1WA1X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 94
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X02
2BZCA 1KYAA 2FJSA 3AY2A 6PCYA 4E9QA 5I5IA 4DP7X 3EH5B 4L0PB 1SDDB 5I5MA 2YARA 2DV6A 2OCCB 2YAMA 4A66A 4Q89A 2VMJA 1QNIA 3PXLA 1KBWA 1XB6A 2B08A 2R7EA 2XV3A 4DPAX 4YSSA 3RYMA 2Q5BA 1T5KA 4HAKA 3EHBB 4YL4A 2ZOOA 4UAHA 2EIJB 1JVLA 2GB2A 1E5YA 2J56A 4YSQA 1KDJA 3U25A 3AG2B 1GW0A 1NINA 3EH3B 4GY4A 4F7KA 2FWLB 3DKHA 4X4KA 5E9NA 3FSVA 3UAAA 2J5WA 2GI0A 3NP4A 3N2JA 1NIDA 1WA0X 3NJFA 4BWWA 4BXSV 1ASQA 1SHXA 1X9RA 1WS8A 2YQBA 3WKPA 3NJHA 2CUAA 3CDZB 2QPDB 3N55A 1SFHA 1RKRA 2YAHA 3CVDA 3NT0A 3NJKA 2GSMB 3WIAA 4AZUA 1TEGA 2PPFA 1HAWA 2I7OA 1CYWA 2QDWA 5I6LA 2BP0A 4TXVB 4K9JA 1ILSA 4NB7A 1L9TA 4A2DA 2HXAA 5D4HA 1GS8A 4ZK8A 5LDUA 4YSDA 2YAPA 2BW5A 2J55A 2OV0A 2IWEA 3FQ1A 1OCZB 1PAZA 3T6WA 1NPNA 2FTAA 3CVCA 1JXFA 3OMNB 1W6WA 3FU7B 1RZQA 2W8CA 3AW5A 3NYKA 3FYEB 1HFUA 3V9CA 1GR7A 1W6LA 4KO9A 1UATA 3H56A 5FC9A 1TU2A 2XVBA 3FPYA 1AS6A 4G7RB 5A7EA 2CALA 4WKXA 4FA7B 2XWZA 1OE1A 1GY1A 3EF4A 4DP8X 3AZUA 2YAOA 4HHWA 2PP8A 2XUWA 2JXMA 3FYIB 1ETJA 1NDTA 4YSUA 2ZONA 2DWSA 3S3CB 2QDVA 1JZIA 1MDAA 1JXDA 4EF3A 5I6KA 3T6VA 1JVOA 3HEIB 4M4RB 2FQFA 1J5DA 2GHZA 4M3HA 2LLNA 4YSEA 2BZ7A 1SDDA 2Q9OA 3QJVB 1WA2X 3BQVA 3PLYA 1OCOB 2AZUA 1I53A 4P5SA 3ZBMA 3WI9A 1TEFA 2IDQA 1PY0A 3QPKA 4E9XA 1X9UA 2WO2B 1WA1X 3WG7B 4GP5B 1NPJA 2BW4A 3CVBA 3SBPA 1ZDQA 2CCWA 1KGYE 1NTDA 1OV8A 1AG0A 1GS6X 4A2HA 1PF3A 4HCFA 2IDUA 2BP0B 5I5JA 2ZXWB 2XXGA 3NJJA 2TSBA 9PCYA 2Y69B 4E9WA 3OM3B 1NIEA 1XB8A 1AR1B 1ILUA 1BAWA 1SFDA 5B7FA 3MBWB 4WTQA 2HRGA 2IWFA 2PP7A 3FT0A 1BYOA 3TU6A 2PLTA 2WSDA 4BXVA 4YVNA 4A67A 2QT6A 1MG3C 1KV7A 1AQ8A 2X88A 8PAZA 4NERA 5AZUA 1AZBA 3QJSB 1AACA 2IDSA 1EZLA 2HX8A 4MFHA 4N8UA 3S3BB 5I28A 3C75A 3FS9A 3IE9A 4E9YA 4HCIA 1PCSA 3V9EA 4AKOA 5B7MA 1PZBA 3NSCA 1DZ0A 3T71A 1JERA 1BEXA 3X1NA 1M9WA 2J57A 1R1CA 3FSZA 4E9RA 4YSCA 1FWXA 1V54B 3DTUB 3ZDWA 2W88A 2XV0A 2XXFA 1YLBB 2EIKB 1CUOA 4NAJA 1NIFA 2NRDA 1CYXA 4HIPA 4G7QB 2VW4A 7PAZA 3G5WA 5I26A 1ASPA 3ABGA 5I6NA 2I85A 2R7EB 1GSKA 1QHQA 4PCYA 2BP8A 1AOZA 3T9WA 1HAUA 1SF3A 7PCYA 3NSFA 4HALA 2QPEB 3NSDA 4UANA 3PAUA 2GIMA 5I6OA 2IDFA 1MZYA 2GC7C 4DP1X 1PZAA 3TA4D 1PMYA 1URIA 3FU8A 5B1BB 2XV2A 2AZAA 1BQ5A 1L9QA 1JZEA 1L9RA 3IBOA 3S8FB 3CG8A 3MX0B 1IUZA 1BXAA 3L45A 1KCWA 6PAZA 1N68A 4G7SB 3OD3A 2CAKA 3NJNA 2IH9A 4YVUA 4BK5C 4E9SA 1ID2A 3QJQB 1N70A 1VLXA 1V55B 4RH4A 5F7BA 3SQRA 1BYPA 2XU9A 1ZIAA 4E9TA 1E30A 3AG4B 1CURA 2HX7A 1QLEB 4BDVA 1PNCA 2UX7A 1ET8A 5I6MA 1NWPA 3H4HA 3AG3B 2EINB 5EHFA 1PLAA 1ET7A 3NJMA 4YSTA 1XB3A 4G72B 3GYRA 3BVDB 3NSYA 4FAAB 2YAFA 1L9PA 2VN3A 1L9OA 3ASOB 2I7SA 2EILB 2A3TA 2FQGA 2RACA 4AX3A 4DP2X 1KBVA 1IBYA 4KNSA 1GYCA 1A65A 1XMEB 4CSPA 1ASOA 3KW7A 4UF7C 2CBPA 3T6ZA 2UXFA 3UABA 4DPBX 4DP5X 2FNWA 3EH4B 1JZJA 5D4JA 1A3ZA 2H47C 3S8GB 4DP0X 4G71B 4PAZA 3WKQA 2YXVA 4KO7A 2PP9A 2DYSB 1E5ZA 3FQYA 4KOCA 2WO3B 2BP8B 3UACA 1J9TA 4A68A 3CZUB 2BO0A 3TBCA 2P80D 2HRHA 2UXTA 3OQRA 2MTAA 3D12B 1IKOP 1J9QA 1EHKB 2EIMB 1GS7A 1ZIBA 2P80A 4GYBA 3FPXA 1AIZA 4KO6A 4AI7A 1RZPA 3FU9A 2VM3A 3PAVA 4W9ZA 4YSRA 1NIBA 3IEAA 1PLBA 2AANA 4G70B 3JTBA 2TSAA 4AKPA 1A4CA 1RCYA 1JZFA 3X1EA 5IY5B 2HLEB 2AVFA 1DYZA 2IWKA 2PPDA 2AFNA 1NZRA 2E86A 2FT7A 3DIVA 1SNRA 3H4FA 5ANHA 4F2EA 1MZZA 2PCFA 4QLWA 1J5CA 1AS8A 3JT2A 1GY2A 1V10A 1JZGA 3IN2A 4YSPA 1TKWA 3WNJA 4YSOA 5B1AB 1AANA 4DP9X 4GXFA 1AAJA 1M57B 2CJ3A 1E65A 4JHUA 3ASNB 2JKWA 4YSAA 1E67A 1OCRB 1SF5A 2VSMB 4HCGA 3ZX1A 3ABMB 1ADWA 5F7AA 3UAEA 3X1FA 4BDVB 3T6XA 3X1GA 2UXGA 1PLCA 3OMIB 3S3DB 2HX9A 1PNDA 1A8ZA 3X2QB 1AG6A 1ET5A 3SBRA 2H3XC 1OF0A 3NJGA 1AZRA 3SBQA 1AZNA 2BWDA 1NIAA 3AG1B 3CDZA 1ZV2A 1OOWA 2JFCA 4CSZA 3NJLA 1AZUA 4KO5A 3ABKB 1OE3A 2IAAC 5I6PA 2GC4C 5AKRA 2FQDA 2X87A 1BXUA 4W1TA 1KDIA 3X1BA 2Y1AA 2PPCA 4A2GA 5B1KA 3QQXA 1PZCA 4KNUA 3NP3A 2UX6A 1WS7A 2YXWA 4HZ1A 4KNTA 1SHWA 5PAZA 3ZIYA 1L9SA 2B3IA 3NJIA 5B1JA 3HB3B 2DWTA 5D4IA 2IH8A 2YAEA 2XYBA 2XLLA 1CC3A 2DY2A 2VSKB 5TK2A 2XX0A 3WNIA 4F2FA 1OE2A 5TK4A 1SJMA 3UGEA 2FT6A 4A2FA 1FA4A 1OCCB 2HZHA 4Q8BA 2YAQA 1IBZA 2ZWNA 4GP8B 3PPSA 2FT8A 1KCBA 3FSWA 1BQKA 1WAEA 1NWOA 2N0MA 2OJ1A 5B1JC 3FU7A 2GBAA 1BQRA 2PCYA 4GP4B 4DPCX 1JZHA 1ZDSA 2VM4A 2DYRB 1NICA 2BWIA 4BWTA 1J9SA 1JOIA 1AZCA 3QJTB 3FSAA 4ENZA 5B3SB 2VW7A 3KW8A 2PPAA 5B7EA 1A4AA 1J9RA 3PAZA 3QJUB 1JXGA 2H5UA 1B3IA 3UADA 3QJRB 2PPEA 3ERXA 1W8EA 3GXUB 1MG2C 2MRYA 1IC0A 2VW6A 3GDCA 4P5RA 1FFTB 4JHVA 4JKNA 4N4YB 1ZPUA 1AS7A 4HHGA 5PCYA 3PCYA 4BWUA 1BXVA 2FQEA 5AFAA 4DP4X 4QKTA 4E9VA 4KOBA 2IDTA 3ABLB 4A2EA 3IN0A 3TASA 4AKQA 1M56B 1A4BA 2UXVA 1F56A 3FQ2A 2XX1A 3TBBA 4DP6X 2BHFA 3OMAB
chains in the Genus database with same CATH superfamily
1KYAA 3OLGA 2R9HD 3DX7A 3FT4B 4NI3A 3V8OA 1S6NA 4OM1L 5E7FA 2ADFH 4YHOL 4QHLA 3OKEB 4FQJH 3MRMA 1JHTA 4QYAA 4TLSA 4Y7OC 3RWDA 4DGYL 1FZOB 4IHBA 4RFOL 3AVEA 2BOCB 3L9BA 4MXQD 1QFWH 2BJML 3VFSA 5J5EA 2AXFB 3U6RB 4I0KA 3WFHB 3GO1L 4BUHA 5CCJA 4M62H 3OAUL 1OAZL 3B8SA 3CH8A 3MRMB 2E5EA 2Z93A 2VLKE 3KPRD 4L0ZA 4IIQB 4PJ9A 4KDVA 5EOCH 4HKZB 1SLVA 3M1OA 4OZFA 5EPMB 3V0AC 1KXVA 5K9KB 4I2XB 1JP5A 3VH8G 4F7KA 2HFEA 1BQUA 2NY5L 5TQ0L 1QI5A 3FCBA 3O6LL 3VD3A 1AOHA 1TDQA 3I6LE 4PR5A 3D52A 5T1LB 4LPCA 1MCOH 1Q9KB 1XZ0A 2B1AH 3D33A 4NUQA 4XXDA 4HHAB 4Y88A 5DJZA 1W72B 3SDAA 3D7PA 4BXSV 1S5IH 3G6JE 3L7EB 2F54E 1H15B 1LO4H 1G9MC 4GO9A 1C5DB 4QRAA 3QXVA 4N0YL 4TN9A 2YN5A 5IF0B 1A7QL 5KVDH 4MA1B 4NM4H 5F3HA 3C2AL 4J8RA 1ED3B 3GJFA 3MA7B 3B9KB 2YRZA 4PP1C 25C8L 1XSKA 3L1EA 4QXTA 3MNZB 2F1EA 2YAPA 1FE8H 1FC2D 1HXKA 3RZCB 2R2CA 2RGSA 3T6WA 4J3XA 2HTKD 3GHBH 1KYUA 1E9OA 4KDTA 2Q7NA 4IGBB 4DKEL 4XNMB 3LIUA 2CO7A 1WHPA 5KW9H 4TUKL 4MCMA 4QHKJ 1ORQA 3TPUA 5BRQA 1W6LA 4WU7A 4K3DL 5B8CA 4DH2A 2I07A 2X40A 3FW6A 5TGBB 3QNZA 4N87A 1CF8H 2XWZA 3PNWA 5LXVA 4C83B 1E6JL 2D2OA 1NFIB 4Y4KC 3U2IA 4BZ2A 4HWZB 1U8HB 4HKXB 2XWTB 3WO3B 4UT9H 3KYMB 2YAOA 4D7PA 4P9HL 2CK2A 3S37X 1CT8B 2H2PC 4CVXA 4P2RA 4CVXB 3TYGH 1OSEA 2Y5TA 2HN7B 4O5LL 2QDVA 1Z0NA 3UPRA 4PS7A 1LHZA 4LKXA 3SE9L 1QYGH 2QKIB 4JFDD 4C83A 2WXKA 4RMBA 4QRSB 3SD2A 1D7DA 3LHAA 3JUZA 3RX7A 1TJGH 2ENPA 2OSXA 4R0LA 1J88A 4CADA 3T2OA 1YNTB 3EH1A 4BINA 4C56B 1TYEB 2VXSL 2VITB 2IDQA 5ICUA 4YFLI 1GHFH 4OQTA 1VFUA 5HGDA 2AXGA 1NPJA 2YMTA 2IO5A 2MH4A 2XG4A 4JPIB 1WVZA 5DRWB 3C6EA 4NJ9L 3SGKC 4OQTH 3CU7A 1YEWA 3VXNB 5IHUL 15C8L 3IFPB 4PJIB 4JFZH 4JFEA 4K73A 3BKJH 2BHYA 4X5WA 3AQXA 3DIDA 1AR1B 3ETSA 4NN6C 4WNQB 3MV7B 4DK6A 2DN7A 1S9KC 3MLTB 4YHZL 4MAYA 1OARH 3UGXA 3RURA 4KH9A 1A3RH 2ZYSA 1LQBC 4LQFL 4AYMC 4BXVA 4A67A 3WFBH 4EQ2A 4L1SA 3HE7B 4HJ0D 4MFHA 1RUPL 3TBVB 3O8XA 4M6OL 1M6OB 3QRLA 1AGBA 2R2HB 4MCZA 1KT2A 3T2QA 1VADB 3MBEC 1MW3A 4FA8A 5D7JD 4FA6A 3IDYC 4I0CC 3L3HA 5F72S 2EKSB 3GMOB 4HHAA 2PTTA 3MBEB 1MCWW 2R29L 3T8MA 4JY6B 1N64H 2WXFA 4NQCD 3G3LA 1I1FA 1RUQL 4GRLD 4A7GF 4PU2A 1ERNA 1EHNA 2Q2LA 1DZBA 5IMLA 3NA9H 4G5ZH 4M1CC 4FG6D 5A2FA 5ACMA 3DUHA 2VR4A 3GS4A 3LS4H 4NQDA 1MF2H 2QLYA 1FFNB 4WUUA 2C9PA 3VD5A 2A83A 3QEGH 1P4IH 3QS2A 4K9EL 1ASPA 2JK5B 1O9VA 2XQYA 3LNEA 1KCSH 4JFFD 2XI9A 3RWFA 4DFIA 4PGDB 4QTHA 5FEBA 5GSRB 4HLZG 5IJDC 2RFXB 2QPEB 1RJLB 5HTSA 1N7MH 3K91A 1A2YA 1PD1A 2FUQA 4R3SA 1JNLL 5JXAH 2F6AA 2GK2A 1A14H 1KJVB 2C9QA 3FB6A 4RBPK 4ZX5A 5GZOC 3SCMB 3ECBA 2PETA 2OA9A 3IFOA 1FCGA 4PGCB 4E41A 4PGDA 4QTHB 2Z31B 3O3BA 1UWEH 3KGSA 1C08A 4UUJB 5TFSL 3ROLB 3SGKA 4DFHA 3GRGA 5KVFE 3T4AA 3VG0H 2WMPA 4L4TA 1JPFA 1KCWA 5C9JA 3S8FB 1J1PH 4ODVH 2ADIB 4EN2A 1QBLH 4DN3H 1UOKA 2ED6A 3ILPA 5L0QB 1MVUB 3ULUD 3WE6B 3TBSB 2CAKA 3RWEB 2YK1H 3T3ME 3QUMB 1ZVYA 4ODUB 1EDHA 4F9LA 3BN9D 3Q2VA 4NDMB 3GMMB 1A7OL 3WD5L 3IGFA 4K23H 3KWXA 3MUHL 4B53A 5F9DC 5IVZB 5FYJU 5E8EB 5GJTH 2EZ0C 4ANVA 3VWKC 2Q7AA 3ESUF 1R3LA 5K59F 1WISA 1JZ5A 2DEXX 2B77A 1SYSA 1HYSC 2R23B 2E7LC 1TJXA 3BLPX 2B59B 5G5DA 3TBWB 5JOPE 1U58A 4XNYL 4B95C 4RRPG 1NDGB 3JWOL 3HR6A 1XAUA 3D2UD 1T0MB 1INEL 4PRIB 1D6EB 4WK4B 4YLBA 1JDCA 4HH9B 4RFNC 4KRPB 4BHUI 2V7HA 5BO1L 5KYWB 4KNSA 1CE1L 1TETL 2IG2H 2XG4B 1W15A 4JJHA 4UQ9A 3KW7A 5JW4N 3P11H 3RWIA 5J13C 1A9VA 3DHUA 2CLRA 2HJFB 3BPOB 5TE6H 4ZNEE 1CFSA 4QEGA 3KWVA 2NXYC 1ACCA 3GINA 2BFVL 1TTGA 4F7TA 1NSNL 3D2TA 4M7ZB 3OPUA 5CAYB 5H4ZA 1UTDA 4YDIH 1HCVA 3A4FA 1TJMA 1TF4A 2BP8B 3MFFA 1C5CL 3PWPA 2COQA 2O5XH 3AXLA 4AQOA 2OTUA 3MV9D 2X7LB 4JRYD 5I74B 4OLZL 1A7PL 1G1YA 4GYBA 3FPXA 3RWGB 1A3LL 1UM5H 2BP5M 1YYCA 5E2VL 5I8OL 3VFVB 4IRJB 5C0JB 2XA8H 5IK3B 1PEWA 4F2MB 1JD9A 1NIBA 3KBEA 2DWEB 4G9DB 1ZY9A 4X5XB 2VLKB 5LBSA 1TQSA 4D2NA 5CP3A 1MH5A 3LKQA 3GLZA 1OK0A 4JBSA 3D3VE 4PW4A 5DJ6A 4F3FB 4HIHA 4QT5A 3MLWH 4MA8H 4MVBD 4IHOB 2X6BA 4G43A 2WLIB 3NEXA 1BZEA 1NBQA 1NOAA 2YD3A 3ZTJH 4OAWA 5DFTA 3K6SB 3HN5A 4MMXB 4DZ8A 1GTNA 3V0WL 2WYHA 5C0DA 5AYUL 4XN9A 3O2VH 3WHE1 1A7RL 1U21A 2GSGB 3GMRB 4PQXA 3WKML 4L05A 4HJJL 2DB8A 1BG1A 1UXWA 2WBWB 1EX0A 3SZ6A 5D7IE 4ZI8A 3RDTD 2PNDA 3AU1A 3SKUD 3JYBA 4ZUSA 4D7BA 5EG6C 3HE6B 4G9FA 1IFGA 2EC9T 3QZWG 3NTCH 2BWDA 2XTJB 3AG1B 4Q4EA 3QZWB 5IHUH 4B41A 3KZ8A 5C9JB 1CK0H 3CFBB 4IW4C 2P5WD 2W07B 4OV6F 4RX4A 1AH1A 5DHDA 1KPUA 4MYWB 4JFED 3SQBB 2Y36L 4FULA 4QJ5B 2CKBB 3FB7B 3FB7A 2Z31D 4FHBD 1IKFH 3CC1A 3QIBC 2I9LA 1T1YB 3I02B 2Y1AA 2EIZA 3W2DH 2XQBH 3D0AA 5EUOE 2P5EE 3WDJA 5I76A 3H54A 4NQEB 3BVVA 2G4GA 4BA8A 1AGEA 4WSGA 4F8LA 2GI7A 1OQOA 1RURH 2B3IA 1UB5A 2X6MA 2KC0A 1A6WH 2K78A 2Y1VA 3GSNH 3QNFA 4K7PY 3WNLA 1EHLH 1P7QB 2HAZA 2QADD 2WC7A 5TQ2L 1XEDA 3IYLW 4X98A 4LGPB 1EIBA 2VNCA 1DQKA 4ZTOL 4JM2C 4Q8BA 4LIQL 3VFSB 2BHUA 2VDLB 1OD9A 1YY9D 1UB5B 2EO7A 2NY3C 1L5GA 2WQAA 1G9HA 4HJ1A 4MZ2A 1P6FA 4PY8J 2WQRA 2ZX5A 3DXAD 4PJ9C 2CH8A 3Q05A 3NZ8B 1FG2A 3BN3B 1A7QH 4LZKA 3I75B 3LXUX 1RK0B 3GBML 4NJAL 3OTTA 5C7XL 3EDFA 4W68A 1A4JA 3MRJA 1FSKC 3ARXA 2K4AA 4OM1H 4C55A 4E5XB 1AFVL 3KW8A 3MRIA 1BD2A 1T0PB 4XPTL 1SN0A 1XCXA 4IOSD 5SX4H 3WMSA 5L7XL 1T4WA 4HK3N 4QF1B 3LEYH 2RQEA 5EZIL 3EBGA 3EIFA 4ZNCD 4YXKH 1KF9B 3PQYD 2VW6A 1ECZA 4U2ZA 3EJPA 4E41D 3K2UL 1MHHA 2VAAB 4R3SB 5ITBL 5J1TC 2BERA 4E9VA 2IDTA 4YHZH 4NWTL 5BVJA 3QULB 4HS6B 4DGUA 3FOMA 1EEZA 2X4QA 4MLIA 3WXVL 2BHFA 1WZLA 4Y2LA 4PUBL 5IKCB 4ZXBD 2EEFA 4EDXA 2HT2C 4AMKL 3TVMB 3MJ7A 4XO5A 1P53A 2VR5A 4ZUUA 1DBJL 2FX9L 5DD0L 5ADPH 1I7ZB 4U6HA 3AWGA 2GVYA 1VKXB 3S3JA 2R1XA 4AYDC 3WIIL 2ZUWA 2CO1A 5DZOA 1NDGA 5K9OA 4UAHA 4CVZB 5HVFB 3BZFB 3U46B 2GB2A 5BOJA 3RX5A 5FM8A 1FBIH 1CDBA 1NMCB 3AG2B 1CDJA 3MLUL 4LSDA 5E9NA 5GGVL 3U0PB 4OZHA 3K5SA 1SJVA 2IANB 1UFGA 4XAKE 5D1QB 3P9MB 1AVAA 1KPUB 2XFGB 4JHZA 3VI4B 1AXTL 1B6UA 1DUYA 2NLJA 5AZEH 2IV8A 4MB4A 4LLAA 5IMOB 4JZJA 3K46A 2WQWA 4YZFF 4XVSH 1RSYA 4H25B 1MJJB 4U0QB 3PP3H 3MGTA 2WINB 3MV01 3NH7L 2PPFA 3LN4A 4NJAH 4M4PA 5AVQB 1CFSB 2ZUSA 1DSFH 3OB0K 5HHOD 3ATFA 1BPVA 1NANI 1DN0A 1B0IA 1CG9A 3V4VA 4KRPC 3TN0A 5AZEL 4NC1E 1IQWH 4OD3L 3K4ZA 3IU3A 2P4AB 3VA2C 2JKTM 5D93C 1MCCA 5FYKH 3X12B 5EWIH 3UTPE 3X11B 3L6FB 2IAND 4FFZH 2A6KA 3BLKA 3N06B 3FKUS 3LV3B 3LPOA 2O5ZH 5IFJB 1I1CA 5HI5D 2IGFL 5C0RL 1T22B 2NY2B 2ARJA 3IGUA 5FM4A 2VDNB 3LH8A 5EU5A 5IEKB 3MUJA 5KVEL 2VISA 1NBVH 1VFOA 1THAA 4LHUG 4A7GA 2YJLA 2AJYH 1GZHA 1JZ8A 3P54A 4JFDE 3P3YA 4IBYA 4JEGB 5DZJA 5AVVB 2ESVD 2YC1A 3D1MC 3UCQA 4ODHL 4AYGA 4QRRD 1BJMA 1EAPB 4R96A 4OFPA 2A9BA 1ZOXA 4HIHB 4QT5B 3W3BA 4X6DA 3RVTC 4YXKL 5HDRA 2ITCB 1SBBA 1TZHA 1TZHB 2YOAA 4MDJA 2TRHA 1NDTA 3B1TA 5EEXA 3S0PA 4JZNB 4M9OA 5IG7A 2IGTA 7FABH 4K07A 2HMID 3EOAB 3GRWL 4OJFL 3RHWK 2EVIA 3V0JA 3B7SA 3O9WC 3NRQA 1T1XA 1KJMB 2GHZA 1UEYA 4N90E 3ZO9A 5DZVA 4X4YB 3HC3H 2A6IA 5AKVA 1XIWC 2AZUA 3FT3A 1I3RB 4MDIA 4ZOCA 4LSRH 5C6PB 5D70H 5JDSB 3ALXA 2H8PB 4YUEL 3CSPA 5T3ZH 5GSRA 3IGAB 1FNGA 2DM7A 4U6YA 4G9FB 1RK7A 4CN1A 3TC9A 1ZLSH 4IBQA 3TTSA 3FZUD 4ELKB 1IGML 5L2KB 4FNQA 5KZCD 1FGNL 2YFNA 2VB5A 1A1OA 3P73A 3U0TA 4FADA 1XB8A 5DRWA 5AOZA 1SUHA 2DIEA 1H3WM 3UXFA 4HP5A 3HAEB 1OAUL 3MCYA 5GS1A 2A73A 1IAMA 2B5IB 2ESVA 4A7QA 3HLAA 3BP5A 1K6QL 1IILE 4R7DA 4LCUA 4WW2B 2CA4A 5SWZA 1NUFA 2GTZB 3P2DA 2IDSA 2FO8A 4FXGB 2DM4A 1YYLL 2YLHA 4HSAC 1FORH 4P4KC 1SHSA 1P7HL 3AXHA 1IL1B 3ZQ9A 5CILH 2XPZA 4IIQA 1UJ3B 4JN2B 3HE7A 5I1JH 1KFAH 3MRRA 1OP3K 3HI6L 1NC2D 4EIUA 1QQDB 4NKIL 2OSLA 3LHPL 2G9HA 4BBWA 3DTUB 2C9VA 3GGWB 1LDSA 2F5AH 2XHNA 4HFUL 4N3TA 4X6DB 2XQ0A 4KTDL 4AV0A 4AEHL 5EC1B 4KI1A 3WL9A 5A3IC 4ABUA 2FJUB 3AT9A 2M8XA 7PAZA 1BX2A 2BNQE 5AB9A 2WTRA 5D9SB 5D2LE 2IALB 4IMKA 2ED9A 4ONHB 3WIFB 1ITCA 4XB3A 5ERWB 3ZQWA 4JN1H 1E9OB 1D2OA 4X7SH 1X7QA 1C12A 1CLVA 1F41A 3VFMB 3RKDD 2VRQA 5AW4B 5I16B 2IXQA 2WKOA 3ULSB 1BLNA 2GC7C 1PZAA 2BOLA 5IOPA 1ZJAA 1HESA 1Q1JL 3HG0A 1OB1B 3QFGA 1LMKA 3HS9A 5D5ME 4JM4L 4X6CE 1JV2B 1UWGH 3M6DA 3R0MA 3IDUA 1LO3L 3Q6GL 4MQSB 5HGHA 1PKQE 2XY1A 1H0DA 1J8SA 5K93A 1EJOL 1X5LA 3ZYIA 4B27A 4JQXC 2A77H 4M29A 3FRPB 3MACH 3M46A 5DD3H 4HKXA 4L8CA 1UH3A 2BSCA 2IH9A 3VVVA 2WXIA 3II2A 3BRDA 2XCMC 4GRWE 4J39A 4JPSA 1GGYA 3QFDA 4I3RH 2EXTA 4AY0A 1V55B 5F7BA 5IW1B 4KX9A 4DEWA 4HPHA 2XN0A 3PWJA 5DJAB 1DVTA 4XVJL 3AG4B 5T1JA 2HX7A 3IMVA 1MNUH 2V33A 4PJBE 4HJEA 2JJTC 3NIFE 1PD6A 1PS3A 2VDQL 4H8VA 2ATKB 1HHHA 5CD5C 5EHFA 4Y4FB 3K71A 2NY2C 3MRDB 4Q0XL 2DQHH 1TTBA 5EU6D 5C0AD 4ZD3H 2OMTA 4JL2A 3GYRA 5AUMA 2YOCA 3RVWC 1QBAA 2AEQL 3HI5L 1JXJA 1KGJA 3VXRB 2VN3A 4WUKH 2ICWA 1L9OA 3B43A 2CGRL 1LD9B 2VDLH 3C60C 3GM8A 3KD4A 1P4UA 3D34A 3O41B 2N0KA 4FQHB 3QAQA 4N2AA 5CMAA 4BFEA 1Y6KR 2WWKO 4QRQA 5DQDH 1U0QA 3F7KA 1ZV9A 1USQA 5C0CB 2J88L 4Y5XB 3HRZA 4D0CB 3MA7A 3NIGB 4Y2NA 2R69H 4KWUA 1D5IL 3ZUCA 3P73B 3QUZD 3SE4C 1OW0C 3JTSB 4HKJB 4JDVB 5KYNA 5IF0A 3APNA 5FYJH 1J8HE 3HS0C 1MJJA 3VXOA 2DYSB 1E5ZA 3U4BH 3HI1A 3QVAA 3QHTC 3TBCA 3ZSSA 1TPXC 1U33A 2NNCA 2UXTA 1CFNA 2YPVL 5JHMA 2Z9TA 1NMBH 1GS7A 1ZIBA 2WD0A 2BVOA 3MGAA 4D0BB 5D2NA 5F1NA 4JQVC 1HH9A 2VXQA 3WS6C 1CBVH 1ZA3B 1UZ8A 1ZVSB 2BY1A 1GGTA 4IU3A 3GSOB 4ONFH 1OCWH 4P8QA 2H26A 5IR1A 4DHLA 1XXDC 5IROA 1DHKA 3FQNB 3O6FB 3V4LA 5F97E 3TPUB 2EKSA 2F58H 1H3XA 2BZDA 1YMMD 2G60L 3QGVA 5D7LA 5C08E 5BV7B 1HQ4A 3IN2A 3MRQB 4XCEA 5D6CB 3DVFA 2DDQH 4PVLA 2Z91A 3NZUA 4FFYL 1PYWA 1SQMA 4HPYH 4Y4FA 4IDLA 4PRIE 5AVTB 3NGBC 5HPMA 3ORJA 3OHXB 2NY0C 2YJQA 3F01A 3FN9A 4ZMNA 1UH4A 3DPBB 2OYMA 4OGXL 2CHZA 4FNLL 2CZNA 1UWEL 3QIBA 5TFSH 1YNTF 4CU7A 4WU5B 4BQ8A 4O4YH 4AIXA 4G9FE 3FT9A 1E40A 2AEQH 2XBDA 1JTOA 3GXDA 1DQML 5L2KE 2JKJA 3FTWA 2ADIA 2CIIB 3OWEA 3BKCH 3QG7H 4I4WB 4FL4B 4WWKA 3KCWA 1LE5B 3TNMB 4NI6A 2IPUG 3HN3A 3QJXA 2DKSA 3D05A 2P43B 3RZWA 4HJGB 3CFMA 4RMRA 5TDPB 5I9QB 4YXLL 2K45A 1S5HB 3GB7A 3EADA 4I9XA 3H3PL 4WWKB 2LABA 5HYJA 1EJOH 4J3OH 2RH0A 5C0IA 5T3XL 2Q6WA 1DVXA 5E4EC 5PAZA 1KIUB 3VWJD 3IFNH 2CJSA 3EJZC 1ETA1 4N68A 4AIZA 2MCMA 2R4RL 2X9XA 4JFHE 1HZHL 2Q0ZX 3BZFA 1G1OA 3RFZA 1RIHL 3ARFD 3ZY7A 4WGWB 3DROA 4Y4FD 3O4OB 2PF6A 2X9WA 4U1SA 3ZHKA 2VH5H 4PTUA 2ZUUA 1N26A 4RCAA 2FJHA 3F58L 1CE1H 2IG2L 3K0WA 3SKJL 3J8F7 3QUHA 4B9FA 1T0MA 3HE7D 2F19L 4ALAL 3HHSB 4FFYH 3UO1L 1YRKA 4BE6A 4JDEB 3X3GL 1P4IL 2AS5M 4A63A 5I0WA 4JE0A 4XCNA 4MVBC 3MJ8B 2I5YH 1AHWB 5FYLL 1QSED 4L2LA 1VACB 5EFIB 4HIXL 5BCAA 1WK0A 3G5YB 3QJTB 5LAPA 4YOKA 1QRNA 4U0RC 1E4XH 2B7DT 4KRMB 3TEZA 4CBPA 1A4AA 4H5SA 1JS4A 5FW7A 2UVFA 1BVLB 3PG2A 1BVLA 5EBWA 1MLCA 3O3BB 3PWNA 3ERXA 4UUJA 2ZX8A 2P7TB 3GXUB 4JG0H 4EI5A 3M1BB 2X6CA 4DN4L 4GBXD 3KXFE 4GS7B 4N3UA 4F1SA 4G80A 4ODTH 1FCCA 4C56D 5IMMA 3R4RA 2ZZUT 4X6EB 5TE4L 1K6QH 1CF1A 2D31B 1EEYB 3NCBB 3GMPB 2XX1A 4QOKA 3IMTA 3QIWB 2FEDC 2RHEA 4DGYH 1MCQA 2HFFA 4KHTL 1R46A 1ACYH 3GMNB 3TCXA 1OGTB 4DVBB 3TCTA 2Z8SA 1HVXA 5E6IA 4XPAL 3T04D 1EERB 2V8MA 3LQZB 3NN8B 5I5MA 2DV6A 2V17H 4Q89A 4QNPF 1QNIA 1P1ZB 2FJFB 2CG9X 1NC2A 3OKDA 2XQYK 5AZ2H 1KBWA 3D8MA 4N1CA 5D5MB 4AIZB 2E8YA 3KCPA 2ZD0A 2FDBP 1HTYA 3QUXD 4FHKA 3U7YH 1CCZA 5E08H 1T0NB 3VFWB 4LSPL 4FNTA 1RUAL 2F53A 3Q9QA 3KPNB 1OGAE 2H4EA 2Z65C 5D1ZD 4PV9B 1QKZL 5JQ6L 3N40F 4O02H 5CUSL 5ID0B 1ZXKA 3ES6B 3R8QA 5AD0A 5JHLA 1F4WH 5HYQB 4G6AC 5C6WH 4KZ0A 2K7PA 1UQSB 1WA0X 4Y2DB 4WW1A 3DSFL 5JPMC 5FW6A 4RGMB 3QUYD 3ZL4H 1IE4A 1SFHA 3F3HA 4EE2A 4PRHD 5FWRA 1FPTL 5E6YA 1BZ7B 1M3IA 4BSVA 1PLGL 1BFTA 1A7NL 4W93A 3SQBA 3E8VA 3HZMB 3C5SB 2DMCA 3KBHE 5CCKL 2E4FA 2NOYA 2UUDH 3V4PH 5CJ8A 5D96B 1CFTA 1OXYA 4JFPB 5JNYA 1ZTXH 5ETUB 4O02A 1HWWA 1JFHA 4L3ED 5EBLA 3HZMA 3CXHK 5IHZA 4XI5D 5KVFL 5E24E 3OR6B 2QHRH 3P4MA 3PL6A 4JKMA 4YBHA 1RZQA 5DJXA 3BOVA 5LO7A 5C70A 4G43B 1QMUA 3BAYA 4HOWA 5CGTA 3VXRD 5CJQH 4JLRA 5BUAA 1A9EA 4M43H 5F44A 4BFGA 2VDPH 2EZ0D 4MJJA 3LD8B 1JZ4A 5FC9A 4TF4A 1TU2A 4HQQH 3WY1A 3ZXAC 1RIUH 2Q8BL 1I75A 4IEFA 1XR8B 2VMFA 4FZEL 4JHBA 3MXWL 1A1NA 1AY1H 2W59A 3HG1A 2I26N 3BGFB 1BJ1J 3MROA 4TNEA 5E0QA 4DWHA 5GSVA 4WHDA 1YAZA 5GGRY 4HMDA 2GUOA 2GIXA 2PP8A 1GGCL 4OQ1A 5DK3A 2VABA 4M8QA 5CWSB 5DFAA 5EBMB 3FH8A 3PWVB 4WFGD 5DVLA 4UT9L 5I6KA 3LH9A 4G8AC 1OGAB 4AL8L 3T6VA 3IKCB 4NQEE 1OPGH 5IB1B 5LBSL 2Q3XA 3TP4A 3PUCA 2Z7ZA 3VU1A 1EK3A 1F3JB 3EG9B 4UTAL 4MMZB 2ZCZA 4U3SA 3UTTD 3VXRE 4AG4L 4LLVB 5HPOA 5I16A 2DQGH 2NW2A 3D30A 3II3A 2X2YA 5E9DB 4FYTA 3GKZA 5GS1C 1XH3A 5HSFA 2BSEA 4ZX3A 3QDHA 3RPIB 2WO2B 1YA5A 1SVCP 3QYNA 4GW4A 4Z95L 5EORL 4BFIA 2EYTA 3QJZA 4HAFA 5HHOB 2VDPL 3VFOB 1JGUL 2ZKMX 2G9KA 5JZ7C 3IXAB 5IMKB 1TZ8A 5EZJA 4K2UL 4K5OA 3WY3A 4HG4J 4OD2B 2FD6H 1TMCB 4NZUL 3J2PA 4C4KT 2D3LA 3C2SA 4JFPA 4PN6A 4OH2A 5K59E 3EDDA 4E41E 5FO8B 5F7UA 3SDXA 4H4NA 5DGQA 4TSBH 1IGIL 2D73A 4QXWA 1FVEB 1MCJA 2ZXBA 2X3CA 4NM4L 1I3UA 1FN4A 1F02I 1KEML 3ZL1A 2OMZB 1YJDC 2C9SA 3K6IA 3SEPA 2OMTB 2Z4TA 5CNHA 4XHJD 3BP7B 3KLHC 2K4WA 3VVWA 4K15A 4HKZA 5F0MB 1C1EH 4P2QD 3TFBA 1BXXA 1D9KC 4MQXC 4V1DD 4JDEA 2F18A 5L0QC 3KH4A 4KI5C 2FEJA 3G5VB 3S48A 1XGYH 1FHGA 4XO8A 1YECL 1JIBA 3CZSA 1LE9A 1BZQK 3RAJL 1SBSH 1H8NA 5J12C 3S34H 3E9UA 2W88A 1GGCH 1OHQA 1QFOA 1JDDA 3AS0A 1PZSA 2XZCL 5IBTL 5HGBB 4KK5D 4UT7H 4YN3A 3STZA 1NFDF 4E2OA 1RLWA 3MCLL 3EW3B 3TO4C 2VIRA 5BPPA 4FERA 2VXUH 2IH3B 5CGYC 1N8ZA 3WIIH 2YPKB 4PCYA 1YMHB 3T1FA 1U8KB 2J8UF 1HX0A 1KACB 5DC2A 5IFJA 1T80A 4K94H 4PJHF 2VDKB 1X44A 4Z9KB 3LSOB 1MZYA 1T5WB 5DMJB 3AREC 4N2CA 3WKYA 3C5ZC 2FBJL 4RGMC 4EN3D 1CDHA 5F9OL 3T1FB 2PTVA 4LSSL 4Z7VF 2O6FA 2QQLL 5FS5A 1NCDH 1NGWA 4HIJA 5CGYD 1LTXA 3NG5A 4JFEE 1OO2A 3DHPA 4HJIA 3UIYA 1KYDA 2PTTB 3NJNA 1EZUA 3NH7H 2JI2A 5CINL 2DQIH 2XIBA 3DPDA 5GSVB 2YMXH 1ORSB 3CMGA 4BK5C 3IAQA 3PNWB 5IESH 3R19A 1S7WA 4YHYB 3TO2A 4NP4H 2W60B 1BYPA 4PB0H 5LGJA 5DHXB 2QSCL 2F15A 2P45B 3FUMA 2MOQA 1WFOA 4NPJA 3BSZA 5F21B 3UTZB 3UTZA 1B88A 5T3ZD 2NZIA 3L1OL 5HPMB 3U0PA 4N85A 1KB3A 4P2QB 1DQJA 5HYQA 4D0DA 1ET7A 4CU6A 1PY9A 1Y1UA 2QADB 3BKYL 4NUMA 5C0GA 1PIFA 4BFRA 1KJ3L 3P3RA 1NC4B 1QPPA 4AK2A 2WQUA 1DANU 3FUJA 4R2GD 4YWGL 3C8KA 1CVRA 4JFFA 1EQWA 5GZNA 4QXUL 4Q6KA 3LQMA 4AX3A 3D2UA 4NXSA 4O2CA 3TCLB 3VFOA 2VC2B 1XMEB 2ZXDA 1JZ2A 5AYUH 2DMBA 2AQ1A 2E3VA 3HB3C 2ZPKH 3U0TB 4G1EA 1QATA 1REIA 3EH4B 1GOGA 5AYQA 1KTLA 4LFHD 3UYPA 2H47C 3D69B 3DV6A 4G71B 2EIZB 5ID1A 4OFIA 4Y4HB 1VFBB 3GK8H 5C0BE 4R26H 4RMSA 4ELKA 3DOHA 4J2QA 2E7LA 2XVKA 3NFSH 3CFDB 3O3AB 4DUXA 4KROB 4JRYA 1VESA 1JV5A 1MJ7L 3IJEA 4PJBF 4WI8A 3BWUC 5AVWB 2AQTA 2J6EL 3DARA 5DT1L 5C09D 3B56A 5TH2B 4PY8I 3KYNB 5L4MA 3MV9E 2CA3A 4RISL 4ISVA 5F1IB 2D3JA 3UTTB 1UCBL 1TCMA 3I6KB 4KO6A 4DCQB 3BDBA 4OZIE 4K94L 3S35H 1KN4L 4GRMA 5KG9A 5K9KA 1NA8A 1KIPA 4H0HB 1EAPA 4R96B 2TSAA 4AQ1C 2WXPA 2G9HB 2CCLA 5FDWB 2NNAA 2JF1A 2JKNA 3X1EA 4APQC 1FH5H 1JGVH 2DQUH 2DLHA 2AFNA 2IWKA 4PW3A 4MB5A 5JHLH 4S0TD 5DHVH 4NX0A 4IS6B 1MZZA 3LPFA 1KCVH 3BKCL 4XCYA 3ULVC 4JQIA 2NYYD 4YDIL 2F54A 3LVEA 4WHYH 4QO1B 3SYAA 5HYJE 2YPLE 1WUZA 4YSOA 1BYNA 5F7DB 3K1DA 3JYCA 3TBTB 2H0FA 3GLAA 3L3DA 4FFWC 2CRIA 5SX4I 4F91B 3H9YA 5AVZB 4F57L 4AVIA 3UTSA 3MRKB 2CM5A 2WWOA 1JCVA 4H8PA 1A9BB 3GIZL 3L4TA 4AYBA 3R1GL 4YDLB 3NFNA 3VRJA 4ZFZA 3EJUA 4P2OC 2X89A 2IVFC 3SGEI 5L2KA 3KPQB 1E2WA 3PFUA 5SV3A 3HG4A 4AQEB 1EXHA 1M2OA 2BVQA 5KJRH 2DIBA 1ZHNB 3UYRL 1QVOA 2NT0A 1KPRA 1VSCA 4UBDD 5KYXA 3Q2CA 3ULUE 4L1HA 2X2UA 1C08B 1I8MA 2FHFA 5T3XH 2DWEA 5JPMB 4P3DA 1HILA 2P48B 1F5WA 1AZUA 3GKWL 4DESA 5L9DL 4YPJA 3LTVA 1PKQB 3ECBB 4JW3A 4OZIF 1MQ8A 5BVPH 1KDIA 4JPQA 2ICWJ 3TNMA 2Y36H 4MAYD 4DOHE 3LH2H 4L4VA 3FQXB 1IV8A 5GGSY 4KNUA 2WAQA 2DQTH 2F74A 2HN7A 2VCOA 4FQXB 4Z3TA 1N4XL 4LGSB 3RHWF 2O6EA 5C08A 3VG0L 5LGHL 4WK0B 4ZOAA 1AC6A 3HB3B 3ARVA 4MJ2A 5DFWH 5ISZD 1NL0H 4XVTL 1ZLWH 1G7QA 2Y24A 3VXME 3BUDA 1PW3A 5DU7A 4AXWB 3RWCB 5H37H 3N9GL 1OSPH 5GS0C 4Z7NB 4I1PA 4E68A 5C0CA 1NEZG 3U36B 2BXYA 2E0PA 5ICYB 4BFKA 4GP8B 3DGGB 3PRZA 4RAUA 3EHBD 1ZGLM 3ME0B 2NY6B 2H2SC 5F89B 4EXKA 4PG9A 5B1JC 3QFJD 4GP4B 1WT5C 1NEZA 5DC4B 4OFQA 3WFCH 2OTWB 4XP4L 2DYRB 3CN1A 4PJ9D 3M8OH 3E0GA 5H35B 3BCFA 5FK9A 1BPLB 3OKYA 2JELH 4JM2D 2CPUA 1LK3L 5SX5H 3TN0B 2VW7A 3MOBL 3IDMA 3PAZA 4M56A 3QIWC 1LK2B 1B3IA 2AMUA 4PRPB 3MRIB 4Z78A 4H0GA 4X4XB 1I9RL 3L5WA 4X6FB 2AABH 4LRIC 4NM8L 2VSDA 3CGTA 4KAQL 4NZRH 4YDZA 3HMWH 4ZS7L 3W9EB 3W9EA 1YQVH 3US1A 4N4YB 4PS4H 1BLNB 2ADYA 5D72H 1MLCB 3PWNB 1RERA 3GBNL 2FQEA 1GOHA 2NY1C 1AKJA 1CB4A 4KOBA 3AXLB 3V6ZB 1KJ2B 1TQCB 3THMH 1MXDA 3UX9B 2FUTA 1HT6A 3QWRA 2OR8A 4D8OA 5CD5D 1QSEB 4J3SA 2XSKA 4UINH 5FYJD 1AO7B 4JRXA 3NVQA 4U4IA 3O3EB 3FHEA 1BBDL 3V4PB 1HXMA 3RBSA 4PIRF 3G04A 3WFCL 3B2VH 2WLIA 1BOYA 3EFFB 3HB3D 4XCEB 1GGIL 1W72H 2EE6A 3O2DA 3BKML 3BYTA 2H45A 2IQAA 3SJVE 1YHPA 3RYMA 1CIUA 4LVNC 3INUH 3TZVD 4ZZKA 1A66A 2GQHA 5JHBA 1A3RL 4PRBB 5FOBA 4GAJL 2CO6A 2VQUA 5AUMB 5FUZL 3CN4A 2IFFH 4AGQA 2ALAA 2R1WB 4KK8D 3OKOB 4X9BA 4AQZA 1BZDA 2WLLA 3TH3T 1E9PA 3LIZA 3O6KH 5DWUH 3KMDA 5IREA 3SY0A 4DJMA 1ULVA 1TJHL 3EJZD 2GI0A 3FB5A 4JFZL 2EECA 1B9KA 2X41A 4QRRE 5HYIA 1OSYA 4WFHE 3IU4L 4H8WC 4WCYL 3EJYD 3MV7D 4QUOA 5J06A 1KLGB 1AR1D 3NJHA 1EVTC 2DAVA 4S1RL 4Q9RL 1KBKA 4JRYB 1DL7L 1S7UA 3VRIA 3ATDA 1RUML 3O2DH 4XOAA 3QXDB 4BZ1H 3D69A 2DBLL 2AJZA 3L4YA 1LK2A 4J6IA 3MX0A 4PRPA 4OCSL 3DX3A 1T20A 1VERA 4QOKD 5L4JA 3ISYA 5EN2B 4UB0H 4FQXD 2X4SB 4GINA 4TUOA 2BW5A 2J55A 4JKLA 4BFJA 1JRHL 3FMGL 4P57B 5IEHB 5KW9L 3ZKXB 1WO2A 2R1YB 1QABA 4TLTA 1VEOA 1JXFA 3NFSL 2B4CC 5JXAL 1HL5A 3FU7B 4M8VA 5DZPA 4PRID 2L4OA 1Q0XL 4Y5VB 3PV6A 2EO1A 4X99B 5J1AA 2CHNA 3MRNB 1HFUA 1I8LC 4HIXH 1Q9KA 5DJZB 2F54D 2VLRD 1JHLH 2LR4A 4X9IA 4G7RB 1GZPA 2FAUA 2CHXA 5ISZE 2MCPH 5HYSB 4OZFB 5EPMA 2LT9A 1DQQB 1E8YA 1DQQA 3EUDA 3FU0A 1YMMB 2C1PA 4OZ4A 2H2SD 3SE6A 3UDWC 4DQAA 1YZZA 3IFLL 1OTUD 4LLMB 4XVUC 5DS8B 3WCYA 5DFVD 1IAOB 3VI3A 4OUOA 3O6FD 1T7ZA 3G08A 2QMJA 3ET9F 3LZLA 1ACZA 2W9LA 4A38A 4NFDA 4RDQF 4V1DA 2YD5A 5AAMA 4MNQA 43C9A 2P24A 1NGZA 4YE4H 4KI5F 2EIBA 2OTUB 1JZIA 1T21B 4H8WL 4LLDB 3ETBF 5T1KB 4JANA 4KQ0A 4IGBD 3C08H 1SJHB 4AW4A 1ETB1 4OZ4B 3OX8A 4XTRD 3CN3A 2OK0H 2QQKH 1JL8A 3F64A 1NFAA 1ODAA 5DZ9A 1S8DA 1OP4A 2AXJA 1BQHG 1OCOB 4P5SA 3ZBMA 1JUFA 1G6RL 1UGKA 5D8JH 3MACL 4A2MA 4FP8H 1PY0A 4BK8A 5LKNA 1WIPA 2CO7B 3D4ZA 1BAFL 1YC7A 2PO6D 3MNZA 3QUGA 4G3YL 2HA1A 4X5QA 3WO4C 5CJXA 1IT9L 4OF3A 4YXLH 3V4VB 3WY2A 4HV8A 3HRPA 4R4ND 4QHMA 3FRUB 5TPWL 2ENQA 2LFGA 2IDUA 3NJXA 2AK4A 4DIXA 3LZPA 3GHBL 2Y69B 1RD6A 1XF4A 4IOIA 3CX5J 4POZD 1PFOA 2GJ6D 2KDYA 3AWFA 3GMLB 5K5YA 1NCJA 4NZDA 1HHHB 1PJWA 1QA9B 3QH3B 1X5JA 2Q86B 4APXB 5GZOD 4ONOA 5CXPA 2QR0A 3B6SA 1NCNA 2V2XB 3TBWA 1RJYB 3L4WA 5CEZL 4PJFF 4TNGA 5IW1A 3CIAA 3MRHB 3KPRB 3SHSA 2AEOA 5INCA 4Y4HD 5A2AA 5INCB 4H2AA 4HT1H 2L7QA 5D7JB 3H42H 2ATKA 4KHXL 2Q2EB 1PX8A 3ATBA 3P0VL 5FUCC 2YD9A 3D6GA 4OZHB 5EULV 7FABL 4YHPA 1UENA 3MMEA 1J5OH 1I9IH 3HUJB 3TOPA 3N40P 4EN3B 5I1JL 2BDNL 3REWB 2C1PB 5LB1A 1PQZA 1XGYL 4EKXA 4WW2C 1Q0YL 3KPMA 5D6DA 2FWOB 3RZCC 4F8TA 4A1RA 1E6OH 4P46B 1NC4D 5IESL 1YNLL 2VWEE 4U1HA 5C09E 2YKKA 1PDKA 5JOFB 3TESA 3IVKB 3QXAB 4UOZA 4IMLB 2FYVA 2WXJA 3MLVL 5AOKA 4Z7QE 32C2A 3EH2A 1CL7L 5HGDB 4JDTH 4TNVF 1CICA 4OCNC 1KNOA 5DC0A 5ILTL 4O2EA 5AYTA 2PWDA 3DUUA 3D25A 3OR6A 3P4MB 4LSQH 3CX2A 2NPLX 1W80A 4MS6A 3ZHFA 3BC9A 3BQUD 1AQDB 3S37H 1AQDA 2O5ZL 5E6UB 3X12A 1C12B 3SKNA 3UEQA 2Q7YB 1NGPL 4AMKH 3A6BH 4NCC1 1FV1B 3MOBH 4AJVA 2K9UA 5DK2B 3TEWA 2MPAL 1OAJA 3OKLA 4L5FL 4HCRL 1CR9H 3AUVA 3PQYE 4CILA 1QBBA 4KKAC 3GPSA 1HHJB 1GYAA 4L1DA 5H8DA 3QIUD 4M61A 2G5RA 1WAAE 3OD3A 5KEZA 1AGCB 3LOWA 5JYMA 3QI9A 4WFEE 3VGEA 2XKNA 4NZJA 5I30L 3AJ7A 1QSFB 2IAMA 4L37A 2VLJA 3FQRA 1KT2B 4JM2F 4KMLB 4PJCA 5GZNC 2B9BA 3BPLB 2RQ8A 1S46A 3TF4A 1RVFH 2OW6A 1HSBB 4GO6B 4PJXB 4QRPA 4QRPB 5F71A 1MUJB 2FO4A 2IBZX 4U2YA 2B1AL 5F6IB 3UTSB 3PWJB 1SXCA 4GRWB 4BGDA 5D7EA 1V05A 4DZ8B 4BZ1A 3UBXA 3RP1A 4TSAH 3DXAE 3X17A 2Z0UA 1VGEH 2VMDA 2YLKA 3FU3A 3UMTA 6FABL 3W0WB 4ZG1A 1BEYH 2PR4H 3TJHD 3SDDA 5DEFA 3SJVB 2WWKT 2KKQA 4DZBB 4FNSA 3LZQA 4KPHH 4JFHD 2WYTA 4NLHA 5I1EL 3VW3L 1GYCA 3WGVB 5AQ0A 4ZAKC 5EB9A 4KQ4L 3AGWA 5IOPB 1Q4NX 4DGIH 3CPUA 1UG9A 1GMIA 2A38A 4DP5X 4G6KL 2VITA 1DBMH 4NZUH 5F8QC 4WLCA 1IAIL 2AI0H 2CBOA 3GSQA 1N3NA 1EO7A 3LDBB 3TEXA 2JTYA 1EEQA 2PP9A 4I18C 4IRSB 3VRLF 1DVQA 1NCBH 1WZAA 2BNQB 2HKFL 2H32B 1HOCB 3VX1A 4KU1A 3VXUD 1NOLA 4WJ5B 4A68A 2ZF8A 4XNXL 2KQMA 3CZUB 2NY4D 1Q9LA 3JWDC 1Q9LB 4N2DA 4PFEA 3OQRA 5DVPA 1ZA6B 2XACC 3TEUA 5JDJA 1GGBL 3KPLA 2EP6A 2UZPA 2EIMB 2YS4A 3HKZA 3II1A 4PJ7A 5IBLC 1PZUB 2X4UB 3FUKA 2O30A 3Q1EA 3QQ4B 1CU4L 3BWSA 1MIEL 1KB5A 4GIAA 2GCYB 2VN4A 2BIIA 3HN8A 4AGMA 5AW0B 4MJID 1I1AB 4OTXL 5EZIH 2CKBH 4M3KB 4V1DE 4YHPB 2Y07H 4MJ4A 3DVGA 2GUOB 3DSFH 5KYWA 1PAMA 2ICEC 3PWLB 5JIQA 1UUSA 5D1ZA 1AFVH 5CMAB 3JQOB 4FE9A 5I24A 4PP2B 5HVHC 4J3OF 3W11D 3CJJA 1J0KA 1SYVA 2EEXA 2LLLA 1M57B 5JOPD 5B4MD 3ZZLA 3ASNB 4NUGL 4OKDA 5DJ2B 2JKWA 1E67A 2HSIA 2HLAB 4RAUB 4HJJH 3PWLA 3CBJB 5E1HB 1ZS8B 2EXYC 3V6FB 3X1FA 4BDVB 3IM1A 2DEWX 3UG3A 3CN0A 2QZ5A 2VJXA 1PNDA 1RUKH 3X11A 4ABWA 5E8DL 4MDRA 5J3HC 4LBEA 1XF5B 3CZNA 4S10A 3I84A 5I1AA 4MMZC 4HWEL 3LQAC 1NCDL 2P7TA 4J27A 5CIPA 4Y2DD 1KIQB 3L3JA 3CHQA 1Z3GL 4WWOA 5HVWA 2YFOA 4KKQA 1GC1L 1KEGH 4WVRA 2MNWA 2C4FU 1U41A 2K1MA 2B16A 1P5VB 1OTSD 2AF2A 3JXAA 5BS0A 5EA0L 4N0CD 2C9RA 4I18A 3LEXB 1ZLSL 4AM0Q 4QTIH 4GUPA 1CLZL 3E6HA 3PDOA 5C07A 1J8HD 2GSIA 3HS0B 3NABL 4RGNB 3UIZA 5LXGL 4RFNB 2CDFA 4UT6H 5BQ7B 2R0ZH 5FGBA 4XNUL 4CVWA 1NAMH 4AW7A 2EDJA 2YA2A 2VQ1B 2XIDA 2H1XA 2VM9A 5KS9B 2Z4QB 1CC3A 2B4CL 1N9PA 1D5XA 3UP1A 1QBMH 3BPOC 1FFNA 4WUUB 3RVWD 3BP6B 1N67A 3O6KL 5DWUL 5TK4A 5FV1L 2XN9E 4N26A 3SDXF 2C1OB 2A4CA 1FFRA 3V6OA 4LPYA 2YAQA 2Y6SC 3Q01A 1G7JA 1ZK5A 2OULB 4JCWA 3X3GH 1D9KA 2Y2TA 1PYWB 1KCBA 3C8KB 2HTLD 5EU6E 3L17A 5HDOA 3F8UB 4KNQA 1BFOB 3V4UH 2VE6A 4HGKC 1UKTA 2LOEA 3EO9H 4Z7QF 5HHPB 5JLZA 3PWPE 3T77A 2XPGA 2SEBB 5C0AA 3EFDH 3C8HA 2UWEF 2VM4A 1GGBH 5ACZB 4N9OB 4RZKA 2QQQA 4C54A 2N7AA 4X6CA 3T0EC 1CFTB 4BK5A 3HNTH 4ZNEA 4P0DA 4PLKD 3GJFB 3ZHNA 4WO4A 4L1LA 4PJ5D 3MV8E 1IAIH 2AI0L 3PHSA 5DDHB 1AYOA 1ODUA 1UB6A 1MCIA 4ODUA 2MRYA 4JGJA 3QXWA 3GDCA 3NZHH 4ISVB 5F1IA 1FLTX 1P7KA 3IFPA 4QD2E 2YZ8A 4BE5A 1GJIA 5LVEA 3S5LB 4LPUA 2VXUL 2CXGA 3S3PA 4I8DA 3C12A 4NUJB 4B9JA 4PLKC 1BEYL 5I66A 2O5XL 3VXUA 3UYOD 3NDYE 4YNYA 4LVEA 3BGMB 5EU3B 2BZCA 1MCSA 5DJDA 5CHNA 1EMTL 5I1IL 5A3ID 2A83B 1KTCA 1L7TH 5LN4A 2OCCB 4OFYA 4GO8A 4P5KB 2XICA 4TTGA 4ZMLA 5JHDA 3Q0HA 1TQUA 2XV3A 2G3ZA 3TV8A 2F19H 4TPRH 4PV1C 3CSYA 1FUNA 4HAKA 2OXHA 3LKOB 3O0RH 2ZOOA 3FFOA 3CZFB 2D3VA 2EIJB 2R8SL 3L3KA 3UC2A 1YMMA 5K1NA 3I9AA 4ZSOB 1PZ5A 2X44D 2QADC 5IB2B 4FKKA 1AD0A 5ENWB 4MZ3A 3VB8A 1TT6A 4OZIB 3NP4A 4KH2A 4OLWH 4RNRB 4GKZA 3MCG1 3W39B 4NKMA 3T2PA 2F58L 1GYWA 1ASQA 4PRHA 1WS8A 2DEYX 4MSWB 5FGRA 4KQ3H 3VA6A 4FFVD 3FQ4A 2DQTL 2BVTA 1A6ZA 5FR3A 1MREH 1BREA 5JIHA 3H6AA 3OAWA 4C47A 4NENA 1T89C 3QIBD 1VFBA 4ZS6C 4JFEB 4UNTA 2JKSA 4PJDE 4K9JA 4NZRL 2XQYG 2HXAA 5EIIA 2C4XA 5EIIB 4ICXA 3WFBL 1QLFB 1Z0MA 5CM1A 5J12B 1SOQA 3BSZH 3R7QA 2PO6A 3S2CA 5IZ7A 1QR1A 2EUZA 1PAZA 4NLAA 4YLQT 3CVCA 4ZMAT 3PHAA 4PJAA 2WO4A 4AL8H 3VXRA 5K9QG 3NIDB 2IC2A 4HUXA 3N0PB 4LCWE 2F54B 4S0SD 3DJRA 4OT1H 2HVKB 1WTLA 2FH6A 3L54A 5F1OB 3H9HB 1INDH 1EFXB 1W72A 4R5TA 1CLCA 1MFCH 3D4GA 3P2TA 5E8EA 5I71B 1X5GA 3NJVA 4WNJA 1KTBA 5LCVA 1NFDE 1RV6X 1ZT1B 2WXGA 4J3OG 1XT5A 4QWWC 3DTDA 3R06B 1E2VA 5A7EA 2HT4D 4YLCA 2FWOA 2AXWA 3KPNA 2DWXA 1OLLA 3DUSB 2OTPA 1NBYA 1E9QA 1SM3L 1SPDA 5JW4R 2VLKD 2DWSA 3DX4A 3POCA 2IGLA 4KKAD 4M7KH 3STLB 4J1UA 2DLTA 5KYUB 4HIQA 4F33A 1HDMB 4AEIH 5E94A 5CEYB 3HMXH 4QR7A 3VQ2C 5J9PA 1IM9A 5IK3A 2XWDA 4ODBD 3BZ5A 5HDLA 2HB0A 4DK5A 4A6YB 4I89A 4WV1A 1SDDA 2GY5A 2VRKA 3PABA 1A4KA 1VPOH 1FNEA 4LHQB 3VAEA 4ACTA 3B5HA 3FB6B 3IMUA 4IBLT 4U1MA 3CD4A 3U4EA 1F4YL 1I9JH 1QSEA 4CJ1A 3JTTB 3N85H 1CICB 2O4EA 2W9DH 1SOSA 2CCWA 2PYFA 1QSZA 1JNHA 1WE5A 2AEPH 3BUBA 5KVGE 2CGYA 3E2HB 5T33H 2Z0BA 1OTTD 2VDOL 4G80B 4EI6A 5I75C 2N1KA 5IHLB 3M07A 2Z6FA 4QRTA 1RQ5A 5AVRB 5HHOE 3GK8L 1QACA 1QLFA 4M7LH 1ILUA 2IDCA 5CN1A 2JI1A 1BG9A 3OLEA 4U4BA 4N2EA 3L9RA 5E1QA 4Q74A 1ES0B 4R5VA 4QYOB 3GXMA 2X88A 3COOA 2OMWA 3FAWA 3PS6A 4NERA 8PAZA 5E03A 1NAKH 4WFFE 1J12A 2V2TB 3Q2LA 4N5ED 5L4FA 1U3NA 1SYSB 4YPGB 3ZKMD 1WD9A 3I6LD 3OF6A 1NEZB 1OGAA 5FA3B 4ZPTB 1C9SA 5I2IB 2WKGA 3DJTA 4OIIL 2F53E 5KBNC 1MUJA 1Q94A 3B3BA 4QYOA 3V95A 3OSVA 1B0WA 1T0NA 3FU6A 4XBEH 1U8MA 3VFWA 4CN4A 4E9RA 4YIQA 3H7BB 4KUZL 3Q13A 4PJEA 1G7JB 2OL3H 1MVYA 3L1OH 4WFED 1GGUA 4Y5YA 3JV0A 4PV9A 1MCHA 1YLBB 2GABA 1BBDH 3APFA 4K9EC 5D93B 1XVSA 3I3EA 5T33L 1Y0LA 3KM1A 2VLJE 1CD1B 2XJKA 2ZSVB 1TMQA 3NCEB 2ADGB 1WAAA 5I26A 3U1QA 1T3FB 5JW4Q 2ID5A 4Z8FH 4NP9A 1T5XB 4JVWA 3W1ZA 2PO6C 1M9SA 1X5YA 1H9DA 2BP8A 4DW2H 4O2FA 4G83A 1KEGL 4J3OD 1E50A 3CDCA 1WD8A 4MD0B 1MCPL 5D72L 4UANA 3SCMD 4AIOA 4OIBA 4FF9A 1CDCA 4TVPH 2ADGA 1RZJH 4D8PA 1YEIH 4Y19B 2XWJA 3TA4D 1NUGA 4O2EB 1MCEA 15C8H 1VGKA 4LSVL 2OP4L 2ZCLL 5E99L 2W95A 2X9ZA 4BQCA 1PY4A 1DJGA 1KJ2A 4M93B 4PS8A 2GITB 2H9GB 3NFPB 3HZVB 3RNKB 1FJ1B 4KTYA 3JBG7 6PAZA 3N43F 2PXYB 3PAYA 3DX2A 4KUCF 4PJ5E 2DQ6A 5GRXG 3TV3H 3I9IA 4FQCL 4GH7B 4OD1H 5BOPA 1IEBA 4XPBH 5EEUA 1YEKL 3MJ8A 1ZLVH 3CFJB 1FIGL 2Q10A 3QI9D 1DFBL 5JQHC 3LKRB 2A5UA 2NYYC 1DLFL 5D1QA 5A16B 2R69A 1QLEB 5E6SB 4UDTA 1ZS8A 4IBVA 1L5GB 2DDQL 2VR9A 3BD5A 1N6VA 1A6AB 2YZ1A 3JVGC 3BPNC 3CFJA 4MJ6B 4YSTA 3O6LH 4UNUA 2CO6B 1SYVB 3VXMA 1UT9A 2GK0A 3CZFA 3B7RL 3W9DA 1N8OE 2J4WL 2EILB 5KUMA 1LNUA 1JK9A 1SY6H 1TLKA 1WSST 2OS7A 4LKCB 5EOTA 4OKVA 5DD1L 2WBJA 2WUBL 3FRUA 3N3EA 4XNAA 3ROOB 1AZZC 1FFPA 3PXHA 2ROYA 4PTTA 2G2RB 4YC2B 1DDHA 2P5EA 2MFNA 4UF7C 4RQQA 4GW4B 2IPUK 1I8UA 1XF4B 3CXFA 4IOIB 4IKLA 1YPZF 1MRDL 2DM2A 5D4JA 3HBGA 1WJ3A 3S8GB 3DVNA 2VDKH 5IMKA 2EH8L 4QHMB 3TL5A 3FH7A 1QW9A 4FQ1L 4MJHA 4IRZH 4PREA 3Q8CA 1TZIB 3P1VA 3CXHJ 3N42F 3KNBB 3ULVL 3WNMA 4OU3A 1UZ6E 2MTPA 2MTAA 3P77A 4E9LA 3HHMA 3MREA 3GIVA 4JG1L 5F9JA 3AUWB 4FQLL 3KYMA 3S2AA 3QEHB 4HZLA 2MEJB 4HUMB 3IJHB 3NCXA 4LE8A 1R5VB 4WJKB 4M4RA 4Q4IA 4ZTPL 1ZLWK 3AGVA 1UWFA 1RI8A 5IFHL 3QPQD 3EAKA 1I7UB 4GRWF 4HIEA 2R2EA 3CUPA 1HJBC 4CVZA 1RZKC 4P5MA 4DT2A 1A4CA 1F58H 4EOWL 2HRLA 1U8MB 3FTSA 2X0UA 4MA7H 4UQ3A 5DR5H 5C07D 4MJIA 1N19A 2PPDA 2RB8A 3QEGL 5I8EA 4XPFH 4U6HB 3H9HA 2DQDL 3L8QA 5F7NC 1J5CA 4FD0A 1JGLL 3L48A 4YDNA 4AVHA 1UFUA 1BZOA 3MUGA 5GGSA 2FX7L 3SYOA 2GFBA 4XWGL 4BM7A 4TRPH 4LL1A 5JLZB 1QBML 5B1AB 5B39G 4LDOB 4KY1H 5C0GB 4F93B 1AAJA 2CHWA 2WP3T 1KLFA 4P06A 4N9GB 3QUMH 2JNZA 2CJUH 4WTXA 3D07A 2NZ9D 4FZ8H 4GI8A 3RWJB 5E8PB 2DLEA 3QW9A 2VL5B 1XBDA 3ZDYE 3BVNA 1OP5K 1CG9B 5FHAL 4PJAE 5E00B 3ILQC 2WCSA 4UT6A 1CD8A 1AGFA 1G7IB 3A6BL 3C5ZD 1AG6A 2UUDK 5KVFH 2FJGA 3M1BA 1HE8A 1S9VA 4MNHA 1XTMA 4UV4L 3VFGH 3MJ9H 43CAA 1NIAA 5ALCL 2NY4C 5C6TL 4JQXA 2YR3A 1J0ZA 3BWAA 1UWXK 4OCWH 4PJDA 5JIKA 1BOGB 4N90D 4IRJA 4AQAA 3P9LA 3RGBA 3GS0A 3V4PL 2FLMA 4AJYV 5C0JA 3TIEB 1D2PA 2NYZA 2R69L 3MYJA 3T2LA 1C5BH 5AKRA 2Q8AL 3VXUE 1I3GL 2DF3A 5I1LB 4YZWA 4OUUB 1E2ZA 2YQ2A 5EF0A 4A2GA 4NZTH 5B1KA 2JCCB 4XHQA 4ESKA 2F53B 2PWGA 5C3TA 2NTSP 2R0WL 4H40A 1MNNA 2ODIA 2DQFB 2R1XB 5AD0B 2YAEA 4P4KA 4IBWA 4AGOA 2B39A 3N04A 5I1IH 2YMOA 4LLYB 4ATTA 1UM6L 4L29A 1J0HA 4LEXL 1MFVA 3V52L 5E4AA 4EI0A 1T66C 3UGEA 4ZMWA 3EF7A 2DWYA 2F7PA 4XT1C 1DJYA 3TYGL 4B96A 2CBMA 3O4OC 4IDJH 2AJXL 1XGPB 3J27A 2DI7A 1WAEA 4IK6A 4CC0A 1BA9A 5F1KC 2QLVB 5BMFH 2DQIL 1KTDA 3KS0H 3I02A 2ZJSH 4HJGA 1Z5YD 1KB5H 3KS0J 4IIZA 4E5XG 3WUZA 4IOSA 3CVHL 4RX4D 1U8NB 2X28A 2WN3A 3Q8FA 4P2OB 2UZIH 5TF1L 2EDFA 4UAOC 3JV6A 3JV6B 3R7RA 5L6YL 1IU1A 5LWYL 4UV4H 3VFGL 5LG1A 3FUIA 2Z31A 2ZCKL 1FGVL 4KZDL 4KKRA 3SOBH 1AO7E 2Z1PA 2DYPB 3ARDD 5L88H 1K8DA 3QORD 3I6KA 1CGYA 4QLRA 1KXHA 4JKNA 4JHVA 4QHPA 1GJWA 3BAEL 3PGFL 4BWUA 3ARDA 3OKKB 3TONA 4L4TD 3MJ9A 3TA3B 1R17A 4ZQKB 3HFML 4QJ4B 3VW3H 2R2BB 3GSXB 5D7SH 3RVXD 1A4BA 1SDAB 3HFFA 2ZP0T 3Q06A 1WZ1L 4IRJC 4LQ1A 1EHAA 3QFJE 3VXPA 3SOBL 1P5UA 3Q1SH 5L88L 1OTSC 2NSXA 4JO8A 4H88H 2FJSA 3H53A 2A6DB 1CFVL 3BESR 4IBZA 5ICYA 1ZEAH 3E2HC 4GXUM 4L0PB 5GGTH 5SWQA 1LO4L 3DO4A 3SD5A 4QO1A 3UPCA 2VXQH 3RWCA 2QGBA 3EOBA 4DAGH 2PW1B 4DKTA 4DPAX 2XN9D 4PJAF 5FGCB 5CILL 3G6DH 4NQED 2HKHL 3SDDB 1D6EA 3NIDE 3NEOA 3MRRB 5DMIH 5C0NC 3L08A 4N2NA 1JPTH 2EYRB 1KXQA 2JLLA 4LCYB 1HWGB 1E5YA 1KELL 3E38A 4YSQA 5J6GB 3GO1H 5M7QA 4JZJC 1D5BA 4P4RB 4PHXA 1ND0A 4XI5C 4JG1H 2QVIA 4PJFB 4JR9H 1MQKH 4MX7B 4PJIE 4X4KA 3BUYA 2EC9U 4B0MM 2MQGA 2XTJD 2D7TH 4L5FH 1D6VL 4FKHA 3IE4A 2MSPA 4PJDB 4FG0A 1KB5L 4L8SC 2ZOUA 4GFXA 4GUPB 1KIQA 2QPDB 3L3JB 1WV7T 2GJ6B 4GQPH 5DHEA 5D7IF 5EDXA 5I1LA 1KYFA 2QBWA 1ZV5A 4H7VA 1XF1A 4KXBA 4ABQA 4YHNB 4JMNA 1U4FA 1A1OB 2BCKA 3P0YH 4R4NC 1LDPH 4NB7A 5I1EH 1LP9F 1S9WB 5MP6H 1K2DB 4GRWH 4XO9A 3WDIA 3GXNA 2WY3B 3QUML 4UT7L 2CRMA 5IQNA 1KC5H 1MFNA 5A2IH 4M7KL 3EKCA 2JJSC 5DHYB 1NPNA 1MHPH 2VLLB 4G6MH 4OF0A 1NSNH 3VNYA 1EFQA 2DJSA 2WPGA 2D2CC 2JB5H 4LLQA 3K6OA 5GGSB 5ACLA 3L7EA 1CGVA 3ELAT 2WBKA 3P9MA 4ELME 4HLZH 4QPEA 4FQPA 3UTSE 1NCAH 5DFVC 2XVBA 3N41F 5EU7C 2YHGA 1RZFL 3ALPA 4FXKB 3WLBA 3EXLA 3FCSB 1HKLH 4HEME 4W81A 2E6PA 3EF4A 4B9CA 2YRBA 3EYUL 3OZ9H 1JGDA 4NZ8A 2VC2L 1ZT1A 2AQ3A 4F9LC 4ODSH 1OGAD 1G4MA 5AW6B 5EO9B 4E36A 2YQ3A 2H1PL 3CH1A 3UBHA 1PSKH 3DO3A 1IM3D 5EUKB 1HNFA 1DBML 2ZOKA 4ZO9A 2DICA 3WN5B 1NDMB 1MW0A 1TYJA 3EYQD 4ZO8A 3FF7A 3SKNB 4AOFA 2IPKA 5MERB 5I17A 4XGZA 1A02N 4PJ7E 4X5LA 4ZPVA 4H0IA 1BOGA 2CM6A 4PBDA 3ZIMA 1IT9H 2E47A 3AROA 3D25B 3QPKA 3B2DC 4NIYE 1N5AB 5FUOH 5C9KA 3VQLA 2BW4A 4R90H 3MFGB 1H5BC 4PMFA 4A2HA 3QJHB 5J1SC 4PWHA 3QEQA 5GIRB 1JF6A 2A6KB 2YGQA 3QQ3A 3A0OA 4NBYB 3HOGA 2CNYA 4TUJA 3FCTA 2IBBA 3M8OL 2BSRA 1J9CT 4RMUA 3IB4A 4ZFGH 5IFAH 1JZDC 1SFDA 5B7FA 5C1MB 1IC7L 3KLQA 3MBWB 2P42B 3BAXA 3NESA 1D5IH 2HRGA 1VDGA 3MV9B 3TU6A 4HWBA 2QT6A 1MG3C 2Z91B 3KJ6L 4HT1L 5FO9B 1AQ8A 2CK0L 1FDLL 5DQ9B 4ELMA 1SGKA 4R0LB 3ESMA 4G11A 3L4ZA 4YK4C 1AHWA 3DRTB 2ZUVA 3LRMA 1ADQA 4XNYH 2MCAA 1B2YA 2QVFB 3WIHA 4D0DB 3LS4L 1PZBA 5CSGA 1U36A 1DZ0A 2WUBH 2XXCB 1MN4A 1TNMA 1OVZA 1VJSA 2BVYA 2CU9A 3WAKA 1QG3A 1OAXH 1U95B 1F4XH 2ZKWA 3G08B 4N8CH 4CDHA 5DMKA 1GSMA 3DK0A 3ES6A 3Q5YA 1FYTD 1PKOA 2R29H 4NNPH 5TQ2H 2KZWA 2YD8A 4ZUVA 3FT1A 4OF5A 2BSTA 2W91A 3TBSA 3HMXA 1EFXD 4I3RL 4HIPA 2Z8WC 2WK2A 4N8VB 1UGNA 5HHQA 5MI0B 3T3PB 2VW4A 3QG6A 3OC8A 4JRLA 1LQSR 1AP2A 4M5ZH 4JFTA 2ITEA 5KSUB 4X0KB 4NSKA 4D3CH 4G8GB 3GMPA 2EYTB 3QUXB 4LPWA 3T0EB 3VTAA 3T0EA 5HJ3A 2AJSH 4W6WB 1TLMA 5KBPA 2Z1KA 2BINA 2GIMA 5G55A 3U4BL 2F8XC 3D18B 5J8OA 1T1YA 4Y19D 4JG0L 4F9PA 1FO0H 2DMGA 2DYPA 3SPJA 4WENB 3KYOA 4AEIL 4GBXA 2R0KH 2D7NA 1S78D 2C9UA 5DTFB 4NRZA 1YN7A 1L9QA 1FZMA 3ARPA 4LDEB 1OAXL 1JYWA 2ORBL 1N68A 3BIBX 2F8IA 3NEEA 3TO4D 1EZVY 4LGRB 4XC3H 1H3UA 4Z18A 4KK5C 4K55A 5BZWB 4KVNH 3ZKNC 2Y25A 1RU9H 1FNHA 3FO9B 3R06A 2XWCA 3BW9A 5L4IA 4Z3GA 4PJ8C 1B4LA 1TU2B 4F8NA 1U30A 4BDVA 2A4ZA 1ET8A 1UYWH 2VH5L 4FJYA 3ZDYB 5EEYA 1OKEA 4C4KO 1KFAL 4RWYH 5ES4B 3FCUB 3MLWL 1WIUA 1CD0A 1SMAA 2VOTA 1YN6A 2WLYA 3KGRA 2EYRA 4L8BB 3H9SA 4MNQE 4BH7B 5C3LD 3DX6A 1LO2L 1JK8A 1FO0A 3MV8B 2VR8A 4CN6A 5B3JF 2CO3A 2RACA 3IJ8A 4MXQC 5IQ9B 4RRPA 2CBPA 3P4OB 4MAYC 4PGCA 2D0GA 3WSQL 3VD9A 2W38A 5E2TL 1PG7H 2RCSL 1JWSB 4CMHC 4M6ML 3WKQA 3J7HA 4TSCH 3S9DB 4KO7A 2IPTH 1F4HA 3F04A 1EDQA 1I9RH 1QD0A 4GKNB 4KUZH 3TIDA 3NCFB 4I5BB 5GGVY 2WO3B 2W65A 2K8MA 1J9TA 2X4TA 2C3VA 1QNZH 4UBDC 5DRZA 3UTTE 3SE8L 5FF6A 3SE4A 2I9TB 5FA4A 5CJOL 1SRDA 4KK9D 3ZZ1A 3ZSTA 4PREB 4P2RB 2UYLA 4WWKD 4JFYA 4ZQTA 3GEFA 4O4YL 3QEQD 4RFEA 4HA1A 3WKMH 2J1XA 5CR8A 4UDUB 2N59A 3IEAA 3M17B 4UOW0 5FW8A 2K8QA 4FXKA 1QNZL 4KJQD 3T4AC 4LARH 5HI3D 2WKOF 2OJEB 1CT8A 1NLDH 3QUXC 1IBFA 2E86A 1Q0XH 4JO2H 3OLDA 4NN7B 4JN2A 1U42A 1HN1A 3MOQA 3LQAH 1RIHH 2JB6A 2ODHA 4WFFD 5TDNB 4TKWA 2DQMA 1OZUA 4HC1H 3ZU8A 3FXIC 5E2TH 1M7XA 2X53A 3CLWA 4HZAA 3HG1E 1F4XL 1TG8A 3ILEA 4N8CL 2AEWA 5GJSH 1OY3B 3B2UC 4W4NA 1PGRB 3FO0L 3D3VA 4GEIA 1FI8C 4HCGA 3K81A 5AL8A 3QO0B 5ETUA 4RIRB 1NGQL 4L4JA 5F7AA 1S9XA 5F3BA 1RMFL 4WI2A 3RFRA 3QSKB 1E8WA 1RZ7L 4NYLB 3C5ZA 2VMCA 3LEVH 4TYUA 4OD2A 1KGCE 4HWBL 3IGLA 1EJ8A 4PLJC 1NOFA 3WN6A 2OYKA 4PGEB 1ZA3A 2PCFB 3LN4B 1JGIA 2D9QB 3MCKB 4K8RL 1F6AB 2HVJB 1HL9A 1DJSA 1OF0A 3FFCE 3K3QA 4QXTB 2BWQA 3T08A 4GJTB 2EDTA 3MLYL 4BQ6A 1IZJA 4U1KA 1SVZA 3QR2A 1COBA 5T1LD 1E5UI 4Y8AA 3K2MC 5C09B 3GXIA 1AJ7H 5DYOA 2PYED 2FATL 3MNVB 4N1HB 5D1XA 1GIGL 3NJLA 5DK0A 4WI6A 4KO5A 4PJ5A 5CP7A 3TIDB 4DCQA 5DJ0B 1M53A 2GAZA 4PJ7B 4MNGB 1RK0A 2I32A 4JO3H 3EO9L 3P3UA 5FF6B 2XA3A 2ZG1A 1NBCA 3VFUA 2XETA 2P1YA 4ZT1A 2O1AA 1INDL 2ETWA 4HBCL 4G8IA 1FNAA 1XGUA 4U7SA 1KG0B 2OXHB 4EVNA 3BP4A 1UXLA 2ITCA 2RA1A 4WZ9A 3I9GL 4YDJA 3SPIA 3ZTNL 1OSPL 1X6LA 4EZKA 1J10A 3VU2A 3OF6D 1IM3B 2ZXAA 1MDTA 2XX0A 5KUKA 3FHQA 3DX6B 2AJUH 1ZLDA 2ICEA 3NFNB 5GGTL 4PRBA 3V0FA 5FOBB 1YEJL 3JWDL 2GBUA 1IBDA 2JTDA 1TZGH 4JQIH 3SJVA 3PPSA 2X4OA 1CDGA 4JO1H 3HZYB 1NWOA 4HS6A 4Y4KD 4MMXC 1KLUB 1NC4A 3A23A 4Y16C 5FFOA 5FYJE 2YK1L 4LVNB 2YQGA 3V0IA 1FL3A 4WSKA 3S88L 3GJFH 1SOXA 1U92B 5H2BA 4I0PD 5JIMA 4HK0A 4OLXL 1V7MH 4UV7L 1PKQA 4FN0A 4UOJA 4AQ1B 5DLLA 1XH0A 2X4SA 4CC1A 2Q3AA 4ENZA 3QULA 1ZGLA 4LEEA 2PPAA 4ODXA 5DUMH 3ARGC 1S9WA 4OD3H 3UBFA 4AENA 2VXVH 1SLWA 5IUSA 5GS1B 2AJZB 3CVHH 3WIHL 1MG2C 1MFAL 2P8LB 1IC0A 5FCUH 2G5UA 4AQ1A 3ARBB 4CC4C 1FFTB 4U3XA 1UB6B 2NY4B 4WEUD 5CU5A 5KS9F 5MEOA 5JW5B 4KXAA 2KH2B 2VR6A 1H8LA 5LBSH 1DJZA 5D2LA 3NZ8A 1XF3B 3BH9B 2UXVA 1AXTH 1SEBB 2X0VA 1DVFA 3HC0A 1M05A 3OJDB 4ZXBA 1BVNT 2JJUA 1CGSH 4KDTC 2WUCL 1V8HA 2OMUB 4Z7UA 4Q97A 1LO0H 2A9NH 3EH5B 4U1SB 4XMWA 1FNSH 3BIKB 3BKYH 2J20A 2WTOA 4EUPG 5AEAA 3KE0A 1ROCA 4NO2A 3SJVD 1HQ4B 3MRQA 1J1XL 1CGTA 2YPKA 4QWWD 1CDIA 3ZL2A 4O2CB 3HI6H 3RNQA 3DGGA 3KGUA 1P84K 2WV3A 4LKCA 5IJKC 2VABB 4M8QB 1LDPL 4MHHI 4DVRL 3J07A 2FYYB 3F5WA 1CLZH 3BMVA 5KSAB 5CBAB 1JVLA 1IMHC 3SDDD 4RISH 4GY4A 2LGNA 1U4EA 3UAAA 2ITFA 5LNDA 1FF5A 3B2UD 3PFQA 2OZ4A 2CWRA 5JMRA 4Z0BL 4OCXL 5EU5B 1MQKL 3N55A 4A6YH 2YAHA 3CVDA 3I3BA 3NT0A 2BVQB 3TBVA 2GSMB 3LV3A 3NA4A 2X2HA 1LEKA 2XQBL 1I1AC 2ZPKL 3QRGH 5HHNB 1RZ8B 1IBHA 3QH3A 4FJZA 5JPMA 2DWDA 2VN6A 3LVTA 4JE4B 4L4TB 2IANE 2DW5A 2YUXA 1X5HA 3AREB 5FO8A 5D70L 4NBXB 4UQIM 4JAMA 3EJRA 4ZK8A 3C2AH 4F37K 4PGZA 2BSSA 3MRBB 3KVPA 5ALBH 2NUTA 3U4KA 3WFZA 4TUJB 4PLNC 5C0DB 1ZCRA 5HHNA 1MLBB 2RD0A 4LEXH 2CDEA 1M1XB 4ZW7A 5JORA 3O81A 1K4CA 2IH1A 3LAFA 2ZUTA 3UPAA 3O4LE 5J6HA 2DQDH 4Z7AA 1OGPA 2QKIA 1YECH 2X4OB 1MFEL 1TOXA 1DR9A 2R29A 4WW1B 1OT2A 5LLIC 3GJEA 4Y5VC 5I8EB 4NP4L 4PGJA 1E6JH 4ORGA 2OJEA 5IROD 4U1HB 3WENA 4X4YA 1BBJA 2CALA 5EO1A 3KPOB 3BP6A 2ZICA 5IFHH 5KSVB 4KXCA 4K3EH 1T1ZA 4K3DH 1T1ZB 5TDNA 1W0VA 2NQCA 4KZDH 5FHBH 2AJXH 5IV2B 4HD5A 1MFEH 2W0PA 3TXAA 1U95A 1JI1A 2JXMA 1HU8A 2JXMB 4ORGB 1SEQH 4HJUA 3ECVA 1CE6A 3KYNA 4MB1A 1NBYB 1JPFB 4OGAD 1ZA6A 3RX8A 1G1KA 4AQ8A 1YYMH 3LN5B 1JVOA 3WFEH 3FB8B 3ZDZF 3VH8B 4WDIB 5KSBF 4K3EL 3VM5A 1J5DA 5E2WL 2Y4SA 3QJVB 1SN5A 2DBLH 1T5WA 2R1YA 4GKLA 3DV6B 5ID1B 3MNVA 5D1QE 4MRCA 4FDWA 2VISB 3IU3B 1YNKL 2ESVB 2L8AA 4JLRB 1F6LL 1PEZA 3U1PA 5HJ3B 4J4PA 3ZKND 5EN2A 4WEBL 4OLZH 4GP5B 3D87B 1INQA 1OV8A 4WAFA 1AG0A 3NCCB 4OGAC 3BI9X 5LBVA 3OKMB 4JZOB 3DVIA 1FP5A 1E3ZA 3HTLX 3QCVH 4HCFA 2XZCH 4I85A 2XXGA 1TITA 1OTTC 4XB7A 2PO6B 1PG7W 4RMWA 4XBMA 4TRPL 5TE7H 3ZRSA 4W6YB 1OF2A 1ZTXE 5G5DB 2J8UA 2LVEA 3K2KA 4NC1C 4XVUD 1YPZB 3QJHA 5ALBL 3QR1A 3MA9H 1JN6B 2BP3A 2EABA 3DA0A 1K8IA 2HH0L 3ZTNH 3L2MA 1NCBL 3UBXB 4Z7WB 5A7BA 4XRCB 4NHCL 4PCKA 4GKSA 3RI5F 1BIHA 5HDBE 1NFDA 1BJ1H 1ETZA 5HYJD 1CLOL 5A40E 2XZAL 1KV7A 1LP9E 4FHJA 1QTYT 1U2CA 4UM9A 1DVFD 4KDWA 3VXMB 3UP6A 1NCIA 4NBZB 2JQAA 3OX8B 1YEDA 1T4KB 2V5TA 4HCIA 1RIUL 1C7TA 4AKOA 2V2TA 3VXSD 1BQSA 4LCYA 4W9GC 2ZYRA 2FATH 5E1AB 1M9WA 4RFOH 1R1CA 4OZIA 4FABL 1DBKH 1SDYA 3ML8A 1RZGA 1V54B 3NAAL 4OGYH 2WB7A 2WSPA 4PWIA 4AM0A 2L7UA 4JFOA 1W0VB 5MEQA