5A33 A;  4C91 A;  1LOG A;  1ZA7 A;  4MGI E;  1VP6 A;  4TTG A;  2PXJ A;  1NG0 A;  2JIC A;  3B01 A;  1X82 A;  3MIB A;  2RS5 1;  3HJR A;  4HK9 A;  3TOJ A;  1FNZ A;  3WP3 A;  4B3N A;  2V72 A;  3NRU A;  4V2V A;  3I3E A;  4GD4 A;  1OT5 A;  5FTT C;  3SIT A;  2WNV B;  5H9P A;  1QY4 A;  1K45 A;  2G1M A;  4CUB A;  3CQO A;  4O9G A;  5KXB A;  3ZX7 A;  4XAA A;  5KC6 A;  3SH5 A;  2W0X A;  1LHV A;  3SQO A;  2PN5 A;  1VAK A;  3ZO0 B;  4QM9 A;  3BAL A;  1O91 A;  1G9B A;  1IG3 A;  1VJ2 A;  1S0D A;  3WR0 A;  3WNK A;  1GP6 A;  5APA A;  5FYC A;  2P6H A;  4CPB A;  1GP4 A;  3TB0 A;  1JZ8 A;  1W6N A;  2CYF A;  1QGL A;  2ZZQ A;  3S57 A;  5KWR A;  3POI A;  4XIL A;  1J59 A;  2WO7 A;  3OGS A;  3AXD A;  3THT A;  5FZK A;  5F8P A;  3GM8 A;  4KBZ A;  3OCP A;  3S7I A;  3PDQ A;  3CJI B;  1H6X A;  1UYP A;  1MEC 3;  1TME 2;  2W9X A;  4AFC A;  4BJ0 A;  4N8M A;  4Q4W 3;  2YC2 A;  1OOP C;  5FY0 A;  2DF7 A;  4OZX A;  4YVS A;  4ISR A;  4OQ9 A;  4OZO A;  4XQ4 A;  5EQU A;  1XYO A;  2JG8 C;  2WII B;  2ZX2 A;  3QLQ A;  5A3N A;  4IER A;  5JMC A;  2J1T A;  4OUE A;  3RDI A;  4RA0 A;  3OEB A;  3ZSE A;  5A3L A;  1JYX A;  5ACA 2;  1HRV 1;  2BYV E;  3LA3 A;  2Y0I A;  1WW6 A;  1EV1 3;  3M3I A;  1AF9 A;  3J9S A;  4Q1P A;  1DQ5 A;  3OG2 A;  1A3K A;  3POS A;  4BQY A;  1IKP A;  1IOA A;  3WDY A;  4YSF A;  1NAE A;  1NYW A;  2HWC 1;  5FMC A;  5A6Q A;  1PO2 2;  2OXB A;  3NJX A;  1HRV 3;  2E63 A;  4HSL A;  5FPV A;  4DXS A;  2JG9 B;  3ZPO A;  2HWF 3;  1ZBA 3;  4A44 A;  5A1F A;  4GWJ A;  3GZU C;  4AED B;  3VBO B;  1PGL 1;  5LBC A;  1OKQ A;  3Q8B A;  1MEC 2;  1J3P A;  1TME 3;  4MH0 E;  4RS5 B;  1YIF A;  3NL1 A;  2VUC A;  1Q8P A;  4RR3 C;  4S2H A;  4IEQ A;  1W6Q B;  4IEY A;  4PLN A;  3VD9 A;  1JZ6 A;  4RFR B;  1RUC 3;  3L9J T;  1X8M A;  3WG1 A;  2BVB A;  5M0T A;  2MEV 3;  3WT3 A;  1VBE 1;  3IT8 A;  3ZYH A;  2KR2 A;  2QBX A;  2OW4 A;  2WNU C;  3J8F 3;  1RUJ 1;  5A7O A;  5C9A B;  4CDW A;  5TSW A;  5A3P A;  1GWM A;  3THD A;  4WVM A;  1AR6 2;  1AR9 3;  1YI9 A;  3U1X A;  3N9N A;  4AOC A;  3I2O A;  2BFU S;  2QDR A;  3N7J A;  1O3R A;  1UOJ A;  2HEY F;  2DTW A;  5FYU A;  1AR8 2;  2QJV A;  4ASL A;  3WDU A;  4ZU7 A;  4PT6 A;  3RZG A;  3AP6 A;  1VB4 A;  3GAL A;  3P3P A;  3USS A;  2WFP A;  2X8K A;  1QF3 A;  1UMH A;  3RMY A;  4CDU C;  4ZS2 A;  4LIV A;  1V00 A;  3JB8 A;  2WYF A;  1T2X A;  1UX7 A;  2R07 1;  2WNU A;  5FWE A;  5JXG A;  2UUR A;  1U0A A;  3Q8C A;  4Y20 A;  3MIE A;  2P3K A;  2RR1 1;  3VBF C;  3EXU A;  3WG2 A;  5FPX A;  3BYW A;  3GCX A;  5CFD C;  4XJ8 A;  3BI3 A;  5FV3 A;  4GIQ A;  3HNB M;  3WIN E;  5A3T A;  1ULP A;  1JS9 A;  2NMO A;  5FYV A;  1H2N A;  5KXE A;  1N1T A;  3OY8 A;  5LK7 B;  4JRL A;  1HB2 A;  2W47 A;  3DN7 A;  3NV3 A;  2EF6 A;  2YGM A;  3FHI B;  4LLF A;  3TRS B;  5I0S A;  3W21 A;  2V5D A;  1QQP 2;  1QEX A;  1VRB A;  3JBG 1;  1X8E A;  4DXZ A;  3RPQ A;  5JAX A;  2ARA A;  2WAA A;  1QJU 2;  4L8Q A;  4SLI A;  3RSJ A;  1ASJ 2;  5DXD A;  4YW1 A;  1D2Q A;  1OSG A;  4OHW A;  4GMP 3;  2R0H A;  1RIN A;  4JVA A;  5KHI A;  2P3Y A;  3VBH C;  3TEW A;  2Q8O A;  2WQZ C;  5FUN A;  4CDX B;  2BDR A;  4LHS A;  1JYN A;  2BNO A;  1AYM 3;  4DMI A;  1ND3 A;  4IGO A;  4XUN A;  2QZ2 A;  3GZT B;  5BNP C;  4FI9 A;  3MUZ 1;  1QWR A;  2LRO A;  1H1I A;  2QVS B;  5FO7 B;  1G9D A;  3BPZ A;  1RHI 3;  3PUQ A;  4WM8 C;  1UMI A;  1GUI A;  1ZRC A;  2DU0 A;  4PCR A;  3V0A B;  4YVW C;  1VLN A;  2RS5 2;  1O7F A;  3E6D A;  4K21 A;  4K9S A;  1OOP A;  1Q5O A;  5FLI A;  1LOE A;  4AVS A;  4YM3 A;  3IWZ A;  3PU3 A;  4J1X A;  5BNP A;  2DVA A;  1UY3 A;  5FQ0 B;  3AKP A;  3BN6 A;  2W1U A;  4QX8 A;  1DIW A;  1YQ8 A;  3AZW A;  1JMU B;  5EWS A;  1MZ5 A;  5E16 A;  4YPJ A;  5LEJ A;  4ORF A;  4GH4 C;  1WCK A;  2RMU 1;  4ISQ A;  2RE9 A;  4KU7 A;  2VZ1 A;  3CNA A;  4P9L A;  4R52 A;  2XDV A;  1ULO A;  3UGF A;  1SMV A;  3K3O A;  4QXK A;  4LBN A;  1HQN A;  1MZE A;  1PGW 1;  4E4H A;  4XJZ A;  3WDV A;  2BER A;  4PDW A;  1X33 A;  4BK4 A;  1R09 2;  5C3R A;  4FTS A;  4D69 A;  4XDP A;  1RJ7 A;  3O7O A;  4FCA A;  5AC9 3;  2VZR A;  3PJQ A;  4UAP A;  4CCC A;  3LGR A;  1JYC A;  1POV 3;  1Y9G A;  2IWG B;  4LPL A;  4XMA A;  5JXJ A;  4ZHN A;  2YU2 A;  1VBD 1;  4Q4W 1;  3ZFF C;  1AJK A;  2OPW A;  4SBV A;  2QUO A;  5EJ1 B;  1I3H A;  3POF A;  2IVI B;  4BQ1 A;  3BGA A;  3CL1 A;  5JIA A;  4D6Q A;  4LO8 A;  5A33 B;  1SLC A;  3VKN A;  2J1S A;  2NYY A;  1Q8O A;  1RVF 3;  1C28 A;  4FAG A;  4KGG A;  1XNK A;  2WNO A;  5B4X A;  3O1U A;  4FT8 A;  2HWE 1;  2KXL A;  4M01 A;  4X6Q B;  3AK0 A;  1REE A;  5GM0 A;  1VRH 3;  1MS5 A;  3HN1 A;  3OGG A;  2QQV A;  2AR6 A;  4XTP A;  2RM2 2;  3BTA A;  2PYT A;  1DQ0 A;  4E27 A;  1CZS A;  4A6S A;  2G9F A;  4FOQ A;  5FK7 A;  3B9C A;  1O5U A;  2ZGU A;  3V0B B;  4RL7 A;  1RMU 1;  4CU7 A;  1N47 A;  3HOB A;  5IK7 A;  1JU3 A;  1PMH X;  1H1A A;  2ZGM A;  5AC9 2;  1NY7 1;  1WWY A;  2EVX A;  2A6Z A;  3KHB A;  4B4R A;  1UU6 A;  2JDN A;  3NNL A;  2UY8 A;  3K77 A;  5CFD A;  4CPB D;  4D94 A;  1H9W A;  2YB7 A;  2EAA A;  4LBQ D;  1PGL 2;  1CES A;  1H2K A;  4NUB A;  1AHS A;  1Q8Q A;  2IC1 A;  1GAN A;  1E5H A;  5LA1 A;  3QBQ A;  1TNR A;  3KZ4 C;  2VCC A;  5FZE A;  3NJY A;  3OY8 B;  5EYY A;  1XU1 A;  2RS1 2;  1NOV A;  1G6N A;  5C9A C;  5C3P A;  2ZGN A;  3ZFG B;  4B7E A;  2C26 A;  3VN4 A;  2JD4 A;  4AEM A;  3FBM A;  4CDX C;  4LO4 B;  3Q8E A;  4WZC A;  4Q0S A;  4AI8 A;  4DXR A;  5CKQ A;  4LR4 A;  4JHZ A;  3JBG 3;  3HQU A;  5LK5 A;  4IE5 A;  1XQN A;  2GDF A;  3JD7 3;  4AVT A;  4CCJ A;  3ZXD A;  2BWA A;  4FBF A;  2FDH A;  2WFF 1;  4URA A;  3MF6 A;  4CDQ C;  1HKD A;  2W39 A;  1VR3 A;  3AFK A;  4CP0 A;  2E6V A;  3BTY A;  1RB8 G;  3FX3 A;  2B5H A;  4AVA A;  1W6M B;  4E4Z A;  4YVW B;  3OBA A;  4Q4Y 1;  1I9R A;  1POV 0;  1JH5 A;  1W06 A;  2ZGL A;  5E6H A;  5FY5 A;  4BB3 A;  2VNR A;  3BCW A;  4RHV 1;  2NM1 A;  2JG9 A;  3VKM A;  2RV9 A;  4XUP A;  3TN9 1;  4HAN A;  3HPN A;  4LOS A;  4PIY A;  1WLT A;  1ZRE A;  1V6I A;  1YNA A;  3B5L B;  2QE3 A;  4M0H A;  1SBF A;  2ZCW A;  4OLL A;  4BWO A;  4CP2 A;  1FYU A;  3IAP A;  4UFM A;  5KHJ A;  1N1S A;  1QDC A;  4XCB A;  3H8R A;  1UU5 A;  4IV3 A;  4DB5 A;  4XUO A;  1XNA A;  2BQP A;  2JDY A;  1O4Y A;  1U5X A;  4GH4 B;  5CB7 A;  3VHP A;  2G19 A;  2FBE A;  4CE8 A;  2ORX A;  2PHD A;  1W6Q A;  2G9G A;  3T30 A;  1J58 A;  1BEV 2;  1J84 A;  1H1M A;  2YUE A;  4V2W A;  2J1V A;  1EUU A;  1K5J A;  2HWB 1;  2W94 A;  1GSL A;  3NJZ A;  4L92 A;  4OVE A;  5IAX A;  2XJQ A;  5JPN B;  5L9V A;  4CUA A;  2VNG A;  3PVO A;  4CP9 A;  1JHN A;  1PMI A;  2XUM A;  1PZ8 A;  4DIQ A;  4P00 B;  1HJF A;  4XYX A;  4Q4V 1;  2VQ0 A;  1UY0 A;  3ST7 A;  2KM2 A;  5ANN A;  3VDD C;  5LA0 A;  4BQ3 A;  4PDW C;  5FZ8 A;  2WT2 A;  3VD7 A;  3ZFG C;  4Z92 B;  3AMP A;  4COY A;  2ORZ A;  2WZR 3;  3N36 A;  3OUJ A;  3UK9 A;  4E2S A;  3APB A;  2BW8 A;  3UL2 A;  3B94 A;  1AR7 3;  1F5F A;  5FZ0 A;  2BNN A;  1IS4 A;  1F15 A;  5BPX A;  2VCB A;  3RI9 A;  1OLM E;  1OUX A;  3K3N A;  1SLL A;  1WCQ A;  3H9A A;  3IDA A;  5IT6 A;  1B35 A;  2PHT A;  2RDR A;  4COV A;  1HXS 1;  5GZC A;  5L7O B;  2ARE A;  4BIO A;  3N9M A;  3KMH A;  2R06 1;  3J26 N;  1SLT A;  3CIH A;  1N3O A;  3N7K A;  4FAH A;  2VH9 A;  1DFQ A;  3VZJ A;  5DUW A;  3O5S A;  1F9K A;  3T4H B;  3ZKU A;  4W8J A;  2NQY A;  2ES3 A;  5I8T A;  1B09 A;  2R07 3;  1WA4 A;  2GMP A;  4E2Q A;  1LRH A;  1RUD 1;  4A7Z A;  5JDB A;  2QQK A;  3MYX A;  2R04 1;  5ACA 1;  5ABJ B;  3UKT A;  4FPL A;  1W2O A;  2A3X A;  3FHA A;  3GXU A;  4IW3 A;  4ATF A;  4HXC A;  5D1I A;  5DN2 A;  5K4L A;  5KXC A;  3A7Q A;  5IAV A;  2LS6 A;  4E4D X;  4UF0 B;  2VEC A;  1UAI A;  5FY7 A;  2CAV A;  5F37 A;  2AC1 A;  4GQ7 A;  4EQV A;  4YW5 A;  1YCI A;  2GAL A;  3MID A;  4QPW A;  1VIW B;  1Q3E A;  4HPK A;  2Y34 A;  3BPS A;  1O59 A;  3H3L A;  4FQZ A;  4AGV A;  1N1V A;  1YQ5 A;  5BY5 A;  1BEV 3;  4AW7 A;  2ADE A;  2WS9 3;  3NNJ A;  5IVB A;  3V0A A;  5FRE A;  3ZM8 A;  5FOJ B;  1GMM A;  1YJL A;  4S2F A;  1W8Z A;  2BJS A;  1JBC A;  1EPW A;  4ET7 A;  5FIX A;  3RJR A;  1GV9 A;  5FXZ A;  4CDW C;  2E31 A;  3ZXF A;  5F2S A;  4YZ2 A;  4L2N A;  1PVC 2;  4BZ4 A;  4IND A;  3HD8 B;  4JTO A;  5J98 B;  4LQR A;  5LB6 A;  3RGB A;  4XF0 A;  5GLZ A;  2EIG A;  5FY9 A;  1AL0 G;  4JKL A;  5IFP A;  2R16 A;  5A32 B;  5FDB A;  1BBT 3;  3NV1 A;  2ZBJ A;  4XOG A;  3RNS A;  3W5M A;  1Z7S 2;  1GWL A;  2GAU A;  1OUS A;  5DZG A;  2W2I A;  5CFC A;  1W6M A;  1W28 A;  5C7G A;  5D8A C;  2VC9 A;  2B9U A;  3AYA A;  1VBC 3;  4I3G A;  5T54 A;  1IS5 A;  4KWJ A;  3G6J B;  3NAP A;  4AED C;  2W3J A;  2ZEZ A;  4CUG A;  1NQJ A;  4OQ8 A;  3R05 A;  5KXD A;  5CZK A;  2WA4 A;  3KS7 A;  2IFW A;  5FZ9 A;  1XE7 A;  5JUV A;  4XBN A;  4FOW A;  2NP0 A;  3BUC A;  1LJ7 A;  1YQC A;  4XVH A;  1O4T A;  3R4S A;  4QHO A;  4CCO A;  1VAL A;  2VM9 A;  5EJ3 A;  2R30 A;  1HQL A;  3CMG A;  2WO3 A;  2E53 A;  4XFG A;  1WW5 A;  3H0O A;  1WKY A;  5C8C C;  2DUR A;  1D7P M;  5GZF A;  4A3X A;  4AI3 A;  2PQQ A;  3IIA A;  4Y4Y A;  5C3Q A;  3S30 A;  1U5Y A;  1AL2 2;  3MIG A;  4K40 A;  4N43 C;  4GUL A;  3ZVX A;  4CP9 B;  5CG8 A;  4GWN A;  1OC1 A;  2WWU A;  1LCL A;  2B7Y A;  3N7L A;  3OOX A;  5FFO C;  3J8F 2;  2EXJ A;  2RM2 1;  4LE4 A;  3SC7 X;  2XOM A;  4M4P A;  1W03 A;  2NMN A;  4UI9 L;  1GIC A;  2SLI A;  1XC6 A;  2R32 A;  1S0F A;  3LIH A;  3ZLI A;  3AL5 A;  3BOP A;  4E2G A;  1C3H A;  1QJZ A;  4XIO A;  2OYZ A;  1J1L A;  1EY2 A;  4I0A A;  2I07 B;  5AC9 1;  2VMH A;  3K75 B;  4WZF A;  2XGX A;  4AI2 A;  1H4G A;  3HWJ A;  4QU1 A;  5JR2 A;  1ZBE 3;  2DV9 A;  2F6B A;  4AHZ A;  5H9R A;  4AVB A;  1VB2 A;  3ACG A;  4MZU A;  4Q4W 2;  4LKE A;  1SFP A;  3ILF A;  4LUK A;  2SBA A;  2XHK A;  2VZQ A;  4I0W B;  3C7F A;  5ERL A;  4E8C A;  2X29 A;  3WEZ A;  1H8T B;  4YG6 A;  1YO8 A;  5J96 B;  1YI7 A;  5F5I A;  4Q29 A;  4HN1 A;  1X9T A;  3HMY A;  2VVD A;  2XJU A;  3I7D A;  4ZY9 A;  1E5I A;  2PAE A;  2H0B A;  2ZA9 A;  3DV8 A;  4FPE A;  5J36 A;  1NXM A;  2W46 A;  3SHR A;  5GZG A;  3PU8 A;  1AZD A;  3RVH A;  4O61 A;  3WNM A;  2GND A;  2P4E A;  1VRH 1;  4YGD A;  1A8M A;  5FCC A;  5JI9 A;  2VVE A;  4UWD A;  5FZ1 A;  1QU0 A;  3D0J A;  5FY4 A;  2HYK A;  1PK6 A;  2WC2 A;  5C8C B;  4QPG A;  3O0W A;  5A7P A;  4IEW A;  1ZZB A;  4JCK A;  1H8V A;  1CIY A;  4LKF A;  3GYD A;  2GNM A;  4Y1U A;  4HPK B;  3LWC A;  4LBQ A;  2Z2S B;  2ZX4 A;  2VQU A;  2YRO A;  2AEN A;  4P02 B;  2RMU 2;  4WM7 B;  1H9P A;  4CP1 A;  3T0B A;  5JOW A;  1V6L A;  3ATG A;  4IEP A;  2YXS A;  4BXS V;  3ILR A;  4IQP A;  1DF0 A;  4FPG A;  3C7H A;  4GH4 A;  3TAY A;  2GP3 A;  1PGS A;  2DUQ A;  2ZOE B;  4N9H A;  3ON7 A;  3A22 A;  5C4W C;  5K0U C;  5CG9 A;  5CAD A;  1RUN A;  2WYS A;  3UJQ A;  3WNX A;  5AFE A;  3SCF A;  1U12 A;  4ZON A;  4EYU A;  1RMU 2;  4LT5 A;  4MXW B;  4ATE A;  4QQL A;  4HFS A;  1KFU L;  4XFF A;  4LE3 A;  1ZVF A;  2W95 A;  1EP0 A;  2HWE 2;  2XUE A;  5IAT A;  3B9I A;  3O14 A;  3TWI A;  2VZV A;  1OKO A;  2D40 A;  1UIJ A;  2ZEW A;  3ACL A;  3IDB B;  2CGN A;  1UPS A;  3ME2 A;  3KVA A;  2JB8 A;  5DAP A;  5F3C A;  4P9I A;  2ATF A;  5FZD A;  3DPR B;  2OX0 A;  2VUD A;  1YLL A;  2YC0 A;  2FDF A;  4NHX A;  1L3J A;  4FO9 A;  5IHR A;  3I59 B;  2Z69 A;  1EAH 1;  1PK6 C;  4KQ7 A;  4LOT A;  4KMQ A;  3ZFF B;  3OD4 A;  3PLQ A;  3PUA A;  4HKL A;  2D44 A;  1QNY A;  3GF6 A;  1TVG A;  4LO7 A;  2XKP A;  3MPP G;  4LBL A;  3PVB B;  4AI9 A;  1DLC A;  2GN7 A;  3ZKY A;  4CU8 A;  1MAC A;  4NRO A;  3SIS A;  5CIS A;  4TLF A;  1EAH 2;  4HSJ A;  5A7W A;  3ITQ A;  4HOO A;  4UW5 A;  4XF4 A;  4R9C A;  5GAL A;  3VB9 A;  4CU9 A;  4N7U A;  3RYR A;  1XYP A;  3WLU A;  3OEA A;  3F2Z A;  1D0H A;  3JBG 2;  5HXV A;  1K5M B;  3NNG A;  2JDZ A;  4FFI A;  3FUO A;  3H50 A;  5G05 L;  3WF4 A;  2VW0 A;  1UOB A;  1COV 1;  4PQ9 A;  4Q1R A;  5C70 A;  2QDN A;  3SMH A;  1GQP A;  4EWD A;  2C24 A;  4MGZ E;  1NZC A;  2GH2 A;  2ZX3 A;  2D97 A;  3JCI A;  3NJV A;  2QQW A;  4N53 B;  3T2O A;  5T50 A;  3MUY 1;  5BNN C;  4RFT 0;  4CTE A;  5FZA A;  2AYH A;  1NCR C;  3DUI A;  3V56 A;  2F17 A;  4I2O A;  4XW3 A;  2X05 A;  1YEW A;  4B1L A;  1A78 A;  3ZN6 B;  2X5I B;  5B2G B;  4QKN A;  4YRD A;  3WY6 A;  5A7S A;  1W2N A;  3WCR A;  3GBF A;  1BVV A;  4LHK A;  1ND2 B;  2A3W A;  2Z42 A;  2Z79 A;  2CGO A;  2PHL A;  4DXT A;  1AR8 1;  2GC3 A;  3O0V A;  2Q0A A;  1ASJ 3;  4IV3 C;  4OI0 A;  4LBJ A;  3ZDV A;  3U0Z A;  4TN7 A;  3ZXL A;  3ZYI B;  4XQD A;  1UCX A;  4P08 A;  4QPI C;  3EO6 A;  4JZR A;  3OJB A;  4WV8 A;  2VR4 A;  2NLR A;  5FOB B;  5FYS A;  1LGC A;  3NKT A;  1VBB 2;  2VU9 A;  1W0N A;  3KQ4 B;  4OI1 A;  3EQE A;  3VKL A;  3U78 A;  2XLG A;  1ZM1 A;  2EID A;  4AG4 A;  1GYK A;  1ALY A;  3HT2 A;  1W3V A;  2P6C A;  2PLV 2;  3MLJ A;  4UXA A;  4Y1Y A;  5FZH A;  2XHN A;  1WME A;  3E5U A;  1HXS 2;  1YXW A;  1F4H A;  4UT5 A;  4WVV A;  5GLU A;  1GBG A;  3OGR A;  4I02 A;  5T5L A;  2WR9 A;  1PGW 2;  2JKX A;  2YBP A;  4FQ4 A;  2Y0O A;  4BIS A;  4FFG A;  2JDU A;  3GHN A;  3C7G A;  3FBY A;  1MS3 A;  5LEK A;  2VOX A;  3RWN A;  1RUF 2;  4PLM A;  5BXX A;  2GMM A;  1JZ5 A;  4FPH A;  2FDG A;  2FMY A;  3VHR A;  1EAH 3;  1TME 1;  4JGY A;  2ZHN A;  3HQR A;  5DAB A;  3QD6 A;  1MVQ A;  2O14 A;  2WWJ A;  3KSC A;  1BXH A;  1SPP A;  2VUL A;  2VZO A;  4UFI A;  5IWF A;  3WXP A;  2RDS A;  3DL3 A;  4GJZ A;  1HJG A;  4GWI A;  1OMI A;  5F6K A;  1OUR A;  2J22 A;  1VBB 3;  3HNY M;  5FUI A;  4BXF A;  2C4X A;  3KT4 A;  2IZW A;  2OVU A;  3RZL A;  4XFC A;  5A1A A;  1OQ1 A;  3VDD A;  3WZ1 A;  2ZPX A;  4MHR A;  4XFH A;  4KU8 A;  4XXP A;  2HWD 2;  2LTN A;  3VZL A;  1O3T A;  5IW0 A;  5BYN A;  3S7E A;  1O6U A;  2AUY A;  5JZG C;  1NX9 A;  2VOK A;  2Y6K A;  4Y1Z A;  1W6O B;  2BZD A;  1DYO A;  2PHX A;  1Y4W A;  2P37 A;  1GNH A;  4XAC A;  3VLB B;  1LOB A;  2R49 A;  4Y22 B;  5FBZ A;  4QX5 A;  4QPY A;  1EYB A;  2PMW B;  5JOY A;  1JUH A;  1PNF A;  4DO0 A;  4XF3 A;  3AMH A;  1SDD B;  4G4F A;  2AZ5 A;  3W5N A;  4J6G A;  2XML A;  4WM7 C;  1V6M A;  4CEW C;  4LEJ A;  5FZO B;  2ADD A;  1SEF A;  4K3U A;  4XPV A;  1RXG A;  2ET7 A;  2W1Q A;  3MW2 A;  1NCQ A;  3VBR B;  1U5I A;  1Z7S 1;  2P1B A;  1XSQ A;  3GNE A;  3MLK A;  1SBE A;  4H55 A;  4JDN A;  4NMI A;  4X8N A;  5EV7 A;  3ZFE B;  3ZXJ A;  5J1X A;  5DMY A;  3VHO A;  4NPM A;  3EB7 A;  1DZR A;  1Y9Q A;  1US3 A;  3WX5 A;  5SV5 A;  1GKB A;  5EZW A;  3OPT A;  4XMI A;  3O1S A;  4UFK A;  4Y5Z 0;  5FYI A;  4XJW A;  4W6X A;  2R6Q A;  3AZV A;  4N53 A;  5FY8 A;  2QNK A;  4XAE A;  1W39 A;  4Y33 A;  4AQ2 A;  1LOF A;  2R07 2;  2W1W A;  3ZPY A;  1W8F A;  1S0C A;  4TLG A;  4CXY A;  3M3E A;  2ZMN A;  1ZRF A;  4YLZ A;  1UX6 A;  4Z82 A;  4J25 A;  3VBU B;  3WF1 A;  4YYO A;  2P3I A;  2F4L A;  1ZA4 A;  1N3P A;  1PK6 B;  2DCK A;  2JIJ A;  3P5B A;  2YBS A;  2XJT A;  2OQ7 A;  3M3C A;  2ZAA A;  3AP9 A;  1KJR A;  3B69 A;  5C5T A;  1AYN 3;  2EAL A;  5DUX A;  4D6R A;  1QJX 2;  3T1L A;  1RVF 1;  1IKQ A;  1CZV A;  3HQX A;  1AXY A;  1L7L A;  2CV6 A;  2WZE A;  4K8R B;  1NXD 1;  5KR7 A;  3U37 A;  4K20 A;  3I2H A;  3R0R A;  3PUH A;  1HV1 A;  1O8S A;  1YQ2 A;  1GLH A;  4EN8 B;  3TBD A;  5C33 A;  2Q8E A;  2JB4 A;  5FP9 A;  4AR2 A;  2OA2 A;  1VPH A;  2WLQ A;  1W9S A;  2O8O A;  1YFU A;  3T1M A;  4B29 A;  2VCM A;  2WNV C;  4B7K A;  1XND A;  1DZQ A;  1SCS A;  4LBM A;  5GLV A;  4YFW A;  2YU1 A;  2VW2 A;  2WLP A;  3KM5 A;  1FAY A;  1CPM A;  1FPN 1;  4JV4 A;  4GB3 1;  3PNA A;  2OUH A;  2AAC A;  5B4N A;  3LDR A;  1SLI A;  1QIQ A;  4RSU A;  1QXP A;  3NV2 A;  2ZGP A;  2EXK A;  2JDA A;  2C5D A;  3MHZ A;  1W0P A;  4F3J A;  3M8L A;  3S5Q A;  1Y43 B;  1UY2 A;  5HBA A;  1MR5 A;  1GNY A;  2GSY A;  3HNM A;  5KHH A;  1AYN 2;  1JU4 A;  4JGY C;  3UV9 A;  5CKN A;  2TUN A;  2VBD A;  4JX0 A;  2ZGK A;  2CSG A;  1XBF A;  1KXG A;  3K48 A;  2QZ3 A;  3H3U A;  4QHZ A;  4C0H A;  4WBB A;  1S0E A;  5HI0 A;  3RZH A;  1SPP B;  5LY2 A;  4NIH A;  5FXW A;  4QXB A;  5IYY A;  1OQD A;  5A7W B;  2XR4 A;  2HWC 2;  1CJD A;  3VBH A;  1QJU 3;  1ZX5 A;  3LDB A;  4P14 A;  5AVP A;  5FJK A;  3FLP A;  4AF9 A;  1LU2 A;  3KV6 A;  5K8S A;  4P9Y A;  4BLJ A;  3ZYP A;  5IK4 A;  1PIV 2;  3V65 A;  2D5F A;  4FOV A;  3OBZ A;  3AZY A;  4PIX A;  1ND3 C;  4XAB A;  1ZBA 2;  2ZAC A;  3EBR A;  2ETE A;  3BB6 A;  4W65 A;  1US2 A;  2HBU A;  4CEY A;  2BRT A;  3FFZ A;  4MG2 A;  2OII A;  4WM8 A;  3UYJ A;  1QJY 1;  3C7O A;  4FFF A;  3GJA A;  1UW8 A;  1JZ7 A;  2XJS A;  4MET A;  3SEE A;  2OPK A;  1YFW A;  1H6Y A;  1W9Y A;  1RHI 2;  5I91 A;  4AHY A;  2MEV 2;  4MYE A;  2XBO 3;  2BV4 A;  1QJX 3;  1WW7 A;  2RS1 3;  1AR7 2;  1RJ8 A;  3DXU A;  4LUM A;  4O7X A;  2V5Y A;  1POQ A;  1X50 A;  1W0O A;  1PO1 3;  2X10 A;  2ZGR A;  4YWA A;  2X5I A;  4ZXE A;  3W58 A;  4IE4 A;  1IGO A;  2B9V A;  2Y6H A;  1AYM 1;  2VZU A;  2VY0 A;  4UBG A;  3MV0 1;  4HON A;  2P17 A;  2XWJ B;  2P3J A;  3ABZ A;  4JRA A;  4QQO A;  5D2A A;  4FPF A;  2ZTN A;  5J7M A;  2ZGQ A;  4HT1 T;  1DP0 A;  5J3U A;  2EXH A;  2Q5T A;  4Y3O A;  3MIC A;  2WZP P;  5A3U A;  4AK3 A;  4Q8K A;  3M3O A;  3O1R A;  1F35 A;  3ORJ A;  2CWS A;  5AVA A;  3H1M A;  1T6B X;  1SDW A;  1UMZ A;  2DVF A;  3RMX A;  3AKQ A;  3I49 A;  3RS6 A;  5C71 A;  5JZG B;  1UYX A;  3ES4 A;  3KGL A;  5GLW A;  4ZPI A;  4MAD A;  4PF1 A;  2D93 A;  4XCA A;  1S2E A;  1FOD 2;  3KD4 A;  4XZP A;  4IE0 A;  1GZW A;  3UGH A;  1XJA A;  2VMC A;  4QGL A;  3KV5 A;  2FZ1 A;  4QX1 A;  3RI8 A;  4XJU A;  3RYK A;  1D2S A;  1IZ3 A;  2IUW A;  4IEV A;  1Z78 A;  3OUI A;  1JZ4 A;  4UW3 A;  3QCW A;  5DPN A;  2BUK A;  2G9Z A;  2JDH A;  3I3Q A;  1OXC A;  4JDO A;  4COU A;  1VE0 A;  4RR3 A;  3IPV B;  4PBP A;  1IS3 A;  1RUF 1;  3VBS C;  4Y1X A;  5FRA A;  4I30 A;  1K12 A;  4JHT A;  1H4H A;  2VAU A;  3KGZ A;  4LIU A;  4O9E A;  5L9R A;  1RYY A;  4QKF A;  4FPO B;  3VV1 A;  5CBL A;  4G9S B;  1OHF A;  3VUO A;  3LCP A;  4XDO A;  4IXL A;  4AZZ A;  2XXZ A;  1WD4 A;  4QWN A;  3VHN A;  1JI6 A;  1BK0 A;  2YZ4 A;  5FPL A;  2IXH A;  1LOC A;  2ARC A;  2VTX J;  2VZS A;  4QKD A;  1OI6 A;  3ZYF A;  4BQ2 A;  1RUF 3;  3UKV A;  1C8M 2;  3M2M A;  1HRI 2;  2IXK A;  1XYN A;  5T55 A;  3CU7 A;  3ZR5 A;  1W6O A;  1ENR A;  1MQT A;  1NT0 A;  5K9Y A;  4YGE A;  2VTF A;  3WDW A;  1AVB A;  4H2A A;  5BNP B;  2V4A A;  4FXG B;  5E89 A;  4BA6 A;  1IPJ A;  1SLB A;  3IKW A;  2QTW B;  1GWK A;  3O12 A;  2ZGO A;  3QOP A;  4RHV 3;  1LU1 A;  3BVC A;  4WVM B;  3CJX A;  3DGT A;  1KS4 A;  2FHR A;  4ZU4 A;  4CXX A;  1AXZ A;  5JXH A;  3OD0 A;  1XE8 A;  2YC4 A;  3B3Q E;  1UPI A;  4LO6 B;  4BM8 A;  2XBO 2;  1FT9 A;  1OA4 A;  1CAW A;  5FO9 B;  5ACA 3;  1HIX A;  2OQ6 A;  2D98 A;  1V6K A;  1HXS 3;  1LR5 A;  1R09 3;  3H7Y A;  4TYS A;  4MGS A;  4UFH A;  1R1A 1;  1TG7 A;  3ES1 A;  3M70 A;  3FN9 A;  4EN7 B;  3MF9 A;  2CL2 A;  3O1O A;  4CEY B;  5FZ4 A;  5DAW A;  4NHY A;  1VMH A;  1VBD 3;  2XL9 A;  5FYT A;  2VBB A;  3N9P A;  4OFG A;  1MS1 A;  1CR7 A;  2N7G A;  4JDM A;  4BQW A;  3UKN A;  1UWW A;  5C3O A;  3NWK A;  5BNN B;  2GC1 A;  2WNE A;  2QQP A;  5BV6 A;  4QKB A;  4C0B A;  4AHX A;  3VBU A;  1DG6 A;  3H7J A;  4R4X A;  1SFY A;  3VZO A;  1CD3 G;  1WA6 X;  2EXI A;  3DEC A;  3JQX A;  5AFB A;  4JQR A;  5CNA A;  2UY9 A;  3WNN A;  4IEX A;  4CUC A;  1NE4 A;  3LFI A;  1W8U A;  2CGP A;  1VAM A;  3HBK A;  3AXE A;  1FXZ A;  4GMP 0;  4QU2 A;  2EIC A;  4YZ1 A;  4I01 A;  5JXI A;  4BK5 A;  3LFM A;  2A3Y A;  1ULF A;  4FTB A;  3PUS A;  1EV1 2;  3JU9 A;  1HLC A;  2JG8 B;  2WS9 2;  3NO8 A;  4DEV A;  3D3A A;  2DUP A;  4QMA A;  3IDC B;  3O1T A;  3VKF C;  3LKJ A;  1LED A;  1RUJ 2;  1ND3 B;  2IXC A;  4QX2 A;  3TN9 3;  3ROU A;  2JDP A;  1YRZ A;  4HVO A;  2BGC A;  4NID A;  4FFH A;  3KCX A;  4KNC A;  5JZG A;  4LBO A;  4YM0 A;  2Q8D A;  2YGL A;  1JW6 A;  4AE2 A;  3VD5 A;  3ELN A;  5A1L A;  4GKY A;  2BWC A;  4XZU G;  3VBS B;  1CPN A;  2DTY A;  5LBE A;  4AYU A;  4XET A;  2HWD 1;  1OH4 A;  5I0U A;  2YPJ A;  2JEM A;  3MGU A;  2BOI A;  5FYZ A;  4RYD A;  4YZ4 A;  5EXO A;  4HG6 B;  4RGA A;  2XPJ A;  3AKR A;  4N7I A;  4Y24 A;  1J83 A;  3J4U H;  1R1Z A;  4GA9 A;  5H9Q A;  4DNY A;  4D8M A;  3TEX A;  2QCS B;  3SKV A;  1L7R A;  1S4C A;  2KD7 A;  4RR3 B;  2ZHM A;  5A3W A;  2C9K A;  4XUQ A;  3U4S A;  2VOT A;  4UOJ A;  2BPA 2;  5IK8 A;  3LF7 A;  5FZI A;  3CLP A;  3JD7 1;  1S0G A;  3VGI A;  3WDX A;  4XTM A;  2DVG A;  4IGQ A;  2JD9 A;  1EUT A;  1OH3 A;  1QXJ A;  3D5O A;  2WZR 1;  5FKC A;  1XU2 A;  1YWK A;  2QQI A;  4FPK A;  5IK5 A;  4EZH A;  4ONU A;  5CEH A;  3O1M A;  1FNY A;  1GZ9 A;  4Q0U A;  3WNO A;  4B4P A;  2CWM A;  3E5X A;  4ZU5 A;  4A4A A;  3UNP A;  1UZW A;  3CZU A;  5DQ0 A;  2OZJ A;  3OF1 A;  3ZSM A;  4RQP A;  4YGB A;  2MHF A;  1LGN A;  2CNA A;  3LOB A;  4PQQ A;  4KG0 A;  4WM8 B;  4BCU A;  3CDZ B;  1FMD 1;  2VG9 A;  4HMZ A;  2Y6F A;  1FOD 3;  1R08 3;  1MQT B;  3I3M A;  5LA9 A;  3H1W A;  5BNO A;  2Q8C A;  3WD5 A;  4CDU A;  3MO4 A;  1E5S A;  3N7M A;  5BNQ A;  2ZEX A;  1AXK A;  1JN2 P;  1WCU A;  4NRQ A;  4OHV A;  2YDE A;  1RUC 2;  3DYP A;  3OBR A;  3RYP A;  4JC1 A;  1UU4 A;  2XVL A;  4QQH A;  5LA2 A;  5LW9 A;  2TEP A;  1UZV A;  2JX9 A;  3RRD A;  1UZ0 A;  2HH9 A;  2ZX0 A;  1RMU 3;  3RFR A;  3NST A;  1TNF A;  5FZC A;  2D5H A;  4YG3 A;  5ABJ C;  4EE2 A;  1DGW A;  5FJH A;  3VBO C;  3V0B A;  2CAU A;  3BOW A;  3I2D A;  5EHD A;  5JLV A;  1SLA A;  2PFW A;  1TE1 B;  4OUL A;  5HCF A;  1Q8S A;  1WGP A;  4AAP A;  4K1Z A;  2P34 A;  1XNB A;  2BTV C;  2VOW A;  4URT A;  1QKQ A;  1OF3 A;  3PTR B;  1WW4 A;  2VVF A;  2LW8 A;  1HDK A;  1TZO A;  2WT0 A;  4MO3 M;  5BUV A;  1B35 B;  4QB1 A;  3LQC A;  4QGN A;  2BBA A;  4ES8 A;  3PVN A;  5FYY A;  2R06 2;  2RM2 3;  1P8J A;  4IE6 A;  1FPN 3;  1WCS A;  2JDM A;  2XJP A;  5CA6 A;  2R1B A;  1QQP 3;  1DZT A;  4OI4 A;  4QPI A;  4E4S A;  1W2T A;  1HN1 A;  1R09 1;  4MUV A;  3VBU C;  1LOA A;  1GZW B;  2EIB A;  1I5P A;  4COZ A;  4FSJ A;  2VL4 A;  2L9L A;  5CVR A;  3RWK X;  5F2W A;  4P9X A;  3P6B A;  1QJY 3;  2OS2 A;  1W8O A;  2R1D A;  3PJY A;  3RJ2 X;  2VMD A;  3ZFG A;  4CVU A;  4DUX A;  3EHK A;  2RR1 3;  3FLR A;  4YW4 A;  4WVW A;  1Y3T A;  2R0F A;  2ZAB A;  2AEY A;  4HK8 A;  4FPY A;  4AFD A;  4BQ4 A;  3T3Y A;  4DRR A;  3KT7 A;  1FX5 A;  1AUY A;  1R1A 3;  1YJK A;  1MQT C;  3LEI A;  3TEY A;  1HQW A;  4U2A A;  3MLL A;  1DQ4 A;  3AYE A;  1XNT A;  3T2P A;  4DUV A;  4AWD A;  4UFL A;  3III A;  2XQX A;  1LAJ A;  2J1U A;  3U07 A;  1JHJ A;  1W2A X;  4YVW A;  3PL0 A;  2VMG A;  1VBB 1;  1UF2 C;  1AL2 3;  3PUR A;  2A6Y A;  2TNF A;  2VJX A;  3QH7 A;  5FP3 A;  3SH4 A;  1RUG 1;  1MS0 A;  2FCU A;  4CZS A;  1VBE 3;  3H42 B;  2BGO A;  3OYW B;  4RS5 C;  4XFI A;  1HB4 A;  4IEZ A;  3LSE A;  3HT1 A;  3KVB A;  3D0S A;  2W91 A;  5DDJ 2;  4AI0 A;  2H0V A;  2Q1Z B;  3AJY A;  3F95 A;  4FXK B;  4CCD A;  5LRR A;  1DQ6 A;  3CJI A;  3NMB A;  3KLS A;  3ZXK A;  2UWB A;  4XJ9 A;  5F6L B;  2XWB B;  1QOS A;  1OQE A;  4BIF A;  3J7H A;  2RVA A;  4MGT A;  5SV8 A;  2JIG A;  4YVS B;  3W59 A;  1C1L A;  1FV3 A;  1V6N A;  2D6N A;  2ZHK A;  2QFE A;  3GBW A;  5KC5 A;  2K9Z A;  5FP4 A;  1GQH A;  3OPZ A;  1OD3 A;  3MIF A;  4KH9 A;  4XEZ A;  1R08 2;  1C4R A;  5FPU A;  1ODM A;  1GU3 A;  2IXI A;  3D8C A;  5C3S A;  5JIU A;  1BBT 2;  1OBN A;  2D6P A;  4QDQ A;  1VMJ A;  1PNG A;  1TMF 3;  4Y5S A;  1W8W A;  2R04 2;  1C8M 3;  3HAG A;  1JYI A;  3VDB A;  4QPG C;  3INA A;  4QDR A;  1X7N A;  2HWC 3;  2FCV A;  1LKN A;  1C57 A;  1UYY A;  4L97 A;  3U14 A;  2ET1 A;  3ZN4 A;  4Z2W A;  1DHK B;  1GP5 A;  2D3S A;  3FJS A;  2LAL A;  1RXF A;  4RD7 A;  4FPJ A;  3W20 A;  3R4U A;  1UKR A;  3IBM A;  4RS5 A;  5T5O A;  3K4D A;  3WW1 A;  3WOG A;  1ULE A;  2UWA A;  4GB3 2;  4LK7 A;  1W9W A;  3KV4 A;  4L11 A;  2QQO A;  1G9C A;  1UO9 A;  4GWM A;  1S55 A;  5BNO B;  1O5L A;  1Y7B A;  5HCA A;  5C4W A;  3WDT A;  1NA1 C;  1SZB A;  2OT7 A;  3JQW A;  4CSW A;  2J1R A;  3KHC A;  1ZZ8 A;  3ZOI A;  5JSR A;  3J8F 1;  4XC9 A;  3H3Z A;  1E5R A;  5ABJ A;  2DCT A;  5I0D A;  4COW A;  1UD1 A;  4RQP C;  1LEC A;  1CZT A;  1EPZ A;  1RUC 1;  3WNL A;  5JPM B;  4EWE A;  1PX3 A;  5FMD A;  1QJE A;  2DDU A;  1QJX 1;  1QJF A;  4C8D A;  4QD2 A;  2X53 S;  3ZYR A;  4UF0 A;  3QH6 A;  2JG8 A;  3POJ A;  1SCR A;  1JOP A;  1UY1 A;  1T6G C;  5IVJ A;  4Y20 B;  1RUJ 3;  3LPF A;  4LLO A;  4HKW A;  3NNF A;  1W8H A;  2NZ9 A;  3J7M A;  5F7U A;  3B93 A;  1J1T A;  2FD8 A;  4OMD A;  4KWU A;  2HWB 2;  4UW6 A;  3CKH A;  1F5J A;  4ZXK A;  3T09 A;  5A6Y A;  4LHL A;  3DXT A;  1RUG 2;  2XKO A;  5FYM A;  2DCJ A;  1RIR A;  1SFN A;  4M3C E;  5IVY A;  3VBS A;  3PIG A;  3AZZ A;  2A5Z A;  2IVJ A;  4UFJ A;  3ZYG A;  1YUD A;  2XL7 A;  1ZBA 1;  2DVD A;  3AYC A;  3AVS A;  4MV2 A;  4OHZ A;  1LHN A;  4GAZ A;  5F5A A;  3ZR6 A;  2DWR A;  1ZBE 1;  5T5J A;  4OHY A;  2XH6 A;  2VME A;  4AI1 A;  2IFR A;  1KS5 A;  2OUJ A;  1ULC A;  1OLM A;  1MVE A;  1TMF 2;  2JG9 C;  4BPZ A;  4QXC A;  4A7K A;  2QQJ A;  2B8M A;  4UBH A;  1URX A;  1RTV A;  3POW A;  4GKX A;  4HVQ A;  2VXJ A;  4CCN A;  1UYZ A;  3GHM A;  3AP4 A;  4NPR A;  3SEP A;  3LSD A;  5C8C A;  1TMF 1;  4CRQ A;  1O8P A;  4AHW A;  4PI0 A;  5CFC C;  3OUH A;  5F3G A;  2MNG A;  3K51 A;  4DRV A;  2PLV 1;  5GZE A;  3SKJ E;  4DFS A;  5DZE A;  2RS3 1;  2WRA A;  4R9A A;  4RQP B;  5C6C A;  2B39 A;  3OYW A;  4JKM A;  2D3R A;  4QQ2 A;  4X8P A;  4DY3 A;  3B00 A;  2VNV A;  5KHG A;  1W3X A;  2NPI A;  1POV 1;  1XPW A;  2WIN B;  1A34 A;  1OOP B;  2MEV 1;  4AXO A;  2JJ6 A;  5F9T A;  1WLW A;  2FMD A;  2R7E B;  4LNV A;  5FBJ A;  5FQ0 A;  4CDU B;  5HV4 A;  2GN3 A;  1GFF 2;  3ZSL A;  3V64 A;  4EZ4 A;  4YGC A;  4CDW B;  2CY6 A;  1WCD J;  2Y6G A;  2PQS A;  1MZF A;  3OTF A;  1HN0 A;  1QDO A;  4NIG A;  3AZX A;  1RC6 A;  4ITC A;  1WBL A;  1S0I A;  2G4I A;  4MSV A;  1D4M 1;  2D6O X;  4TWT A;  2Z5W A;  4Q4X 2;  4F83 A;  3LB9 A;  2GC2 A;  4KWL A;  5K0U B;  1CGP A;  4BE3 A;  4DPN A;  2VZ3 A;  3POB A;  3BU0 A;  2WBK A;  4ERO A;  4KWK A;  4Q4X 3;  3WG4 A;  4E9K A;  4IGP A;  1NUK A;  1ASJ 1;  2E33 A;  1N1Y A;  2Q1M A;  1UXZ A;  1OLQ A;  3I59 A;  1RUH 2;  1AX0 A;  3THC A;  2JKB A;  3ZFF A;  4N90 A;  3FUQ A;  5ISL A;  4NII A;  3B7M A;  1DQ2 A;  4NHK A;  5IJR A;  1Q43 A;  1TEI A;  1QQP 1;  1XE0 A;  4PJY A;  4NWV A;  1W8N A;  1CAV B;  2ZAH A;  2C1F A;  2JE7 A;  1S0B A;  2P2K A;  4LKD A;  2Y26 A;  1UNB A;  4RGG A;  2DCZ A;  2ARB A;  4Y5T A;  1HX6 A;  2VNO A;  4QPI B;  2CTV A;  4LO5 B;  1W6P B;  1H8T A;  2D3P A;  4NJ4 A;  4YVS C;  4LA2 A;  5LY1 A;  4A6O A;  2E7A A;  5FUP A;  4XF9 A;  1VAV A;  4XHB A;  3WQ7 A;  1BZW A;  3E5Q A;  1V0A A;  3H1Y A;  3U11 A;  1O4Z A;  1XXN A;  1JXN A;  3JD7 2;  1D4V B;  3LE0 A;  1OFN A;  2RR1 2;  2BBV A;  1COV 3;  4U36 A;  5C5U A;  4BYY A;  2YG0 A;  1ZRI A;  4DQA A;  1W90 A;  4HET A;  3SLI A;  3BIW E;  5L9B A;  3M1H A;  1XSR A;  4CU6 A;  3N4M A;  4CDQ B;  3RZM A;  4DIN B;  1K5M C;  2W68 A;  2WUH A;  3AM2 A;  2W1S A;  2HWD 3;  3LDK A;  4AFB A;  4JQT A;  4QPG B;  3T0D A;  1NQD A;  3FL7 A;  3ILN A;  3MFC A;  3ZN6 A;  1DBN A;  1BCX A;  3LZZ A;  3AJZ A;  3HN3 A;  1HB1 A;  1IPK A;  2E51 A;  2WA3 A;  1VBA 1;  4IET A;  5CFD B;  1ND2 A;  3M3Q A;  4I0B A;  2ARX A;  4Q4V 2;  3MPB A;  1S2B A;  1H2M A;  4MGQ A;  1LEN A;  2GZW A;  3I3B A;  4S2G A;  2Y60 A;  3FFQ A;  4QX0 A;  4WM7 A;  4ARX A;  1MPX A;  1UKG A;  3OGJ A;  3TN9 2;  1NCR B;  1UQX A;  1STM A;  1VBA 2;  1WLC A;  2RS5 3;  3HEI A;  3WF2 A;  4DY5 A;  4N9I A;  4NHL A;  4R4Z A;  1CX4 A;  1R64 A;  3AYD A;  3WVJ A;  4UW4 A;  5HV0 A;  1RUO A;  4AVC A;  5HXM A;  2WO2 A;  1G8W A;  2VE1 A;  1OA2 A;  1LTE A;  1FI2 A;  1ND2 C;  3GDB A;  1WZX A;  3WF0 A;  3WHU A;  3MEP A;  2MPF A;  2BGP A;  4C1W A;  4ZZ5 A;  1MS9 A;  3WCS A;  3O0X A;  1N3Q A;  1H30 A;  2ZMK A;  4BH9 A;  3UES A;  2E9Q A;  2WO1 A;  3WHT A;  3FWE A;  2EA7 A;  1G9F A;  1ZRR A;  3E1F 1;  4H7M A;  4BDV B;  3HR9 A;  4LK6 A;  3OBT A;  2B45 X;  2PA7 A;  4IDZ A;  3P3N A;  3L2Y A;  2B46 X;  1HV0 A;  3DPR A;  2O8Q A;  4L99 A;  4QB6 A;  5FZL A;  5A7N A;  2ZHL A;  5FMO L;  1LB2 A;  4RGK A;  3CEW A;  5DZF A;  5FYH A;  1WUV A;  2VW1 A;  3K46 A;  5A6Z A;  4XF1 A;  5A7Q A;  3CO2 A;  3AMM A;  1XB9 A;  1PIV 3;  2DFB A;  1PVX A;  5I0R A;  5JSP A;  1KDK A;  5ANQ A;  3USU B;  1Z7S 3;  5EFU A;  3WQ1 A;  3A0N A;  4W50 A;  1UY4 A;  2WAB A;  5I8Y A;  3BTX A;  1JOB A;  5L7O C;  2RS3 3;  1ZZ6 A;  2XVK A;  3N35 A;  4Q8L A;  2YY1 A;  3ZIW A;  2K2S A;  3N9L A;  1GOG A;  2K46 A;  1KIT A;  1RUG 3;  2EAK A;  2WAO A;  3NNM A;  5JWP A;  4L0P A;  1APN A;  4QHB A;  2W08 A;  3VZN A;  4KG8 A;  3P1I A;  3H8U A;  1QH7 A;  1RUE 2;  4M4R A;  5IVE A;  2A6X A;  5E1R A;  5FZ6 A;  2H6B A;  3T0A A;  5C4W B;  1RUH 3;  3KF3 A;  3IAQ A;  3QAC A;  5LBB A;  4DUW A;  3DKW A;  4FP3 A;  1AYM 2;  1PVC 1;  1CAX B;  1RUD 3;  1GR3 A;  4L9B A;  2R04 3;  2V4V A;  4PBO A;  4XFB A;  5DDJ 1;  1D4M 2;  3K4Z A;  4HZF A;  5FK8 A;  3AL6 A;  1BHG A;  1F4A A;  4Q2F A;  2GNB A;  1MS8 A;  5LBF A;  1F2N A;  4IEU A;  4ASK A;  1DGR N;  5FPA A;  2K0G A;  2YBK A;  3NW4 A;  2E32 A;  2VBP A;  4R9B A;  3ENR A;  2YPD A;  1AR6 1;  4AEJ A;  3Q8A A;  3CBN A;  3WP5 A;  1KGY A;  2RS3 2;  4IUG A;  4M3C A;  5JR7 B;  1M4W A;  1QOT A;  3HIF A;  2A6W A;  2GME A;  4Z8B A;  5JMO A;  2XB6 C;  2DCY A;  1RUE 1;  4JAA A;  4ZS3 A;  5JVV A;  1CAV A;  1MS4 A;  1OFS A;  1ZYB A;  3NKG A;  1KD7 A;  2AH2 A;  3UT0 A;  3ASI A;  4DOU A;  3OSD A;  5L7O A;  1K42 A;  2B42 B;  2BEO A;  5F5Q A;  3SCG A;  4CCM A;  1ULD A;  3C7E A;  4LTA A;  5I93 A;  4Q4V 3;  1QNW A;  2WT1 A;  1F31 A;  1UZZ A;  4NHM A;  4ZKT B;  4F7Z A;  4PF5 A;  2WKK A;  1C5I A;  1ENS A;  4FPC A;  1AR6 3;  4AFA A;  3ZYB A;  1DYK A;  1AX2 A;  2WFF 2;  1CX1 A;  2A7A A;  4NAM A;  3A21 A;  5I0T A;  3BKZ A;  1F8V A;  4KBB A;  1PZ7 A;  5FLH A;  4K6B A;  2Q1F A;  1OVS A;  4AQS A;  1AX1 A;  1I6X A;  3KT1 A;  2HWB 3;  5DUV A;  5H9S A;  1W8T A;  1V9U 1;  3TYJ A;  4DZG A;  4Z2A A;  1M06 G;  1NCQ C;  1NLR A;  5DUU A;  1JZ3 A;  3FHQ A;  3LAG A;  1BMV 1;  4A45 A;  4JGY B;  2UYA A;  1H8T C;  1YQ6 A;  3CZJ A;  4YNI A;  4NRM A;  2X5I C;  1LHU A;  2HEV F;  2OKX A;  3LD8 A;  1UZY A;  2Y8K A;  1CAU A;  4CCE A;  4NRP A;  5CAZ A;  5A80 A;  4MXV A;  3FE5 A;  5FYB A;  2VZT A;  4FP2 A;  1SBD A;  3M4F A;  3FMG A;  4IV3 B;  3H8O A;  5A6X A;  1GOH A;  2FQP A;  1C8M 1;  1CVN A;  1FAT A;  1YIP A;  4AEK A;  5LAT A;  1S0J A;  3AFG A;  4NPL A;  4OCT A;  3ECQ A;  2VMI A;  5DDJ 3;  5T52 A;  5GZD A;  2WFF 3;  3VDD B;  3ZSK A;  4BMB A;  4KI5 M;  1YYN A;  2GNT A;  1RUI 2;  3DYM A;  3J7L A;  3RZZ A;  4N43 B;  1BLZ A;  3KF5 A;  1SAC A;  3LA2 A;  3R6S A;  4GAL A;  4RHV 2;  2WWS A;  3DEM A;  3DCQ A;  4NR1 A;  3LIG A;  1COV 2;  2XQR A;  3OPW A;  1MEC 1;  4HL0 A;  3WG3 A;  4JGZ A;  4Q26 A;  5EP9 A;  3T2T A;  2RHP A;  3AKS A;  3MV1 1;  2I74 A;  2GH8 A;  3A4U A;  2D6K A;  1JYW A;  3L2H A;  3LPG A;  5K0U A;  1J3Q A;  1AR7 1;  5LCW L;  1WMD A;  2PHU A;  3D82 A;  2Y64 A;  1CIW A;  5T5P A;  5GLT A;  1H2L A;  1PO2 1;  1KJL A;  1RED A;  3WQ0 A;  2D6M A;  4YG0 A;  4ASM B;  4EN6 B;  3POE A;  4C90 A;  1E57 A;  4N53 C;  1JUI A;  3K2O A;  4JGZ C;  5CIR A;  1OD5 A;  1SG3 A;  1LOF C;  3NAP B;  4IE7 A;  5FZO A;  2ZKN A;  4DS0 A;  1CON A;  2VO5 A;  5J09 A;  2Y33 A;  4ES9 A;  1ENQ A;  1G86 A;  4M0N A;  1NCQ B;  3VBR A;  5LAS A;  3GZE A;  3JUU A;  2W87 A;  3C8X A;  3OB8 A;  5D21 A;  3MIH A;  1NE6 A;  3VDA A;  3S5A A;  3SH3 A;  3URF A;  1W6P A;  1W99 A;  3D6E A;  1V70 A;  4I09 A;  5FZB A;  2ZGT A;  3ZN5 A;  1OF4 A;  4PI2 A;  4P9G A;  3DPR C;  2VQA A;  1I5Z A;  2W92 A;  3B02 A;  2VTX A;  1RUH 1;  3ACF A;  1BK1 A;  2A75 A;  4AGG A;  4CCK A;  1R08 1;  4CDQ A;  5FR3 A;  2E7Q A;  3LEG A;  2DUO A;  4XIK A;  2X09 A;  5K7P A;  3TEZ A;  1K3I A;  1ULG A;  5FZ3 A;  1OPO A;  1HRI 3;  3PTY A;  1PO1 2;  2HEW F;  2UWC A;  4IV1 A;  4LHN A;  4YZ5 A;  2JXA A;  4P5H A;  2VOV A;  1DGR A;  1IG0 A;  3VZM A;  5FP7 A;  2O0O A;  4M3C B;  3I2F A;  1MZ6 A;  5LWB A;  3WUC A;  2RJK A;  2Q30 A;  3JB4 C;  1BMV 2;  4CA9 A;  1BYH A;  1PO1 1;  2FCT A;  4LBK A;  4XXA A;  3AMN A;  1NY7 2;  2I2S A;  1NCR A;  5CYY A;  2XON A;  4DEQ A;  4EN9 B;  3IN9 A;  2E7T A;  4NIA A;  1QJY 2;  4X6R B;  5JI7 A;  1VRH 2;  5F1R A;  2CDO A;  4XBQ A;  4EWA A;  5A3M A;  1PZ9 A;  3G7D A;  4A3Z A;  2YHJ A;  1XOY A;  4LUL A;  4BU2 A;  4C1X A;  1QJU 1;  1DQ1 A;  4NO4 A;  3ZSJ A;  3POG A;  5D8A B;  5LZ6 A;  5DAV A;  1GNZ A;  1WBF A;  3GGL A;  4K1Y A;  1CWP A;  1W9T A;  4TSV A;  4WVZ A;  2LUW A;  3U75 A;  2DU1 A;  3JZV A;  5A32 A;  5CKM A;  3VD4 A;  1ST8 A;  3NV4 A;  4D7T A;  3GBG A;  1G9A A;  4LJH A;  4XHX A;  3I2J A;  2OZ6 A;  5CFC B;  2Q4S A;  4TXW A;  3C2U A;  3GJB A;  4CEW A;  2WN2 A;  1JYV A;  2UU8 A;  2WN3 A;  1FMD 3;  3USU A;  3ZMO A;  3WQB A;  2BU9 A;  5J48 A;  4K8F A;  1ZBE 2;  4IV1 C;  1LEM A;  5EJZ B;  2D7F A;  2RDQ A;  4LBQ B;  1CAU B;  2TBV A;  3ZDS A;  3RG0 A;  2DBN A;  3U4X A;  4XFA A;  3PMS A;  2ERF A;  3K4A A;  4V1P A;  4W6W A;  2XVG A;  3DF0 A;  4Z1V A;  4Z07 A;  1SHW B;  4W6Y A;  1IQA A;  1YFX A;  2IXJ A;  2GU9 A;  4PHZ A;  5F32 A;  5T3N A;  3SCH A;  4R8H A;  3U10 A;  2C9A A;  2J42 A;  2VQT A;  5GKA C;  3ZYJ B;  1BEV 1;  4S2D A;  3E6C C;  2VGD A;  5LRS A;  5JOZ A;  5JOX A;  1CQ9 A;  4EV0 A;  4BME A;  2PTM A;  1JOD A;  3E6B A;  2Y6J A;  1HRI 1;  4CEY C;  5FPZ A;  1CAX A;  2DFC A;  2FDK A;  1RUI 1;  4JGZ B;  3AX4 A;  3ZFE C;  2W52 A;  4CYD A;  4K7J A;  2JWP A;  1PX4 A;  2Y6L A;  4JTN A;  1QOO A;  1S1A A;  5FZF A;  3KCC A;  3RZK A;  2GC0 A;  4P5Y A;  4TZD A;  1ONA A;  1FMD 2;  1KQR A;  3ACH A;  5FWJ A;  3MW4 A;  2ENR A;  5J37 A;  1NA1 A;  1LOD A;  4D7S A;  2I45 A;  3PVE A;  5FZM A;  1IS6 A;  3LA7 A;  2HJI A;  5IVC A;  3D4K A;  1FV2 A;  3WV6 A;  1ZZ7 A;  4R9D A;  4OUS A;  5L36 A;  3MZH A;  1V9U 3;  1NZI A;  2RMU 3;  3H8X A;  1CAW B;  4G3Y C;  4BLI A;  2J7M A;  3T2Q A;  4QM8 A;  1RUD 2;  5FZG A;  1XRU A;  4MGK E;  2HYX A;  2YMZ A;  1C5H A;  1K5M A;  4H7L A;  4LXL A;  3I2I A;  4LKS A;  3WW2 A;  3ETQ A;  1G7Y A;  2HLE A;  2Y38 A;  5DAQ A;  2YFZ A;  5FXX A;  1FOD 1;  5KBF A;  5JSO A;  1AR9 1;  4YAR A;  1O3S A;  2PEL A;  3WF3 A;  3WUD A;  1PO2 3;  4FVV A;  1HRV 2;  3I8T A;  2DBI A;  4GZ9 A;  1Q8V A;  2CU5 A;  2QKD A;  3WW4 A;  3UGG A;  5BNN A;  4YW6 A;  2JE9 A;  3T08 A;  1I1E A;  4GMP 1;  4QXH A;  2ZZJ A;  4NN0 A;  1QH6 A;  4GXL A;  2H6C A;  3NVC A;  4QB2 A;  4ARY A;  4BOW A;  3TNP B;  1DYP A;  3UJO A;  3VBR C;  2BP6 A;  3VL8 A;  3BIE A;  1R1A 2;  1DLL A;  3MBW A;  2QQN A;  2QQU A;  4HKO A;  4Q0V A;  2LM3 A;  1QHD A;  2QQL A;  2XLA A;  1HW5 A;  2Z4F A;  4LA3 A;  5FMB A;  1ZRD A;  3IPV A;  2WNV A;  4H3W A;  5CU1 A;  4XUT A;  4D6S A;  4NVP A;  5G04 L;  3I4I A;  3Q8F A;  4I3P A;  3ZXA C;  1VBE 2;  5E8A A;  4ZZ8 A;  4P9W A;  1RUE 3;  5FO8 B;  4MGY E;  1LHW A;  1GZT A;  2XG3 A;  2HWF 1;  3KWV A;  3I2G A;  1UOG A;  5A70 A;  2F4P A;  4Y26 A;  4AGR A;  2J1A A;  3HBZ A;  2XJR A;  2WQ8 A;  3C3V A;  2PHF A;  3N3H A;  4Y1V A;  1ENX A;  2PAM A;  2JEC A;  2WDB A;  3I3D A;  2P5B A;  4IL7 A;  5L19 A;  4LMF A;  2AGS A;  1W6N B;  4NWW A;  4QX7 A;  5EIY B;  1KDM A;  2UYB A;  3WNP A;  1EV1 1;  3VBF A;  4YM2 A;  3SXW A;  4F8A A;  4MX3 A;  4N43 A;  4MXW A;  3WW3 A;  3MFA A;  1WMF A;  2VZP A;  2D6L X;  5D8A A;  1VBA 3;  3WSO A;  1REF A;  2HKX A;  4MOA A;  1HB3 A;  2ILM A;  3AC0 A;  4NAO A;  5FMO S;  5I8S A;  2WZR 2;  1PMJ X;  2ZGS A;  1PVC 3;  3IDE A;  1DGW X;  3NQH A;  4KL1 A;  4PLO A;  5HPO A;  3O1P A;  2HWF 2;  4OUM A;  1PM4 A;  1W05 A;  3ALQ A;  4YW3 A;  5F3E A;  5F5C A;  2WQ4 A;  1RVF 2;  2ZJC A;  2AEZ A;  2ZX1 A;  3ZMN A;  2VUJ A;  4Q4Y 2;  2FDI A;  2WSU A;  1DDL A;  1YC6 1;  2R06 3;  3A0K A;  4CEW B;  2C6S A;  1IPS A;  1JOJ A;  2PHR A;  5FP8 A;  5C8W A;  1YHF A;  4Q4Y 3;  3LOI A;  1BBT 1;  3BOD A;  4IEO A;  5JCT A;  2CDP A;  1XNC A;  4Q5O A;  2RDN A;  1VMF A;  3FLT A;  5HCB A;  1LES A;  4AQT A;  4HN0 A;  5F3I A;  1VBC 2;  1A6C A;  3I2K A;  3IZO A;  3ACI A;  1GZC A;  3E97 A;  1BQP A;  4OHX A;  2NN8 A;  4A7Y A;  1D0G A;  1KEX A;  2ZS6 B;  3FC0 A;  4M3C F;  4BQ5 A;  1RGS A;  5KHK A;  3KQR A;  2XJV A;  5FY1 A;  2ID4 A;  1ZZC A;  4XE9 A;  3IMM A;  4MVT A;  3PIJ A;  2ZEY A;  2D43 A;  1JYT A;  2XBO 1;  2JE8 A;  3PUI A;  4JKK A;  4KGQ A;  4A41 A;  3VZK A;  2J1E A;  2QQM A;  1V6J A;  2XLF A;  4OI2 A;  4AAX A;  4B8E A;  1B35 C;  3N9O A;  3PHM A;  3PME A;  1C8N A;  4M00 A;  1BKZ A;  3O1V A;  4Q27 A;  5IVV A;  4A42 A;  3I97 A;  5FPB A;  1NKG A;  3RQ0 A;  1IHM A;  2A1X A;  2HBT A;  2YYO A;  3IMN A;  3CHX A;  2YV8 A;  4Y22 A;  2VUA A;  1DGL A;  3I54 A;  1UIK A;  4XDQ A;  1UOF A;  2VPV A;  4LIT A;  1CJP A;  4OYU A;  4IV1 B;  1D4M 3;  3A23 A;  5FAX A;  1A8D A;  1AL2 1;  2GP5 A;  2O1Q A;  1RUI 3;  3AP5 A;  2CHH A;  1QXR A;  2ZXQ A;  3IB3 A;  1CN1 A;  4BHP A;  1W9F A;  3DYO A;  2FZ2 A;  1DCS A;  2B4K A;  1Z0H A;  3MW3 A;  4XQW A;  3ZFE A;  1PHM A;  3EMR A;  4QQP A;  5DG1 A;  4A2U A;  1L7Q A;  3KCY A;  1IQD C;  3LEM A;  4XBL A;  4YW7 A;  2VCA A;  5EYX A;  1ODN A;  5IVF A;  1KFX L;  3RZJ A;  4RN5 A;  4AQ6 A;  2BFU L;  3GZA A;  1BJQ A;  4UYB A;  3ZXG A;  2ZKL A;  2RJ2 A;  4J1W A;  3EYP A;  1UL9 A;  4D0Q A;  2A71 A;  1NLQ A;  1WMX A;  5DG2 A;  2RS1 1;  1VBD 2;  4PIZ A;  1X9P A;  2V09 A;  3AKT A;  2A73 B;  1OVP A;  1PIV 1;  3KB5 A;  4H14 A;  4YW2 A;  3VKO A;  1V6O A;  1Q56 A;  4D3W A;  2BVV A;  2PHW A;  1H0B A;  4AVV A;  2WL1 A;  1TQ5 A;  1NLS A;  1GQG A;  3LEK A;  4HBN A;  4NE9 A;  3T4V A;  3VD3 A;  1JZ2 A;  4EN0 A;  1KRI A;  3N9Q A;  3ZIX A;  3POY A;  1W2U A;  1LGB A;  4YFZ A;  3KV9 A;  1PM7 A;  4W4Z A;  4QT6 A;  3X29 B;  2V73 A;  3WP4 A;  4D7Y A;  5GJ6 A;  2WSV A;  2BOJ A;  2YFU A;  4LOR A;  4QAW A;  4OMC A;  3UET A;  4CDX A;  1WD3 A;  2E26 A;  2LRP A;  4IES A;  3S6P A;  1WLD A;  1LNS A;  1OPM A;  3FZ3 A;  4HLT A;  3DKQ A;  2IXL A;  1GOF A;  5DAX A;  5IFT A;  1W04 A;  3W9A A;  1RL3 A;  1QMJ A;  3MDP A;  3Q9O A;  1BVP 1;  3M7A A;  4Q4X 1;  5FXV A;  3VBF B;  4AED A;  4E8D A;  3VBO A;  3ETP A;  5IUQ A;  2PAK A;  4P9J A;  2C0Z A;  3AMQ A;  1U5Z A;  3MI8 A;  5F39 A;  5FLJ A;  1YFY A;  3HVD A;  3TNQ A;  3OGV A;  1FPN 2;  1X36 A;  1ZZ9 A;  2WS9 1;  2DVB A;  4HVR A;  4YM1 A;  4EJR A;  5HCH A;  4MLO A;  5FKB A;  4YZ3 A;  4QGM A;  2HWE 3;  3S0M A;  5BNO C;  4QDS A;  2W5F A;  5C9A A;  1O3Q A;  1RHI 1;  3VL9 A;  1NA1 B;  4AL9 A;  3R4D B;  5A3O A;  3NAP C;  4GB3 3;  2FDJ A;  2A70 A;  2DYC A;  4GJY A;  2RJL A;  1AJO A;  3AVR A;  3BU7 A;  3GCW A;  3J7N A;  4NOT A;  1JTZ X;  1UXX X;  5E88 A;  1OA3 A;  1V9U 2;  2BNM A;  3VDC A;  3WP6 A;  3ZXE A;  3BTZ A;  2EIE A;  1UN1 A;  4B1M A;  2KA3 A;  5FZ7 A;  1LUL A;  3VBH B;  2RG4 A;  2WNU B;  4CCL A;  4CXW A;  4MHU A;  2WZ8 A;  2PLV 3;  1RIT A;  4PDW B;  5EPA A;  3CJI C;  1DU3 D;  4O65 A;  1S2K A;  4BQX A;  4Y4R A;  4FOY A;  3THP A;  3IM0 A;  4Q0Q A;  4B4Q A;  2VXR A;  3AB0 A;  3SNM A;  1C1F A;  2JEN A;  1VBC 1;  2WJS A;  1ACC A;  3EJK A;  2VMF A;  2VD7 A;  4XUR A;  4XJA A;  1Y9M A;  5L73 A;  4FTE A;  2A6V A;  3AP7 A; 
#chains in the Genus database with same CATH homology
 2E32 A;  3JXS A;  4QX3 A;  1UWW A;  3K75 B;  1KGY A;  4IUG A;  4TTG A;  5JR2 A;  5JMO A;  3ACG A;  3HJR A;  3DEC A;  2V72 A;  3NRU A;  1K42 A;  3WNN A;  3I3E A;  2VZQ A;  1OT5 A;  3C7F A;  4CUC A;  4E8C A;  3WEZ A;  1K45 A;  4CUB A;  3CQO A;  3C7E A;  2EIC A;  5JXI A;  4BK5 A;  4ZY9 A;  1CX1 A;  3A21 A;  4DEV A;  3D3A A;  2W46 A;  3WNK A;  4QX2 A;  1JZ8 A;  3WNM A;  3OGS A;  4Z2A A;  3VD5 A;  1JZ3 A;  3FHQ A;  3GM8 A;  4A45 A;  4XZU G;  1CIY A;  1H6X A;  2W9X A;  4BJ0 A;  1OH4 A;  3CZJ A;  4RYD A;  2OKX A;  2YC2 A;  4HG6 B;  2Y8K A;  4P02 B;  2VQU A;  5JXG A;  1J83 A;  4OZO A;  3T0B A;  4BXS V;  2VZT A;  4D8M A;  2J1T A;  3SKV A;  1GOH A;  1L7R A;  4OUE A;  3C7H A;  3OEB A;  2KD7 A;  1JYX A;  2C9K A;  4XUQ A;  3A22 A;  3ECQ A;  2VOT A;  4UOJ A;  4KI5 M;  2WYS A;  3DYM A;  3OG2 A;  2JD9 A;  1EUT A;  1NAE A;  2QQI A;  2W95 A;  3NJX A;  3WNO A;  4A4A A;  4DXS A;  3UNP A;  3CZU A;  2VZV A;  3MV1 1;  2ZEW A;  5DQ0 A;  1JYW A;  3LPG A;  4A44 A;  5LCW L;  4GWJ A;  2Y64 A;  4PQQ A;  5IHR A;  3CDZ B;  4KMQ A;  3VD9 A;  1SG3 A;  1JZ6 A;  1TVG A;  4CU8 A;  1DLC A;  2VO5 A;  3MO4 A;  2QBX A;  2ZEX A;  3DYP A;  2W87 A;  3C8X A;  5LA2 A;  3THD A;  4CU9 A;  3OB8 A;  3OEA A;  3F2Z A;  3VDA A;  1UZ0 A;  1W99 A;  3NNG A;  1OF4 A;  4PT6 A;  5G05 L;  3WF4 A;  1UMH A;  2W92 A;  5C70 A;  1GQP A;  1T2X A;  1UX7 A;  3ACF A;  3NJV A;  3T2O A;  1OF3 A;  3MUY 1;  3LEG A;  2X09 A;  2LW8 A;  1K3I A;  3HNB M;  4MO3 M;  4QB1 A;  1ULP A;  3LQC A;  2BBA A;  2X05 A;  1P8J A;  2W47 A;  1HN1 A;  2EIB A;  1I5P A;  3I2F A;  2VL4 A;  2L9L A;  4DXT A;  2V5D A;  3P6B A;  1W8O A;  4DUX A;  2VMD A;  2WAA A;  4P08 A;  5CYY A;  2XON A;  4DEQ A;  2VR4 A;  3LEI A;  1W0N A;  2CDO A;  3T2P A;  1XNT A;  4AG4 A;  4A3Z A;  2EID A;  4DUV A;  3III A;  2XQX A;  2J1U A;  1JHJ A;  2XHN A;  4LHS A;  3GGL A;  1JYN A;  1F4H A;  1W9T A;  3OGR A;  4XUN A;  2VJX A;  2JKX A;  4FI9 A;  3MUZ 1;  2BGO A;  3VD4 A;  1UMI A;  1GUI A;  3C7G A;  3I2J A;  2W91 A;  4TXW A;  1JZ5 A;  2WN2 A;  1JYV A;  2WN3 A;  3WQB A;  1UY3 A;  2RVA A;  3J7H A;  5EJZ B;  2VZO A;  3BN6 A;  2W1U A;  4GWI A;  3K4A A;  5FUI A;  2J22 A;  3HNY M;  1OD3 A;  2C4X A;  4YPJ A;  1SHW B;  5A1A A;  1GU3 A;  2VQT A;  2VZ1 A;  4QDQ A;  1ULO A;  2Y6J A;  2BER A;  4BK4 A;  3VDB A;  1NX9 A;  4QDR A;  2Y6K A;  2BZD A;  2VZR A;  4UAP A;  1UYY A;  4LPL A;  1DYO A;  5JXJ A;  2Y6L A;  1PX4 A;  5EJ1 B;  4P5Y A;  3ACH A;  3K4D A;  3BGA A;  1SDD B;  3W5N A;  1W9W A;  2J1S A;  2QQO A;  5B4X A;  2W1Q A;  2J1R A;  2J7M A;  3T2Q A;  2HYX A;  5J1X A;  1CZS A;  5DMY A;  5I0D A;  3EB7 A;  1CZT A;  3I2I A;  1US3 A;  4LKS A;  3WNL A;  1PX3 A;  2DDU A;  4CU7 A;  2HLE A;  2YFZ A;  3HOB A;  1JU3 A;  1PMH X;  3WF3 A;  1UY1 A;  3LPF A;  4GZ9 A;  2W1W A;  5F7U A;  3K77 A;  3T08 A;  4OMD A;  4KWU A;  2YB7 A;  4QB2 A;  3CKH A;  3WF1 A;  4ARY A;  3MBW A;  2DCK A;  3T09 A;  5LA1 A;  2QQN A;  4CVU A;  2QQL A;  2VCC A;  2Z4F A;  2DCJ A;  4XUT A;  5G04 L;  1CZV A;  2WZE A;  4ZZ8 A;  3U37 A;  2C26 A;  3I2H A;  3PUH A;  4DXR A;  3I2G A;  1O8S A;  1YQ2 A;  2J1A A;  2VME A;  2WQ8 A;  4JHZ A;  2WDB A;  1W9S A;  3I3D A;  2QQJ A;  5EIY B;  3WNP A;  1UYZ A;  3SEP A;  2VZP A;  1O8P A;  3OBA A;  3WSO A;  4MOA A;  5B4N A;  3AC0 A;  1PMJ X;  3NQH A;  3SKJ E;  5HPO A;  2JDA A;  2RV9 A;  4XUP A;  3HPN A;  1UY2 A;  4JKM A;  1GNY A;  3HNM A;  3IAP A;  1JU4 A;  4XUO A;  1XNA A;  4JX0 A;  1XPW A;  2ORX A;  1J84 A;  2R7E B;  2CDP A;  2J1V A;  1EUU A;  2W94 A;  5IYY A;  3I2K A;  2Y6G A;  2PQS A;  3ACI A;  4CUA A;  1KEX A;  4P00 B;  2ID4 A;  5LA0 A;  1UY0 A;  2ZEY A;  2VZ3 A;  1US2 A;  3VD7 A;  2WBK A;  2JE8 A;  3PUI A;  4JKK A;  2ORZ A;  4A41 A;  2J1E A;  2QQM A;  1NUK A;  2E33 A;  4AAX A;  1UXZ A;  3C7O A;  3THC A;  4A42 A;  1JZ7 A;  3SEE A;  3I97 A;  1H6Y A;  5IJR A;  1NKG A;  2VCB A;  1WCQ A;  1W8N A;  3IDA A;  2X10 A;  4OYU A;  4ZXE A;  3A23 A;  3CIH A;  2B9V A;  2Y6H A;  2VZU A;  4A6O A;  3MV0 1;  4W8J A;  3ABZ A;  2ZXQ A;  3LE0 A;  3IB3 A;  3DYO A;  1DP0 A;  2QQK A;  2B4K A;  2YG0 A;  4CU6 A;  1L7Q A;  1IQD C;  3FHA A;  3GXU A;  2VCA A;  2WUH A;  2W1S A;  4RN5 A;  5DN2 A;  3A7Q A;  2LS6 A;  2RJ2 A;  5C71 A;  3T0D A;  1UYX A;  3EYP A;  4D0Q A;  3FL7 A;  4MAD A;  4PF1 A;  3HN3 A;  4QX1 A;  2VMC A;  4QPW A;  4MGQ A;  1O59 A;  3I3B A;  4QX0 A;  1JZ4 A;  4ARX A;  1MPX A;  5DPN A;  3HEI A;  3WF2 A;  3ZM8 A;  3LEK A;  1GMM A;  1R64 A;  3VD3 A;  1JZ2 A;  5HXM A;  2WO2 A;  1K12 A;  3GDB A;  4ET7 A;  4W4Z A;  3WF0 A;  2E31 A;  2BGP A;  4ZZ5 A;  2YFU A;  1RYY A;  4QAW A;  3UET A;  4OMC A;  4LQR A;  2E26 A;  3UES A;  1LNS A;  2WO1 A;  3E1F 1;  4BDV B;  1GOF A;  4JKL A;  5IFT A;  5IFP A;  1JI6 A;  4E8D A;  4QB6 A;  2VZS A;  3ETP A;  3W5M A;  3K46 A;  5C7G A;  2VC9 A;  3OGV A;  2VTF A;  2W3J A;  2ZEZ A;  4W50 A;  1UY4 A;  2WAB A;  5CZK A;  4QDS A;  2W5F A;  5JUV A;  1GOG A;  2WAO A;  4XVH A;  4L0P A;  2VM9 A;  5JXH A;  3P1I A;  2YC4 A;  1UXX X;  3CMG A;  4M4R A;  2WO3 A;  3VDC A;  3T0A A;  1WKY A;  1D7P M;  2EIE A;  3IAQ A;  4DUW A;  2WZ8 A;  2V4V A;  4MGS A;  1TG7 A;  3K4Z A;  3FN9 A;  1BHG A;  1F4A A;  2XOM A;  4M4P A;  4UI9 L;  2VMF A;  1XC6 A;  4XUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...