1WA1X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Reductase
total genus 94
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X02
1TEGA 2BP8B 2DWSA 1AS8A 2J56A 2FJSA 2LLNA 2IDSA 4A66A 1OE2A 4BXSV 2DV6A 3GYRA 1WS8A 2EIMB 3AZUA 2MTAA 5AZUA 3FQYA 3FYEB 4P5SA 2MRYA 1PNDA 5FC9A 3FU8A 4L0PB 2CUAA 2GB2A 1E5ZA 4WTQA 3GDCA 5F7AA 3X1EA 2VW7A 3FPYA 4YL4A 2FWLB 1BXVA 2ZONA 2PP9A 3JTBA 2CALA 1AS6A 1NIEA 1SFHA 3BVDB 1NIDA 1E5YA 1QNIA 1JZHA 1BQ5A 3L45A 4BWUA 4HZ1A 3T6XA 4YSSA 1X9RA 1HAUA 3HB3B 5AKRA 1MZYA 4DP5X 4HCFA 2H3XC 4E9VA 4A68A 1GS6X 2FT8A 1A4AA 1YLBB 4GXFA 1AG6A 2DYRB 3IBOA 4AKPA 2AFNA 2YAHA 5D4IA 1JXGA 2IAAC 3OMNB 2FNWA 1SHXA 2YAMA 1ASOA 1AQ8A 2PCFA 4YVUA 4YSOA 1AOZA 3ERXA 1N68A 4G70B 3OM3B 1JVOA 3EH5B 3S8FB 1J5CA 1OV8A 4NAJA 4UANA 1EHKB 1XB3A 3N55A 3FT0A 3NSFA 4N4YB 1SF5A 8PAZA 3S3BB 3D12B 3CVDA 1GW0A 3NP3A 2GIMA 1CYWA 2WO3B 1A3ZA 2EINB 4QLWA 1ADWA 2R7EB 3FSAA 1E67A 4GP4B 2HX9A 4N8UA 3RYMA 4AKOA 4YSAA 3NJHA 1ILUA 2PPCA 1JOIA 1ZIBA 2XXFA 4M3HA 1ETJA 4KNSA 7PAZA 4ENZA 3X1BA 1AR1B 1PMYA 1ASQA 1PF3A 2BP0A 2FQGA 4NB7A 2VSMB 3PAUA 2AVFA 1GS8A 2BWDA 2BWIA 1CURA 3UADA 4Q8BA 3NJJA 4YSPA 1OOWA 2BZCA 1QLEB 2TSBA 3UAEA 2AANA 1OCCB 1N70A 1PY0A 4AI7A 3TASA 4BDVA 1URIA 4DP7X 3FU7B 1M56B 3QJQB 2PPEA 1ID2A 1CYXA 2E86A 1RKRA 2EIKB 4FA7B 1F56A 4YSDA 1AZNA 2OV0A 3T6WA 1QHQA 3EF4A 3G5WA 4QKTA 4K9JA 3QJTB 2YAPA 2XX1A 3PLYA 4G7SB 2P80D 1BQKA 4WKXA 1ET7A 2J5WA 2OJ1A 2BP8A 4E9TA 2FT6A 2GBAA 1ZIAA 4HHGA 4AX3A 5I6NA 3OMAB 3SQRA 3PCYA 4GY4A 1OF0A 3C75A 1XB6A 2FQFA 3V9EA 2NRDA 1AS7A 1JERA 2YAEA 1EZLA 2PPDA 3OD3A 1FA4A 2DWTA 5B7MA 1NWPA 1TU2A 3QJSB 3NSCA 1OE1A 2H5UA 1A4CA 2DYSB 1PZAA 3ASNB 4KO7A 4F7KA 1T5KA 2J55A 2VSKB 1MG2C 3FPXA 3MBWB 3NJKA 1BYOA 2IDFA 2ZOOA 2HZHA 4BK5C 1ZV2A 1MG3C 4YSCA 2B3IA 1RCYA 3TA4D 3SBRA 2XX0A 2HLEB 2IWFA 1ET5A 3KW7A 1IBYA 3CVBA 2YAOA 4G7RB 4YSEA 3H56A 1I53A 1IC0A 3ABGA 1RZPA 2BW4A 3WI9A 1E30A 2QDVA 1GR7A 1A65A 1KBVA 4CSZA 4A67A 2ZXWB 2XV0A 2YXWA 2DY2A 2HRGA 4Q89A 4DP6X 1WA2X 1BAWA 3FSZA 5EHFA 2VMJA 5ANHA 1NICA 1MZZA 2GC7C 5I5MA 2UX6A 3AY2A 5B1KA 2JXMA 2EIJB 1ET8A 1JVLA 1PNCA 3QPKA 1L9OA 3DKHA 2FTAA 3CDZB 4BWTA 5B1JC 1NTDA 3PPSA 1PAZA 1J9RA 5I6PA 4JHVA 5AFAA 2XYBA 3CVCA 2Y1AA 1ZDQA 1JZFA 3UGEA 4KO9A 2R7EA 2PP8A 4E9RA 1J9TA 1E65A 9PCYA 2XV3A 1PLCA 2J57A 2IDUA 3ABLB 5LDUA 3S3DB 2ZWNA 2XXGA 3FSWA 4AZUA 1CUOA 1R1CA 2PPFA 3ZIYA 3PAVA 1IKOP 1JZGA 3NSYA 4KO5A 3UAAA 4DPBX 2BZ7A 2I85A 2UXFA 5A7EA 1AZBA 3X1FA 3WIAA 1AACA 2AZAA 2GSMB 2VM3A 3IN2A 3QJVB 1NIBA 2OCCB 4KNUA 1RZQA 4DP4X 5I26A 3N2JA 1SNRA 3ZX1A 1PCSA 1NIFA 4JHUA 4W1TA 4G7QB 1KCBA 3ABKB 2HRHA 4HCIA 1KCWA 4DP2X 1AANA 1NZRA 1TKWA 2H47C 3CZUB 3FU7A 1KDIA 5F7BA 5I28A 1SJMA 1SDDB 4E9SA 1SF3A 2QDWA 4E9QA 3WNIA 3ZDWA 1W8EA 5D4HA 3SBPA 5D4JA 5I6MA 2B08A 1V55B 2TSAA 3FU9A 5B3SB 4UF7C 3FQ1A 2YQBA 1BQRA 2QPDB 3UABA 1GYCA 2IWEA 2XU9A 1IBZA 2UXTA 4DPAX 5I5JA 6PCYA 4RH4A 1PLAA 2QT6A 3FS9A 2FQEA 4HHWA 3X1NA 3TBBA 1HFUA 1BYPA 3WKPA 4AKQA 2WSDA 2RACA 1J9SA 1GY2A 3NJFA 5B1JA 2CBPA 2W88A 2Y69B 1GSKA 3NT0A 3CG8A 1OCRB 1L9QA 3SBQA 2GHZA 3UACA 4E9WA 4CSPA 2P80A 3KW8A 3NJGA 2UXVA 2PP7A 4YSUA 3EH4B 1A4BA 1AZCA 2CCWA 1KYAA 2A3TA 2FT7A 1FWXA 4A2DA 2X88A 1W6LA 1GY1A 3WKQA 3IE9A 1JZEA 3PAZA 5E9NA 4NERA 4W9ZA 4F2FA 3QJUB 2VN3A 2XUWA 2PPAA 3GXUB 7PCYA 4HALA 2Q9OA 3T9WA 5TK2A 3QJRB 2GI0A 1V54B 5B1BB 4JKNA 1J9QA 3TBCA 3NSDA 1KV7A 3OQRA 2UX7A 4P5RA 3WNJA 2BO0A 3HEIB 3OMIB 5B1AB 5I6OA 1W6WA 1OCZB 2XLLA 1NPJA 2HX8A 4DP0X 3CDZA 2JFCA 3FSVA 4FAAB 2Q5BA 1L9TA 4KNTA 1PZBA 2X87A 1AZUA 4GP8B 2IWKA 4KOCA 4YSRA 4G71B 3TU6A 2YXVA 2IH9A 1AZRA 1BEXA 3NJNA 2CJ3A 3H4HA 3AG2B 5IY5B 3WG7B 4ZK8A 2HXAA 1V10A 3NYKA 1WA0X 3S8GB 1IUZA 2VW4A 3EHBB 4DP8X 4G72B 1M57B 1WA1X 2W8CA 5B7EA 1L9PA 3X1GA 1JZJA 1WAEA 1XMEB 3NJIA 3T71A 3T6ZA 2I7SA 2IDTA 2XVBA 4YSQA 1GS7A 4A2FA 1B3IA 1MDAA 1OCOB 3X2QB 4DPCX 5I6LA 4E9YA 4BWWA 4TXVB 1BXUA 2VM4A 2BHFA 3AG3B 4HIPA 1OE3A 3ASOB 3T6VA 3NJMA 1KGYE 4DP9X 3ZBMA 2UXGA 3ABMB 1CC3A 3AW5A 1WS7A 4DP1X 4PCYA 5TK4A 4YVNA 5I5IA 1NIAA 2IDQA 4A2EA 1VLXA 2EILB 2YAFA 1KBWA 1SDDA 1KDJA 1NWOA 4BXVA 1PLBA 1SFDA 1UATA 4E9XA 3DTUB 1ZPUA 1NDTA 3FYIB 3MX0B 3AG1B 4HCGA 5I6KA 1XB8A 5B7FA 3NP4A 4X4KA 1M9WA 3U25A 2JKWA 2CAKA 1X9UA 2PLTA 5PAZA 1ASPA 3EH3B 4GP5B 1SHWA 1ZDSA 4UAHA 3IN0A 1DZ0A 1TEFA 5PCYA 2IH8A 4HAKA 3V9CA 2I7OA 2GC4C 2WO2B 3IEAA 2BP0B 4A2GA 1A8ZA 4GYBA 4YSTA 3AG4B 1JXFA 4PAZA 4KO6A 2XV2A 2VW6A 1FFTB 1NPNA 3JT2A 4A2HA 6PAZA 1AAJA 3QQXA 1AG0A 4M4RB 2BW5A 3BQVA 1NINA 3NJLA 2YAQA 2XWZA 1AIZA 1JZIA 2PCYA 3FQ2A 3DIVA 4BDVB 2AZUA 1J5DA 1ILSA 2N0MA 1HAWA 4KOBA 1L9SA 2HX7A 1L9RA 2FQDA 2YARA 1BXAA 1DYZA 4F2EA 3PXLA 4EF3A 2QPEB 3S3CB 1JXDA 3H4FA 4MFHA 1PZCA
chains in the Genus database with same CATH superfamily
2AGJH 3CC5B 3CLEL 4YHLL 3HZMA 1N0LB 3QDJA 2YEZB 3A5VA 5FM5M 4ZS7H 2W38A 1G1KA 1HXMA 3MR9A 4GSDL 3OKNB 3VM7A 4M6NL 3B7RL 4GW4B 4AQEA 2LW3A 4PLJC 5F0JB 3I6KA 5I8KH 4ONFL 4OKDA 4YIQB 5AWNL 5J11B 5GS1B 2R2EB 4ES9A 3RKDC 3KNBB 4TQ8A 5D2NE 3UBXG 3RZCC 1CQYA 2A9MH 1JPTH 1INQB 3SJVD 4Z3HA 2OMXA 2P4AB 1TUPA 3CXDL 1IBBA 4HWUA 3JTBA 2W95A 3QYMA 4XCFH 5GHWL 3WIIH 2AK1H 1E5YA 4CJ0A 4HFWA 3T6XA 2X4UA 2NR6C 1D5RA 3FH7A 4HLZH 4K71C 3R18A 4GUPA 4R7VA 3X11B 1U8NA 4CNIA 3IT8D 5LAXB 3K6DA 3PQYE 5G55A 2FT8A 4QPEA 5B4MD 1A1MA 4LLQB 3H9SE 4JG5A 5EU3B 4QHNA 3T3MB 3OAWA 3UXFA 2WLIA 2F68X 3W9EA 2DBLL 1BVOA 2JJSC 5I1AA 3GTVA 5DC2A 2QV4A 5SWZA 2XQBL 3JVGC 3TO4A 1NLBH 3NGBC 3MUHL 1L0YA 1BGXH 5ECJE 1OAZL 4XP1L 3NEEA 4MNGE 3ZRFC 4PGDB 1I7ZB 5HHXH 1JI1A 1KULA 3WO4C 3MLSL 5F2FA 3TA3A 1EHKB 2Y25A 3GXTA 1VEPA 4U1GC 1G7IA 1XH0A 2AMUA 4IBQA 5J6HA 3R19A 1DCEA 3DDGA 4PRIB 2DIBA 5DGQA 2O5ZL 3DGDA 3IXTA 3NP3A 1SVCP 4AVHA 3PS6A 3MODH 2VZUA 5EOCJ 2VERN 4FMVA 2NY0D 1GAFL 5B8CC 4PJ8D 3O3DA 4JFEE 3EBHA 4RMRA 2I24N 3KVQA 5SV3A 4KI5C 2BOCB 5LBSA 2EEBA 2DQJH 2VDPH 4ZTPH 1VPOL 4XN7A 3R0MA 1H5BA 3GUTB 2WXFA 4JFYA 3T04D 3BGAA 1YSOA 3WXWL 2YJQA 4K94H 1RUKL 4XO8A 2EH7H 1NC4D 2YC1A 1E0OB 1BDYA 1YDPA 4JFOB 4K23L 5BXFA 5TE6H 1D5ZA 1DJYA 1KTDB 3MROB 3QO1A 4FHKA 4R26H 5CIPB 5FV1L 2WZ5A 5KZCB 1AGDA 4CSTA 1YNLL 1FL3B 3O2VH 3U9WA 2VQ1A 4M1DH 2VABB 3HCVA 4CBZA 3SPVA 3DURA 4ZS6D 3UPAA 4MXQD 3GSQA 4G6FB 5IR1A 1X7QA 2YRZA 5HI5D 4E2OA 2D2CC 3A6BL 4H5SB 1FO0A 2EDJA 3F7VB 1C08B 1PD1A 1MIEH 3BPNC 2WNXA 2YUXA 5IOKA 5DR5H 3M46A 4G7YL 3ARFC 4AQAA 3D39B 4J3BA 3VNYA 1HESA 2JJUA 2WVVA 4X98A 1XCTB 2ZSWB 3IJYB 2NQDA 3DK0A 5C08D 3RILA 4RX4D 3LSOB 4GS7B 5EOCH 4XMTA 2HVJA 4ZFOA 3FU5A 3ZMNA 5ALBL 3TZVC 4BSJA 2XPGB 4JFDD 5T1KA 3VGGA 3NSCA 1BEYL 1U2HA 5C0RH 3C87A 1VHPA 1QFUL 4F7MA 2Q8AH 4OJFL 4WO4B 2CGRH 5JIKA 5TE7L 4I3SL 3WFBH 1HQ4A 2BIQA 4MA1B 1KY7A 2WOYA 3VXUD 4UIKL 2Z31D 2MKWA 1E27A 3VXPB 5AVZB 5LG1A 3CFKB 2AEQH 1PZDA 1DBKL 3NN8A 4G11A 3FN3A 4M03A 2DQIH 3QDGE 1IC0A 3QORD 4LSQL 1NAMA 1P7QD 4J3OH 1Z9LA 1CDIA 1IFRA 3IFNL 3LIZL 4RFNC 1RJYB 5IMLA 25C8L 2XN9A 5E1AB 1S9VB 2UYLB 3HMXL 3REWB 1NCTA 4V1DD 4NOBA 2FWOB 4WCYH 5DA4A 4NNPH 3L3HB 3ZE0F 1XGQA 5KVGE 2PYFA 2E59A 4LSRL 3PL6D 1MZZA 4PHZA 5I5MA 3A4DA 1CI5A 4OUUB 3F7PC 2WW8A 1Q9OB 2D0GA 3Q3GB 4OCWL 1XR8A 1KV3A 2HH0L 5ACMA 4U1SA 3HAEA 2FTAA 4UB0L 2WCSA 3B1TA 4GUCA 1JZ7A 1P7KA 2FCBA 2X53A 1IM9A 1HH9B 4FNQA 4PJ7A 4TUJB 1NCBL 4HV8A 3HZ3A 2XZQH 3ZSTA 5BNXD 1ZDQA 3E80A 2WWKT 1MKFA 1U58B 5F1OB 2PP8A 2W9LA 1NOFA 1E65A 5EC2A 5HVHB 5I73B 1D5MA 4EN2A 4MRBA 5FUOH 3MYZA 1XFPA 3D2UD 4PRPD 5K9OA 2W9EH 3V4UL 3BVNB 5DYOA 1AC0A 3NRQA 2BY1A 5EEXA 1Z9OA 2VSCA 4I1NB 1R5VB 4IW4C 3JV4A 4KO5A 4XNYL 2UXFA 1QTPA 1CXLA 3C60D 3WLBA 2NNXA 4D9QE 4ADJA 1AP2B 4CVXB 4ODWA 2MCAA 2NY6D 4P5TB 5KUKA 5FYJE 3VRIB 1SNRA 2JWYA 2HJFA 1KIQB 4XR8C 1I8MA 1TETL 5IQLA 1T83A 2Q2LA 3AY4C 3IFPB 4Z3GA 5D1ZC 3S2CA 3SO3B 3P9WB 3ZOAA 4BFIA 4K3EH 3QUMH 4TNVF 4U33A 2WTRA 1D6EB 1UXSB 3NAAL 3VJ6B 5CEXB 4ZTOL 3CLEH 4YHLH 1HSAA 2NUTB 1JK9B 5EU6B 5KSAD 4GSDH 1BV8A 4MQ7A 2X0UA 2DJMA 2DLIA 5FA4A 2IBZY 5HJ3B 5HHPA 1L0XA 3ATDA 4K3JL 5JPMA 2Z4QA 2VJXA 4ONFH 4AGNA 2RIKA 2JCCB 5AWNH 2ATPA 3O6FA 3WFDL 4NUGL 4WTXA 1F4XL 5D6CB 1XGYH 4KJQC 2V8MA 3RA7L 3BI9X 3RTQB 3K2IA 3GMNA 1ES0B 1HQRB 1IAIM 1ZS8B 3CXDH 2ADJA 1CXHA 4ZMWA 3NPZB 4H0LC 1P4UA 3SE3A 2Q2EB 2FE0A 4XNAA 5AAMA 5GS2D 3IETA 1EH9A 3KLAA 2P45B 1NJ9A 3OJDA 3P2TA 1I3GL 1DQVA 2HT3C 4ONHA 5E56A 5DZPA 3KPNB 3T8MA 4XVJL 5H2BA 2QQQA 1OCRB 3RX5A 3VG9C 4B0MB 3QH3B 3N50A 5AL0A 3CFBA 4PMEA 1BREA 2A74B 2DBLH 1AZCA 2CCWA 5B3NA 5KAQF 3STZA 4GB9A 2XJLA 3BFWA 1KEGL 2HLAB 3QNYA 1SLWA 5EN2A 3D85A 1M71A 4HSQA 2QKIB 3HC0A 2R2HB 4IJ3C 1OAZH 2WAQA 3UAJC 2YUVA 2VDLB 1WT5C 4A7GA 4EJ1C 4MJ6A 3X12B 4QRPE 2DQUH 2UWEA 1TZIB 3MLSH 4HALA 3FCSA 4M61A 1EWHA 2A6KA 4PW9A 3H3PL 4MS8C 3UMTA 3HA0A 3N1FC 2O5ZH 1ICTA 2XNAA 3OR6A 3AWEA 3QUZA 3Q9QA 5HI3C 1GAFH 3OMIB 1R3IL 3AU1A 2W1NA 5AVQB 2ESVA 3QUYB 3SOBH 1RJZA 4X9YA 3U4AA 3V4VL 1JD7A 3GXFA 1EO5A 2WLNA 3MREA 3HPLB 4POZC 4AIOA 1GGBL 2X09A 2DICA 5AVRB 2X87A 4GAFB 3WXWH 1OCWL 4IBLT 2OTWB 1CFQA 4K23H 2CJ3A 4LF3B 4OZGF 1FYTD 2R0WL 5GJTL 5LUMA 3WHE0 4X6BB 3ARDA 4Q0XL 4A7SA 4AGPA 5ESVA 4DZ8B 3S8GB 2GJZA 3EHBB 3SDYH 4QTHB 2ICWB 3AM8A 1SXSA 2FIRT 1CK0L 2I32A 1CFSB 2X9YA 1WO2A 1WAEA 2OYPA 5ETUB 2IDTA 2WVSA 1OHQA 2XY1A 4GRMB 1J9CT 3KL0A 4A2FA 3MV8E 4F1SA 3VXQB 3QQ3B 2XWRA 4YN3A 3BKML 5C0AE 4HZLB 2EUWA 4DPCX 1AQHA 5CSZB 3A6BH 1BXUA 4HIHA 2A6JA 2V3FA 4MD4B 3ASOB 3T6VA 5DJDB 4DP9X 1K2DA 1N64L 1NCGA 2XG5A 3JQOB 3CHOA 1WS7A 1A2YB 3ZL2A 2VXTL 1VFBA 2WN2A 3R4DA 3FTSA 4G7YH 4O2CA 4XNQB 3VXTA 3RIAK 4P46D 4NOFA 4L5FL 1SFDA 4PB0H 3U0PA 4PSRA 4N3TA 4C56A 4LCWD 2GCYB 3F8UB 3MX0B 5ABAA 4APQD 5A2JH 3TF4A 5B7FA 2A73A 3SYPA 3TEXA 2V9TA 4XCYB 3AT8A 4IU3A 5ALBH 4NRYB 2Z6FA 1LE5A 2A0LC 1WAPA 4B7LA 5J6GB 4TLUA 2CLZB 4GP5B 4MMXA 2QR0B 2WZAA 4YEEA 3UTZA 2E47A 4FZEL 4Z95L 1N5AB 4JM2B 1DZ0A 3JV5A 3T4YB 3FF8A 1QFUH 2DD8H 3BYYA 3CVHL 3UTPD 2XC8A 1IX2A 2NZ1A 1BLNB 1Q9WA 2BVYA 2YRLA 3QBTB 1T0OA 2GC4C 4I3SH 5TE7H 3WV0A 3RQ3A 4D9RE 2EE6A 4OZIF 4UIKH 3LV3A 1U3HC 5IHZA 1EAQA 1PD0A 2O30A 4KQ3L 2P46B 1QI3A 3QP3A 4JFHD 1PX4A 2XWJB 3BQVA 1NAKL 3IFNH 2V3DA 3F12A 4OH2A 25C8H 1ZE3C 5FFGA 1JZ2A 4NC1E 2AZUA 1U8KA 1GL4B 1RZIB 1UQSB 3ARUA 1EAPB 3HMXH 4G9DB 3Q1SH 1T89C 2QMKA 4B9YA 4E41B 1K72A 1L9SA 3RI5F 3L13A 1J1OL 2FQDA 4QRRB 2IPTL 1LK3L 2EXYC 5E5RB 2Z91A 1ZANL 1FNHA 1CL7L 1HWWA 1W8NA 2LE9A 4GMSL 4LSRH 4XAWL 2WLYA 3D69A 3QZWG 2XN2A 2EDWA 1H3VA 4NCC2 3N44F 4OBSA 4UDTB 5KN5A 5DMGC 2BS8A 2AJ3A 2HH0H 1DFXA 1RV6X 4UB0H 1XMWA 3TJPA 5IOPB 4QHPA 4ISVB 2Z3FA 4Z7WE 3VFRB 1I7RB 1NCBH 1OE2A 3D06A 1KTCA 3GYRA 4JFFE 1G7MA 1H6EA 4K7PX 5SWSE 3ZTJG 5LKNA 4P5SA 2MRYA 3HG1B 4R2GB 5EFIA 5JZ7D 2IBBA 1UOLA 4MJIB 2CUAA 1WBXA 1BFOB 5HGAA 4EI6B 3FPYA 3DVNA 3V4UH 1P0SE 2AQ3A 5HHME 4ZXBB 5IJDC 2PCPB 4XNYH 1KLUA 2BSSB 4JCMA 2JV6A 3MCKB 3IGFA 1AE6L 3ESUF 3QUHA 4WTWA 1JIBA 3CFCL 1BG1A 5D9SB 1EAJA 1FFNB 1QFPA 1BQLH 5D7KE 3L3KA 4M8UA 4XP5L 3AXHA 3SKNB 3ISRA 1N8OE 4LHUA 1Z66A 4E9VA 2M2DA 3LZFH 4JDTL 4GXFA 4YGVB 3IWUA 2DYRB 1A6PA 3IBOA 5T1LA 3F04A 5HYSA 3GSWB 4LOVA 1MCHA 3F3HA 1BJ8A 5CJXC 1G7LA 2Q1EA 4NN6C 3ML8A 4XMVA 2L3BA 4ZTOH 4AQOA 3T0DA 1WUNT 3L9YA 1UZ6F 4NQDE 3RB7A 3BQUA 3WY4A 4K5LA 3FO2A 3WE1A 1N68A 1NCWH 4Z7VE 3MLWL 1A7OH 3B2PA 3E2HB 5DJCB 1RUAL 5EUOB 1ETA1 2AAAA 2X6CA 4YK4B 2HT2C 1WFUA 2GTWA 4NAJA 3WFDH 5KSUB 4NUGH 3QUKB 2C5DC 1F4XH 1FNGB 3UZQB 1IKNA 1MLBA 3NSXA 1HHJB 3N1PC 2P8PB 4IIQB 1ECYA 3RVUD 5CEZL 1MI5A 1U8LA 4N0UE 4BA0A 1DQKA 5I1IL 4NQED 5D1QA 2ENPA 2E4TA 1TJMA 2BSEA 3SCMD 5KBKA 3RG1C 1M3JA 3PDDA 1DZBA 3HZYB 1I3GH 5E8NB 1DEEB 3VH8A 4XVJH 2ZUQC 4GXVL 3G6JF 3L1GA 5AW9B 2C7UA 4BZ2L 3AUWB 2FK9A 1L3NA 1TTBA 1Q94B 2FQGA 5KYWA 3CBKB 3UTQB 3IFLL 4QRFA 4NI3A 5DQDL 4EZLA 1EDYA 3NCXA 3RZCA 1XSIA 3FB5B 1EEQA 3JV0A 3MRDB 3VU2A 3GSUA 2RALA 4PP1D 5CZKA 5EO1A 3AS0A 1KEGH 3KH3A 5JW3L 1XBRA 3OX8B 4K8RC 4M4RA 4DESA 5ESQA 3S9DB 2Q6WA 3RUGF 2DM7A 5KAQG 2D7TL 5DC4B 4B0MM 1PY0A 3C08H 1IEAA 1KJ2B 4BDVA 3TF7C 5F72S 2BX5A 3QAZC 2UVEA 3H3PH 3O4LE 1CD8A 1MHEA 4N87A 1D7DA 2YD6A 5E6UB 1U8QB 1MCDA 1UH3A 4YSDA 1AZNA 4DHLA 1RY7B 3ULVL 1CFVL 1QW8A 4DVRH 2OM5A 2JJSA 4QKTA 4UYPA 3LZLA 4ZTEA 2AJXL 2YAPA 3NIFE 5KYUB 2P80D 2YKLH 3JVGA 1KACB 4HJ1A 4WKXA 5EU5A 4G82A 1FIGL 2ZWYA 3BKCL 4AQZA 3V4VH 4I4WA 1P84K 1T21A 5CGYC 3OMAB 5D7LD 1GGBH 3PCYA 4JFWA 1PJ9A 2ITCB 1OF0A 5IVZB 4MZIA 5T33L 2FL5B 2FQFA 1AS7A 1IT9L 2YAEA 4ZODA 2LLLA 5AEAA 1AO7B 1R24A 1LDSA 4G6JL 3ULSA 1OCWH 1AR1C 5GPRA 5DDHA 3EDJA 2JIXA 1P6WA 1KXQA 4ZFZB 3CFJB 4TULL 2R0WH 5GJTH 3KWWA 4PP2A 4WI9A 5KANG 1T5KA 2NNAA 4Q0XH 4GG6F 3V0GA 3VB9A 3VI3F 3JTTA 1ZMYA 1WD8A 3OHXC 5B8CA 3APCA 1LEKA 3KHQA 5FF6B 4HYTB 3G5ZB 4URTB 1H8NA 1I7UA 3MJ9A 4M5ZL 5F1KC 2B3IA 1PQZA 4FQXB 3C12A 5C08B 2HLEB 3VXSE 4HUWA 3BKMH 4D0DB 1TSRA 4LFHG 3Q43A 3ABGA 4JFDB 4KI1A 3OR7B 3H9YA 4N0FB 3TEUA 1N64H 3T1FA 3WAKA 3ILPA 3FFCA 4HUVB 2NY5C 3B5GA 2VXTH 1G87A 1JE6A 3GS4A 1LO3L 3BGMA 4WF7A 1R5WB 4L5FH 5B38A 1TJXA 3AQYA 3MRFA 4ACPA 1IL1B 1BAWA 2BCKB 4PJFF 3W9DB 1G7PA 1DQLH 4OCSH 2IXQB 3L7FA 5B1KA 5DO8A 3UCRA 2PTVA 2BP5M 1A6UL 5MEOA 1BQSA 2L7UA 3BAYA 1P7QB 5B1JC 3K72B 5J13C 5K39A 4Z95H 3ZTJH 2MQ0A 1IZKA 1HSBB 2RGSA 2B1HL 3L9RB 4IOSD 3K5RA 3CNKA 1LK2A 3GTTA 5IB3A 1T7WA 4PTTB 4F33B 2FIKB 5F7HA 4GQRA 2P8MA 4LDEB 3VCLA 4E9RA 4V1DB 4PR5B 3ARFA 1RSYA 4KJWD 1WICA 3UGXA 3S3DB 5IW1A 2IO5A 1KIRA 4P57B 1HI6B 1JPGB 5T3ZD 4AZUA 3PL6B 5I2IB 5IWLC 3B9VA 3GJFA 3QIWB 3MKGA 5C7XH 1FUNA 3CFEA 4M7JL 4PJ5D 3UAAA 3TZVA 4X9HA 4G9FE 3CJJA 3UJTL 4ZOBA 1NAKH 5CLWA 2J6WA 1XF4B 3HBGA 1L7TL 2ENQA 3MLZL 3ZTCC 1KXTA 4LLMB 3UTOA 3VDAA 1E5CA 1QSVA 4IRSC 3AROA 4TPRL 4LL1A 1U8CB 1J1OH 5IMOB 2IPTH 3CN0A 1NIFA 1LK3H 4M6AA 3B5TA 5IZ7A 1ZANH 1CL7H 3UTTA 3DX2A 4GMSH 4XAWH 4YR6A 1AANA 3LN5A 1NZRA 1QR4A 3F84A 4ZYKB 1OOAA 1HXYA 4GKNA 4FFVD 4AYFA 5J9PB 3T2QA 4AGLA 3GPEA 3C60B 2WXMA 2G4EA 3VFGL 3WNIA 3ECBB 2Y5TB 1KLGB 4X99A 5E2VL 4XOAA 4DZBA 1N5YL 1MEXL 2XWEA 3LPOA 3BZFB 4I0CC 2NY6B 4ANKA 4JQIA 4NC0B 4HOMA 4D7BA 1QSFE 3U4KA 2AHIA 2P52A 4PJIA 3QIBC 1VGEL 1U92B 3BVXA 3NTCH 1B3JA 2OL3A 3FS9A 5DMYA 1SJHB 2WC7A 2BVTA 4P5MA 4ATWA 3NCJL 3GIVB 4H44C 1DSFL 2MQGA 1MUJA 1AE6H 1WSST 2CBPA 3CFCH 3F83A 4JLRB 2HN7A 3SKOB 1ZHBB 2EIZB 3CG8A 5GGVY 1AQMA 2P9RA 3OKKA 4FNPA 1OSZA 1QYGH 2HJKA 4XRCA 4JDTH 2C4FU 4EDWH 2ZE0A 4JY5L 1NEZG 3DGCR 3BPCA 3EFDL 3HE7C 4HUUB 5GRZA 3EH4B 3US9A 1D9KD 3L4CA 1T1YA 4NGHL 5BS0B 3D0VB 2DQCH 5C3IA 3FFDB 4BZ1H 5JIPA 2X88A 4X80L 2H7WA 2EJ1A 3MLWH 2K9FB 4LSVH 1QFHA 2V5YA 4FYQA 5I23A 4XH2A 1RUAH 5F7DB 5FYLE 2W07A 4BH7A 3GXUB 3FB7B 5CCKL 1RIHL 3R4RA 2DKMA 4BJLA 5TK2A 3WO4B 4E42B 3BFOA 3AY4A 2P8LA 4U1GB 3VD9A 5D1ZA 3TS8A 3IKCA 4IBWA 2N1KA 3CVHA 1IAOB 2IF7A 3FKUS 5I1IH 4P4KC 5DZAA 5DJ6B 5JMOC 3ZHDA 4TNWK 5DQ9A 1B9KA 1E7VA 3VMOA 2VLLB 1IV8A 1XD1A 4M1CD 3CPLA 3ZGHA 3EO0B 3ESMA 4Y4FC 2CKBL 3ULUF 3X14B 1A47A 2OMYA 3BLKA 4GXVH 4G80B 2XVGA 1MHHA 1ZHKB 4LDLB 3TPKA 4BZ2H 4QRTA 2IH1A 4U1KA 3IFLH 1F3DJ 5DQDH 4DVBB 1B0IA 1WC7B 2D31B 3CSYA 1J05B 2ZXGA 3SGEH 1W91A 2RHEA 2GEEA 1TJHL 1RK0B 1B2WL 1FV1B 2HFGL 4DUWA 1J0JA 1B0RA 4FDWA 4YHOH 4YFDB 4DGIL 2D7TH 4PJAE 4E36A 5BUPA 4L1HA 2JCWA 4HDIA 4LE8A 4BELD 3O41B 2GUYA 3NQKA 1RZ8B 4C4KO 3AQXA 2VAJA 1THAA 1HN1A 4OI9A 4IDJL 5DJ2B 1CF8L 2WXPA 1CFVH 1FYTB 4WAFA 3VXUE 4GG8A 2HMID 2CUHA 4QF1B 4YHPA 5INCA 2AJXH 5K9OB 3LD8C 3CU1A 1FIGH 2P1YA 3BKCH 3JT0A 4HKXA 3V9FA 5IMMA 1BVKA 4XAKD 2XOTA 3TJHC 2KUTA 1U93B 3UAJA 3FO0L 1GPOL 1HHHA 2ZXBA 3DTXA 4ZDHB 3VXRE 5T33H 1KJMB 2AKRB 2Q7YB 1IT9H 1JD9A 4X4KA 1VAHA 4MD5B 4L0YA 1TZGL 5F1IB 1S46A 2V9UA 5AW8B 5BQ7A 4TULH 5IEHA 5F89B 5E2TL 3RRQA 3U0TB 1SHWA 2I9LA 3PFQA 5AKVA 2F8XC 3I84A 4I88A 4IMKC 1LO5A 5PCYA 3KPQB 3U1QA 3EFFB 2VLKD 4Y16D 1IGJB 3CH1A 5F9AC 1EHXA 3OLEA 1ORQB 1IGYB 4OCMC 3NZ8A 5D7IF 1MWAL 4M5ZH 1O75A 1C7TA 1NBZA 3MUUA 2A5UA 4P2OB 4K94C 1F1AA 3FUKA 1R34A 3VYPA 1CXKA 1PSKL 5AZEL 1SY6H 3JT2A 5I17A 5HY9B 5KWYC 5F8QC 3MOQA 3RWDA 3LXBA 1W16A 3QGVA 3EJZC 1DQMH 4WSGA 2FEDC 2DLHA 5DTFB 3RL1B 1AIZA 2R23A 5HYJE 4GLRH 3FHEA 2X05A 4BFKA 3QDJD 4RFNB 4Q6IC 4EIZC 1LO3H 3HG0A 3D25B 2HX7A 3V6OA 3DXAA 2LAAA 4JFQB 3CLWA 2XQYA 4J27A 3D33A 2N4IA 1G6VK 4MFHA 1QSED 3ABKB 3QDMA 5AALA 2QPFA 4CDGC 2WQUA 1UA6H 2IGFH 1QZ1A 3LHAA 4GLRI 4KUCD 5EZIL 1VDGA 3EZJB 1OB0A 2DWSA 2Y07L 4FOMA 1CDYA 3OZKA 1S7TA 1WWWX 1XH3A 4YHML 4JCWA 2O1AA 4J7RA 4C83A 2FYYA 2B1HH 4GQZA 5AZ2L 3T77B 1YEWA 3I9AA 2AJVL 5HGHB 4GKOA 2P5WB 3QE5A 3GKZA 4MDRA 4R7LA 1W72L 1U36A 3V6FB 1U8MB 1E9QA 4YPGB 4JKPL 4FZ8L 2YD3A 4RA3A 4M7JH 3P2BA 4TQIA 5BRZB 1QBAA 3OKMA 3UJTH 2F54B 2VITB 1BBDH 4NZ8A 1XGPA 2K45A 4LHJB 4H8VA 1L7TH 2XN0A 3MLZH 3TPUB 4N26A 4PRNA 3ZMEA 4MYWB 4ZZKA 4ZW5A 3M8OH 3GBNH 4HCFA 4KHTL 4QYOA 1IFHL 4RRPM 2NX5E 4Y9CA 4L4TB 4XGZA 1BWWA 4A68A 5MEQB 1YLBB 3HN5A 4HULB 3IB4A 5BZZA 4IS6A 1A14L 1LNUB 4I48B 5E23A 4Q9QL 1J86A 3PFUA 4F1ZA 2IAAC 1DQQB 3TA3D 2VDRB 4AH2A 2PCFA 5ISZA 2MQCA 3K4DA 4PJEE 2WPGA 3NSJA 3NVQA 3VFGH 2DQ6A 2WCGA 3WIHL 1MEXH 2F7IA 3EO9H 4HETA 3S8FB 3HHSB 5AD0A 2DH2A 2QL1A 1T89A 1T1XA 4YBLC 1YJDH 1O6SB 1KB5A 5IJVA 3VG0L 2YA1A 1VGEH 3U9UB 5DFAA 1FRGH 2WBWB 2Q7AA 3UGUA 1SF5A 2XWBA 1TZHA 3TEWA 4LVOC 3LIUA 2PO6B 1SZNA 4JZJB 1KELL 4UM9A 5SWQA 3U48A 4O9HL 4L8CA 2EUZA 1WFOA 1V5JA 4HCRL 3KPOB 4RGMB 5KYNA 1IAKA 5F1NA 2R4SH 1LMIA 4NZDA 2ZKHL 3NCJH 3WTVA 3SD2A 1DSFH 5A1AA 1MLCB 4WWNA 5I0WA 4KK6C 1UKSA 4NS0A 3ULUL 1LJMA 3W0WE 3HZKB 2PWGA 4HDIB 4JY6B 3C5JA 1OSEA 3BWAB 4JY5H 2PW1A 2H3NB 1D2PA 3EFDH 2ED6A 2ZXCA 1MCLA 1Y18B 4IU2A 1AGBB 4IYKA 4JKKA 3DX3A 1S7SA 4NQEB 2MHAB 1D5BB 2WIMA 1KB3A 4X4ME 5A6LA 4QI3A 1I1AB 4QNPF 1Z3GL 4QYAA 4X80H 5JHLL 2NYYC 2WJ7A 1QLEB 1CWVA 5DF0A 4X6EA 1OCCB 2GJPA 4UQIM 1N70A 3HBPA 4TF4A 5L2KA 2ISDA 1URIA 5D1XB 4F7EA 5BZDB 4YDJB 3QJQB 2BSBA 1OT2A 1I8KB 1RIHH 3ES6A 2EC8A 1JGDB 3QPXL 5TF1L 1DLHA 4PJXF 3HUJB 5DZOA 4LZKA 3ZYZA 5HYQB 4TNWF 4JREB 4FA7B 2V2WB 1F56A 3QWRA 5DYFA 3MBED 1FVDB 1M1XB 1S7XB 2G9HA 4Z7UB 5D5MA 4PV9A 4HWZA 5EO9A 3G04B 5EO0B 5T1KD 2CPCA 4ETQB 1BQKA 4NN7B 1G7QB 2V0AA 3BO8A 1ET7A 3ECWA 1F3RB 2YK1L 4RGNB 4H25A 1CGXA 2RFXB 5C8JB 2CKBH 4AX3A 1KT2B 3NIDB 4HK0B 4F8QA 2YLHA 4MVBD 2YN3A 4LRIC 5E7BA 3INUL 4S0TD 3WUWB 2Y5EA 2H8PB 3QJSB 1TU2A 4KO7A 5D2LE 4YHNB 4AMXA 4QOKE 1ACZA 3U6RB 1B2WH 2HFGH 4PJBF 4F7CA 3NJKA 3D8MA 1EQWA 4GRWB 4U6YA 5T5FA 1MNUL 2HWZH 4DGIH 4PVBA 4UOW0 2XN9D 1SLUA 1H3UA 3RFZB 1IC4L 3D3VB 1RCYA 3GMMB 3HN3A 5D7LB 5L8LB 2HAZA 1AXIB 4A04A 2VMFA 4CW1A 3CFMA 4G7VL 2F8VA 3UTPE 4LLUB 3VFUA 1RZPA 1B0GB 1IU1A 1A7NL 4PW4A 1LEGB 4JMNA 3S3PA 1JCVA 2ZWLT 5DRXB 4MMZC 4PJ9C 4U1NA 1F8TL 4IOFD 2ZOWA 4R97C 5TJWK 2VIRB 5JXEA 1KYOK 1IM9D 3AT0A 2F08A 5HDOA 4XWGL 5DUBB 2AJZB 4JANB 1XCWA 4KY2A 5F7EL 5HGBB 1UM5L 5DFTA 3EBIA 1C16A 1CIUA 4B97A 1TZGH 2Y7MA 3QFJA 2NY2C 3MRJA 4CVUA 5C70A 5E51A 1CDHA 4R0LB 5J1AA 4J5VA 2GITA 2BJML 5C07E 1QVOA 4K15A 1NEUA 1E3ZA 1PU0A 1JZFA 1E8ZA 1T5XA 5DJ0B 4ZX3A 4X6CF 4XBPA 2Z92A 3QB7C 4LKXB 2GSGA 4AUJA 1DVFB 1QRNB 1KOAA 3RL2B 3FQNB 2GJ6E 3HVDA 2N0KA 4HUNB 4ZPVA 1YMMA 1U3HB 1S8DA 2V7NB 4MA7L 4LNRB 3T8VA 3HNTL 1OAKH 5A7EA 1O5DT 1U2CA 4FTVE 3RAJL 1FG2A 3FFOA 1JXJA 4DP4X 3BP7A 1P1VA 4MSWA 1JI2A 2XTLA 3PWPA 2BSTA 3OHXA 4UZSA 5IVXF 4QJ5B 4G7QB 4N2OA 3UYRL 5GS0D 4NO5B 3QNXB 1KCWA 4FKHA 2WBJC 1KF9B 4GFTB 1TKWA 2H47C 3O6FD 4DQOL 2H26A 4WZ9A 3MZTA 3FU7A 2NDGA 5EZIH 1KY6A 1ZHLB 2Y07H 2FSEB 3A6OA 2IALA 5BCAA 3ZDWA 2P7TB 1A9BA 4LL9A 4PJHA 2YBRB 5AZ2H 1S9WB 2G75B 2AJVH 1AHMA 1IIKA 2IGLA 4R7XA 4XHQA 1HEJC 1W72H 3UZVB 2XU9A 1NFKA 3W3BA 2WSPA 1ED3B 3UTSE 2N59A 4Y2OB 4PWIA 4JKPH 4FZ8H 4U3SA 3GK8L 1CJYA 1OK8A 3BUIA 4KKAC 5IBUG 5C0IB 2E5EA 1DVTA 1G9MC 3LKOB 3G5YB 4RMSA 1U42A 3IVKB 3GXNA 1IE4A 4Y1AA 1U9KA 5B1JA 2FO1A 1MW3A 5D7SL 1MJ8L 3K6SA 1NFDB 1EEZB 3BP5A 4KHTH 3DV4A 2QQNL 3V0EA 4OD2A 3W5MA 1IFHH 2EECA 4EXPX 1F4WL 4CSPA 1ZWIA 4J3TA 1EGJL 1OP3H 3DX7B 5E5LA 2DWEB 1RIUH 5HBBA 2OMNA 4Q9QH 4YLQT 5HYFA 1BX2A 4X7SL 4ENED 3H0TB 1M7IA 4RAUA 5GZND 2MNUA 3L5IA 1IC7L 4G6ML 4OB5L 3EO1B 1IEBB 4R5VA 2WWKO 3QUZD 3WIHH 1RUMH 4LEOB 4LIQH 4ORGB 4AEEA 4AW7A 3EXLA 3TCLB 4DIXA 4XI5C 1CG9A 3CQFA 5IHWA 2ESVD 1UOWA 3VG0H 1NBQA 3EOBB 2K6WA 4A6YL 4WNJA 3DJ9A 1A1NA 3GINA 3N1MC 5JW5B 3TBCA 1KELH 1CD9B 3NSDA 5IREA 4O9HH 1B9ZA 2WLJA 1PKQA 4HCRH 4TVPD 3OQRA 3NESA 2PR4L 3EGSB 5B1AB 2ZKHH 2BC4A 4FL4B 1W0VB 3GIZL 5J56B 3ARDD 4S1QH 5KVMC 3D6GA 3BPOC 3FSVA 5DJAA 4DAGL 2OP4L 1URLA 3KYOA 4K4KA 3ULUH 2NSQA 2ZUQB 4L3AA 1QHOA 3UDWC 5EBMA 2R83A 1AGFB 3QIBA 4NNYB 4LP8A 3PXHA 1CBJA 1BEXA 4K2UL 3PWVA 4P5KA 3VXOB 4IEFB 4OIIL 3PJSB 5E9DA 3NYKA 5F7YC 2MCG1 1K9TA 1K4CB 2R69L 4G72B 1Z3GH 3DJSA 4PS4L 1H6TA 5HHOE 5KSBA 1L9PA 5E0QA 4RNRA 5E6YA 5I0DA 1MFEL 1MHCA 3NDYE 4OZHE 3MA7A 3I9IA 3QPXH 5JPNB 1UA7A 2NUPA 1XTLA 2AJSH 4C56D 1P6FA 3VTMA 3E9UA 3QAZB 5LLIC 4U6XA 43C9A 2RJMA 1E28B 2CNYA 2V7HB 5FYKE 3GMQA 2WKOF 3P69A 2O5YL 4G6AD 4RAVA 3BUYB 3QEGL 4Y2DC 5E08L 2Q86A 4LO9A 3HI1B 1GCYA 4I18B 1P2CA 2WGNB 1YYLH 2B1AL 3OMZA 3RVVC 3BSZL 5HDQH 3RWGA 2DJUA 3TYFB 3INUH 2O26U 1G0YR 5LGHL 4WV1C 4NKDA 2B4CH 3PGDA 2ADIA 4XZUA 1GTNA 4WU7B 4DSYA 1XR9A 1AVAA 4P4KA 2Z7UA 4QLRA 4QJ3B 3VD5A 2QQKL 1G6RA 3WIFB 2VO5A 2ZOTA 1SBSL 4LXFA 1MNUH 2I7OA 4J3VA 2BP0B 2FO4A 1RZ7H 2ZOKB 1IC4H 4Y4FA 5ADPL 5E94A 3LY6A 2YPVL 4PPTA 3ZDYF 4LKCB 5HD8C 5I8OL 3KDPB 4W68A 2XA8L 4G7VH 4XCEB 5L2JB 2NCMA 4P2RB 2BW5A 3ZE2B 3CDYA 2FJFB 4RESB 4L18A 2C8NA 3BDXA 1BZ9A 5HPOA 3KXFA 1MAJA 2VNCA 1F8TH 3H8NA 4R4ND 2X4PA 1YAZA 4Y16B 5AW2B 3GLDA 3TP4A 4CBPA 1BMWA 2F7PA 3PABB 4HH8A 2XWTA 5BO0D 4KDVA 2X38A 3LEYL 4UQBA 4RZCA 2VB5A 1UM5H 3ETTA 2JF1A 3U36A 1YA5A 4NDMA 1HCFX 1CLVA 4UQ3B 3Q2NA 4GQ9L 3REVA 3MRLA 5TDNA 4EBQH 1J5IA 4DT2A 2BJMH 4YOKA 3MTXA 4HF5L 1QATA 1E7UA 4G8GA 2J1YA 3N42F 4R5XA 2GFBA 2P24B 3T0EC 3G6AA 4F15B 1UM4L 1TVHB 3MV9E 1RXLA 1JCKA 1HWGB 4WTQA 5C0CA 5FGSA 3BXNB 2J8UB 3FQRB 1QSEB 2F53B 3MGTB 2BNUB 3CZKA 2WMPB 1SFHA 3HNTH 4QR7A 5AW7B 4MWFB 2DQHL 4FN0A 5IHUL 5KBPA 5IG7A 3F58L 3V6ZB 1M6UA 4IRSB 1LQSR 1YN6B 1MFBL 3DRQA 3IDMA 3UYRH 5AAPA 3QZLA 1VGKB 1N4XL 1OGTA 4OFDA 4PJGF 1UD5A 5ES4B 3VDCA 5HDBF 5DJ8B 2X12A 1YECH 1K5NB 4YSOA 4YNYA 3MU3A 1YYCA 3BP4B 3ERXA 4YL9A 1MI5D 2CRYA 2M26A 3LKPA 3HBQA 4G70B 2E9IA 4LNVA 1NGZB 5TH2B 4DW2L 3BWUF 3FT3A 5D1QD 3GI8L 2BSED 2EVJA 3W82A 2XBDA 4Q6IA 1USQA 4BE5A 5LWYL 3WJLC 3O3AA 4B9IA 3IMTA 3T3ME 1ADQA 3C6LB 3D18B 4PLJD 5FWRA 3QI9C 1E2WA 5B3JF 5ALCL 4NSKA 2EP6A 5E03A 2YD7A 3GK8H 1CYWA 4LCUA 3RKDD 3FSAA 1ROWA 1MRDL 5HJBA 4LLYB 1JS4A 3RZCD 3KPLB 3N6YA 4MBRA 4DKFL 2W5PA 5D7SH 3Q6FA 3ZHNA 4MJJA 5EZLB 3FB6A 3DROA 2APVA 3HB3C 2X3AA 4OFVA 2QQNH 4IBTA 4WUUA 4GW5A 1F4WH 1G7HB 1EGJH 1GC1L 4HKJB 4WLCA 5IQ7L 1PMYA 3IAQA 5EWIL 4L3FA 2F74B 1SJEB 2VXUL 3T0WA 3FQXA 3X3FL 2CHDA 3HE7B 1N67A 3MRQB 4GFXA 3O2WH 4X7SH 4YWGL 1NKOA 4WFHD 5E2JA 3D07A 5LN8A 2WHVA 1EZSA 1OGAA 1WYJA 1IC7H 4G6MH 1A6ZB 4OB5H 2BIHA 2TSBA 3BVTA 2X2UA 2IADA 4N2MA 4WHYG 1YQ2A 3TBVA 5TTRA 1TTAA 3DDFA 3OGOE 2EKSB 1D5XB 2K8MA 4DP7X 1OAJA 1M56B 3WKMH 2G0KA 1JHTB 4HEME 3P4OA 5C3TA 4R6UA 1CYXA 1M1SA 2X70B 4EPSA 4PGJA 2OMWA 4UWQB 1HK6A 2HRPL 4QRQB 1HL9A 5ERWB 1BFVL 5DK3A 5KVDE 4Z8FH 3QA3B 2GT9B 3OPZL 2HPOA 4FG2A 2EDBA 1FFPB 5D2NA 4U0RC 2W0FB 3LRKA 4K9JA 2PR4H 4QAMB 4Y8DC 4DH2A 3OAYK 2JIXD 4JM2F 3V0VB 1AXSA 3GIZH 5AUMB 3C5SB 2WLLB 4PRHB 1L7IL 4TUUA 3LRSB 4DAGH 2OP4H 5IEKA 3P0VL 3ILQC 3OZ9L 2HFEA 2ATAA 1ZTXL 4LEXL 3WFEL 1P5UB 4OZFA 4R9HA 1A1OB 1DSWA 3IJEA 5KOVC 3TNMA 4KI5D 4K2UH 4MJ5A 3MBEB 3ZO0A 4Z7NF 1WLHA 3DX1A 1PZAA 3PQYA 3RDJA 3KLKA 3IRZA 4OIIH 1U2YA 1KB9J 1JHLL 3H9SA 3O2DL 1UJ3C 5GSVB 3MJWA 3OL2A 4BQ6A 1H9VA 3AXLA 4XCNB 4XBGB 3DRTA 1SXAA 1XEUA 3N40P 5E1IA 4K9EC 4G8IB 1INDL 3FFCD 5IMKB 4M7KL 1MFEH 4XMPL 3FF7A 3QC5X 5FWQA 4LP4A 1M05A 1JWMB 4JX0A 3SBRA 3UJIH 3P73B 4ZMVA 2A4EA 2VLJB 2EE0A 4JDZB 4WTZA 5IKCB 4NQXB 3VFWB 1Z5LB 2VLKE 1ZSHA 5GXBB 4F20A 1G4MA 1T1WA 2MMXA 5I8EA 1QKZH 1R33A 4RIRA 4NZTH 1IAIH 1XAKA 4XXWA 2GBTA 5C71A 3L3GB 3UG3A 2J6EL 4PJDB 5FO8B 3U7YL 1OIOA 3C09B 1ETZB 3QEGH 3OAUL 5DUJA 5EC1A 3S37L 2PYEB 1MJUL 5EHFA 4WSKA 5BOPA 2EABA 1KMGA 4JFEA 3LH8A 2B1AH 4RFEA 3BSZH 2BK8A 4YXLL 3ARFD 3MACL 3QDJE 2EIJB 4E0RB 2G3MA 2X6UA 2ORBL 2VN7A 1FVEA 1AD0B 1YEIL 5LGHH 1IAII 2W60B 4Y4HC 1CDGA 1I85C 3S96B 1LLAA 3I6GB 1L0PA 4IM8A 1ONQB 3DX6B 4GAJL 1J9RA 2V37A 4JHVA 4FQHB 4YAQB 3VU1A 3BHBB 1OHZA 2QQKH 2Y1AA 1B88A 5BRQA 2B39A 1SBSH 4LCYA 2K7PA 2Y2WA 2UZXA 1KGJA 5IV2B 3MV7B 5KVEE 1A7RL 2GJRA 3TGXA 4KXAA 1SVZA 2VDPB 5ADPH 2G2PA 2DQDL 2YA2A 4OIFA 3TXAA 5I8OH 3EUDA 5D1QC 4AT6A 1DUYA 2L4OA 4LRIA 1JZGA 3M17A 3A67L 3UTTD 2YD0A 4ELMA 1AZBA 5A2AA 2Y7QB 3L6FB 3QCVL 3T65B 4CGTA 4NM4L 3SDXF 4KNUA 4KXDA 5ID1B 3QRLA 4HJJL 4YDKL 5IM7A 1O6VA 4S1DD 1H6FA 2C9RA 4D8PA 3MLRL 3LKQA 5A40E 4G5ZH 4ZNEE 1KCBA 1GYAA 4Y9GA 3DHUA 1X3DA 2BHZA 3LEYH 4L2LA 3L95A 4Z5RB 2QVFB 3QYNA 5JIDA 5SWZE 3D0LB 4GQ9H 1KIPB 4KUZL 1M3IA 4NUJA 2F9BT 5F9JA 4NRXA 4HF5H 4MMZA 3N41B 5D4JA 5J3HC 1YN7A 4RA0C 4M4PA 4JO5A 2DF3A 1E2VA 5EIIA 5CJ5A 3KLLA 3HKZA 2QZ5A 1UM4H 1WV7T 4G59C 5DHYB 4MAZA 2WNKA 1ZKAA 4YX2L 5D6DC 3H2WA 3OKLA 4BE6A 3X3GL 3PREA 1TQUA 4WW2F 2NDFA 2DEWX 3TBYA 1JMZA 1TF4A 1R3KB 5EMYA 4JJHA 5IHUH 2DYPA 3F58H 8FABB 3S0PA 4QHUB 1L9QA 4NO3A 1CFBA 1MFBH 3P4MB 2JKLA 2Q20A 3K0WA 1A21A 2H9GB 3HI5L 1N4XH 2CHZA 1SMOA 2OS7A 3LEVL 3IDJA 4HWEL 3T8XB 3VFOB 2XKSA 2FEEI 3II1A 1CFNA 1SDYA 3EGXA 4PGEB 4DPRA 1NFAA 3CBJB 4F92B 3PNWA 5FKAB 3MNMA 5EEUA 2ICES 5D1ZD 4DO6A 4WHYH 4UIMB 1W6LA 4EKJA 4LB8A 5JORA 3BWSA 4QJ4B 3CFDB 3GI8H 4XNMA 2V2TB 3SDDC 3DNKA 4QT5A 1HZHH 5LWYH 4BQ9A 4H8QA 1BCIA 4N2DA 2EO7A 3T9WA 3AITA 4ZD3L 1U8PB 4Z77B 3K71A 3UJJL 1XIWC 1XXDC 4KZEH 3N3EA 5ALCH 2J8OA 1N19A 2WBJA 4LVOB 1BVLA 2R2BA 2WQXA 5I6OA 5IJCC 3DVGB 1UENA 5EOTB 3NACL 5IQ9A 4YLBA 3DPDA 3BEWA 3QPQC 2HVBA 2YPVA 4HUXA 3UBXB 2ICEC 1E9PA 3A4AA 4FAAB 1IGIL 1VEOA 1XCQB 4O02H 4XPAL 3IKKA 3H9ZA 4HBQA 4KGJA 3ROOB 1GC1H 4B3EA 3VGAC 3LB6C 5FS5A 2CDGA 3I2CL 1Z9NA 2HT3D 2A6IB 4AM0B 5E8EB 4C57C 3ZE1F 2VXUH 2DKSA 5FEBA 3WS3B 2D3NA 3X3FH 4JBSA 3CIQA 3PWLA 4RSVA 5EPMA 4YWGH 4FXGB 3SOTA 3QAQA 3DARA 4JAMB 3ISWA 3MRMA 4KFZC 3EJYC 5B7EA 1PLGL 4H1LG 1QWUA 3KBEA 2ZPKL 4G42A 3A22A 2I26N 3UO1L 2CU9A 1J1XL 2AXJA 5CGTA 1OCOB 1OTUD 1YPZB 1WZLA 1ZV5A 2LFEA 2VUYA 3Q48A 3QUMB 1TO5A 4XC3H 2CDFA 3T5WA 3UAJD 1BFVH 5FOBB 2QMJA 1S7WB 2PWFA 4OIBA 2XN9E 2NY4C 3OPZH 4GSXA 4HXBL 5DK2B 2UXGA 5F3BA 3WSQL 2SODB 4MS8D 1VLXA 2BVQB 3NMEA 5C6TL 2OA9A 4OT1L 5M7QA 1PLBA 3LPGA 3DWTA 1SJXA 4ABWA 1EERB 1OF2B 4NPKA 1YJDC 1L7IH 3B5HA 4HS6A 5CSBA 3P0VH 4OV6F 4DEPC 1WZ1H 2E6QA 3OZ9H 3OB0K 1N8ZB 4MLIA 3T2LA 1ZTXH 1PX3A 3NP4A 4LEXH 3WFEH 2JKWA 2YGVA 4HOXA 1RPUA 3F65A 3ILDA 4WI5A 4QHLA 2G5BA 1N2RB 2YRPA 2EDXA 5HVGB 4BFOA 1WQVT 2NXZD 1ZDSA 5K69A 3VI4A 2GUOA 1JHLH 2HKHL 3GSRB 1DDHA 3O2DH 3N91A 1IAMA 4HHAB 2G3ZA 3HE6A 4HAKA 2ZX9A 1XF5A 1INDH 2WGXA 4M7KH 1CT8B 1OB1B 3QIUB 1A8ZA 4XMPH 5TDOB 1BF8A 1F90L 2C1PB 1AD9B 1YY8A 1WAAF 4FFTA 4OLWH 3FMGL 3HI6L 3MJ7B 4W93A 4A2HA 3WKYA 3UDWA 5CEZD 4NKIL 4QRPA 2B5IB 4F8NA 5GGQL 3NJLA 3EAKA 2VMEA 4RVBA 1DANT 1XEDA 1JZIA 3HG3A 2P42B 1JK8B 4DCQA 3ZW3A 4M5SA 2CO7B 3MNWA 4PJ9B 2N0MA 2X4TB 4BIKA 3G08A 3DUSA 2J6EH 4HSCX 4IRZH 3BZEA 3U7YH 3EYFA 3OAUH 3VYNA 3G6DL 3WS6C 3RVXD 1MJUH 3D87B 1JXDA 2VLMD 3IDGA 4L3EB 1EXHA 3INOA 1CVRA 3OKLB 1MREL 1CQKA 4YXLH 1G9NH 2LR4A 1RK7A 3MACH 1CGYA 2ORBH 1TEGA 1QLRB 1YEIH 5IK3B 1ZLDA 3FT2A 3S88L 2FJSA 4JM4L 4WFEE 4GAJH 4P23D 4Y5XC 4A66A 4W9DC 4F7PB 4E41E 4UMGA 2EIMB 2OBGA 5AZUA 4PLKC 2A0LD 2ERJC 4Y88A 1LL1A 3E6FA 3TBWB 1U8OA 2AP2A 4L4VB 4N9OB 3AXIA 4GQQA 1N12A 4LFHD 4Y2DA 3WE6A 4P9HL 2CBQA 3BP6B 2DQDH 3S5LA 4TKWA 4YHIA 5L8JB 3F6JA 3UP6A 2IIJA 1BXVA 2ZONA 4LQ1A 3GSVA 3ATEA 2K9UA 4YQXL 3ULVD 1GXEA 2NTSP 4MX7A 3KG5A 1QQDB 1PG7L 3MV8A 4S2SB 5FUCC 4Z76B 4WV1A 1TMQA 3U2SB 2ZKWA 1JZHA 4KZCA 3K2KA 3QCVH 5C0AA 1FL6A 4M8QB 3S6CA 5KEZA 4NM4H 3CQPA 3HG1E 2FZ3A 4LLVA 4HJJH 4YDKH 3FTUA 5ISZD 4XP4L 3L81A 2IJ0C 2ZYHA 4ANUA 4MJIE 2ZKMX 4HIIA 3F2LA 2FD6L 2EEDA 2EIDA 3CLFL 1F6AB 3MLRH 5BJTA 4IQHA 2RAMA 2Y72A 1CICC 2PW2A 4ZFFB 2FDBP 4AKPA 4EOWL 1XGRA 4X5WB 1ZVSB 3O6KL 2YRBA 3SGJC 1JWSA 1ZT4A 3FN0L 2EXYD 4GSUA 3O6ML 5FYLL 4KUZH 1OQXA 2DQMA 2JB5L 5H35A 4JGNA 2DI9A 4UM9D 4DTGL 1DQJB 2BOBA 2UWEE 4HU8A 2NT1A 4GRLC 4NPYB 1OV8A 1NGXB 2JXMB 3O8XB 5T1DL 1S5HB 1CLZL 1U91A 2R8SL 4NX0A 4OGXH 3BN9C 3EW3B 4YDIH 2CO2A 1WFTA 2YPLD 4BEIA 2FBRA 2XKUA 4NRZA 3WEXA 2WO3B 3KLHC 4CADB 4ATTA 2O5XH 3K8KA 4IBVA 1RVFL 3U4EB 1J5OL 4LLWA 3QWQB 3BE1L 5L6YL 4MXWH 4PJCB 4WJG3 2CCVA 1NC2D 1Q9KB 3RWHB 2GTQA 3ZZQA 3T0EA 4ENZA 3X1BA 2OR8A 5MENA 1NCJA 1B6DA 4L8DA 4Y89A 1E50A 4HWEH 4I9WD 5TDPB 1QSZA 1ZK9A 4KAQL 3H6AA 2BVOB 5E4OA 3L4UA 3QWRD 4YSPA 1HOCA 4H1LH 4PG9B 4RWHA 3B3IA 3KAAA 2ADGA 2RR3A 4U6VL 5EH1A 4FJZA 5AOKA 4HJGB 1ID2A 2VN4A 3SQBA 3DSNB 3ZGIA 4ZD3H 1Q38A 4JFFA 3UJJH 3WD5L 2Y23A 3PIQA 3VFMA 1IM3A 3L7EA 4I8DA 4PG2C 1NANH 1KIUA 1NDMB 4NNXA 5JQ6L 5MP6L 3UPRB 1AY1H 4B27A 5IQOA 1S7QB 2KT6A 4PTUA 4PWHA 5I16A 2NW3B 3ZYOA 3BFQG 1BQHA 1WWBX 2FJGB 1KTLB 2Y7OA 5DSCA 5GZOC 3O45B 3F00A 4ZUVA 3W11C 4HGWA 1IGIH 4ZSOB 2RQ8A 3C75A 4XPAH 3KD4A 5GRJL 4HA1A 3WJLA 4E5XG 3VYOA 4KVPA 3I2CH 3O11B 3CVIL 3D08A 1E43A 1SBBA 3QI9A 1ETB1 4QRSA 3IJ9A 3PE9A 5CAYB 3B2VH 2YSTA 1J8HB 3WAJA 4X6DA 2MPAL 3D1MC 3EFOA 1CPUA 3BIKA 1DN0B 5JHDB 3HRZC 4IRJC 5F7MC 1PLGH 3BC9A 1RPQA 2ZPKH 4L1BA 4HK3J 1X5GA 4NQDA 3LPWA 4ODUA 1V3LA 3B9AA 1AO7E 2IWFA 4NWTH 1J1XH 3ELAT 1KPUA 4FYSA 4K8RD 4X6FA 5JXED 5EF2A 5DI8B 3ZKXC 2IQAA 1I9EA 2OMTA 4HXBH 1VKXB 1R3LA 1R46A 3LKNB 3MFFA 3CZFB 1BZDA 4K7FB 2QVIA 3QFJD 3WSQH 2TAAA 5ECGA 4JPKL 4N0UA 4BSWB 1AZVA 1U0QA 1VADB 4GBXD 3DGGA 1WA2X 2ZOLA 2VL5A 3HZVA 4BH8B 3FSZA 4K5NA 2HA1A 3WGUB 1NICA 3V5KA 3KPPA 5DZ9A 5GGSA 2BNRA 3KCPB 2ZNWA 4N5EC 3U4BL 4JY4B 3NABH 4N85A 3K8MA 5FB8A 4HKZA 2E7LC 4OGAC 5IVOA 1D6VH 3JUYA 4ZPTA 1YMMD 6FABL 4HWBL 3E3QC 2HKHH 5AFAA 3J07A 1MDTA 1AR1D 4GIOA 5KVFL 2Z93A 1FNEA 3ULUC 1A6VL 1KTJA 3GSNA 4GUOA 1XGTB 1T20A 4F7TA 3LJ3A 4HPYL 1F90H 2VE6B 3EOAB 2XBTA 1R5IA 2DQFB 3FJTA 5GGQH 2Y4SA 3FQ4A 3TBTA 4GIPD 4AV0A 5IF0A 5D70L 4XB3A 2YFNA 3O4LA 4WRLA 1URZA 2OSYA 1UJ3A 2Z8WC 3NFNB 3KLSA 1S78D 1RI8A 3CZLA 3G6DH 4W1TA 1PEZA 2FSDA 4WWKC 4F58L 5M95B 3KBPA 2R59A 3IXAB 1MREH 3QFDA 2ITDA 4KFMA 3H54A 5E00B 2VWEE 3K5SA 4JRFA 3EYVA 2PMZA 1AOHA 1RJLB 1SDDB 1SJMA 4OTXL 4RMTA 4XE0A 4FNRA 2OMVA 4BZ1A 2X40A 5I1KL 2XTJC 3QNZB 5FW8A 5I6MA 5GGUB 3UCQA 3FK3A 3S2AA 2AF2A 1RURH 2NSMA 1A5FL 3MRGB 3V4VB 4Y1AD 1LP9F 3QEQB 3P3YA 3OJ2C 3I75A 3LPFA 4OF6A 4NAQA 1AGCA 4AM0Q 4N8CL 3ZKSD 3PDGA 5I5JA 2GIXA 1MI5E 3L5WB 4BKLA 2Y7NA 5D1QE 2HSIA 2B4CC 4EDXA 4DN3L 3W37A 2V17H 3Q0HA 5HSFA 1PG7H 4FRWA 1BYPA 4Y4HA 5K9KA 3CK0L 1HDMA 1E4WL 4ZMQA 1F13A 2V5RA 4UILL 2MFNA 4JRYA 2FH6A 3R1GL 4XP4H 1VFOA 4WJKB 3PAYA 3VSQA 4Y4KC 2FD6H 3GUFA 3CLFH 1WE5A 3ESPA 4LU5L 3VFSA 2LTQC 3PHQB 3SE6A 2ITFA 2VN6A 2NCEA 4UTBL 2QSTA 4ETYA 5J12C 1HYSC 1USZA 3C8KB 3FN0H 1ULVA 3DBXB 1FYHB 1JZ3A 2PCXA 2JB5H 1FPTL 3IE9A 1GHFL 3PAZA 4L3CA 1F18A 4DTGH 2BSRB 1UEMA 3LX9A 1FSKB 2EXWC 4MQXC 1A0QH 2M8XA 4FQJL 5A16B 1I3UA 3BUQA 1JXKA 5T1DH 4WFHE 2YSSB 1CLZH 3QZWB 4LSUL 4QRUA 5ICXB 2R8SH 4MNQB 3ZE0B 2ZCKL 4N90D 2KBGA 3QJRB 4EEEA 1T22B 2JJTC 3P1VA 3VE0A 5BS0E 4PWJA 5EEZA 2WZ6A 1ZLUK 3BZ4A 4BK5A 3QIBD 3ZDZF 2H0PA 4Z3FA 5TQ0L 4UDUB 1IGTB 2B16A 1RVFH 2HVKA 4DP0X 4N6RB 2ZQKA 3N43F 5E9DD 1K8IA 4OKVA 2X5PA 1C5BL 1TQBB 1FZMB 3TT1L 5C0FB 1J5OH 5L6YH 4QXUL 1CE6B 5KS9B 2JB6B 3QYCA 1WF5A 3L5XL 1XD0A 2V9QA 2V2XB 4YSRA 3MC0A 1BD2A 2ZF9A 2YXVA 5BZWB 5FR3A 2X41A 4ALAC 4OSUL 3AG2B 4JN2A 3KWVA 2D7QA 3FRPG 1H0DB 1K8DB 2G9KA 1HJCA 4V2CB 1UXWB 1WA1X 4B9CA 4OZHF 5HYIA 2UZIH 3GT6A 3MRHB 4H20L 5EBLA 1XMEB 4KI5E 4KKLC 3T71A 1HH6A 3MOBH 4AQ1B 4JK0D 1OPGL 3SZKC 3F6LA 1XZ0B 4U6VH 5LAPA 3DA0A 4IKJA 2PTTA 1F4YL 1GMEA 3L4WA 4E9YA 4HX1A 1BOYA 2VM4A 4Z0BL 4F3FB 2DM2A 3LXCA 4JFXA 3GMPA 1CGUA 4JVPA 3NJMA 2XN1A 5IFHL 5JQ6H 5MP6H 2DBJA 3ABMB 3AW5A 2WP3O 3NIGE 4YVNA 5SX4I 4FG6C 4H0GA 4PI2A 4R4BA 5C9JA 3II3A 4GO8A 2L04A 1JV5A 1QEXA 1RHHA 2NLJA 3V5HB 5DURD 1CR9L 1NUGA 1NDTA 1ZPUA 1KLFA 2FJUB 2X28A 3AG1B 5CJOH 1ZLWH 4ZMAT 5I6KA 4ODTL 1FE8L 3WNOA 1FN4A 3M86A 5GRJH 1G1CA 5EZJA 4S0HA 3TN0C 2UZYB 2CH8A 1XSKA 2X0WA 3CVIH 1MAMH 1K4DB 3EH3B 1XIWA 1QA9B 4JG9A 1FDLL 1JNHB 5L9DL 3J8F7 4ILDA 1QO3B 5AOJA 2EDYA 4M6OL 2WTOA 2BINA 5H4YA 3GXDA 1V3MA 1AIFB 3KWTA 4GAAA 3WFHA 3HLAB 2J5LC 3MBXL 4PH8A 5MEPA 4W9KC 2BOLA 2AQNA 1T6WA 2ICEA 4KKCC 3ESVF 2Z35A 3PV6A 4H0HB 4KO6A 4Q7DA 1YEKL 4FFWD 1FFTB 3Q2CA 2AVGA 5E4IA 3WTYA 1M6OA 4PGCB 2FBOJ 3SSGA 3GMOB 1BZQK 3I3BA 3CXHJ 1T7XA 1E3XA 2H4EA 4LSPL 5I30L 4F9PC 3WHXB 4RWYL 4LCCC 1GIGL 3K2MC 1RFDL 3HNSL 2ZAHA 1L9RA 5K33A 2XFGB 4WU5B 1VZGA 1RZFL 3GF8A 3WEMA 2SEBA 2LAGB 4G8GD 4G1EA 4JDEB 5ICUA 3H4FA 2J7LA 1DTUA 4HEPA 2UY7B 3U4BH 4JFPA 4WEMB 3VWKC 5ESAB 4NLAA 1J18A 3K7UA 5CBEB 2H6OA 3LDBB 3TJHD 2NY1C 5I0XA 2XKNB 4EZJA 3VD2A 5HGGS 1EXUA 5I74C 4MDJB 6FABH 4G8FB 4FLRA 1NBYB 4HWBH 4KXZI 2IV9A 1GGIH 4MGXA 2IQ9H 2ZUXA 3OSKA 3QXAB 3QULB 4JUSA 4NQCD 4UOJA 5F9WB 3U82B 5C1MB 5KVFH 4PJIE 1JGLL 5EU7C 2F1BA 2YS4A 3G5VA 2YD1A 3WL9B 4HPYH 3OKEB 4PV8B 1NBVL 1RP8A 2VR5A 1JN6A 32C2A 1NCDL 4OZ4A 3W1ZA 4L29B 2BVPB 1V27A 1R9FA 1VFAA 3KWXA 4OZGB 4YZWA 1CD1A 3QG6B 5D70H 4P23B 3MRRB 1E5UI 4CVZB 5I8CB 4DP5X 4P4RA 4HPOL 4XNBA 5GS2H 1P7BA 3EJZD 1O6TA 4OI8A 3OXSA 2DI8A 2E7DA 3FZUC 3T0XA 2Q0ZX 1EUUA 1GZQB 1Q72H 2IAMB 4OLXL 5BRZE 4JM0A 2AXFA 2O61A 5IHHA 5KYYA 4HJ0C 4OTXH 1P1ZA 3LZQA 3QEUB 1MCIA 3VXRA 4EVNB 5F21B 1M2VA 1U8HA 5I1KH 1CFMA 1KJ3H 2MWCA 4L4TE 4WJ5A 2XA3A 3SEPA 1LTXA 1A5FH 3DHPA 1FJ1B 3RUGA 3S37X 3NFSL 1BZ7B 5JOFA 3FT4B 3DIFB 4MB5A 3FT0A 4YFEA 3WS6A 1CGSH 2ZAGA 3MRIB 2AQQA 1GW0A 4X5XA 1CGTA 1V05A 2EINB 2V5MA 1O7DE 1P69B 2R7EB 3GEWB 3CK0H 1S9XA 3Q8AA 1E4WH 4N8UA 5JW4N 1EEYA 3IGKA 4N2LA 4UILH 5I19L 3UEZA 4Y5XA 1KPRA 1QFWL 2YEVB 1JOIA 2YXMA 3K1DA 1OGAD 2OMZA 3MNZA 3R1GH 4WK0B 5CF3A 1ETJA 4KNSA 2KZ1B 3WDIA 3K81A 4LU5H 1EJFA 3TVMD 5T8IA 1NL0L 2NOYA 3O4OC 3FTGB 3IMSA 4P06A 4Y19A 1I1YA 4W9IC 4OZIB 5BUAA 5CLTA 1Q90A 2P5EB 2BIPA 3BW9B 4LPWA 4KRPD 5LGJA 2DIJA 1ZLSL 5I1CL 4Q8BA 3NJJA 4LLDB 5GGRA 3QXTA 2JSFA 2FEJA 1ZVHA 2AANA 3EH1A 4L8SA 2J2ZB 1U8IB 1RK1B 4FQJH 1HVXA 3TASA 1NC2B 2AMGA 4LSUH 3S4SG 4H13C 3SDDB 2FGWL 4GKLA 2ZCKH 1SN2A 2P26A 3GEFA 2JKNA 3CDFA 3U83A 1CICA 4LAJH 5CM1A 2XV6B 4UU9A 4ZUUA 2VRKA 3N44B 1J8KA 3H42L 2BNQB 3G5WA 2WYIA 4Z78B 4JJ5A 3SGJA 5TQ0H 5I76A 3EJRA 4MA3B 4PRAB 3PQYD 1JV2A 1TQVA 3DO4A 4UQ9A 3TT1H 5D1XE 3FCGA 3H9SD 4MCZB 4K5PA 4QXUH 3FQTA 4XO5A 4GRLA 1O9VA 1U41A 4WI2A 3GBEA 5DU7A 3L5XH 1ZLVK 4B5ZA 1W8OA 4FS0A 4O2FB 4XPBL 4Z7UE 1P4IL 4V11A 1OE1A 4OSUH 3ASNB 3MRCA 4XOBA 43CAA 1MG2C 4U31A 3BMWA 1KG0A 5IB5B 1QPXA 3PWUA 5CNHA 3RNQB 4TNFA 3AGVA 3QQDB 4H20H 5F44A 2VGLM 1FIEA 2A9DA 1OPGH 3CTTA 3BZ5A 1NEZB 4FI6A 4WKZB 1DFBH 4PJEA 2OMUA 3PGCA 1UEYA 4Z7QB 5FDWA 1TYJA 3TBSA 1ORSB 1F4YH 2NYYD 4Z0BH 5IIEB 2KI6A 4JFED 5T3ZL 2EDNA 4N3UA 2YQGA 3RU8L 3EDFA 1ZVNA 3FCTB 3VQ1C 2QPUA 4KRMB 1A9EB 4GRWE 4UT7L 1OAUL 4JRXB 5BV7L 3SGDH 3DXAE 4P2YA 5GIRB 3WBDA 2D4DA 5I1JL 3OB0H 3D3VE 3WJMB 1IEHA 1E8WA 4TYUA 4XPTL 4B53A 1H15B 1CR9H 3KR3H 3O3BA 5FHBL 3UL4A 5DD1L 3ISYA 3LTVA 3U2IA 1FE8H 3QDME 3BJLA 1TQSA 5DHEA 4GS7C 5CN2A 3RVTC 3KPSB 3PHOA 3GRGA 4G1MB 2A6DA 4I3GA 4KMTL 1FDLH 2O5NA 3SGDI 3FT1A 5JIHA 3CZJA 4PG2A 4M6OH 4RQQA 1PAZA 3TIDA 3TIEA 1YHPA 3GZPA 3JWNH 4FNSA 5IB1A 4WO4C 3CN3A 4GBXB 3MBXH 1WHOA 3RWFB 1MFCL 1QG3A 1JJUA 2OMBA 1XBDA 5JUEL 5GZOA 2Q10A 4MA1C 3G6JB 2R27A 4XWOD 1YEKH 5D7JD 4IKIA 5AB2A 2MKLC 3CHXA 3BRGC 2JE8A 1ZEAL 3CHPA 3WIAA 4AXWB 2AZAA 5I30H 4LSPH 2OZNA 2QHLA 1NIBA 2Y0SA 3VXMB 2QZQA 4RWYH 1GIGH 4NBXB 2C9UA 1RFDH 3HNSH 3GKWL 2QLVB 1XAUA 4YGAB 4EO5A 3HRZA 4IRJA 2LVCA 5K9QG 1UH4A 1RZFH 5HHNA 3L4VA 4W4NA 1G5GA 1T66C 4N9GB 2H41A 4JPVL 1VEMA 4OF8A 3Q7JA 4NENA 5DMKA 2IOMA 3DPBB 2MSPA 5FW6A 5CJBA 4BSVA 5EEVA 4UV7H 7FABH 3UC2A 1M7UA 1X9QA 2PN5A 1AFVH 2X10A 2E9JA 3APNA 4KROD 4AMKL 3P11L 3LZNA 5E8OA 1FLTX 5D2LA 4OAWB 2CKBB 2IANB 1X5AA 1YVLA 2WZ0A 1JPST 4QOKA 4M00A 3QDGD 3V8CA 2IWEA 5HVHC 2DEYX 2CDEB 2DYPD 3ARBB 3MNDA 5I73C 2AXGB 3VB8A 5D7HA 1NBVH 5CU5A 5JNYB 3OGCB 5I1DB 3GXPA 1NCDH 1R47A 5KTEL 5JHAA 1GCFA 3GM0A 4X8JB 1W15A 2FLRT 4L37A 3KYAA 1GY2A 2E7LA 3IU3A 4GG6B 3VI3B 1UZGA 3EIFA 1KN4H 3OPUA 2G5UA 3NFPB 4MCMA 2F2HA 4HPOH 3FRUB 3MBWA 3QQ9C 1OALA 4P5TC 3NRFA 4EUPG 4ZUTA 3TC9A 3EBGA 3ESNA 4WNSA 3SE4A 4UOZA 4ZUWA 2AITA 4OLXH 3SO3C 3GMRB 5C0JB 1A4BA 5JDSA 1ZGLB 1IO4C 4MCYB 2Y6SC 4ZO9A 1NFDE 1R6VA 1CTOA 5T3XD 2GK2A 2WBJD 2W9DH 2ENSA 4JFZL 1TQWA 3QJUB 3VUAA 3T4AB 5L2KE 2GJJA 2IBZX 2F8IA 1JRHH 3DBSA 2GSIA 1GGYA 3GD1C 3NFSH 4E9LA 5KVDL 1TPXB 5CBAB 3Q5OA 1G9NC 2WQRA 5FECB 4PJFB 4WWKA 3RTQC 4D9QD 2EUXA 4AIZA 4NYLB 4DO4A 4BFGA 3KMDA 1UTDA 1TVBB 4L1LA 1TNNA 1UXMA 2BVUA 5FYJD 2IC2A 4HS8L 1GZPB 1JRHI 4AK2A 4JB9L 5EF3A 2IPKB 4U1LA 5I19H 4KKAD 2PUQT 1QFWH 3HLKA 1FFOB 4N8VG 1R3JA 4FTVA 4XMLL 3MLXL 1UB5B 1MWAB 3CZGA 3F7YB 3OKOA 5H94B 3PWJB 5TE4L 5FM4A 3NJNA 4XC1L 1T7ZA 2WXNA 1KBGL 4ZMLA 3OWRA 2A74C 2R29A 1V10A 4Q4EA 1PG7X 3FOMA 1ZLSH 1GYUA 5I1CH 1H6UA 3HS0B 2OSLB 1UGKA 3O0RL 1WP6A 1H3TA 3BAEL 3T08A 1H3WM 3C2AH 2MEJB 3BH8A 4PREA 1HHIB 3N06B 4ZW7A 5B39A 2QKIC 3Q13A 3WO3B 2I7SA 5HHVH 3ALXA 1PZ5A 1B3IA 2R0LL 4N24A 3RPBA 2HB0A 1TCRB 4WHTA 4Y4KA 4YDMA 2XG4B 3I9PA 2HG5B 3ZUCA 1W0WA 1NQBA 3AUVA 3MRNB 4OQTA 4UI2A 4AYID 4WK2B 4XI5D 5ANMA 4FKEA 1COBA 3IE4A 4F2MB 3H42H 5HPMB 2BMKB 4LHQB 3ZHFA 4KJPD 4CC1A 1KBWA 4QUOA 4XB8A 4XPFL 3SGKC 1BA9A 4KH2A 1NWOA 2F5AL 1EHAA 4PWEA 2VLRA 4R8WL 5HVWA 3QUYC 4PI0A 3FYIB 1LYQA 1B2YA 3KZ8A 4ODXA 3DETC 4PJ7F 3HE6D 1W72B 3G9AB 1QX1A 2F7OA 3CFNA 3M07A 4NQSA 1VB9A 2DMGA 3QFJE 5DS8A 3GSOB 4H2CA 1X9UA 1OD9A 1YEEL 4XPBH 1ASPA 5G5DB 1P4IH 4KX7A 3BLPX 3GXIA 1WZKA 2JJTA 2OCFD 1VACA 2CIIA 3BJ91 3DYPA 3MJ8B 3DVIA 1TEFA 2NY3B 1FFRA 1F4AA 3GZKA 3T2NL 5KVEL 2Z4TA 4QRPD 4HS3A 3EHBC 2IH8A 1T0NB 3CH8A 5LHDA 4AVIA 1TMCB 4IBZA 4PW3A 1UB6B 1MCSA 2L7EA 3AG4B 1YMME 1PIGA 2XV2A 1HHGB 5LXGL 3NZSA 1E4XL 2BWQA 2CO1A 4GMTL 2CLRB 3CZEA 2X4OA 4NO2A 2QTEA 3TURA 2O6DA 2PABA 4P2QB 3ZKXB 5T3ZH 1DANU 5KOMC 4JZNB 3RU8H 5C0GB 3NPSB 4OLVL 5KSVB 1I9RH 4UT7H 1WPCA 4P2AA 4YE0A 1KENH 1OAUH 2E74C 3PWPE 4F8OA 2X4RB 5BV7H 5I1JH 2ZXAA 3RDTC 1JGEB 4DERA 1OD7A 3VA6A 4XPTH 2EYSA 3CSTA 2X4QA 5EA0H 5FHBH 5DD1H 1BPVA 4XX5A 3V0FA 4J4PC 5DQJA 3OTTA 4P2RE 5C2BL 1PZCA 1YNTA 5DJZB 3L3JB 3ZE2E 4OF5A 1DVQA 3L3DB 3O6LH 4Y2DD 1SUJA 3VGHA 4ZW8A 5A2BA 1AS8A 3FO9A 1MRCL 1TDQA 3BLBA 3V6BR 3QHTC 4PJHE 1F11A 3MAWA 3PWNA 4QTIL 1M7XA 1W2KT 4JM2C 2X4NB 3QQ4B 3MV8D 4HG4K 1O7VA 5C0AD 1MFCH 4L0PB 1Z6JT 1AZZC 1MVUA 2XZAL 5ITBL 1JPFA 2EYTB 1KZYA 1NCCL 4QAWA 3WN6A 1C12B 1ECZA 3TN0A 2K78A 3BD5A 1AS6A 4ZMYA 4FHJA 4A2LA 4ELDA 5CWSA 1BQ5A 1WBYB 1L5GB 4HJEA 1MNNA 4AENA 3L3IB 4JN1L 5LXVA 3O3EA 5C0DA 2D03H 4EUPH 4KTGA 4NQCB 4IJTA 3QUXC 2X4SB 3GKWH 3KYMB 5JYMA 3I85A 1GS6X 1QR1A 4D0CB 2AFNA 4BGLA 1UVQA 2F53E 3OMNB 4JPVH 2Y1VA 4D8OA 1K85A 5E8PA 4DKDC 4A7GF 1F2QA 2WIIB 1AQ8A 1KXVC 1A3RL 1CXFA 1UWFA 4ODHL 1UT9A 4J1UA 2OYLA 3GC3A 4D9RD 2ZP0T 1MVFA 5A6MA 3X13B 3VRLF 1JPEA 1UM6L 4AMKH 4EMZA 1FO0L 4LCCA 1T1ZB 1JUFA 4YLCA 3VSVA 3EG9A 4JO2L 4HUMB 2XWDA 1CBVH 1UYWL 1JAEA 2QJDA 4M62L 3V0JA 1HIMH 3EDDA 3MRBA 3RY5A 2CO3A 1AQDA 1U95A 3MHZA 5KTEH 3U0WH 4ZXBC 3VWKA 1WCQA 1UWXK 5E1GA 1A6TB 1TEYA 1CTMA 2GTZA 3JWDC 5D96B 4QO1B 4ZFOL 1NCHA 5BO1L 3V4PA 2Y6TE 1MQKH 2Q3AA 2NW2B 2RMNA 2XIDA 5D7IB 4PEEA 3IJHB 3AREB 4XOCA 3GJEA 4N25A 3PAUA 3E38A 5ACZB 1V7ML 4IHBA 4N2HA 5E9DE 5EU4A 4I2XB 3MLUL 4Z23A 5JIIA 4JFFD 4YPJA 5SWSD 3RIKA 5FK9B 1JZ4A 2VSDA 1IM3D 3IDNA 2NNFA 5KSBE 1RUPL 4K3HA 3I6SA 4WI4A 5KW9L 2WCPA 1UCBL 3R06A 4FXLA 1NGYA 4UT9H 4OLEA 3E2HC 4B9PA 2A38A 1NAML 1SYSA 2LU4A 4YK4C 2AABL 3COOA 4UM8A 2CKNA 1YEFL 5KVDH 2H32A 1GOGA 1SPDA 2NQCA 4FP8L 3TVMB 1HEZA 1ZGLM 3ZRCC 1ZTMA 1CVSC 5C0BB 1WCBB 4IK6A 3MV9A 2DMHA 4LVNB 3IJSA 3KBFA 5D7KD 4C4KT 3RFRA 3VQMA 3CC5A 3UROR 4RZKA 4HS8H 1N0LA 2YEZA 3FW6A 1HCYA 4JB9H 3TV3L 4EKXA 1AXTL 2BVEA 1BIIB 1ZIAA 4JPIB 3OKNA 4GW4A 4Z6AT 5FKPB 2MH4A 2ZUSA 4TTGA 3ZJAA 3V9EA 3QEHB 4YIQA 5GS1A 5IBUB 2R2EA 5CSGA 3QS2A 3P4NB 4I5BB 3KNBA 4JQVC 4NQDD 5TE4H 4G8EB 4XC1H 1KBGH 4MAYB 1II4E 4R7NB 3KJ4B 4JZOB 4LLAA 1EFXB 3U1SL 1PJWA 1AKJB 1INQA 3FPXA 3ETBF 2CJUL 5K9JL 2WLHA 3O0RH 1EZUA 3BAEH 1QPPA 4PRHE 2OR9L 3BT0A 1BYOA 4P8QA 1WTGT 1I7TB 3D9AL 3D09A 3OF6A 4P9ML 1N59B 1MG3C 1KNOB 4WW1B 2R0LH 1JTPA 4N86A 2CA3A 3X11A 1PS3A 4LESA 4MNHB 2R1XB 3GHPA 3QFGA 5LAXA 2AK4B 4LLQA 3MNVB 1KYFA 3KXFE 4M29A 1KBVA 5EU3A 4CSZA 2QLYA 4MNGB 2I27N 4XPFH 2F5AH 1TITA 3B9KB 4PVNA 1OTSC 2N56A 2VLJE 5H8DA 2R1YB 3DUUB 1TG8A 4J6RL 5EIVA 4N0YH