1WA1X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Reductase
total genus 94
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa1X02
1ET5A 3HB3B 1ET8A 2IH8A 3ERXA 1HAUA 1L9RA 4YSEA 2HZHA 4AX3A 2ZOOA 1OE2A 1BXUA 5B1KA 7PCYA 2CBPA 1J9QA 5E9NA 5B1JA 4Q89A 3S3BB 1BXAA 2CAKA 3QJVB 5I26A 1KDIA 2CJ3A 1N70A 2QT6A 2R7EB 2XU9A 3PLYA 1OE1A 3NP4A 3ABLB 1AZNA 1WA0X 2HXAA 2VN3A 1AZUA 3FPXA 3NSFA 1IC0A 2IDTA 2RACA 3G5WA 5A7EA 3NJGA 1UATA 3IBOA 3EHBB 1R1CA 5F7AA 3TBCA 1WA2X 1KCBA 3SBRA 1L9PA 4HALA 2VSKB 2B08A 4FAAB 3T6WA 3T9WA 1AAJA 2BP8B 2FQGA 1PLCA 4HCIA 3ABKB 5I5JA 2EINB 4DPAX 2IWKA 1M56B 2J55A 1VLXA 3TU6A 3DTUB 1AS6A 5B7MA 1A4CA 4HHGA 1MG3C 2H3XC 2UXTA 2EILB 3GYRA 2MRYA 1CC3A 1NPJA 2DYRB 4DP9X 2CCWA 2HRHA 3N55A 1BAWA 1GSKA 2GBAA 1A4AA 2XUWA 3OMAB 2PPCA 1QLEB 5I6MA 5I6OA 3X1FA 4KO7A 2VSMB 2FWLB 4AKPA 4E9SA 5I6NA 3QJTB 1AACA 2FTAA 4HCFA 1MG2C 4PCYA 3NYKA 3QJUB 2OV0A 1PLAA 4ENZA 4DP5X 3EH5B 4A2DA 5I28A 1MZZA 4W1TA 2AFNA 1GW0A 2AZUA 4YSCA 2QPEB 3ZX1A 1E5YA 1E65A 3ABMB 3L45A 3C75A 2XV0A 2YAEA 5B3SB 1TKWA 3TASA 4BK5C 1A8ZA 4A68A 1AR1B 1OF0A 2XX1A 5EHFA 4E9RA 1BXVA 1E5ZA 4AKOA 4BDVA 7PAZA 2VM3A 2GI0A 3NJJA 2PLTA 1SFDA 4GXFA 1AG0A 2FJSA 5ANHA 1URIA 2FT6A 4YL4A 2ZWNA 1XB8A 1OOWA 1ET7A 3IEAA 1JXDA 3S3DB 3TBBA 1W6WA 1RCYA 2YAOA 1AIZA 4G7RB 2LLNA 3QQXA 2VM4A 3FU7A 2TSBA 4BDVB 2XV2A 1T5KA 1HFUA 4EF3A 3HEIB 1GY1A 5B1JC 3ABGA 3UABA 2VW6A 1AOZA 1IUZA 1AG6A 3UAAA 2OJ1A 3DKHA 1NIBA 5PCYA 3S8FB 3FYIB 2GSMB 3V9CA 4BWWA 2BHFA 2PP7A 3U25A 1KBVA 2I7OA 2UX7A 3WNJA 2MTAA 3CDZA 1J5CA 4YSAA 1DZ0A 1PCSA 3KW7A 3PAVA 1W6LA 1ZIAA 3NT0A 4YSTA 1JVOA 3CVDA 1KV7A 3FSWA 1NIDA 1OCRB 1E30A 5AZUA 2H5UA 3OD3A 1PZCA 2EIJB 1J9SA 5FC9A 3TA4D 3CDZB 1AS8A 2PPAA 2HX8A 2PCFA 2VW7A 2DWTA 3FU9A 1TEFA 1TEGA 4UF7C 3PAUA 4N4YB 1OCCB 3OMNB 2BW5A 1A3ZA 2Y69B 1DYZA 1PZAA 3CVBA 3ASNB 3SQRA 4DP0X 2UXVA 3T6XA 2ZXWB 4WTQA 3WI9A 3UADA 2GIMA 1NTDA 4FA7B 3H4HA 3IE9A 1TU2A 3FS9A 1NZRA 2UX6A 4UANA 4GY4A 4DP4X 3X1NA 4YVNA 4E9XA 1EZLA 2FNWA 2CUAA 1NINA 3AZUA 2XYBA 1BEXA 9PCYA 3KW8A 3S8GB 5D4HA 3NSDA 4A2GA 1JZHA 3X1BA 5B7EA 3JT2A 1JOIA 3AG1B 3CZUB 4HHWA 3GXUB 5B1AB 1NWOA 4DP6X 1W8EA 2CALA 2H47C 2AANA 1ZIBA 3SBQA 3WNIA 3BVDB 3FQ2A 1JZEA 4GYBA 1BQRA 1ADWA 5TK4A 3QJRB 3NJLA 1JERA 1YLBB 2J57A 6PCYA 1AQ8A 1ZDSA 4HIPA 4BXSV 2I85A 1IKOP 2IAAC 1ASOA 3H4FA 4CSPA 2AVFA 2WSDA 4G72B 4PAZA 4HAKA 3SBPA 4P5RA 4KNUA 4BXVA 4QKTA 1BQKA 2YAMA 1WS8A 2IDQA 4G7SB 2PPFA 1V10A 1JZIA 1PY0A 3OQRA 2GHZA 4GP8B 1AZRA 4HCGA 1WA1X 1BQ5A 1A65A 2Q9OA 4YSRA 2IDUA 3OM3B 2GC7C 1JXFA 2YXWA 1X9RA 2WO3B 4MFHA 1J9RA 2BP0A 3EF4A 2AZAA 2FQFA 4M3HA 5I6PA 2IDSA 1M57B 4RH4A 1NDTA 2XLLA 2IWEA 2Q5BA 2HRGA 3EH3B 3FT0A 3NJMA 4X4KA 2VW4A 3UGEA 3ZIYA 4E9TA 2EIMB 4CSZA 4A67A 2YXVA 1J5DA 1FFTB 1OV8A 2XX0A 2BP0B 1ETJA 2BW4A 1AANA 3ZBMA 4F2EA 2YQBA 2JKWA 3AW5A 3X1GA 2P80D 3QJSB 3FQYA 4F7KA 2YAPA 1QNIA 1L9TA 1L9SA 4G7QB 4KNSA 4F2FA 3D12B 4Q8BA 3GDCA 1PF3A 2Y1AA 1GYCA 1SNRA 3FU7B 1NIAA 4DP2X 2W8CA 3BQVA 3WKQA 1J9TA 4AZUA 3NSYA 3FU8A 2WO2B 1SF3A 1XB3A 4DP8X 1ASQA 2N0MA 4UAHA 1IBYA 1SDDA 3AY2A 4YSSA 2QPDB 3DIVA 3NJNA 4YSUA 3MBWB 5AFAA 1SJMA 2JFCA 3NSCA 2HX9A 1BYOA 2X88A 3WKPA 1JZGA 1KDJA 1NIFA 1CUOA 1F56A 4DPBX 1MDAA 4KOBA 1KGYE 3PPSA 3FSAA 3NJKA 4NB7A 2PCYA 2W88A 3V9EA 1PAZA 4L0PB 1KYAA 4KNTA 4E9QA 1XB6A 8PAZA 4BWTA 5D4IA 1GS6X 2BWDA 3WIAA 4A2FA 2YAQA 1OCZB 1PNCA 3NJFA 1RKRA 2R7EA 2VMJA 1MZYA 2E86A 1V54B 3MX0B 1ZPUA 4TXVB 3UAEA 1FWXA 2YAFA 4E9YA 3QJQB 1QHQA 1NPNA 2UXFA 4E9WA 2J5WA 3ZDWA 1NIEA 4YSQA 3PAZA 3CG8A 1OCOB 3UACA 4AKQA 2GC4C 2B3IA 2BWIA 2I7SA 1PNDA 2XWZA 2YARA 4JHVA 5I6LA 2BP8A 1KCWA 1CURA 5I5IA 2FT7A 2DV6A 1CYXA 2HX7A 3FSZA 4QLWA 5I5MA 3PXLA 5I6KA 3AG2B 5LDUA 3NJHA 4YSPA 1WS7A 2QDVA 2J56A 4KO6A 1BYPA 4AI7A 1WAEA 2BZ7A 1GS8A 1ID2A 3H56A 4HZ1A 4GP4B 3AG4B 4BWUA 1SFHA 4KO5A 2HLEB 1ILSA 1PMYA 2PP8A 1RZQA 1JZJA 5PAZA 1ILUA 1FA4A 1I53A 4DP1X 1V55B 1SHWA 4JKNA 2NRDA 1AS7A 1M9WA 1L9QA 4WKXA 1JVLA 1IBZA 1NWPA 2P80A 2XXFA 4A66A 4DPCX 3RYMA 2A3TA 3IN2A 4G71B 4W9ZA 2BO0A 5B1BB 2FQEA 3EH4B 3FSVA 4P5SA 4G70B 1A4BA 1B3IA 3NP3A 3T6ZA 4NAJA 5F7BA 2DY2A 1CYWA 1ZDQA 1NICA 3ASOB 2QDWA 4DP7X 1ZV2A 2DYSB 3PCYA 4KOCA 1GY2A 3NJIA 1AZCA 2EIKB 3IN0A 1JXGA 1E67A 1SHXA 1X9UA 3X2QB 2FT8A 5B7FA 3FYEB 3OMIB 4KO9A 2YAHA 4N8UA 2X87A 5TK2A 3JTBA 4A2HA 1N68A 1SF5A 5D4JA 2GB2A 3T71A 5IY5B 4JHUA 1GR7A 2BZCA 3CVCA 4YSOA 3X1EA 5AKRA 4K9JA 1L9OA 2PPDA 4YVUA 2UXGA 6PAZA 3FQ1A 4YSDA 2IH9A 1HAWA 3QPKA 1PZBA 2ZONA 1EHKB 2DWSA 1KBWA 3T6VA 2JXMA 2IWFA 3FPYA 1PLBA 2IDFA 3S3CB 2PP9A 2XXGA 1ASPA 1AZBA 2TSAA 2XV3A 3AG3B 4ZK8A 4M4RB 2OCCB 1RZPA 2FQDA 2PPEA 4GP5B 3WG7B 4A2EA 4NERA 1OE3A 1GS7A 1JZFA 1SDDB 1XMEB 3N2JA 4E9VA 2XVBA
chains in the Genus database with same CATH superfamily
3EXJA 2R2HB 1BZOA 1HAUA 2CR6A 3O6KH 4TSBL 5C09E 4NZDA 3TTYA 1ETZB 5ENWB 4DGWC 2KBGA 3DGGA 2BSCA 4HJIA 2VDRH 5FGBC 2V2WA 2MCG1 2WUBL 4PJ8A 4RGOL 1T7YA 3VFUB 1RPUA 4NZTH 2APWA 1PPIA 1IKFL 4F57H 4S1QH 4BFIA 4WFHE 1MJJB 5DJ0B 3GUTB 4JZJC 1H3TA 2L8AA 5IG7A 4I0PD 1P4IL 2VN3A 2XZZA 3FPXA 2ZOKA 4LSVL 4HPHA 2BERA 3QQ9C 5I74C 1NLDH 3L3OA 4IU3B 2OL3H 2EVHA 1HHHA 3EHBB 1ZRUA 3DARA 3P11H 4YZFE 3G9VA 4X8CA 1S8DB 2OI9B 4PJAB 3HN8A 3QULB 4LCYB 4B96A 2L7QA 2PW2B 3S2CA 3SYOA 2R2BB 4PJ7B 1RZJH 4LQFL 5IUCA 2D9CA 5TDNB 1EV2E 4R9HA 2XG5A 5I0VA 1CO1A 3KJ4B 2D3LA 1CC3A 4FZ8H 4IU2A 5T1MB 3MLUL 4IBLT 1BAWA 1HQRB 2HG0A 1QTSA 1DQJB 4WI9A 5FGCE 3WE6A 4DN4H 1A3RL 2RQEA 3X3FH 4UZSA 3HRPA 2UZXB 3JV6A 1HNFA 3X12B 5CEZH 1FCGA 2WJ7A 2XSKA 1HHJA 1PLAA 5AZEH 3S37X 3T5WA 4ENZA 3E3QE 3MJ9L 1C1EL 3OXRA 5MERB 3GT6A 1DTUA 2E7CA 2HG5A 3LDBB 4J27A 2AGJH 4I1PA 2FATL 1E65A 3ABMB 3MRCB 4B0MM 1EXUB 2IMNA 3OG6B 5GRZA 2RQ8A 1XBRA 4M7LL 3TO4A 3VH8G 1MJUH 1VF5C 3P4NA 5I1DA 2X89A 3N41F 1LO5A 2C3XA 3TV3H 1AIFB 5JQIB 3DBSA 1MW1A 4WTZG 2HFEB 1OF2B 4G6FD 3I3DA 1PZ5B 3DECA 4I48B 3IETA 5FCUH 2G2PA 1J0KA 1S9WA 1E8WA 4S1DD 5DJ2A 1KY7A 32C2A 4EXKA 5IQ7H 1SXSA 5T3XE 1CK0H 1NCWH 1ET7A 1U41A 2DF3A 5ICZA 2X9XA 1MCBA 3S3DB 5MEOB 1NAMH 2OR9H 3G7TA 4G7RB 5LG1A 3GNML 1IL1B 3QQXA 4I3SH 4MJIB 4FRWA 5D7HA 2YC1B 4Z0BL 3VFSB 2CR3A 2UUDH 5KVMC 5L7XH 5KBKA 1FFPB 4G8EB 3WXWH 3FFOA 5BQ7B 1ND0B 3DJRA 1EZSA 3RWGB 4WCYL 1CCZA 1GJIA 3UMTA 3RGVC 1CI5A 3CHRA 3MODL 4I0PA 5DZAA 1BSIA 1A22B 1WPCA 1EA9C 3BSZA 1FBIL 3BP5B 3UAJD 2NTSP 1N5YL 3QUZB 3EBIA 3RNKA 1NCBL 1SJXA 1MCFA 4L48A 3CDZA 1CDYA 3L16A 1A14H 4NC1C 4PG2C 5EOCJ 3GSVA 1C5DB 4U1JA 1E4WL 1YYML 3V8OA 1BJ1J 1ZS8B 4QHMB 1G9NC 5GRVL 5C0NC 5ID0B 1JUFB 1Z9LA 4X6CF 4ZFOB 3BO8B 5KBNC 5C07E 3BZ4B 2BVPB 1PIFA 1HXMB 3NCCB 3QDJE 1HSBB 1M05B 3V95A 2BSSA 3NOIA 2BHYA 4ODVL 2NY3B 2V5TA 4Q4EA 1Q72L 3HZVA 4X5RA 2HJFB 3BMVA 3ZZSA 2NW2B 2LLGA 4JFYB 3AXLB 1SEBB 3WFHB 4Y4HD 2O5YL 5JXED 2PYFB 3RVVD 5EIIA 1B4JH 4H25A 1XSKA 2LAAA 43CAB 2VZOA 3GI8H 3PREA 2R1XB 2V3FA 5B3NA 1KC5L 1LQBC 1RH8A 1R3JA 5F3BB 3TBTA 5CN1A 1KNOB 4TSAH 4Z3EA 3MACH 3ZTCC 3CVIL 2VT0A 4AQEA 4C59B 4GKZA 4R90H 4YGAB 4IEFB 3BIKA 2NY7H 2YUVA 2EDLA 1OLLA 5F6HJ 5FYLE 3X1NA 1Z7JA 5KVEH 1HDMA 4FI7A 4Q14A 3KPRD 3KM1A 1ADQH 1SMAA 2Y2WA 3ARVA 1KTRL 4BELD 3O45B 3SCMC 1DFXA 3X1BA 4XGZA 4WK2B 2FLRT 3QUXB 3V8CA 1SOXA 4ORGB 2B77A 1G0YR 1SXBA 3Q43A 4YNYA 5M7QA 1MFEL 2EDHA 1UM6H 4HUVA 2AANA 1R9FA 5CJOH 2QJDA 3WS3A 1FV1B 3BZFB 1JZEA 1KGCE 3VWKC 3NCYP 4HK3N 4ONGH 3NJLA 1JERA 4P59H 4YK4C 2H32H 3VXSB 1BFOB 1U8LA 3LS4L 3ULSA 3E8UH 4R8WH 1IKOP 4J6RL 2ZOLB 4RRPM 2X2JA 3EZ8A 4MGXA 4ZSOE 3CTTA 5ALCH 1ZEAH 1LEKB 4CSPA 3V4VL 3PNRB 4OCXH 5J13C 1G7IB 3B9KB 2E7MA 1R5VA 2DZEA 2Y7MA 3BHBA 3NAAL 2HN7B 5CWSB 3DK0A 3WEXB 1O6TA 5ANMA 4OT1L 4TNVF 5DQJB 4AXWA 1DE4A 2JIXD 2FO1A 3UAJA 2BOBA 1MREH 3DETC 3V5KA 2WNGA 4MAUH 4QRSB 1UWFA 2FBOJ 4PHZA 1HU8A 3GSOA 3CQPA 3OM3B 3US0A 5IHBA 3D4ZA 1E4KC 3TM6A 4S1RL 3PABB 4KQ3L 1DBML 2VCOA 2FQFA 4J4PC 4IBSA 5ABAA 3CVHA 3F65A 4FXKA 2C1OA 3B2VH 1EEUA 3ZT5A 4M1DH 2VZSA 1FFOB 3KCPB 4ZFGL 1UJ3B 2DQJL 3JWNE 3QXVA 5IW1B 1NUDA 4XTRD 5LDSA 2H6PB 4Q9CA 3FL7A 4Y4HA 5JXEA 4O58H 1XCTA 4WUUB 4NQDD 3P0YL 4PJHB 5GGRA 4OGAD 3Q6GL 1HE8A 5E4EB 3AW5A 5MEND 3X1GA 5HYJB 4PTTA 1CG9B 1NMAL 4ZMVA 3GMQB 4YUEL 3RDTC 4PEEA 2NT1A 1JI2A 2X2UA 3UTTB 4TV3A 1PF3A 2Y1AA 3NN8A 4UTBL 1I1FA 4XP9H 5DT1H 3MBEC 3WKQA 3QH3A 3L3IB 2WO2B 4LNRA 4N86A 2WY3B 2Z4QB 3HC0B 3KPRA 2P3YA 5CLWA 5AW2B 6FABL 4Q2ZA 1CLYL 2FJHA 2GVYA 3BVUA 5A1AA 4D94A 1M53A 3QA3A 4HX1A 1U6AL 4H1LH 4PP1D 3OKDA 2IOOA 5AVXB 4N6RA 3KS0J 2CHZA 3NA9H 3MLRH 1BMZA 1GJWA 2W88A 3ZZQA 5J1SC 1LE5B 1HL9A 1U8HB 2FLBT 2VDMB 4WI6A 1C9SA 1XCQB 2H0EA 4N2CA 5E6RB 5I8CA 5F7DA 4ODWA 4AJYV 1BMGA 2P45B 4NNYB 4G9FD 1OCZB 3GINA 4FQPA 3MUZ1 1BV8A 3ROOB 5EN2B 2NNXA 3WFZA 3ZSTA 2VDPL 4MKTA 3WHE0 3HNSL 3ETBF 2C7UB 1CDHA 1F41A 4XNQB 3ARXA 4XMKH 4YR6A 1OAJA 4Z77B 2VR7A 3FO9A 3DJZA 1LWHA 1UD8A 3NPSB 3IJSA 1U8CA 2F61A 3L2NA 3ET9F 4FA8A 2JIXA 3ALPA 2X1XR 2F5AL 4JHVA 5EU5A 1BEYL 5I6LA 2HTKD 4HOWA 1JYVA 3VG0L 4LSRH 3VGAB 4H8WL 3WFEH 3CSBA 4UCFA 2V2XA 3T2NH 3M1BB 2WJ5A 3IE4A 3NJHA 4L29B 3QEQD 2QDVA 4H26B 3UTSE 5J8OA 2BNUB 4N3UA 2EXWC 2QGEA 3WKYA 2LQRA 2NY5L 2Z93A 2JKJA 4GBXB 4BSWA 4TNWF 3GIVB 5IZ7A 5F71A 3EOTL 5B3JF 1TJMA 3LS5L 1WHPA 4OFIA 1IC4H 4Y19B 5FOJA 2YPVL 1YN7A 4JKPH 3DSFL 5G5DB 3K5SA 3U48A 5C92A 1MIEH 3HAEA 1BF5A 5DK2A 5MENA 2XXFA 4NO3B 4P5TD 5I1EH 3ESPA 4A55A 4Q6IA 5F7MC 3TH3T 2LABA 1XGRA 2OXGA 4G8AC 4M3KB 4R3SB 1VADA 1GJUA 1ZWIA 2CLRB 3QNYB 4W9ZA 4FQJL 1IM3B 3UYRH 4NAQA 1TQCB 2BWQA 2DQEL 1ECZA 1U8JB 5LN8A 1A4BA 4XMWA 4D7BA 4M56A 1KIQA 3CFEB 2Q86B 4F58H 4NI6A 4P4RB 3DX3A 5LQBH 1IJ9A 2CJUH 1WH0A 4WW1A 3TIEB 2YRZA 2ENPA 4ZUUB 4KKCC 4KOCA 4PP2A 4QIRA 5DD6B 1YUHA 3SZKC 1GY2A 1T1WB 4BKLB 1QSZA 3H0TA 3IN0A 3II3A 4OBSA 1USZA 5G4NA 1U8IB 3H7BB 4UT9L 3U30B 1ZLWK 3F00A 3KJ6L 4YHKH 4RFEA 5LO7A 1C8PA 5DFVC 2O4EA 5D4JA 3RUGB 4PJ9B 4G9FA 1Z32X 2GJJA 4PJAF 4LSSL 3SPVA 3FRUA 4NQVB 2B1AH 5JZ7C 4QHKI 3CFKA 4K9JA 4PJ7F 4WNSA 5GRUH 4NQCA 3FQ1A 1KYDA 4LKCA 4CGTA 2VXUL 3KLHD 1YY8B 2GBTA 3FUNA 3GZQA 2IPKA 3IRPX 2CNZA 4PJ8C 2EYTA 2X4TB 1N2RA 1AMXA 5AAMC 4JUTA 2CKNA 4F7TB 5DO2C 3WYRA 4FYRA 4BUQA 3TBWA 3NCXA 3S96A 3AROA 5DQ9A 4XVOA 4R4ND 4PJIB 3QEQA 3HE6B 1A9EA 3K5RA 3P9MA 1RMFL 5BO1H 2LV4A 3ETBJ 3UTOA 1UA3A 3L3OC 4FABH 1GOHA 4FLOA 3V0VA 5I9QC 1YEEL 4YE0A 1G1CA 3OZLA 4QXGL 2PYEB 3MLZL 3OWEA 2M83A 4F2MA 5L8LB 3SGJC 1WT5A 1VKXA 2G5BA 4NC0B 4Z7OB 5IFHL 1CBJA 5DJ8A 4NBYB 4LVNC 5EU4A 1A7PL 4BZ1H 1J5OL 3O2WL 1JGDB 3KPSE 3VXNB 3U2SA 2JJWA 2WWMC 1BFVH 4ZO7A 3F6IA 2JTYA 3F01A 4P5TA 2BFVH 4J2XA 1JXKA 4O2EA 4Y7OC 1KTDA 3Q5YA 4CN4A 4DN3H 3TF7C 1DLHA 3V4UL 3L7FB 5T3XH 1QUNB 1TPXB 2VUYA 3KEDA 4LSUH 2G3XA 5D1ZB 2ADJB 3BXNA 1ITCA 1G84A 4NBZB 4LLUA 1H5BC 4QTIH 3ZK0A 3NJGA 3L95A 2H9GB 4XO3A 4JDEA 3FT2B 1RHFA 4DZBA 2KDYA 3K6SB 1GYAA 5C0GB 3TBCA 2H1LM 4JEGB 4ANVA 4R84A 2VWEC 1NM9A 1JGEB 1PGRB 2NNCA 1C08B 5KUKA 3KPOB 3GMMB 5EUOA 2X1WL 1FORL 4LL1A 1WEJH 5AVVB 3T77A 3VD5A 2HRPL 4M7KH 5T1KB 2MRYA 3CDGB 1S7SB 5JA8B 1F58H 4DP9X 4D3CH 4PV8B 4HBCL 2VAAB 4RRPG 3JWNG 1HKLL 4B9PA 4KTDL 3F04A 4LMQE 1CGSH 5LJYH 3BAEL 4K9EH 4AE0A 4XAWH 4LPWA 1ZLUK 3HJ0A 5FWQA 4F7EA 2CZNA 1II4E 1BFSA 3MDJA 1MH5A 1AXIB 3WY2A 3P73B 3Q6FA 4MQ7A 1CGXA 2DQUL 1WBYA 4J23A 3NRQA 3N40P 5F9WC 1KB9K 4Z7WE 1IAIL 2FBJH 3CSFA 1BJMA 4RFOH 3ZIMA 2WCPA 1GGIL 3SQBA 2AAAA 3OLIA 4HIXH 3C75A 3B4NA 4E42B 3QCVL 4GRMB 4HPYL 3CK0H 3DO7B 3D52A 4JQVA 2HMID 1IVTA 4I0PC 2AQ2A 2Y6SD 2VDNL 2XQ0A 3BZEA 1IU1A 5FYLH 1XAUA 1UC6A 3VGDA 3KPRE 3GSXA 1DBJH 2O6DA 7PAZA 1BVOA 2FX8L 2G30A 1KPVA 4CL7A 5LN4A 3FZUD 2ORBL 4JZNA 1ACYL 1VEMA 4DNLA 4EO5A 1R3HB 3KL5A 4OZ4B 5FDYA 5JUEL 5I73B 1A7RL 5ANHA 4LASH 1RZGB 1TF4A 2QVFB 1T2JA 3OLGA 4YL4A 4AGNA 4OZHB 1NGWA 3MLVH 4HCRA 5T5FL 4X0NA 3QB7C 5ISZE 2F18A 3L5WA 1F00I 2VM4A 2VZVA 4YEEA 1TDQA 4BDVB 2XV2A 3IMRA 3MXWL 2X05A 3SPJA 3G5XB 1RV6X 3GMNB 1NANH 3MRMA 1BVLA 3ARGA 2CK0L 1J8HE 5FWRA 4LAQL 4E5XA 2LW3A 3EFDL 4HHAB 3M6DA 1D7DA 4HT1L 1TJIH 4OJDH 2Y06H 5GZND 4EN3C 4WGWB 3KYMA 5B8CC 3DUSA 4APQD 4PR5A 4XCCL 4W9FC 3ZMEA 4NNPL 3SDYL 4ISVB 2LAGB 5D7JB 1V7MH 1MF2L 3GLDA 2AEQH 2OMTA 4IRZL 4NKQB 1FNEB 3VFTA 3CVDA 1TNNA 3QZOA 1KV7A 3GBEA 4UOW0 5BV7B 4JO3L 3GMRA 3UYPB 1NBCA 4KZEH 3LKRB 2E8ZA 5F1KC 4YDLB 1MVUA 3ZE2B 5GHWL 4PY8J 5E95B 1B0RB 5GRVK 2PTTB 3TNNB 3MZGB 2DWTA 2I07B 3FTUA 4MNHA 1JPTL 3ARTA 5I8EA 3MV7D 3VQLA 4ZMZA 1AY1H 1XIWD 1F90L 3H2PA 3E6FA 3O4LD 4AVHA 3OJDA 2UXVA 1U8NA 1S5HA 3MR9B 4X50A 2P42B 2CO3A 3RVUC 1FFQA 3T65B 4X7FC 4JQIA 2F08A 4X8GA 4XODA 3X14A 1TU2A 4NQDE 4P4KB 5HHMB 3E9UA 2BNRB 1Y7VA 3KM2A 4FJYA 1SXCA 3EYSH 3UBFA 3ZOAA 3ATDA 3NA4A 2ZWSA 4YVNA 3QXTA 1A9BB 4GOSA 3LV3A 2YJQA 2XYBA 2PNDA 4PJHF 2A7BA 1G9HA 2XCMC 1D9KC 3H9YA 4KY1L 3NIGB 4OZIA 4NJAL 1KULA 4EXPX 4MMYB 4L3AA 4QRUA 4OIAA 2IQAB 5FX3A 5LGJA 3BRGC 4MJ6A 4DCQB 1OANA 3CZFA 3FB8A 1O5DT 4NQXA 3U9UA 2NZIA 3PL6D 3QNZB 4GRLA 5I16B 4WEUD 3ARYA 3BCFA 3QEUA 1GZPB 2CM5A 4V1DE 1TEYA 2O1AA 2WP3O 4XX5A 2G4GA 3UZQA 4ZAKD 4LKXB 2Y23A 2XVLA 4FXKC 1NLBH 3VD9A 4S0HA 1NANI 5IHWA 3QS2A 3TTSA 4N8PA 4TVSa 1ZD6A 1MQKH 2P7TB 3WIFB 4BXVA 5L0QC 1HVXA 1NC2D 4G7SB 5DMJB 4OZFH 2JWYA 3GD1C 3NFPB 4Y4HC 2Z1KA 3HG1D 1L7IH 3EADA 1ODUA 5I30H 3CLFH 2ZPKH 5JTWA 4HJTA 5GZNA 1CT8A 3ZRCC 4GRWH 4APQA 4B41A 4RMSA 1HCFX 4ABVA 4R0LA 2HLAB 2NX5D 3QQDB 3S4SA 2J5LC 1D5ZA 4PRHE 5EBMB 3ZDYE 5BOPA 1J9RA 4JN1L 4X5LA 4P3WA 4UQBA 1M2VA 5I5RA 3NABH 5AKTA 5ICXA 4M62H 4RH4A 1TLKA 1HH9A 4XN4A 5INCA 2J12B 3GMPB 3QIUA 2MHAA 3QARA 2YXVA 3QIBD 4NHCL 2EUZA 1L3NA 3MV7A 1OV8A 5HJBA 1FIGH 3DDGA 4QAMB 1XIWA 2C4FT 3B6SB 3TF4A 3O4LA 3CH1B 4QT5A 3BUDA 2Z4TA 3LZLA 1L9TA 1LHZA 2VRQA 4X8XA 1F8TL 2F19H 1XF2B 4JFFE 5FW6A 3J07A 3BN9D 3OBAA 2CGRL 4U6HA 3BQVA 3KWTA 4B9ZA 3EGXB 5C08E 2D0HA 4HDIA 1DLFH 5DI8B 5HHQB 3HZ3A 2CM6A 5HPMB 1SDDA 2O5ZH 1SMDA 4RZCB 5FV2A 3MBWB 3H9SB 3Q8EA 3D18B 3ZJAA 3TJEH 1IARB 5E00A 1ADQA 4JFEB 3IDNA 3NSCA 1EXGA 4GG6B 4YDKL 1BYOA 1HSAA 5BZWB 1ZTXH 1MDAA 3PL6A 3ARRA 4MCNA 1YQVL 2HP4A 1SYSB 3VFWB 3VDAA 3B5HA 2R27A 2C9RA 5FPIA 3GSNB 3OR6A 5F7WC 1SHSA 5D7SH 3K72B 1EGJL 2ZSWB 5DVLA 3N3EA 2OS7A 3QNFA 4PB9L 4ZAKA 3NJFA 1SVCP 1JHLL 2OTPA 4ZMOA 1ZSHA 3X3GL 1GHFL 2PCPA 4N2NA 5GS1B 4WGVB 1NGPH 3TA3B 4N5UA 5HYQA 3ILQD 1IQDA 4OV6F 4XTRC 3UAEA 1NC2A 3UMNA 3IDJB 3I85A 1MUJB 3POCA 4TSBH 2J8UE 3WLBA 5IB3A 2Y2YA 2B2XL 2UXFA 3D0VB 3HG1A 1MCQA 3LKNB 4OGAC 1OCOB 2KZBA 3WHE1 2WKGA 2WUBH 2XWZA 4RGOH 4DGYL 2X12A 3ETSA 3GMOB 1OWRM 3GK8L 2DV6A 4Q6IC 4X9GA 4A39A 1TO4A 5I5MA 3BPNC 3EJJX 3IM1A 3B8SA 4GJTB 4CDHA 1IKFH 3X13A 1QBML 2NX5A 2BRRL 2EAEA 4Y5XB 5KTEL 1AVAA 5H35B 3IMTA 5F3FA 3S36L 2W9EL 3ZDXE 4JHWL 1P4IH 4PWIA 4LSVH 2VQ1A 3D39D 3VFGL 4YDVA 4TUJA 1UXWB 2LU5A 1H3XA 3DX9B 3IB4A 3L54A 3LHPL 2YD2A 3WJMA 5I66B 1YA5A 3QP3A 3MRJA 2E46A 4WV1A 3KPLB 1A6ZB 2HVJA 4A37A 1JWSA 3QIBA 1L0PA 4I2XA 2WKLA 4PP1C 3G08A 4PJIF 3RL1B 3JQOB 2NXZC 3L4UA 4U6XB 5GS0L 4LQFH 4FNUA 3TVMD 3M88A 4BSVB 3QFJE 1IBZA 4KBPA 5D5MA 4N0UE 4LK4A 1BIIA 4K3JL 2PO6A 4J7RA 5C0BD 1ZLUH 1G4MA 1E43A 3RI5K 1I7UB 3MLUH 2A6JA 1AXSA 4I18B 5CCHE 2Z64C 3AREB 1E3XA 1JNNL 4HIHB 3WTWA 2FQEA 4GG8A 3FSVA 4UU9A 3B2XA 1UWXH 3UEQA 2ED7A 1A3RH 4UTCA 5LBSL 4KMLB 4DGIL 1H3PL 1FUNA 5JHAA 2A83B 5G4OA 4OCYL 3PF2A 5A2AA 3MUGB 2FWUA 4J39A 5EEXA 2YFNA 1Z3GL 1JWMA 3MJ9H 4RDQG 5IB1A 1C1EH 1XV8A 5C0IB 2C3VB 2HVKB 1KJMA 3KWXA 2FATH 4XPTL 2DWDA 2ZUVA 4H1LA 5KJRL 1TR7A 3ARPA 3EOAA 4RVBA 4N0YL 2XWBA 1E3ZA 1GXEA 5C0AD 4LF3B 4DK5A 2Q7AA 2AMGA 1V27A 3W38A 3BX7C 3KL3A 3X1EA 1GAFL 1SYVB 3LNIA 3TESA 4RNRB 3WUWA 3DA0A 4NXSA 1HAWA 2YGOA 5GGTL 1C7SA 2XXMB 3WDIA 2A73B 2B39A 3IF1A 3VCLA 1KIPB 1OY3B 2R8SL 3GNMH 1I7TA 3MFFB 4XWOC 2YPLB 3FRPB 4Y1AD 4KXZH 4UNIA 4Z0BH 2BSRA 2WO4A 5AW0B 1UD3A 3G5YA 2BIPA 3BEWA 4WCYH 3J8F7 3JV4A 3K1DA 4G6ML 4U1LB 3WG7B 3MODH 5F6IB 1FBIH 3K6FA 4J3UA 1N5YH 3N2JA 4JG0L 3D39A 1NCBH 2KLTA 3ULAB 3OKEA 3HB3B 2IAMD 3MRRB 2OMVB 5J1AA 1JF6A 1ET8A 2WSPA 3HBGA 4BQ6A 4YSEA 4FL4C 4JFZL 3BIBX 3GO1L 3D07A 5EOQL 4LO9A 3KLAB 2PWEA 1E4WH 5F93C 5HJ3A 1YYMH 3IGKA 1J9QA 2G2RB 3VI3B 5GIRA 1INDL 5CGMA 4JY6A 4HJ1A 1D6EA 4KZ0A 3TVMA 4MXWL 4AQOA 1KYOK 2V7NB 4Y4KB 5T3ZL 1N59B 4K8RC 5ACMA 5C0BA 4ODVH 3FTSA 1KDIA 2X6CA 3QPQC 2JLPA 2XU9A 2R7EB 5J12B 1YJDC 2VZ3A 5E4AA 4N2BA 2O5YH 5TH2B 1OOAA 3P3UA 4AM0B 3L3KB 4OZHF 3IJHB 3MV9E 4U1IB 3RURA 5HVHB 1MHPL 5IVOA 3V6FB 5AOJA 1KC5H 3KLHC 1QFPA 1WA2X 3ES6B 1J0ZA 2ZG1A 1L9PA 1J8RA 1QHOA 1TSHA 4M1CD 3KPNB 3SKUD 5DD3L 3CVIH 5F88A 4FQCH 1LQSR 2R59A 4PJ5B 3TT3H 1I1YA 2GK0B 2XBDA 5EZPA 5AW5B 5IOPA 1NFDA 3B2UD 3BH8A 4HFWA 1K2DB 4W6YB 1I8IA 2H2SD 2NY0B 5HHNA 4GAGL 5DVOA 1EZUA 1E7VA 5HY9B 1AGDA 4JKMA 4JQVC 2MOGA 5HGHB 1AGBA 5C0AA 5E9DE 5J7CC 1HX0A 4XMLH 2OA9A 2XUWA 3T0ED 2PPCA 3BUYB 3JWOL 4XAKD 4QXVA 1JFQL 4TKWA 1S7UA 3QDGB 1EHAA 1MFEH 2CHDA 4JFPA 4ONOA 1Y18A 2JV6A 4U6VL 4F20A 3GSWA 1QLEL 4TUKL 5K93A 3WSQL 4ELME 4PCYA 5SWSB 2WGXA 3DRTA 2X70B 1G6RL 4JY4B 3DHUA 4U1HB 2NR6C 2JKNA 3JUZA 1RK1B 3LS4H 1N64H 2YN5A 4G5ZL 4Z8FL 3MRBA 1T04A 4J6RH 4WJ5A 4WI7A 4Y1AA 3WMSA 1WCBA 1N6QL 2FEJA 1Z5HA 4DSYA 3V4VH 3ARGC 3CQFA 5E94A 4DQAA 1CXEA 2WQVA 5H37A 1L5GB 1AI1L 1KTLB 3L13A 4JPKL 1AR1B 1UOLA 2X4NA 4F5CE 3D2UB 4OT1H 5DA4A 1CLVA 1I8UA 4WEBL 3I6KA 2C4FU 2XT1B 3W5MA 3VFRA 5AB2A 2HKFL 2ZSVA 1UXSA 4EIUA 3T4AA 2IAMA 1XGUA 4LLYA 4PD4K 5E99L 2WLHA 4P57A 3FU5A 2I9TA 2LT9A 1D5XB 4HH9A 1OVZA 4H13C 1UT1A 1TQWA 4M61A 4S1RH 2CWRA 4PBDA 5I1LB 4E41D 3NIGF 4MB3A 1DBMH 1NFKA 5J3HD 2YAOA 3BSHA 1L0YA 3JTTB 1ZT4B 2LLNA 2LTQC 2Z65C 1LD9B 5FUOL 1TTGA 3NDYE 1RZJC 2FHBA 4OAWA 1DJWA 1LM8V 3QEHA 5DMKA 2EEDA 2ARJQ 4ZFGH 2DQJH 5A16B 3V6ZB 1G7JA 4L3CA 4FQHA 1MCEA 3GSRB 3P0YH 5I2IB 1JMXA 5SWZD 3Q6GH 3S5ZA 4FFYA 5GJSL 3ZYZA 4P48A 4JFOB 1J86A 1OW0A 1NMAH 2VB5A 5DJDB 4YUEH 1CL7I 3GLEA 5FKPA 1WWBX 2X4QB 4UV4L 4UTBH 5AYTA 1TZOA 3AT8A 4LCIL 1MI5B 2E75C 5AD0A 3WCYA 1OAUL 3STZA 2V5RA 1B6UA 4TNEA 1QI4A 4J8RA 4KV5E 4DETA 3L5HA 3T1WA 2PPAA 2VLMD 3ARSA 6FABH 4KUCF 2Y6SC 4XOBA 1CLYH 1YPZE 3FU9A 3NVQA 4LGSB 1P1ZA 3T0EA 4UOW1 4JRWA 1U6AH 3BRDA 1A3ZA 4AUYA 1JHTB 2CDFA 4GRLC 3DIFB 1DVSA 2VLJB 4PVBA 2WBXA 3ZT7A 1U4EA 3FCSA 4PS4L 4G2AA 1OO2A 3MNZA 4NRXB 4NNXA 1C8QA 3H4HA 4NUJA 1YUKB 3AQZA 2IJ0C 4XNAA 1H0DA 1MCSA 3HRZA 1S7VB 4GIPD 5J06A 3OX8B 4JFSA 2VDPH 1AO7D 1I9EA 1LO4L 3HNSH 4UAOB 4QRBA 5GZOD 5JIMA 3VH8B 3WTSA 3BPOB 2ARJA 3L08A 1YEDB 4DKDC 2X9YA 1RUAL 1TNMA 3TBSB 3PHAA 4FG6C 4FMVA 2ZWKA 3MGAA 4XN8A 1ZXQA 5GZNC 1IRAY 4OM0L 2F5AH 4BFGA 4APQC 3DVGB 1BEYH 1AHWC 2I9LB 4OI9A 1EJFA 4R0LC 3SBQA 4H8WH 3VG0H 1IGIL 3QNXB 4ZUWB 4XCEB 5J4MA 5TK4A 2Z7UA 3C5XA 4E41A 3CDFA 3CHSA 4GKNB 1MWAL 3EFOB 3LEVL 1KJ2B 1H8OA 4FZEL 3Q9PA 4Z7UA 4G6AD 4GG6F 2W9DL 3AM8C 3LN4B 4XCYA 1A6PA 1L0XA 2ARWA 1BZ8A 2EYRA 2J6WA 3MRPB 3QIUC 3RA7L 4F8LA 4M8VA 3EOTH 4JKWA 2H3NB 2V8LA 3VDCA 3LS5H 4B9JA 2A9NL 1QACA 4ZOCA 2YPVH 3DSFH 3GSQB 4G6JL 5SWZA 4ESKA 4P5KA 2YSSA 2N7SA 2A6IB 2EXTA 3B83A 1T0MB 5FO7A 4D2NA 2I24N 1K72A 4K5PA 3DVNB 4KROD 1NCOA 3DOHA 2WQ8A 2H0JA 4FQJH 5JOFB 5DJYA 1CZ8L 2DQEH 1I7ZB 4CU8A 1M57B 1T1ZB 5J6GA 2NYYD 3MJ7A 1YEKL 4XHQA 1QHPA 2Y36L 3R06B 3BUQA 5GS2H 3NZUA 4W6XB 1WGVA 5E1AA 1VENA 3BQUC 3PL6C 1LWRA 4ZFFB 4F2EA 2P5EB 3N85L 2YQBA 2EIBA 4UBDD 4EDXA 5MHSE 2J7LA 3PJSB 4KHXL 2CA4A 4LRIA 2UZPA 3FQYA 3TN0A 4UT9H 1UKQA 4KHTL 4N2OA 2A6KB 4TULL 3IDYB 1WITA 3KJ6H 5TF1L 1W9XA 4KH9A 5B39A 4ZAKC 5AOMA 2FLMA 2GUOB 2XKNB 5AKVA 2WZAA 3RY6A 2DDQL 1WYJA 4Z7QE 4PB0L 4PREA 5JIHA 5C0BE 4F9LA 1AO7A 1R3KB 1PX8A 2J21A 2QADB 5GZOA 5JOEA 3UTQB 3WNOA 2VXUH 2OMZB 3PYCA 4F1SA 1MNUL 5CEXA 2A9CA 2JFCA 5C0CD 2AVGA 3IWUA 4OFPA 1JD7A 1CVSC 4AH2A 1AZVA 1CDJA 1CUOA 2QEJA 5IGXL 3U1PA 3AQDA 4O2CA 1KBBA 4LCWE 1G9MH 1ZHBA 1PAZA 4GH7B 5DSCA 1BHGA 3CSYA 3BWUC 3L3GB 3CPUA 1GS6X 3VFMB 1F2XK 2MNUA 3AJ7A 3OKMB 2NCMA 4FD0A 1RMFH 2QKIA 1IM9B 1SJVA 2WBJD 1UWEL 3JV5A 2NUTA 1YEEH 1XCXA 5DC4B 1QSFB 4QXGH 3MLZH 4QPEA 1QSVA 4WDIA 2G0KA 3K4ZA 1IGFL 3KYNA 1RUKL 4WV1C 1FWXA 2EH8L 3QIBC 1A7PH 2FVNA 4JJHA 1J5OH 1QFOA 4QRRE 2WYHA 3O2WH 4J3VA 4O4YL 4MX7A 1JV2A 2XWTA 4N6QA 4OZFA 3SKOB 4FTVE 3ZGIA 1B3JA 3FT4B 3MYJB 3AT0A 2PO6C 2VKWA 2E27L 3OAYK 4AENA 4LPTA 4BUHA 3VYPA 4JKLA 4JJOA 4MVBC 5LBGA 3ISWA 4OSUL 2ZOUA 1IBFA 3V4UH 4RMQA 3U6RB 1EANA 4XO9A 5FOBA 2NUPA 3SDXA 1J10A 2BOCA 4NLHA 2NLJB 3IAPA 2O93L 3WHXA 5JHLL 2BHZA 3L3JA 3U0TB 3UL4A 2CIKB 1FRGL 1NEPA 4ODBD 4JCWA 5PAZA 3D33A 2RR3A 4ZDHA 3QUML 1JNLL 5F7FA 3UFIA 4C4UA 5KVDL 2PETA 3LTVA 5CR8A 2XOTA 3SKMB 3VUAA 4BCYA 1VERA 3UTZB 2D2OA 3Q8FA 1BAGA 1FORH 4DVBB 4HS3A 1EDQA 3UJJL 2HRPH 1QEWA 2BNQB 5C0FB 1SOSA 4HLEA 1Q0EA 4HBCH 3V5HB 2V33A 1HKLH 2D4DA 4JB9L 2OW7A 1AGCB 4KTDH 3OKNA 2NQDA 2EKSA 1TO5A 4X6DA 3BAEH 3RTQB 4LLDB 4NAJA 2NCEA 4ODUA 5DDHA 3S5LA 3VI3F 4BGDA 1DBBL 3RPIB 5F7BA 1R5WB 4XO8A 3SQOL 3MGOB 3SCMB 1YO4A 4UM9D 2WN2A 5C0CA 2DQUH 3B3IA 1A6AB 2EDNA 3FCBA 2A9AA 4PGCA 5IQLA 4JJ5A 1IAIH 5EWIH 2YD4A 5CP7A 3FCUB 3LIUA 2CKBL 2PKDA 3CFNA 4A6YL 4Z23A 1GGIH 1ONQB 3FBKA 4KGLA 4CMMB 4IBWA 3GBDA 3QCVH 3VWKB 4HPYH 2YGVA 2QPSA 4OV5A 3B37A 4XCFL 3HHRB 2FYVA 3DOSA 2CNYA 3SB3A 1IBGL 1SQMA 1TTAA 2VDNH 1OB1A 1PFCA 1CF8L 2WBJA 5FYJU 1HINL 4G43B 3WIIL 4F27A 3GXFA 3O9WC 1OTSD 2FX8H 3CHOA 2PPDA 5EDSA 2ORBH 1MHCB 1ACYH 1IGJA 3FB6B 4ODHL 5JUEH 5DC9B 1A7RH 4XAKE 2ZONA 5D2NE 4MDIA 1Q9KA 4XCNA 5T5FH 2X3AA 2V9QA 3TVMC 3Q2VA 2ODHA 5FA4B 3WAKA 1PEZA 3O11A 3MXWH 1M6OA 5IMLB 4NCDA 2VDLL 2XV3A 2B5IC 5SX5K 2CK0H 5GSRB 2QSCL 4LAQH 4QD2E 1QO3A 2P24A 1RZPA 1AYRA 2CO7A 3EFDH 5DEGA 3DHJA 4JAMB 4X4XB 4TL4A 4HT1H 4HUXA 4F7PA 4OI8A 4XCCH 1FNHA 3BMWA 4TPRL 5T5NF 4OLEA 4NNPH 3SDYH 1KFAL 2JKTM 4GSDL 4G82A 4MSWB 1F5WA 2MQ0A 4KJWD 4H5SA 4J3OH 1MF2H 5BS0E 1UURA 5JPNA 4WU7B 5E9NA 4IRZH 4F3FA 4POYA 4RMWA 4KI5F 1RPKA 3WU1A 4PRNB 2ITCA 4U7KA 3D3VD 4B9FA 5DRXB 3FSOA 5J89A 4JO3H 1URLA 1CICB 3LD8B 1ES0B 4ZNEA 1H3VA 1WC7A 1X5IA 1BWWA 1CI3M 1T21B 1YY9D 5GJTL 3SPGA 5GHWH 4B0MB 4PRDA 5FK9A 3PLYA 2YPKA 1JPTH 5GRYA 3S34L 5A6IA 3MBEB 1IC0A 2RACA 2AXFB 3G5WA 3WUWG 4OCMC 5EF2A 5FLVA 1F90H 5EPMB 3L8QA 3EO0A 3BH4A 3CN0A 3K81A 3AU1A 1RZ8B 5IBTL 2CLVB 5ITFA 4NQED 1BFTA 4JFDE 4UM9A 4ZQTA 1IAII 4GPVA 4Q9BA 3FK3A 2ZIDA 5KVGE 3VD7A 1GIGH 2EINB 1UZ6F 3VSUA 1M56B 3GSUB 3TU6A 3VXOA 3MJ9A 5HTSA 3RWHA 4M5SA 3GRBA 2ZUQC 5CM1A 2X38A 3TIDB 3LSOB 4KY1H 3WNNA 4NJAH 4LHUG 4EI5B 2IEPA 3D4GA 2GBAA 1O9WA 1ZHKB 1IAKA 2D3JA 4U1KA 3H2WA 3T4AC 2IAMC 3BWAA 2VLME 2EYSB 1JN6A 5I0YA 1VZIA 1ZLVK 3KEHA 2ICWI 2BCMA 3KLQA 3W0WE 1GYUA 3NYKA 3QJUB 4BFNA 3PPEA 2F53B 4QRQB 1EUUA 4OFKA 1AGFA 2QQLL 4OKVB 4GUOA 1BZ7B 3W39B 4IMKA 1O6SB 3P54A 4FGMA 4KJQC 5IREA 1HXYB 1ULVA 4XPFL 3B7UX 5FW7A 5AVUB 3G5VA 4YXKL 2A4CA 1A8ZA 1VAHA 4F24A 1CWVA 2OP4L 3T8MA 2F58L 4DFIA 1IE5A 5EEVA 4NQSB 5AW3B 4MBOA 4MQTB 3NCEB 4JG1L 4OGYL 2LGNA 5E8NB 2GKIA 3VTMA 1YECH 1TKWB 1S9VB 3IEAA 1X5KA 3B2UC 4JN1H 4LCCB 4HUNB 4FXGC 5IFJA 2FBRA 2H2SC 1U0QA 1GOFA 2Y7QB 4KTYA 4ZSOB 4H8PA 4B9CA 4J12A 3ZTEA 3KMDA 3TPUA 2NXYD 2QR0B 1IUZA 2ICEA 3T0EC 1V3MA 2WVVA 2SODB 1NIBA 1DVFD 1OTUD 4NHCH 1RUQL 3LRKA 1KG0B 3V9CA 3LKSB 3QT2A 4BWWA 4NDMA 5CCKH 3TP4A 4K9EC 5BMFL 2MTAA 3CH8A 2WNWA 1U8QA 1O7DE 1N5AA 2IV9A 2V5YA 2WXPA 3CCHA 3O0LA 1T1YB 1EIBA 4NQEA 1Q38A 4L3ED 5FECB 1F8TH 3HRZC 1DEEB 3P4MB 5EC1A 2DQFA 1EWHA 2CGRH 3C60D 4HS8L 5HDRA 1OP3H 4P2RD 1BZ9B 2WXGA 1FPTL 3BVVA 1AS8A 3FOMB 4FNLL 4OF0A 4NBXB 4KKQA 1RP9A 2HX8A 4TQIA 1XGYL 4UDTA 2Y6TE 4DO5A 1OGSA 4K7PL 1OPOA 1NCCL 4YDKH 2NZ9C 3ALXA 2GSIA 4MMZB 1TITA 1HESA 1UJTA 2ESVD 1EK3A 3LVEA 5SX4H 1JPEA 3F5WA 1YQVH 3ZE1F 3FUMA 1TT6A 2CLZA 3NSJA 3DGGB 4I85A 1UEYA 2GYSA 2V2WB 3UROR 1X7QA 4WK0B 2B20A 2X1PA 1EGJH 3OKLA 4WNQB 1WG3A 2X2HA 4EUPH 4LARL 1ZGLP 4GY4A 4PB9H 1YEIL 4Z7IA 4EBQH 2E7HA 1R46A 5K39A 1JHLH 2GAZA 2X6BA 3X3GH 4X6CE 1GHFH 1IIIA 4M6OL 5J6HB 4RMRA 5IG7B 5LNEA 1RIVL 2XPZA 5F44A 2ZOKB 2B2XH 3OAYH 1S9YA 4GT7A 3V4VA 5AZ2L 3CZUB 2JF1A 2VYRE 3L6FA 2DQGL 5B38A 1HHHB 2P8LB 3MROB 4LCVA 3CFDA 5MI0B 4DGYH 2CALA 5JDSA 1CQYA 4GLRH 2ZXEB 3GK8H 3LRGA 1BLNA 4MMXC 4I1NB 5C0CE 1QBMH 4IK6A 2BRRH 3L17A 4ACPA 5KTEH 3F7RA 4JZOA 4OGZA 3TZVC 3S36H 1XH1A 2W9EH 3M8OL 4JHWH 3ECBA 2XG5B 4HIPA 3BVWA 2I85A 4IU2B 4OJAA 5FYJL 3VFGH 3KLKA 3INOA 4P5RA 4OU3A 3LHPH 1DQTA 4AITA 5EBWA 2MCPL 1YHPA 3EDDA 3B1UA 4ORZC 2L04A 3FQNB 1DVZA 1DVFA 2AQ1A 3GUFA 1F18A 2XJLA 5M95B 3FAXA 3F7PC 5GS0H 3MXVL 2YGNA 3D08A 3TN0C 1HHJB 1WCQA 2EUXA 5DRNA 3LKQA 4YSRA 4BUGA 4K3JH 3OXRB 3FO1A 2EDFA 4L3EA 5TDOA 2HG5B 1MCWM 4MFHA 1JNNH 1F11A 5I6PA 2CBOA 3C60A 4M6ML 4V33A 3TO4B 4P2RA 2VL4A 5LBSH 4DGIH 1H3PH 1O9VA 1J5IA 1LO5B 2WXHA 1I3RA 4OCYH 1GGUA 2VJXA 4UUJB 3DURB 2VW4A 4HGKC 2UY7B 2VLKD 3ZXAC 4JDTL 4A67A 1Z3GH 1Q9LB 3IETB 1M6UA 1S9WB 4RGNE 2BP0B 2J6EL 2D7MA 3KCWA 3PWLA 5J9PA 2ESVA 4UV7L 5DJ2B 1SBBA 2Q7YA 32C2B 4I0CC 4PMEA 1SHMA 2P80D 4XPTH 4JN2A 3PDGA 1UB6B 4F7KA 5KJRH 5C3IA 2Y5TA 4KXBA 4N0YH 5KBDA 4YGVA 2HT2C 4NP9A 2DM3A 3MNMA 4PY7A 2RFXB 2QKIC 3OTTA 4PSRA 1A25A 1SNRA 2MQGA 1NIAA 5HDQL 3EYFA 1WZ1L 4HYTB 4U0RC 3D05A 4ZNEE 4AG4L 2CXGA 2EEAA 4QLRA 1GAFH 2LE9A 5GGUB 3MRGA 3S7GA 5H94A 4UAHA 4OQTA 3NESA 4PV9A 4C56D 2QPDB 2D0FA 4I0PB 3NJNA 5GGTH 1OAKL 1KCLA 1DVQA 4GI8A 1NBQA 2JKXA 1EXHA 3ZT6A 1IT9L 3RNKB 2JK5A 2ZKMX 2Y3AA 1CMOA 3DV6A 2AAVA 1S3RA 2K9UA 2R8SH 1YEHL 3GSVB 2MOQA 3TBVA 1G43A 2HPOA 5I23A 4G9DA 1DO5A 3MJ6A 5JOPD 2BWDA 3HUJA 2YAQA 4N9OB 3HW7A 4G6MH 3BH9B 5GISL 4DUVA 4YHYC 3CZGA 3Q8BA 2VDML 4P49A 5DC0A 2APTA 5C7ZA 4JG0H 3HZVB 3FUIA 3VI4F 4NFDA 1X5LA 5B21A 4U6TA 2F6AA 3FUJA 3SKJL 5BUAA 4JFZH 3ZQXA 3GO1H 4K4KA 5EIIB 5EOQH 5GSVA 1JWUA 1Q1PA 4TNVK 1FH5L 4NSKB 5DFAA 3ZDWA 4FMKA 3O3DA 4JVPA 2VR3A 1MW0A 3MN8A 4FFZA 3HI1A 4UBDC 1INDH 5FKAA 3CFBA 1R3JB 2P44B 4Y9CA 1F1AA 4MXWH 1W2KT 2APSA 5T3ZH 2YPVA 3D50A 3HIZA 4GKZB 3AG2B 3WUZA 4OIBA 1E9QB 5FDWB 3DGCR 1OT4A 2ENYA 1HDMB 3NK4A 4JL1A 1HZLA 1DUYA 2XICA 3QQ4B 3RWFA 2CDEA 4DKEL 1MHPH 4BWUA 4XB3A 1M1XB 4S0TD 5IW6A 4XGZB 4U6YB 4D0DA 2V0AA 5JW4M 2IG2L 2VLKA 4G6FB 5DD3H 3BAKA 4L18A 1HOCA 4HUVB 4CU6A 4IKKA 4DQOL 4AEIL 3ZHLA 1BG1A 3Q8AA 3WS3B 1KTJA 4GIAA 1GZQA 1U95B 2W9LA 4Q56A 2P80A 3NCFB 4GAGH 2APFA 3OZ9L 5E0QA 2Y07L 5E5MA 2ZOTA 1NCDL 4OF8A 1U8LB 1PX3A 4V2CB 3MRLA 3MHZA 1LVEA 2QTEA 3D3VE 3KLDA 2WBJC 5B1BB 3JWOH 3L9RA 5CHNA 4L37A 1DZBA 2MPVA 2WBWB 1JFQH 4JDZB 3BSGA 1KXQA 1P6FA 2X7LA 2FD6L 3ML8A 4JRYE 1R5VB 4U6VH 3GXPA 4XXCA 5CBEA 4C56A 1QLEH 4TUKH 4LXFA 1ROCA 3N50A 4KVCL 1FP5A 3WSQH 4GKOA 3ULUD 1T66C 1HEZA 1G6RH 1KT2A 1HT6A 2ID5A 2FX9L 5E8OA 2DYSB 3V5KB 4E0RB 2KLSA 1VRSA 2R1WA 5KYYB 3OQ3B 1Z9SA 4G5ZH 1BECA 3ARDB 4Z8FH 1JXGA 1E67A 1N6QH 3KXFD 4NQEE 1ETB1 3FYEB 3OMIB 2D7TL 3V4PA 2KMWA 5DJZA 3T09A 5IMMB 3GJFA 1KZQA 3BWSA 3F62A 4LPXA 1PS3A 3QJZA 1KV3A 4WSKA 2BIQA 3PWVB 3CVHB 1AI1H 4JPKH 5KVGH 3LY6A 4KTGA 3D51A 1ACZA 4WEBH 1SLVA 2HKFH 2ZX6A 1CFTA 2WB7A 2UXGA 3OJMB 7FABL 1AH1A 4P99A 5DS1A 4AK2A 5CD3B 2AJVL 3KHOA 1BJ1H 4W9CC 5E99H 2ZWLT 2K8QA 2J8OA 3NRPA 5DRWA 5GGRB 3TH4T 4MJ4A 1P4BL 5BOZG 2FGZA 3IGFA 4HJUA 4BA8A 4Z7WB 2ATKB 1FAKT 4PTTB 3UDWA 2D7NA 5IM7A 3CPLA 5DUBB 3D30A 2BSBA 5FUOH 4TVPL 5KSUA 4IOFD 1BREA 4ZUTA 4Y2DB 4L8SB 5C6WH 1XL6A 2XXGA 1KOAA 4N2MA 2V6HA 4W4NA 1JK8A 1I1FB 4BRVA 1P53A 2EE9A 1N0LA 5EF0A 5LAXA 5K9QI 3RTLA 4LNRB 3QXWA 3L7EA 1MPAL 1MLCA 3K2MC 3KPRB 4G1EB 4HD9A 4MA1C 4Q2ZB 4CVXA 1ITBB 3SGDH 5GJSH 2AEOA 2FJHB 3BW9A 4TNWK 3QRGL 1DJYA 1RXLA 4NOFA 4XNMA 4JFWA 3QYCA 2ZOOA 3QA3B 4HX1B 3K2IA 4X5QA 2WW8A 4NQQA 4N6RB 4UV4H 3ATFA 3SO3C 1F4XL 1RI8A 4LCIH 4QRPD 2EZ0C 1OAUH 4J3OD 4HZLA 3EJYC 6TAAA 2EDTA 3QJVB 3IT8D 3WY3A 3O4OC 4K5LA 5F7DB 5I8CB 1ZLSL 3AQYA 2O6EA 2BSED 1JMZA 2QSVA 1J8HB 2CJ3A 4MS6A 2QT6A 1OE1A 4OZGA 1EAQA 3F12A 1U30A 4P3CL 1CTOA 1WA0X 4YFLI 5A7EA 5CF3A 3T2QA 4QYOA 4BINA 4L2LA 2EDDA 4ZX3A 1QA9B 2XRAL 4LU5L 3FO9B 2J88L 1FGVH 3K74B 3CD4A 4N87A 2R4SL 5F7AA 4PS4H 1FFNB 1U8CB 5F0MB 3T6WA 1QFHA 5L88L 1AAJA 5EU5B 4HCIA 3CC5A 2N59A 5FFGA 3KXFA 1T6BX 1LO4H 4U0QB 1U2HA 4JM2C 2FEEL 1LDSA 5GS3A 1DP0A 3ULVD 1RUAH 2BSTA 4P2RE 1JZ4A 1NFIB 4OM0H 3U46B 4P23C 4ZBJA 4YBLB 2Z9TA 2YGPA 4F8QA 3EOYG 2YKLL 2FTAA 4JO2L 1IGIH 4LHJB 4X5XA 1J5HA 2Y3NA 4KJWC 4MJIE 1CE6A 4NQDB 1YN7B 4FTDA 3HAEB 1K9TA 5MENB 1MWAH 4MLIA 3LEVH 3D8MA 4FZEH 1E5YA 2ICWA 5T5FA 3PXHA 1J7VR 2W9DH 2OXGB 3BPNB 1YY9C 3L45A 4GXUM 1VADB 4NS0A 2ICEC 4UQIM 1ZWIB 3GS0A 1G7LA 2GJPA 1WE5A 4KQ4L 3RA7H 2RIKA 4Y2OB 4HKJA 2SEBA 4IBTA 4A68A 3VW3L 2E6JA 2OLDA 1KIQB 2A9NH 3P0GB 1QOKA 4WQOA 4G6JH 5E5LA 3T2OA 1B4LA 4FG2A 4WW1B 1K8DB 2UZYA 1GOGA 4V1DB 1JTTA 3N44B 4PP2B 5CMAA 1OOWA 4Z6AT 3SYAA 2DMKA 3TBBA 2XTJD 2D31A 4XOAA 1CZ8H 4QRPA 4HC1L 1F0LA 1TIUA 4W4OA 3TYFA 4MA8L 4RFEB 1F3JA 4IRZA 4ETQA 1S3KL 2H6UA 3L4YA 4DAGL 1LWJA 3UABA 4G9FB 2BH0A 1YEKH 1EH9A 2BSEA 4HLZG 3SPVB 5HYEA 2ZP0T 2Y36H 1HK6A 1KTCA 4JKKA 3FRUB 1E50A 2P26A 4GMTL 1DUZA 4U2YA 3PV6B 2VMDA 2YGQA 3N85H 1A02N 1HJCA 4KHXH 4OLWL 4ZS6D 4HJEA 1JPSL 1J5CA 1P5VB 2Q8BL 1BMWA 4KHTH 4TULH 1E27B 5TF1H 1S7QB 1TVBA 4AV5A 2EYTB 2XIBA 4P05A 4KRNA 3QHTC 1N2RB 4AVJA 2Y1ZA 4QNPE 2FECL 3HC2A 2DDQH 4FXLA 3GTTA 4OCRL 3EF7A 4PB0H 3S96B 2NNAB 3RL2B 4IW4C 1QSEE 3G6JA 3FT3A 3H6JA 2DJSA 3QEQB 5BV7L 1MNUH 3OKOA 3V0VB 2WQXA 2CG9X 4IYKA 2KL6A 1D5BB 2BW5A 3Q44A 2R15A 2V7HA 4OFYD 3L3HA 2ZUUA 2G5BB 4ZUVA 5IGXH 1VKXB 1ZANL 5CLTA 3Q7JA 5DJ8B 5AL0A 5FYJE 3ARFD 3UTPE 2NY1D 3VXSE 5DCCA 4FA7B 3IE9A 3U2SB 1IQWL 3RNQA 3DX6A 5E56A 4P5TB 4O2EB 1UWEH 1H6EA 1KTDB 3MC0A 2G3NA 1DLHB 2X9WA 3ZTDC 4POZC 1OAXL 4MJ5A 2R9HD 3FO2A 2BM3A 2YBGA 3BXNB 1IGFH 1RUKH 1DVFC 2EH8H 3IFPA 4CBZA 1XEUA 2HJLA 4UT6A 5K59E 3L95B 4JDEB 1E4HA 1F6AA 3MNVA 1X5AA 3ORJA 4O4YH 4HIJB 5D7LD 4S2SA 4O51B 3UOAB 1HOEA 3T04D 2BVQB 2Y7LA 2D73A 2F68X 2G5RA 2OMWB 2E27H 3VWJD 4XZUA 5I76A 3VQ1C 1H15B 1UH4A 3P9WB 4LRNL 4OSUH 5CN3A 1LEGB 5EUOB 3ZDZF 1RULL 3T77B 2XY2A 3C60C 5ID1B 3CIQA 3FN9A 1YEFL 4WO0A 3QE5A 3ME0A 4ENEC 5JHLH 2VQUA 4G11A 5KVFL 4L4TD 3H4FA 2JLLA 5FFOA 4N5EC 1LL1A 1FRGH 2D4FA 3UBXI 1R34A 3SBPA 4WUUE 5JOPE 4PJHE 2J8UB 2KDGA 3QUMH 1JNLH 1JNHB 1CFSA 5KVDH 2XETA 3QO1A 4PGBA 4F7EB 2NY2D 4YL9A 3FN0L 1MH5B 2EEFA 2H26B 3Q6FB 3TYGL 4MQ7B 4QYAA 5CU5A 3UJJH 1WBYB 1NUFA 4IOIA 3DXAD 3LH9A 2YXWA 8CGTA 3HZYA 1UQSA 4JB9H 5IIEB 4BM7A 3ZKMD 2QMJA 5C2BL 4PLOB 3JUYA 3WTTA 3D0AA 4K2UL 2LVCA 4PH8A 3SJVD 5BXFA 1AQDA 2VTFA 4QGYA 3S3SA 1DBBH 2AV7A 2IWEA 5JMOC 1UCBL 1CXIA 3EH3B 3SDDD 1IAOB 5IMKB 3BZEB 3R4RA 3GSXB 1HHIB 1MFUA 1KPVB 2GTQA 4OFYA 2ZF8A 1X3DA 1RSYA 2CKBH 2N1TE 3QFJB 5KYXB 4A6YH 1QBAA 5FYKL 3NFNA 3TCLA 4AV4A 1NGWB 2X0VA 3CHQA 4H8WC 4KNSA 4JFXA 5IEHA 2KERA 4XCFH 3L5WB 1WZAA 4CNIA 1UYWL 3GDCA 2BS8A 1IBGH 4DGVL 1XR8A 1IGTB 3DWTA 1CF8H 4NPYA 4EDWH 4F7CB 1HINH 3WIIH 3MRMB 2GITA 3DJ9A 4HUCA 4M93C 2LLLA 1U33A 4E5XB 3AY2A 2NY5C 4ODHH 2XWJA 2CRZA 4C58B 3ZQ9A 1C12A 3BLKA 2XY1A 2HX9A 2MCAA 2QFRA 4PR5B 2CE6A 1I85A 2FJFA 4DPBX 4PLKD 1TJGL 2EIZB 5D7LA 1R24A 2FH6A 3FSAA 3VWJA 5EFIB 3V9EA 1WGOA 2VDLH 1EMTL 5IHZA 2BMKA 2OMTB 1HXKA 3T3PB 3VFTB 2EDRA 2QSCH 2R0LL 3ESVF 3GMRB 1AD0A 3VFPB 4UQ2B 3MCKB 5F7YC 3GSNL 2RGSA 4R97B 2EVGA 1MVUB 4L4TA 2HT3D 4IHBA 4L5FL 1HI6A 4YBQC 4ZW5A 5FA3A 4WWKD 2AJUL 4MNHB 4TXVB 4XXWC 4X8JA 5I8EB 4TPRH 2HFTA 7CGTA 1KFAH 4GSDH 3VXUD 5IOKA 2VL5A 3O41A 1KCSL 1IIKA 3PGDA 4Z0XA 5LGYA 1MN4A 5I19L 3IJYA 1CLOL 3E6FB 4FLQA 3OJDB 1S5HB 4DUWA 4YHNA 2FO4B 4N2KA 2FT7A 3X14B 4BBWA 4GQQA 4QLWA 3JWDL 1MJ7L 5GJTH 4BQBA 5E8PA 4ANKA 5ETUB 5FW8A 1CYGA 3QI9D 5DHYB 3C09B 2HFGL 3LV3B 3S34H 4YJZL 3FB7B 5ACZB 2JCCA 3MRFB 3MRKA 3SJVA 4Z7WF 1E2VA 4GSXA 1NKOA 4QRUB 2WNXA 5LGJB 3SDDA 3W82A 5IBTH 4MJ6B 1BBJB 3FB8B 3IXTA 1I53A 4D8PA 2Q6WB 3U9UB 3B9DA 4ZO8A 5DS8A 1WP6A 3WKML 2AJ3A 1I4FA 4POUB 4MAYD 3NG5A 3D69B 1AS7A 2YUWA 4ODTL 3Q2CA 3DO3A 5C7XL 1NL0L 2RALA 2BVYA 4KX9A 5CLXA 3QXDB 3STLA 3S6CA 2X4OA 4EVNB 4XN1A 3UZQB 5HXMA 2DLTA 4QRPE 2E5EA 3P30L 4UINL 3JT0A 4HUWA 2Y9RT 5IB2B 3LIZA 1RERA 4WFFE 2ZE0A 4OCNC 3KPPA 2C9XA 3DOIA 1P5UA 1KXVA 5E8EA 2OJZL 3J7HA 4ONFL 2ERJC 4GKSB 1MRFL 2PXYD 3N1FC 3UDWC 4GT0A 1M2OA 5GGTA 3O6FB 4HP5A 4APQB 2NW3B 1WFNA 4HEPG 2QQLH 2ALAA 2W94A 4LAJH 4PJIE 4M3JA 1F3RB 1SOKA 3FFCD 3S4SB 1FIEA 3VSTA 1E0OB 3VX0A 2CA3A 3TNMA 2X87A 4HLJA 3DI2B 4XPFH 5ACLA 2IALA 4YXKH 2PYEE 2ZAHA 4L8DB 4Y8AA 1R0AL 4AIEA 5ICXB 4JHUA 3VXME 2OP4H 4K7PX 1RURL 2F58H 3G6JE 4X4YB 1HH9B 2FWOB 1CS6A 1UKTA 5BPPA 5IHUL 2XN9E 3VDBA 3U83A 4JG1H 3NH7L 3PGCA 4WWKA 5HPOA 4OGYH 2MHAB 4ELMB 1TTCA 3MV7B 5HBBA 3LZNA 3VXUA 2ZYHA 3LB6C 3OGCA 5DUJA 1XIWB 3LPFA 1I1CA 3O4LB 5AALA 2Z1PA 3ELAT 4HOMA 2WLJA 4BK5A 1IEHA 4J3TA 5C9JA 3H3PL 4TLKA 5DS2A 1ZLDA 2E7DA 1DL7L 5AAWA 1MNNA 2WWNA 1EHLL 3L4XA 5K33A 1CXLA 3EJPA 3QI9A 2WAQA 4PQXA 1RUQH 1AKJD 4TQHA 1SDDB 5IK3A 4LSQL 2WXRA 5BMFH 1ET5A 1OSYA 3LRSA 3MV8E 1PZ3A 3PWJA 3OSKA 2WIIB 4HWNA 2OYPA 2VMCA 3IDNB 1E3FA 1E9PA 1HSAB 5B1KA 1OSEA 3QWOA 4MAYA 3L81A 2CJSA 4HMDA 4HS8H 1Z9PA 3AVEA 1EBPA 3WFDH 3OR6B 4ELKB 1UHVA 5I26A 1PDKA 2OYLA 2R83A 1NGQL 1FPTH 3PHQA 4FNLH 4ZAKB 4MCMA 4NXKA 4XVSH 4FQQA 1XGYH 4K7PH 3SDCD 1NCCH 1WFOA 2QV4A 4MNQD 2PCPB 3N44F 4N2DA 4KXDA 4S10A 3BUTA 2P46B 2Q8AL 4AEHL 4OY9A 1UACL 3N5AA 4N2IA 2YOCA 1NC2B 3WLBB 3MNWA 5AW6B 5IB3B 2VKXA 1OM3L 3UEZA 3V0EA 3HG1B 1R1CA 5JORA 8FABA 4NLAA 3MA9L 4IDLA 2UZIL 1CFVH 3MGTA 1SDYA 2PXYA 1S9XB 3BD3A 4LARH 1YEIH 4KJYB 3RIAK 1MEXL 2NY6C 1G6RA 2BCKB 4IOFC 4FDWA 4KKLD 2N0KA 4QCIA 1MG3C 2NX5B 3FFCA 4R96A 2O72A 4M6OH 3VRLF 3GLAA 2EILB 4S1SH 2IMMA 3N1QC 1YQ2A 2WZPD 3SE6A 3N55A 1RIVH 4NEHB 1A4AA 4IMLA 5IUSA 4JQXA 5AZ2H 3V6OE 3AFLA 1H8SA 1WISA 4MS8C 4QRAA 1DSWA 4YDVB 3QRFM 2DQGH 1N8ZA 4ETYA 2YA2A 4OCSL 3K2KA 3S8WA 2Z7ZA 4OZHE 5F3HA 1U3JA 1X5ZA 3MRJB 1XF5A 2MQ3A 3RY5A 1JWSB 3QIBB 4FHJA 4R4FL 2MCMA 2ENJA 2VMFA 3G08B 2VXTL 5HD8D 5LCVL 2XFXA 2DQDL 2IIJA 4J3OC 3M8OH 1L0QA 4LGPB 3SE8L 2FHFA 1XGQB 3HMXL 4IGBD 1UG9A 1BIIB 3SEPA 4ZZKA 3WXVL 4X98A 2LHAA 1AXSB 1PW3A 4FQIL 5FYJH 2DL9A 4XMUA 4Y16D 4MD0B 1L7TL 2CU9A 2MCPH 4KKZA 3WOVA 3IRZA 4PRID 4UU9B 1I1AD 1OF0A 4XNXL 5EHFA 3V0AC 5AVRB 4BFFA 1SN2A 1YC7A 2APXA 2J4WL 4N8VA 3APCA 4YO0A 4YZWA 1A3QA 3QFDA 1AKJA 2L7EA 3MXVH 4MA7L 1SJEA 5I1AA 4GI6A 4UWQB 1KUMA 5E6YA 1NAML 1JWMB 4X5PA 2WLLA 5IB1B 1RHHA 4TVUA 5D93C 3WV0A 3GFUA 4M5ZL 5D7LE 2HVBA 1NM4A 4DW2L 4M6MH 1VGKA 2XWBB 3N0PB 4FQ2L 2C5DC 2G75A 1W0YT 3HEIB 1BF8A 4LL9A 3O8XB 5D96C 3UGUA 4HXAL 3TT1L 1EJ6A 2MNJB 3SDCA 4JDTH 5PCYA 4K07A 4MNQA 2PR4L 3HN5A 3RWDA 3WUWB 1EJOL 3HFML 3S37L 2J6EH 1QFWI 5EUOF 1U8PB 4GW1A 4UV7H 2W0FB 4P46C 3KNBB 1HILA 3IF1B 3L9BA 4NN6C 1S7RA 4AEEA 2A9BA 3VCLB 5IFAL 4YDMA 2VR4A 1FVCA 4TS6A 2MMXA 4U7SA 1DJIA 2IGLA 3LMJL 1XQ4A 1DQVA 5HDQH 1WZ1H 3BZ5A 3NIGE 1HYSD 4AG4H 5ECJE 3MPCA 4BHUI 4LBAA 5LLIC 3G5YB 2XV6B 3DXAE 2V2TA 3BEWB 3JV4B 3QBTB 4LHUB 2WZPA 4H2CA 4ALAL 4NQUA 1OAKH 1BM7A 1TEFA 3KPMA 1TEGA 1IT9H 4NKOA 4WW2B 2CUMA 1I3VA 1Q9WB 1MHHB 4GS7B 3AACA 5KVFE 3SQRA 1E8XA 1N8OE 1YEHH 3QVAA 4RMUA 3VXPA 2CBTA 2HWZL 1YRKA 3FTXA 5E2VL 3D5OF 3C08L 1D6EB 1KACB 1LLAA 2PCFB 3Q5TA 4HUUB 4I13B 4UANA 3BCDA 5GISH 3OG4B 4TMPA 1JPFA 2WGNB 4DP4X 4Z76B 2VDMH 4IGBA 5C0BB 2FNWA 2J20A 4G59C 2AXJA 4JVWA 4P5MB 2DKSA 1NCTA 1VESA 3P3TA 3SKJH 3SPIA 4CMHC 1TTFA 3QIWC 5D6CB 4PRIA 4YOKA 3LNDA 3WKNA 3EG9A 1CBVL 4KU1A 1FH5H 2X4PA 2WXIA 4IKNA 3UXFA 5DJ6B 4FA6A 4HEME 5D1XD 1IFRA 1MJ8L 4ZYKA 4PJGA 1VFAA 5FO8B 4WUKL 1YMHA 4PJXA 4ZPTB 1I1YB 3PAYA 4N1CA 5IOPB 1I9JL 1NFDB 3BH8B 4HFWB 5F7HA 2ZCLH 3TFKD 5GXBB 4BFJA 1HIML 1W0VA 1AGDB 4IIQA 2H1XA 1ETA1 1JRHL 3H9HB 1AGBB 5C0AB 4DKEH 3GBML 4N2EA 1KJ2L 4QKTA 3L1OL 3QUYB 4OF7A 3E80A 1QNZL 2IG2H 5JHBA 3T0WA 5E7FA 5CS7A 4DQOH 4I88A 1Y18B 2CCLA 1ID5I 3T3PF 4TTDC 3UBXA 4AEIH 4WF7A 2NY1C 1FSKB 2ZYSA 3EYQD 3DRTB 3VXUE 4XPHL 2JKLA 3OZ9H 4G8FA 5B22A 1XH0A 2Y07H 1NCDH 4ANUA 1NCHA 4K3HA 2H7WA 5DGRA 3CXDL 4AC4A 3MRBB 5AOKA 4Y1AB 5CEXB 1WCBB 3IBEA 3HVNA 3PRZA 5E94B 1A1OA 1ZCRA 2FD6H 4GG6E 3IXAB 4JFEE 1HHKA 4X7SL 1UKSA 5I71B 4AGPA 4KVCH 5BVPH 4UZGA 1O9ZA 4NI3A 4Q97A 1H8LA 5HGGS 3I6KB 4AWJC 3VFRB 1TLMA 2FX9H 5EEUA 1I85C 3T4AB 1JGIA 1XGUB 5KBMA 2H4EA 4P57B 2I9TB 4OLXL 1INQA 4R5TA 2FSDA 1CLZL 2DIEA 2D7TH 4HA1A 4MA3B 4XMTA 4OZIF 1HE7A 4IRSC 3D12B 4Q8BA 3QQ9D 1A6TB 3SE4A 2D8KA 1KLUA 4NUGL 5C3LD 3QDMD 5AVTB 1ZGLA 3BUBA 3IPEA 4OAWB 2XI9A 5IV2A 3QEHB 3S98A 4IS6A 3CSPA 1KEML 3BJLA 3NSYA 4RAHA 3B7SA 4X4ZA 4Z7VA 3DTXB 3VSQA 7FABH 1E5CA 2AJVH 3RQ3A 3SYCA 3BLBA 4FQHB 4P07A 2ADIA 2XACC 4PYHA 1P4BH 2NY2C 3HE7B 1AFVL 1JZGA 1KDJA 1YDPA 2W65B 4KKAC 1NIFA 5D1XA 5D7IA 4EI0A 4L8BA 1SXNA 3WEMA 4TVPH 1U58A 5GS0C 4D0BA 1G1OA 4N85A 2V8MA 3DRQB 5T1JA 4E9QA 4YMPA 1P6AB 3D2TA 4DWHA 5AD0B 4K7PY 3STZB 4GAFB 4Y88A 3FFCE 4K23L 3ARBC 4S0SD 4AVKA 4ANXA 1I8LA 1K4CB 1MPAH 1MZYA 5LBVA 5KYWB 2FAUA 3SDDC 5A2JH 3QRGH 5HHOD 3T0EB 4FFTA 1P1ZB 4F15C 5JHLA 1GRWA 2QKSA 1MAML 1BWMA 5D2NB 1VACA 2NY4C 3CFTA 2D2CC 1FLTX 4KC3B 3FULA 3PAZA 4HMEA 4IM8A 3REVA 1F4XH 2XWDA 3CJJA 3QUMA 3FCSB 3LQMA 4NNXB 3MNZB 3WFCL 4NUJB 4YS4A 5IHHA 1WJ3A 2WINA 1SM3L 1EVTC 5E8DL 1T1XB 2A6DA 2OTWA 3A21A 3PXLA 4O2FA 1ZLSH 5LDUA 5CJQL 3TCXA 3HRZB 1OHQA 3LHAA 1ZSDA 1WS7A 3HCVA 5I1IL 2WKOF 4ELMF 2ZXDA 3A5VA 3A24A 4P3CH 4AI7A 1USQA 4KXAA 4L1SA 3PDOA 4MTMA 4XNDA 4HZ1A 3EYOA 1XH3A 1G9NL 2ARJB 3ZR6A 1P5UC 2P8PB 1I7RA 2XRAH 4LU5H 1QRNE 3SGEH 1KXVC 2J88H 1PMYA 2FL5A 2OM5A 2R4SH 4AY0A 1RZQA 3DX8A 3K6DA 4W70A 5FGBA 1UB5A 2E9IA 5HDWA 2GEQA 5KOMC 3G3LA 5L88H 1DBKL 1IV8A 4OF6A 3P4OA 1VPOH 2MEJB 2I69A 4F93B 1L9QA 5IB2A 4NOBA 2YO3A 1MFBH 4XBPB 2WLIA 3RGVD 3UYRL 4BJLA 2DM4A 4MB1A 1S7TB 2GABA 2VUKA 2CKBA 4Q74A 3WS6A 3GRWL 4AQZA 2YBRA 4Z7UB 3HLAB 2YEZA 3RVTD 3QDMA 3QFGA 3AWFA 4XCYB 5FEBA 3LCYA 2PW1A 4U1MB 5E1IA 5LQBL 4ODXA 4H8HA 2HT3C 1OD7A 1THAA 3PIQA 2ZICA 2EYRB 5I15L 5F7EL 4L8CA 4KITB 2YKLH 4FNPA 1ERNA 2CRIA 3G04A 4JO2H 5TPWL 4YXLL 1FJ1A 5C0ND 1BG9A 1SRDA 3K1KC 3W3BA 4CGUB 5SWZB 1JTPA 3IFOA 4P5KB 4C54A 2ADYA 3Q48A 5AEAA 1PLGL 2YSSB 3LKOB 2DMBA 5TE6L 4LDCA 4JK0D 2EIKB 5FO7B 3QORC 2YUZA 5AAWC 2F54D 4KO9A 4PJDE 4N8UA 3B56A 3CXHJ 3QI9C 4KQ4H 3BKYL 5DJYB 3V0DA 1TVHA 1E9OA 2ZXBA 3MSPA 3VW3H 3F7YA 3PS6A 2XQYG 4TL5A 3A6BL 5J6GB 1A2YB 4UMSA 3MJ7B 4KZDL 1YC8A 4KKBC 3MKGA 2D7OA 5HHOA 1OGPA 2R69L 2ZX9A 3VI3E 1UD4A 3FHEA 5E1AB 2JKIS 2XZAL 3C5ZB 1OSZA 4MAYC 4OBRA 4MD4A 4WFGE 1URZA 2CK2A 4Z5RA 4AK1A 4B7IA 4M1GL 5AVQB 1RUPL 4GW4B 4UQ3A 4HC1H 4G7VL 4XC1H 5FIEA 4MA8H 4X4ME 4PFEA 1S3KH 1ASPA 4XT1C 4PWEA 4RIRA 4ZK8A 4DAGH 3B9EA 2WZ0A 2NYZA 1DQKA 4PREB 4GMTH 4MHHI 1VJSA 1AO7B 5L4JA 3SGEI 1VFBA 3JWOC 3ARZA 1MCPL 4BZ1L 1QRKA 4CVUA 5T8IA 1LYQA 4OLWH 1JPSH 5D5MF 2Q8BH 2HZHA 1LEIA 5DJ0A 1BFVL 2EO7A 2PXYC 4AH2B 4AT6B 4IBQA 5E4IA 4O2CB 2EDWA 3BDXA 1RZKC 3HR5A 5IROC 1J1PL 3GRGA 3S3BB 4OCRH 5DSCB 2FEEI 4PJXE 5D2LA 3CSYB 2AV1A 4NUMA 4PYGA 4AJVA 1Q9OA 3RGVA 3QULA 1S4IA 1WTGT 5BV7H 4NHUA 3QDGE 4RMVA 1NA8A 3DETD 2NUTB 2BY2A 3P3SA 4PJ7A 2QVKA 3PWUA 4AL8L 1WFJA 3G5ZB 1NCAL 3RILA 3DYMA 4WDIB 5TDNA 5SWSE 2GHWB 1ZANH 3PNWA 3RB7A 1TQVA 1Z6JT 1KCBA 1N12A 3O3AA 4J4PD 1DQJA 1PJ9A 1EJ8A 3DNKA 4I7ZC 1JV2B 2O6PA 4MX7B 3HZKA 4AYDC 5JDJA 4QHLA 1IQWH 3BVTA 5SWQA 4ADGA 2IWKA 4TUOB 1VLXA 5DHXB 2UZXA 4KI5E 4AENB 3H55A 1ZGLM 4GUQA 4GNKB 4Z7NF 2KQMA 1ED3A 1OAXH 2QSTA 2R29L 4KROB 1FZJA 2NUPB 3SDXB 2ZOWA 2BOCB 3QAQA 1XDTT 5EV7A 5MERA 2VJ0A 25C8L 3V9FA 3L3JB 1N4XL 1WRFA 5ESQA 4ZODA 4BEIA 4L2YA 4LCUA 4M00A 5L9DL 3CDYA 1OKEA 3RDTD 3ZHKA 5KG9B 4F80A 4CW1B 3U4BL 2GBVA 4U1NA 4X83A 3BPLB 4ZMNA 4HCFA 4CN6A 4OVVA 2VXSL 2Q76B 3BKJL 4LRNH 4JREC 4PRBA 3FH5A 2GPZA 5I28A 1RULH 4D9RD 2HFEA 1OF2A 1PX4A 1PZ5A 4YSCA 4HS3B 1AKPA 4I48A 1YEFH 1AJ7L 3FO0L 3EGDA 1UZ6E 3FQWB 4B5EA 5KVFH 2X0WA 2R0WL 5M94B 5FYLL 1F1GA 2EDEA 3OKNB 2EKSB 3ZL1A 4X6DB 3SDCC 1NGZA 4G42A 5D1QE 1FVEB 2J2ZB 1IL1A 5HHVL 1BXVA 5DDHB 1FL3A 1IBHA 3FN0H 3GKZA 3EW3B 3MLVL 1FFPA 2WXMA 3TYGH 4G8EA 1E2WA 3B9KD 1AG0A 5C0CB 3RWGA 1W8NA 4LEOB 1TQBB 1THCA 4PGCB 1OP4A 4JJ5B 2NOYA 2Y1YA 4U1SA 1F2QA 5C0RL 2FECI 3VD2A 3OAZK 5IJDC 4PVMA 3KH4A 3BP5A 3LN5A 4KKLC 5C2BH 4HIEA 3NEOA 1FO0A 3IYLW 3FU7A 3EJQA 4K2UH 4UNVA 4OV5B 2V9UA 3D87B 4MJHA 5DWPA 3DDFA 2PCXA 1R47A 1FNGA 3MI6A 1UCBH 4PTUA 1D2OA 1O7DC 2P5WE 3B3BA 2HT4C 1ZS8A 3BWZA 4BQ8A 5CZVL 4KVPA 4XP5L 5LUMA 1G9EA 1SUJA 2ED6A 4QOKD 5ID0A 4RFNB 2BHFA 1NFDF 2CDGB 2BVPA 2NPLX 5HYSG 4P06A 1HSBA 2FIKB 1E4KA 4HJGA 4JRXD 1NMCC 1QLFB 1GW6A 4LVHB 5FYKH 1TSRA 5EIQA 1QEXA 2WWKO 1SEBA 4J4PA 3WAJA 2ZP9A 2OAAA 2EXWD 3QQNA 1UYWH 3O11B 5DZVA 4DGVH 4EOWL 4FEMA 1M6OB 3CSTA 3KDMA 2F8IA 5HYJD 4AGLA 1E30A 4B9GA 1IZJA 3MBXL 2ALWA 2BP3A 2L7JA 1QO3B 5TJWK 2CO7B 5D9SA 2VSCA 5DEGB 4N8VG 4TNGA 4HUXB 4IEFA 4B6ZA 4F7PB 4RGNB 3OMNB 4UTAL 4W9HC 3WELA 5J0BA 1EPFA 1T20A 2B3RA 1TJGH 3BPCA 4M8RA 1MFVA 2HSIA 4H5SB 1GC1L 5JPNB 1EMTH 4F3FB 4G7YL 1QMUA 3QUXA 2ITCB 3WIHA 2R0LH 5CSBA 2OMXA 3F7VB 1XCWA 3IFNL 4IIQC 2YR3A 3GSNH