1WA5A

Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
b'PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for the Assembly of a Nuclear Export Complex
pubmed doi rcsb
source organism Canis familiaris
molecule tags Nuclear transport
total genus 54
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wa5A00
1T8UA 4I4LA 4JVLA 1JEEA 5DO9A 1Z0IA 3FGNA 1DAGA 2IYVA 3PEVA 4PZLA 4Q19A 2W6JA 4MUAA 5EE9A 1G17A 2WV9A 4URXR 3BOSA 4CT5A 1GM5A 2DWPA 3WNBA 2CCJA 3T1VA 2JCSA 1GOTA 1W4AA 4IVQA 1NMZA 4TMKA 1P7CA 1JPNA 4LJ9A 2O8BA 3A1WA 1F2TB 3WMEA 3KKPA 2NO0A 3EC2A 3O47A 4BUJA 2GRJA 1T0JB 2C95A 5C4GB 2BJWA 1E0SA 3N5CA 2NOAA 5ELXA 4GRAA 1VG9B 3SE0A 4B2IA 2X77A 4MRSA 2CJWA 4JVNA 4P31A 2PL3A 4R2IA 3QXJA 1OXSC 1GP2A 1XTKA 3O8BA 5KUTA 1ZNWA 3IUYA 5IF9A 2HEIA 1NF3A 1SVWA 1E9CA 4EQ6B 2D06A 1U98A 3CIOA 4M9ZA 2AXNA 2SHKA 4Q4JA 2X19A 3KJHA 3LO5A 5LD2C 1LVGA 1FFHA 4Q1CA 5G3YA 3TK1A 2OESA 2O8BB 1AJEA 4PXAA 2EYQA 3Q7QA 4GOKA 2X2EA 4YMVA 1KSHA 2R44A 1U90A 3CH4B 4AY2A 2XOKA 1A82A 4JJKA 4TYWA 2GF0A 2IHYA 1II9A 3EPKA 2XXAA 4OQFA 3ZH9B 1E2GA 5DYGA 3FKQA 1A2KC 2F43A 3SHFA 4A2QA 3KDSE 1SULA 2J7PA 4HAVA 4KFTA 2BMEA 2O8DA 4F4IA 4Q4JB 4NBSA 1E2HA 1E2DA 5JI3E 1KGDA 1HYQA 3D31A 1R0WA 1CJVC 2IYZA 4AC9A 4NZYA 1C4OA 1G6OA 1KSFX 5AUQA 1CF4A 4PHGA 3P32A 1I4LD 3TVTA 3ASYA 2Z4SA 2ZETA 5FPKA 1TL7C 2OLKA 1Y63A 2WWHA 4MYUA 4P32A 3PENA 3FPAA 1U99A 3MD0A 4Q7JB 4HATA 4OK5A 2XXAB 1A4RA 2NZJA 2WPDD 2FZ4A 2GVDC 5KNCA 1L7VC 1M7GA 1TMKA 4V0MA 2F43B 5DHAA 2CMKA 4KCGA 4B6FA 2W83A 1P9RA 4BZPA 1LS1A 1L4UA 1SHKA 2O8DB 2IC5A 2GJKA 5EXTA 2ORVA 2C03A 4NCIA 2ZYWX 5KTYA 4QRHA 1BMFA 2ZRCA 3BB4A 5CYOA 1XB2A 1OT3A 2FEOA 2WWXA 2WKPA 3EARA 3FMFA 1JAHA 2OCYC 4R2HA 2BMFA 2ZVPX 3AUXA 1G16A 4XSGA 2GETA 4QBIA 1OH6A 2ZJ2A 1DTSA 4C0KA 4GMXA 2MSDB 3ZVRA 3WNDA 2RGNA 2GCNA 4XVQA 1ZCAA 2J7KA 5CK4A 5FTNA 2P65A 2IS6A 4I81A 5FOWA 4FW9A 1GIAA 1KI7A 1J99A 1US8A 2CE2X 4PAQA 3MAAC 3QF4A 3OEHA 3F0TA 3REGA 1HT1E 2X2FA 3B2EA 1E0KA 4IOKA 4TYQA 4EAQA 2IXGA 3CBQA 2BMDA 4PANA 5J40A 4AKHA 3AKDA 3IHLA 1E79D 1RRGA 1KSJA 2C78A 1M7BA 3VHXA 2FGJA 2QGZA 3RRZA 5BN5A 4FXPA 4RSGA 1L2TA 1KI6A 5JZVA 1KSGA 1FNMA 1P2SA 2RGDA 3GFPA 4PZZA 4ZO4A 1IJFA 2PX3A 3N2EA 3AUYA 4NHOA 1W46A 2XB2A 1VCOA 4Q4LA 1TADA 4BASA 4ITRC 1DVRA 4KU4A 2OZEA 4B47A 3A1UA 1US8B 3B13B 3VKWA 2ODWA 2CE7A 1W4RA 3QF4B 5BN3A 5JJLA 4LJYA 5GADl 4MYHA 2GWHA 4B33A 2ZI4A 1P3JA 3DVLA 2EFDB 1G9XA 3BGWA 3SI7A 4N0DA 3HU2A 4EPRA 1YZTA 3GEIA 3GLHE 2E9SA 4C2TA 3QG5A 1OB2A 2A9KA 1Z3IX 3DDCA 4QGGA 3LFUA 2ZJ5A 4K8OA 3K0CC 3WHLA 3ICEA 4WZAE 3SOPA 4HB0A 5AUOB 1TX4B 1T0HB 1GL9B 1KI6B 2RCNA 3EAQA 4ZKEA 4OQNA 4TMWA 2ERYA 1CBUA 4JLBA 4A8JC 2IYLD 1M7HA 5KYKA 1KDRA 4KBGA 3LV8A 2EU8A 1KY2A 1XEFA 1KMQA 2J7PD 1EWRA 1N2CE 5L3RA 1SQ5A 1JJ7A 2P6RA 3A36A 4RKEA 3PG5A 1NVWQ 3QKRB 4XD7D 4XTRA 3TRFA 4TL6A 4C0QC 1SXJB 4KSBA 1SKQA 2FH5B 5K8UA 3BH0A 3Q7PA 2LCFA 1R10A 4BLOA 2WM9B 4AI6A 2REBA 3LQQA 2G1KA 2ZJZA 2ZU0C 3FWYA 4LJAA 2PBRA 2ZUDA 4FINA 3OE7D 3B7GA 4TL9A 3EG5A 3KFXA 1KNXA 4ASUA 3AF0A 2QMEA 1A2BA 1G3UA 2DFKB 2V6JA 3B1YA 1HE1C 3EIEA 1PJRA 4CYMA 1VG1A 4NYIR 3QOFA 2W0MA 4LBVA 3ZJYA 3UMRA 3WXMA 4NTZA 1PUJA 1NL3A 5J47A 3LBNA 2A3RA 4BRWA 1NVVQ 1P73A 2IYRA 4I1SA 1BMFD 3W8RA 3CNNA 4M1SA 1WE2A 4KVAA 1DO2A 3BIFA 3V4RA 1DS6A 2HCJB 4PPFA 4GI7A 2JLQA 4PZYA 3TQCA 3VAAA 2O52A 1GVNB 221PA 2R9VA 1OKKA 4GSYA 4Q7MB 4TSFA 4EIWA 5B30A 3AKEA 4FI3C 1JR3E 5L8VA 1G5TA 1MV5A 2CHVA 2MSCB 5JWRA 1NP6A 4NU0A 1XPRA 1E69A 4DEYA 4KHZA 1X1SA 2IYSA 1VDZA 1XP8A 1E1RA 3OEHD 4TT3A 1AN0A 4V0LA 3EW9A 4Q03A 4MYCA 5FTMA 1IY2A 2ZJOA 2QNRA 4CT4B 3VQTA 1CS4C 1SVOA 4TMVA 2W2VA 2JATA 2IUSA 4BECA 1CR0A 1MABB 2ZIAA 1RZ3A 4OI1A 1Q1EA 1AGRA 1YZUA 5CIQA 1MKYA 1YHNA 2CLCX 2FN4A 2YOFA 5FTJA 4BE7B 1F6BA 3VTKA 4O3MA 2FPLA 4HDOB 4YMWA 1DAEA 4E5UA 4TN1A 1TQDA 4HDCA 1ZAKA 4HB4A 5E7MA 4IXNA 4KFSA 1VCNA 1LTQA 5DI9A 1W0JA 4D25A 1FQKA 3GD7A 2QUZA 2FJUA 4JVMA 4E22A 2ZRJA 1R5BA 3X1DA 2VQSA 4B3CA 3RSLA 3ADBA 4RD2A 2BEJA 4DVGA 1N0WA 5CM8B 1XU4A 4O25A 2ONJA 1MOZA 1XJCA 4LGMA 1S2MA 1SXJD 3BE4A 4J0QA 5AJZA 2CL0X 1IN7A 4F93B 2RAPA 3TQFA 5J4LA 3GLGE 4LRWA 1G6HA 3U6KA 4BFXA 2QTFA 2UVQA 4LV5B 1Q0UA 2FU5C 5J4KA 1E9SA 4X8OA 5JSZB 4UKDA 3TW8B 2XX3A 3BXZA 1KOFA 2WICA 3LWNA 3GPLA 2ZR7A 4WOPA 2DB3A 5JRJA 1NY6A 2NO9A 1FUUA 1H65A 1P60A 4PO8A 4WXRA 1G8YA 1GNRA 3TLXA 3GJ4A 4M8NE 1KNQA 2G3YA 4W5HA 4WAUA 3IGFA 4Q9JA 1QRAA 4ILEA 4RY2A 4WVFA 4M1WA 3Q85A 3BERA 3KFVA 2WOOA 3IKJA 3N70A 2Q9CA 1AQUA 1DAHA 3X1XA 4U5XA 2GTPA 2Z6VA 1FNNA 2KB0A 2CDNA 5IT5A 3ECCA 4DCTA 4II7A 1W7AA 2ZRDA 3KXIA 4K81B 3OHMA 5JFGA 1W36C 3CX6A 2BCJQ 2RMKA 4Q5IA 1KMHA 2A5YB 1KDTA 2BBSA 1CJKC 4MKFA 4NYJR 4XOIA 4FCVA 1FP7A 1KK0A 1YZQA 2JJ1A 4AWXA 4HAYA 4UNRA 5KNDA 1SGWA 4IDHA 5HE9A 4DLRA 2XZLA 1XNJA 1KDOA 3RRYA 3QVVA 1U94A 4GBMA 1V5WA 3I61A 1ESMA 4B48A 3ND9A 2IEYA 4HAWA 1XRJA 2FA9A 2GESA 5KU1A 3ZVLA 4BEBA 1J90A 4A2PA 4NL4H 5GVRA 1OKKD 3QSYA 1KMHB 3WMFA 1X8KA 3NDPA 3DM9B 2ZI3A 3A4NA 3VU9B 4GL2A 2GZHA 2IL1A 1WP9A 3GFOA 4DJTA 5FR1A 1TTTA 4TT3D 4QNRA 4A6XA 5TY0A 1Q1BA 1XTQA 4TLDA 5B58C 5G40A 1NVUQ 5ANRB 4WIAA 2ZRGA 4RZ3A 5E7JA 4BPBA 2EFGA 2F6RA 3L0PA 3SDZA 4AYXA 2XNDA 3BH6A 1KIMA 2ZREA 2IWRA 5A4JA 3NVAA 1EK0A 4JVSB 1YJ5A 2G9NA 4QBGB 2P6UA 3T12A 3GFTA 3GLFE 3LH5A 2GEDA 4FMDF 1AZTA 1LW7A 2ZITA 4JL6A 3I1FA 4RFSA 2PJRA 1P9NA 2ZRIA 2IXEA 1Z2AA 1KTVA 1XJQA 5SZJA 2VF7A 2XEXA 4R9UC 4XH9B 1IONA 4P4UA 4BFUA 4F38A 4DEXA 1FP6A 721PA 3WHKA 1ANKA 1ZUIA 3NEYA 4JLNA 2JDIA 3LXXA 3GLIA 2LWIA 2J59A 1YVDA 3BK7A 5IK2A 2QM7A 2VHUA 2WJVA 1KY3A 1RRCA 1R5NA 1JR3A 2ZJYA 3CPHA 2ZROA 3QY0A 4DLYA 121PA 4B6EA 3MWLA 5LPNA 3S1AB 2CLSA 2V1XA 3AKYA 5EE5B 2BBWA 1HV8A 3AF2A 2XJ9A 1XMIA 3VKGA 4RFSB 2FSHA 2QQ0A 3RABA 2ZRAA 1TU4A 4PSVA 4LHXA 5FUXA 3I92A 4LCBA 3SBDA 5FBWB 3K0SA 1Q3HA 3I62A 2IYUA 1I2DA 1E0AA 3QKSA 4C0HA 5B64A 4Z8XA 2PMKA 3I8SA 4DC9A 1E2NA 4DLWA 3TJZA 4B74A 2XITA 3GLIB 4NYJQ 4ZV4A 1NI3A 2ZYUX 1GRRA 2HDNB 2GJSA 2RGGA 2MMGA 2XTMA 3U7HB 3GCGA 4L9WA 1JXMA 4UXIA 4KVGA 3EZ7A 2GJAA 3SN6A 2FSGA 5DN6D 4TZ0A 1VECA 2OFWA 4NYMR 3TVDA 1TAGA 1CJMA 4JBXA 1G1MA 4IRUB 1AS2A 4G01B 4LUCA 5EP2A 5JS7A 4A0GA 3AVTA 1XF9A 5KSZA 2C9OA 2OCAA 4G5QA 3KL4A 2XTNA 3G5UA 1NBME 1A1VA 1S3GA 2YOHA 3WYFA 1N6LA 1C9KA 1YKSA 3AVOA 2F3TA 4M1OA 4MYTA 1GWNA 1P9WA 1VIYA 4W5WA 2KSQA 3NHBA 4OHYA 1COWA 2V1UA 5F98A 1KI2A 4G5OA 4UXJA 4E03A 3CNLA 2ZAOA 4JLMA 5FL3A 2QAGC 1E2LA 5TB5A 2NPIA 3SJBA 4YXWD 2HT1A 5C18A 3U44B 3AEZA 2TMKA 1I2MA 1IBRA 1Z5ZA 2R8RA 2YINC 3T34A 4LBZA 5BN4A 4QJ5A 1YR7A 1HE8B 2WOJA 4MRPA 3Q8XB 1KK3A 4DLTA 2GZDA 3IIJA 1N6PA 1RIFA 2DFNA 2ZYTX 4BLTA 4LYFA 5DI3A 5FOXA 3X1ZA 4IDPA 2RGCA 2IK8A 1RYHA 2O8FB 1KI3A 2QMOA 4LYJA 1XDBA 5AWFC 4KLNA 1E4VA 4M53A 2O8EA 2AKYA 3FFAA 4DBLC 2VH5R 2WJYA 5EE0A 4B71A 5CDFE 1RPZA 2FSIA 3NH9A 3OIWA 4YQFA 4V0ME 2GKSA 5KSYA 3HU1A 4WA7A 3W6NA 5FUVA 1IAQA 3ZZUA 2VIIA 2OE2A 5LD2B 2E1RA 5A5GA 2DWOA 2CXXA 2NG1A 2VP5A 2H7VA 3HYTA 1KI8A 5AJXA 3TMKA 2FOLA 3UATA 2GNOA 5IK2D 4RD4A 2RH5A 3TAUA 4PAMA 4WBSA 4IOLA 4QHTA 1VYVA 1KKLA 1UBEA 4GPTA 1P72A 2O8EB 4LJ4A 2AKAB 3CZQA 3KB2A 4RCZA 4JLKA 5KPJA 1WBDA 3T06B 1AGPA 4KFRA 1SZPA 2C77A 3N2IA 2ZRNA 4G3XA 4RCYA 3CRQA 4D4LA 3NEJA 1NMXA 3F5FA 4QHYA 3EC1A 3Q72A 4LBWA 3ZDQA 3T1TA 1D9ZA 1G7TA 1PUIA 1G7SA 1ZC3A 3WRXC 4EPVA 1KO5A 4IW3B 3I5YA 3RNLA 3I5XA 4DCVA 4Q4AA 4XWKA 3ICQB 4GFDA 1UADA 4LSGA 3GMTA 4OQXA 2RHDA 3JVVA 4KO8A 5HCIA 4QKQA 3OFNA 1RYFA 2OBLA 4JSYA 3HR8A 4A82A 3ZS9A 4M1MA 1LNZA 1NJGA 2C96A 2FFBA 1BYIA 4OYHA 1HEIA 3C14C 1ODFA 3AVPA 2ZYVX 3IO3A 2RGEA 3PQCA 2ZTSA 4BLQA 1NN0A 4OQLA 1VG8A 1S96A 3CRVA 1LF5A 1HUQA 2O8CA 4TMXA 2NO1A 1W0KA 2KJQA 5FBQB 3OEEA 1KZGB 4MKIA 4YMSA 3E1SA 5D3MA 2WIBA 4TZ6A 2ZE5A 4I1UA 3AF1A 1OH5A 1X86B 4Q4AB 5DSZA 4B44A 2HF9A 2R6DA 3U2QA 3GLFB 1CR1A 5FOTA 4FIDA 2ZS8A 5E95A 4Q01A 3QXXA 1AKYA 2ZS9A 3RSOA 2HUPA 2IW3A 3GJ3A 1EFUA 1NSTA 1D5CA 5HZKA 5EP4A 2J0QA 2BBOA 3KJGA 1EFTA 2HXSA 1GG2A 3H4MA 2AHOA 3QJYA 3NBXX 1E2EA 1OH7A 2B92A 1DPFA 1EFRA 2XZOA 2QL6A 4ZCIA 2QRZA 3GEEA 2WIAA 5AJWA 4QGFA 3ETLA 3IILA 5AJVB 5DNYB 3K0CA 4B76A 4LHWA 2HLDD 3BH7A 1NG1A 5J4YA 3DEFA 3MWKA 5AUPB 4FWTA 2JJ2A 3WP1B 1NBMA 4G5RA 3OIYA 2QN6A 3RS3A 3WRYC 5HPYB 4PSKA 3RWOA 1LS6A 2BHRA 2V55B 3MGCA 5L3SA 3AV0B 4A8JA 3ZVNA 1SVSA 2EWVA 1OIVA 2XJ4A 4M1KA 4NKRA 3SYKA 3V00A 3G0HA 4H1UA 3PJRA 4AKGA 1CKEA 2XSZA 2V4ZA 3UMFA 1ZIPA 3SJZA 1KO4A 5DLQC 1B0UA 2WMOB 2Z43A 1IXRC 3FYHA 3J81k 1LY1A 1OHHD 2ZAMA 4O0MA 2W6ID 3UIEA 2BCGY 3NG1A 3QVUA 3FMIA 3L8ZA 1Z2CA 3D6TB 2CJWB 1LFDB 1ZVQA 3AP2A 3MWYW 1F3OA 4B3GA 1KDPA 4ZDJA 2B8TA 2QI9C 4UNSA 3KQNA 1TQ4A 4FMBB 3CPJB 4MH0R 5H1YA 3QPVA 1GNQA 4KSCA 1EXMA 1YZKA 1MO4A 2JJ8A 4A8JB 1YR8A 5L3SB 3K70D 2VHCA 4A1FA 1LB1B 4NCJA 2UKDA 2W0SA 3K1JA 1OFIA 4IVPA 1G8PA 4L15A 2WSSA 2QE7D 4JBWA 5EUMA 1P4SA 1E9FA 2KBEA 3QBTA 4TLEA 1NNEA 1Z22A 2ZRHA 3U3RA 2FZLA 1CJTC 2J9RA 4P3YA 2Q21A 5KDOA 2PT5A 1CTQA 1RW4A 2D4HA 2H5EA 4B75A 4ZIRA 1WB9A 1FMLA 2OFOA 1Z6TA 2C98A 1XCGB 2ZM5A 1E2IA 4Q00A 3EWSA 3R20A 1ZD9A 2I1VB 2J3EA 2OM2A 5CDFA 4RZXA 5D3QA 4AK9A 3CWQA 3K53A 2QP9X 3MJRA 3QEJA 4BFSA 4TYNA 4OQMA 1P2TA 1RC8A 5EZ6B 4BZXA 1ZYUA 2IHBA 4S35A 2BC9A 4LOAA 3E70C 1O87A 5BWMA 3P20A 1TPZA 2GEUA 3AVQA 3MCAA 1RJ9A 4TQUS 5LB2A 4D80A 5FOVA 1FTSA 1U2RA 2JLRA 4JMPA 4OHVA 4XIGS 3BFXA 4DUGA 3KQKA 1XPUA 4AYWA 4LPSA 1QG2A 1ZC4A 3OEED 1X8LA 2H57A 5FBVB 3GQBA 4ZIRB 2FX3A 1JEDA 1K5DA 2P6NA 4HAZA 4URYR 3D3QA 5FL7D 2CK3A 3SC3A 2ZI9A 3L0SA 3K9LA 2WJJA 4Z54A 4IFEA 1G3QA 1N5LA 2W6JD 1OH8A 1DADA 3W3AA 1HQYE 1J7KA 2VEDA 1XTSA 1E1QA 3BFVA 1W1WA 4PAOA 2PZGA 2WTUA 1RJ9B 2AD5A 5J5CA 2RHMA 4BEJA 4R7ZA 3KB1A 2OCPA 3HDTA 4KAXA 5CJ2A 4I1OA 4KLZA 5K8IA 2WJGA 4DDVA 1P5ZB 2QU8A 3U44A 2IF0A 3WYGA 4QOSA 4OJQA 2GAOA 1XPOA 1MT0A 2REOA 3EIHA 1W44A 1YZNA 1JR6A 4DKXA 1WF3A 5G41A 4ZDIA 1MH1A 2HJGA 3H84A 4QJ3A 3A37A 3DZDA 1OFUX 2LKCA 4V0KA 1AK2A 1U0JA 4US1R 1WCV1 3NKVA 4Q21A 3SYNA 3HR7A 2Q3MA 2FF7A 3O8DA 4YONB 2X1VA 2J0VA 4C4PA 4RD3A 2QM8A 3A4MA 1PLKA 3QNUA 4ZCMA 2NO7A 1E9BA 1II8A 3Q3JB 2QBYA 3ZD7A 3JZAA 1KAOA 3ONWA 4G0NA 4KBFA 4CEHA 4TYYA 2XOKD 4F4CA 3SEAA 1T9HA 4Q7LA 1Z63A 1W5SA 3CUEF 4ZI2A 3FMPB 5EZ5A 1JNYA 4W5JA 2FPMA 1JPJA 4E09A 2FWRA 1J70A 3SJCA 3K0FA 4ZKDA 3AF4A 3AP1A 3LVRE 2ZR9A 2FEMA 3FVQA 3GJXC 3P26A 2QY9A 1F60A 3MMPA 4HUQA 3PXGA 4M21A 3L0OA 3EXAA 2J45A 1G3IA 3ZZTA 1AA9A 4HZIA 3LBHA 2IA5A 3VR5A 4A0HA 3IHWA 1Z08A 3RRNA 2RGBA 4GP7A 4AD8A 2WSSD 2DYKA 1HTWA 1KI4A 3DL0A 2GCOA 4PC3A 1AIPA 1N5KA 4CEHB 1GDDA 4LC0A 2GDJA 4FN5A 1OPXA 2O0HA 3LX5A 3NTUA 3KQLA 2WAYA 3FHCB 2ZUCA 2WWIA 5AK0A 5JCZA 1QHGA 3P4YA 2ASEA 3K0FB 4Q18A 4DSNA 2BKUA 4ZDKA 3B9PA 1WXQA 1DEKA 3FKSA 4HUQB 2FE4A 3I72A 4G5SA 2CNWA 2OV2A 4RVCA 3A58B 1Z47A 1OXUA 1J2JA 4LZZA 3ZZ0A 3EA0A 2MMCA 1KJZA 2WMNB 4M9XA 3AVXA 2HYIC 3VR3A 2UZ3A 3W5JA 4DUGD 2PCJA 1OF1A 4DLXA 3GLIE 3KKMA 2ERXA 4D0LB 4P4SA 4OL0A 4I99A 1NN3A 2Z4RA 1ZD8A 2JLZA 3PV0A 1DBSA 2QMHA 1AS0A 2CK3D 3PUZA 3IBYA 1N6HA 3SZRA 2F7SA 1LF0A 2GCPA 1U81A 1JJVA 3B6EA 4JLJA 4M0LA 4IDNA 2GZAA 3SQXA 2YV5A 1OIWA 5CJPA 4MA4A 1Z07A 3CLVA 1H8EA 4JLOA 3B78A 1XMVA 1UBFA 3K09C 3U60B 4N3NA 4PC1A 1F48A 2ZEJA 1IOZA 3IDQA 4MKGA 4P33A 5FR2A 4P4SB 1GAJA 5JBQA 3GJ8A 4JLDA 1N0VC 3MJHA 4FMDB 1NN5A 2VP4A 3CWZA 3GJ6A 2VO1A 1QZXA 3DZ8A 4D0NA 3AVYA 4HB3A 3JZMA 3HP1A 2FG5A 3B60A 1QVRA 4HUTA 2P5TB 4UJ5A 5JWHA 5C4MA 2C5LA 5FUWA 1KHTA 4LV6A 1TQ2A 3DMNA 1CXZA 4WXPA 4EFNA 4ZDWA 2WKQA 4EPXA 5FH9A 1U8ZA 2A5DA 1HQCA 1GKIA 4GZLA 2JEOA 4R98A 4CRWB 1L8QA 2JIZA 1YR6A 4JL8A 2ZPTX 4PQYA 3EZ6A 2FDCA 2B6HA 2QA5A 3B85A 4RD6A 4DCNA 3K0AA 1X1RA 2D74A 1M1YE 1MO6A 1ZCBA 2V7QA 2WKRA 1TF5A 2CBZA 2ZE8A 4B3BA 1W47A 4PPGA 3MFYA 4N1AA 3RC8A 3SNHA 4XVRA 3B1VA 3SHWA 4B2LA 1IJEA 4JSTA 1G21E 4MDFA 3WBJA 5F9HA 1E9EA 4JT4A 2DHRA 3C41J 4NCNA 3ZQ6A 4JZKA 3G82C 4NYIQ 4BRUA 4A2WA 3PIRA 2RB4A 2I3BA 1G8GA 2EVWX 3TSWA 1G8FA 3U3JA 5FTLA 2QAGA 3C7KA 4DLUA 3QE0A 4HSEA 1K5GA 4O2RA 2J5XA 4ASUD 1HT2E 2AFHE 1FTNA 1SXJC 2VL7A 3K0AB 4D6PA 2C9CA 2F1HA 3MUFA 2N42A 1KO1A 1YR9A 4MRVA 5HKKA 5A0FA 3TSZA 2A5JA 3T35A 1H8HA 3ZGXA 5FTKA 1Z06A 5H70A 1E32A 3CKLA 4HAXA 4QL3A 3K8YA 3U4QA 3A1VA 2R2AA 1VTKA 3W6OA 4FCWA 1K8RA 3UG7A 1S9DA 1MRSA 5HCNA 1NMYA 2B7BA 2QAGB 4TTPA 1JI0A 2PZEA 4JKYA 2DBYA 4HDQB 4PTLA 4TSFD 2FFHA 1OYYA 2J46A 5P21A 4AKIA 3KZ1E 4BFTA 4WW0A 2AXPA 2QEQA 1OYWA 1G3MA 1E1RD 2V6IA 3BD9A 3RC3A 2NTYC 4PO1A 1IXZA 5FI0B 2QORA 3ADCA 4X8MA 2ZSBA 5GJWC 2WJIA 2PCLA 5HR5A 3U4QB 2Q9AA 4P0TA 2PLFA 3PUYA 3U7GA 4NPHA 2CVHA 4D4JA 4DCSA 2D2FA 1QVAA 4JBYA 2HF8A 5CM9C 2RKOA 1GUAA 1RE0A 3VX3A 2ZRBA 1Z83A 1BS1A 1R0XA 1ZIOA 3PR1A 4PC2A 3EA5A 4D4MA 1TEVA 3LAWA 2ODEA 1W0JD 4EPWA 5TARA 2IYWA 3UKDA 1UJ2A 4OBEA 3PFIA 1ZM2A 1OV4A 2F9LA 4G5GA 3AF3A 4LBYA 3CF6R 4MDEA 1Q20A 2GXSA 1AQYA 1E99A 4CIDA 1G4AE 1L4YA 2ZU6A 1FX0A 1CRPA 1E2MA 3H0KA 3I8XA 4LPKA 1TF7A 2QP4A 2CVFA 1IHUA 1XTJA 2L0XA 2R6FA 2QG6A 3ZIAA 5JWOA 3B8HA 3LDAA 1NY5A 3DKVA 3R9XA 4GDFA 2NMVA 3TR0A 2CCGA 2YWFA 1AKEA 1CR2A 1FOEB 4TYPA 4ARZA 1S0UA 5E7IA 2IX3A 3CNOA 2BOVA 3IQXA 3HU3A 1BYUA 1U0HC 2O0JA 4Z8YA 3GJ7A 4U02A 3RYTC 1D8TA 4ESVA 2EWWA 2IF2A 4Q9IA 621PA 2ODBA 5C2JB 3UWOA 1FMJA 4GZMA 4Z1MA 1AZSC 1XTRA 1FX0B 2F55A 1GSIA 3R7WA 3KX2A 5CYPA 3LBIA 3UK6A 1FL9A 1QDEA 2F1JA 4DLSA 3D7MA 4BFYA 4BQSA 3C4JA 2OXRA 2EFCB 2O0KA 2B8WA 2ZS7A 1YZLA 2PJZA 4YDSA 1E96A 3RS4A 1Z6YA 2AN9A 2WVJA 1KI1A 1PV4A 2PH1A 5C1BA 4ARZB 4E07A 2ZJ8A 1UAAA 5G53C 2JJ1D 3QKSB 4OKSA 1JECA 1UPTA 1QHYA 2DWQA 2JA1A 3PUXA 4HEJA 4MRNA 4QFMA 5FL7A 5IDVA 4EJSC 2OHFA 4RKFA 4FWIB 3AGPA 4NCKA 3TIFA 3GEHA 2IT1A 3MWJA 4B35A 4URUR 1PLJA 1NLFA 2GF9A 3H2YA 4LHVA 3UG6A 2IYXA 2J0UA 1SKYB 2BEKA 2ORIA 2GBLC 2ZE7A 2JLWA 3HJNA 3QG1A 5EXXA 4QG7A 3CW2A 3O8RA 4GT1A 4PHFA 1ZU4A 4D4KA 3GP8A 1T5IA 4LV8B 1VCMA 4TLBA 3IPYA 3AB3A 5CIWA 1G41A 1T91A 1TF2A 4OJKA 4XTCS 3T1QA 4Q7KA 5SZKB 4A4DA 4JLAA 3PEWA 4GOXA 2XNDD 2IWHA 2OCBA 1KJWA 2XZPA 4AIIA 1UM8A 4N0EA 2J0UB 4P4TA 3KTAA 4OI2A 3FMOB 2WWFA 1N5IA 5EXPA 4X8HA 1IN5A 1PLLA 2QPOA 1TUEA 2PT7A 4D82A 2DR3A 1VHLA 5UKDA 1ZBDA 2QPTA 4UNQA 3RWMB 3UWKA 2JDID 3OAAA 4PX9A 5DI3B 2ZQ5A 2ZVQX 4DDTA 4JYBA 4PQFA 1QHXA 5AUNB 1M8PA 4C30A 4B3DA 1KAGA 1CEEA 1JR3D 2BVNA 3A8TA 1DO0A 4HZUA 4MGKR 1P61B 5HZHA 4FCTA 2OEPA 2EFEB 3A1SA 3KTAB 4B2PA 2YJTD 3VKHA 3A6PC 4EUNA 4R71A 1UBGA 1TEXA 1UEJA 5LBIA 1GL6A 1S1MA 4PSAA 3T5DA 3TUJC 4AURA 5KSOA 4HAUA 2JLXA 3AVVA 1DAKA 4Q9HA 4NYMQ 2OG2A 4Q4HA 2V54A 4F91B 3ZLJA 3AM1A 4XSHA 421PA 1XD2A 3A1TA 1OFHA 4Q9KA 3U3KA 5C46F 4XJXA 3Q9LA 4D0GA 3I32A 2E87A 5FBLB 3B1WA 2G77B 3DO6A 1PZNA 1P6XA 3I4LA 3SU8A 1XZQA 2LKDA 3FTQA 4HZUB 2ZRPA 4QBFA 3IEVA 1IN8A 1BO6A 3L2OB 3HYRA 2GVZC 1W4CA 2ZJBA 5AR1A 1Q1ZA 3TSOA 2RGXA 3TH5A 1G3RA 1SXJE 4POAA 4LDJA 3LLUA 4TTQA 5F9FA 4Q4HB 2WPDA 4LYHA 3EPLA 2CL6X 2QT0A 4LK2A 4ZPXA 1XD2B 2BKEA 5TDHA 2DPXA 1COWD 1OXTA 1E3MA 1G4UR 1GKYA 2QMUA 2GJ9A 1CRQA 4V02A 2ZI7A 1GILA 4M4SA 2IYQA 3CM0A 2C2HA 4CGZA 2A30A 3QKTA 2ATXA 4LJ5A 3H1TA 4ZCLA 2H8KA 2H17A 3KXKA 4ON9A 3X1WA 4JT2A 2IUUA 1I4TD 1ZM3A 4C0JA 1DAIA 3QENA 2O8CB 2DY1A 1U0LA 1CP2A 3QQ5A 3DKPA 1LV7A 4MGYR 1E9AA 5D3MB 4JS0A 3R8FA 4BWYA 4JL5A 4EQ6A 4ERNA 3MLEA 2ZJAA 3BJIC 3F8TA 4ACAA 1XWIA 5GJBA 1GKUB 5J4VA 5JRZA 1VMAA 2YNMA 1FW6A 2ZSAA 1W4BA 3FFBA 4HYYA 4DDUA 5DYIA 1JAIA 3NXSA 5E3HA 4TLCA 2VHJA 5FUYA 1T6NA 2H92A 1SVIA 2KWIA 1IXSB 3RRMA 2QAJA 3WYAA 1OSNA 5G3ZA 1E79A 2Z0MA 3LW7A 4LX0A 3T15A 3OF5A 3WY9A 2ODNA 4F7WA 1UBCA 4DXAA 1WDTA 1N6OA 4KV9A 1BKDR 5BQ5A 1SVLA 1EG7A 4EKDA 1ZW6A 4PO9A 3QI2A 1D6JA 5FPTA 4DIDA 4M9SA 4DIEA 2PZFA 4KYIB 1M6NA 1WRBA 3OAAD 4Q48A 1UKVY 1M2OB 4HLUC 4F4JA 2VP6A 1UFQA 2NZ8A 2G88A 2D7CA 3KJEA 4IJMA 1ZM4A 3AP3A 2BWJA 3IIMA 4C0LA 3U3MA 2G0NA 3NC1C 4PHTA 3RS7A 2J0SA 2WJHA 1XCMA 3CF2A 2DFTA 3SFZA 1GTVA 4IDQA 3TUIC 1JQJC 2P67A 4LHZA 5LB4A 3NHAA 5DH9A 1XXHA 2QP3A 3LNCA 4D2IA 2WWWA 2V9PA 1KZ7B 4LHYA 5KHOC 1XEXA 3BS4A 1DAMA 3FOZA 1Z6GA 3JVUA 3BRWD 1T3LA 5BXQC 1F2UA 1OW3B 1YZGA 5KOYA 1ONBA 3NBZC 4L5BA 3QUSA 2GILA 3HWSA 4Q1AA 4Q02A 2IYYA 3AQ4A 5DGXA 1KYIA 1VCIA 2PEYA 4XD7A 2FFQA 4OI4A 3TNFA 3KUCA 3OFND 2IS1A 3RDPA 3L82B 2BIFA 4G1UC 1UF9A 2QTHA 4IVRA 4LY6A 4TQ9A 3E5HA 2VYFA 2Q3HA 1IN4A 2ZI5A 2OAP1 1P75A 1XXHB 2BDTA 1DARA 4Y0VA 4LJ7A 5F2EA 3OE7A 1Z0FA 1N6KA 2H18A 1ZJ6A 1W0KD 4A36A 1JALA 1XEXB 2QGNA 1SVKA 3C16C 4TL8A 1U9IC 3K09A 1YE8A 3K70C 1F2UB 1TQ6A 1II0A 1XZPA 2XB4A 3QBVA 3KQHA 2N46A 4BZQA 1ESNA 3ZYCA 2YHSA 5FPHA 4BFWA 2ZANA 1S1CA 4HLDA 4IOMA 5FPYA 3LQRA 4B73A 1Z6XA 5JS8A 2HYDA 3UANA 3PCRB 3VR1A 1Y3AA 2GK6A 1X3SA 3L43A 1IY1A 1XTIA 1EFRD 1E2FA 4TWZA 3M1IA 5IRCD 1NKSA 2ZRMA 1Z8FA 1E2KA 4IOJA 1JB1A 5KPDA 3GJ0A 2WSMA 1NVVR 3IPXA 3W6PA 5FFMA 1ZUHA 3EZ9A 3TR5A 5CLQA 3THYA 1D2EA 2QZ4A 3QPWA 4QNMA 2REXB 2JJ2D 1NBMD 2EFHB 3BORA 4B3FX 6Q21A 1R7RA 3M6AA 1G8HA 1R4AA 1CIPA 2W2XA 3B82A 1J8YF 1IN6A 4QBHA 4U00A 4IEEA 3BB3A 5L3VA 2VA8A 1GFIA 1VPLA 2G6BA 2XSZD 2ZRFA 1V43A 1ZNXA 4GOJA 5B2ZA 3WP0A 3SYLA 4C0AC 1VHTA 4A0FA 1R8SA 2JGNA 2P3SA 1AM4D 1R5OA 821PA 2FNAA 2OBNA 5B57C 3TE6A 1F5NA 4C3ZA 1T3SA 4UNNA 3CR7A 3TBKA 4IKEA 3THYB 1P2UA 1NKTA 2C04A 3CF0A 1D2MA 3QKRA 4NP6A 1CR4A 3C15C 1YU9A 5CLLA 3AKCA 1G7RA 1SXJA 2JLSA 5EP3A 1GITA 4MQBA 4NMMA 2HCBA 4DLVA 2AD1A 2EW1A 1GRQA 2JASA 2V8OA 3BC1A 4AKEA 2J41A 4WZ6A 2IBMA 1AS3A 3CZPA 3I73A 4URZR 4KITB 2QQEA 1II8B 3RANA 2B21A 2QBYB 1FZQA 2PLRA 5KO2A 2V3CC 1XFAA 5KSPA 4HLQB 4UXHA 4M1TA 5IHPA 4DLZA 1OB5A 1QBKC 3CRMA 1XMSA 3FHOA 4B43A 4Q9LA 2VRWA 4JKIA 1XCPA 5CB6A 2Y8EA 2BMJA 3V4FA 2W58A 3WNCA 2BM1A 1YRAA 2ZR0A 2JLVA 3SJAA 3THXA 1MO3A 3GJ5A 3REFA 1W36B 2OUKA 3KKNA 1UKZA 3KKOA 4X8LA 2CEAA 2W00A 3C5HA 3ZQJA 2Q0HA 4D26A 2PEZA 1ZMXA 4DB4A 2ZSEA 3AVWA 2GA8A 3L8YA 4U7DA 5J4HA 4L8GA 521PA 4LYAA 1G7CA 1OIXA 3RHFA 3K0EA 3TAHA 4ZI3A 1HH4A 3OESA 3B1ZA 4ABYA 4OI0A 3H86A 3CH5A 4PC6A 3EX7C 3I3SR 1JBKA 2QSZA 2GCOB 1ELOA 2WWGA 1N6RA 2VP2A 2J1LA 4TL7A 2NGRA 4C0BA 3VMFA 1GL7A 5H8WA 4CVNA 3X2SA 2H16A 1QG4A 3CR8A 1W49A 3W5IA 4BFZA 5JCPA 3RLFA 4CF7A 3OIVA 3ZVMA 2Z5FA 3B5JA 4M9QA 3THXB 4F92B 5SZIA 3R8CA 1T8TA 4Q1EA 1Z0AA 1FPMA 1MABA 4B3XA 1E0JA 4S2EA 1E1QD 4PQRA 3WMGA 1ZP6A 4I1VA 4JIMA 1Z0JA 2OAQ1 2R6GA 1NJFA 4UJ3A 4Z51A 2RGAA 1NIPA 3NWJA 4DCUA 2PMDA 1DAFA 2AX4A 4CZ2A 1Q12A 1WQ1R 2BV3A 1YRBA 1N5JA 5M04A 1VYUA 1CU1A 2CHQA 1T5LA 2H1LA 1EX7A 2GXQA 3DM5A 3QIAA 3LY5A 5EE3A 4ESHA 4YMUA 4LI0A 1E2PA 1S3SA 3O8CA 4BFVA 1UDXA 2YWEA 2OSBA 2XNSA 4C0SA 3U7EB 4A15A 1SKYE 3NBYC 4Q47A 3KKQA 5JLJA 2EQBA 3LVQE 3LW8A 2QSYA 1EFCA 3C5CA 5JECA 1ZNYA 1HA3A 5GVSA 2R62A 3KQUA 3CO5A 3MG9A 1XBTA 2RGNC 3A4LA 3CONA 2AR7A 2OT3B 3CB4A 2YC4C 1QHIA 3VNUA 1YQTA 5JSZA 1XMJA 4V0NA 4QGHA 2EYUA 4DSTA 4QJ4A 4GNKA 4EFLA 5DE3A 2QTVB 5JMTA 2F9MA 4YLGA 3SBEA 4DZZA 1XEWX 1RVDA 3U3OA 4V03A 1OJLA 1N6IA 2D2EA 3DMDA 3QKUA 2HT6A 3U7FB 3W3ZB 1XEWY 3HPRA 3VR2A 2FSFA 4AYTA 2QRNA 2WHXA 2VP0A 1UKEA 2HJVA 4OHXA 1W36D 2VTKA 1R6BX 2VSXA 1A5TA 3P27A 3RS2A 3VX4A 4DT1A 2VPPA 4US2R 2C99A 4KXFB 2AL7A 5KNBA 2AWOA 1DE0A 3DOEA 4PC7A 2NQ2C 1S8FA 3OZXA 4US0R 2C8VA 2AK3A 3K9GA 1FUKA 4EJSA 3MSXA 4M22A 5GJVC 4DSOA 5TXGA 2DCUA 4L4UA 3IEUA 3W9YA 4EDHA 1BH2A 1QHHA 2KE5A 4C2UA 3W90A 3FB4A 2VHTA 2A5FA 5EP1A 5HTKA 1GRNA 4DDWA 5TMPA 1KI9A 3UPUA 4NCHA 3ZD6A 3K9HA 2GBLA 1J8MF 1G291 5CITA 2D3WA 3X1YA 1UKYA 1W2HA 4QC2A 3K9NA 4V0OA 5FI1B 3RAPR 4DT1B 1NSFA 3FKSD 1B23P 1OXXK 5DN6A 1EWQA 1E94E 2CNWD 4CEIA 1R0YA 1Z6AA 1FQJA 1M34E 3PEUA 4Q66C 1Q1QA 3NBFA 2IEZA 4QM6A 1TUIA 2YZ2A 2IXFA 1JXOA 4DB2A 1E98A 1K6MA 3RVBA 4W9MC 4EJSB 1QF9A 2MSEB 5EE1A 4LJ6A 1GZSA 1UEIA 2NPFA 1NLYA 2P2LA 4W7SA 3KJIA 2NO6A 3VU9A 1SHZA 1X6VA 1QHHB 2ATVA 3PUWA 5BW8A 5E4FA 3GLHA 1E2JA 3QPUA 4JYCA 3DHWC 3U6BA 4AG6A 4OHZA 3THOA 4KODA 3ZS8A 2IS2A 2XTZA 3LLMA 5TV2A 3LA6A 2A78A 1P62B 2G1JA 5JJIA 2GJ8A 1N25A 3FE2A 5K8LA 1RRPA 2ZSDA 5LDDC 1OE0A 5DISB 2GXAA 2BJVA 3KXLA 2Q3FA 2ANBA 2JAQA 3EZFA 1P2VA 4PFSA 3NC0C 4YXWA 1H8ED 4CEIB 1W2GA 4QGAA 3SS8A 3WBKA 2FFAA 3B9QA 3LRPA 2ECKA 2W2TA 4KJZA 4BLSA 4XVUA 4QM7A 2VSFA 2O5VA 2ZSFA 2FV8A 1I4DD 4K46A 2G0TA 2F3RA 4KI0A 4H9GA 2VSOA 3Q5DA 3TKLA 4LWZA 1KK2A 3U5ZB 3GLHB 1D2NA 3CPEA 1G20E 1DELA 1NRJB 2P5SA 5CB8A 5L3QA 4BLRA 1BOFA 1UDWA 4C7OA 4A6PA 2Q6TA 5JJKA 3TGPA 4PPQA 2IUTA 4B34A 2F1IA 1Z0KA 3SFVA 1N3BA 4M1YA 3T61A 1KO8A 4L9SA 1Z0DA 3S1AA 1GNPA 5KDLA 4Q1DA 3FDIA 4TQAA 3ASZA 4TLAA 3THWA 1KJYA 2ZUBA 4URVR 4TMZA 4M2LA 4B32A 1QHNA 4JJZA 2Z83A 1KK1A 3UMSA 2X8AA 5DIFA 4MGZR 1W5TA 4HLCA 2JIZD 3NIBA 3V9PA 3VHLB 2IS4A 4IFBA 2I1QA 3M4YA 1M74A 3PEYA 1VKJA 2N1BA 3CX7A 4DHEA 4NDZA 4QXAA 4BGDA 2WBLC 5L3QB 1OXVA 2BM0A 2V7QD 4C7OB 3FHTA 2J87A 4H1VA 3W34A 1N6NA 3NH6A 3VFDA 2IYTA 2OO7A 1C1YA 3QEOA 4JLVA 3IQWA 4MRRA 5FPSA 3D8BA 2ZI6A 2QROA 4RD1A 4HB2A 3EZ2A 1ZRHA 1RFLA 3LX8A 1E9DA 1U8YA 2R6CA 3KUDA 5DHFA 3IO5A 5FOUA 3BWDD 4IHQA 1RKBA 5JI2E 4ACBA 3THWB 1O3YA 3ND8A 3UXMA 1E9RA 1X8JA 3RS0A 3L0IB 1HY3A 1E4YA 2I4IA 1VG0B 1XJ0A 4NH0A 4Q1BA 3R9IA 3AVUA 1TU3A 4Y0AA 1G18A 4URWR 2OBMA 4JLPA 4UQOA 3PITA 3RS5A 2WZQA 3LD9A 1W48A 5SZHB 5H68A 4D81A 2HV8A 2YVUA 2OXCA 1DG1G 1ZM9A 3P4XA 2GXUA 1G5PA 1Q44A 2ORWA 1A7JA 3PVSA 4MGIR 5HKKD 3Q5EA 1H8HD 2YWHA 2JLUA 4L16A 3CRW1 1G64A 2FGKA 2GK7A 1VIAA 2AK2A 4FMCB 3T1OA 1Q22A 1XD8A 3EASA 5CK5A 5TVKA 2XGJA 2CHGA 4TTRA 3BFKA 3R7WB 4IDOA 1Z29A 5K8TA 2AWNA 2F1RA 2NIPA 4BLPA 2OFXA 3OIUA 1IM2A 5F3WB 1E6CA 4MUBA 4TMTA 2FMXA 3GLGA 2AFIE 4DRZA 3R9WA 4UNPA 5HE8A 3P1JA 5JEEA 2A7QA 4RD0A 2O8FA 5BYKA 1OLOA 1CJUC 1XXHE 1R8QA 2Q9BA 1DOAA 1NLZA 2QENA 3CX8A 5JEDA 3AGQA 4XWOA 1Q57A 3DPUA 3VR6A 1IY0A 2A2ZA 1MO5A 1PVOA 3BBPA 5FOSA 4CW7A 5EJEA 3B1XA 4HLUA 1E2QA 4RJLA 1OFTA 5JHHB 3AH8A 1N0UA 1ZUNB 2FPKA 1HURA 1ZNZA 4DSUA 4CDGA 4GP6A 1WBBA 2R65A 1SVMA 3EPHA 4PR0A 2VLIA 3GLGB 4QHSA 2YKGA 2HLDA 5FBRB 2VP9A 1BIFA 3LXRA 2BBTA 5EUQB 4IXMA 4YC7A 1MR3F 2VBCA 4RZUA 3TW4A 5KDDA 2CCKA 1CULC 2G83A 4PHHA 1S4QA 1TNDA 2D62A 4OK6A 2C9YA 4HI0E 1WA5A 1ZINA 4PPNA 1NG9A 2GAAA 3HPQA 4FD2A 4NE2A 2VHQA 5BYJA 8OHMA 3QXHA 4OHWA 1NN1A 1RRFA 2ZRLA 2B7CA 1OHHA 3BB1A 5JHGB 2W6IA 3PUVA 4Q1FA 3QXSA 3ZIAD 2OILA 4CEJA 2ONKA 3QF7A 2CLDX 3MRSA 1R2QA 3EPJA 1Z28A 3NDBB 4EPTA 2A5GA 5GJCA 4A9AA 1WMSA 2YOGA 3C8UA 1D9XA 3SR0A 2GEVA 1VYTA 2UZIR 4LJ8A 2XAUA 1G5RA 4O2LA 4YDHB 1CLUA 2OLJA 1JQLB 3CRRA 2ZXUA 1R0ZA 2ANCA 1U9IA 3F3YA 1EX6A 1Q21A 4RZ2A 2YYZA 4C9BA 2YC2C 3EWAA 4Z1MD 1IQPA 1DG3A 2KBFA 1U8AA 3BAFA 2DFLA 3QXCA 4AG5A 2QE7A 1QHSA 1G19A 3VR4A 3EIQA 4GMDA 5EXSA 4KYUA 1S9HA 1KKMA 4A92A 4CEJB 4EFMA 3W8NA 2PX0A 4MKHA 1T3HA 1EFHA 4MITA 2JLYA 3IBGA 3TUZC 5AJYA 3GLFA 4IEIA 3T5GA 3U61B 1ETUA 1NVXQ 2ZE6A 4KFUA 2HXYA 2VF8A 4FMCF 3ADDA 2GHIA 2QT1A 1XX6A 4OK3A 3DOFA 4EPYA 5EQTA 2WWYA 3K70B 3E2IA 4WZBE 1MRNA 4RFVA 1F2TA 3M0EA 3SQWA 3IIKA 2YWGA 4A0RA 2K5UA 2D7DA 3ADKA 4XWAA 2KI5A 4NONA 4DWJA 1ZU5A 2R6AA 1Q3TA 1XD9A 1EGAA 4LC1A 1EESA 1NIJA 2ZRKA 1KO7A 3VNVA 2QPAA 2P0EA 1T4GA 2WAXA 1ZM7A 2CL7X 1ZD1A 4YMTA
chains in the Genus database with same CATH superfamily
1ZHFA 1JWBB 1ZGGA 2BGJA 4UU0A 3LA8A 4BN0A 4IDEA 1RI4A 2I6FA 2FPSA 4PZLA 4Q19A 4CMHA 5AK4A 2NZWA 3TCNA 1L5LA 4R51A 3ZX5A 1Y5NA 5F5LA 4GEKA 4CT5A 4X65B 5KC9A 1GM5A 2CCJA 2X9GA 5AJUA 1G42A 3T1VA 4DNFA 3MMZA 2H3HA 1NMZA 1ZMRA 1ZRSA 2HU5A 3PJEA 2VYND 1E5QA 3PPIA 2O8BA 4PBSA 1F2TB 2G71A 3TD9A 4R81A 4K5QA 3WMEA 3UWMA 3KKPA 3MQ4A 2GRJA 3TD2A 1E77A 1QUEA 2R3SA 3OT1A 5CXSA 4K1LA 1L1FA 4FYIA 4GRAA 2HK8A 2EX4A 2X77A 2CJWA 4MRSA 5J2UB 4D5GA 1N77A 2Z9DA 2XDQA 4R2IA 4UREA 1XTKA 3MK31 4MTLA 4XDGA 1SVWA 4WJZA 1E9CA 4F86A 2D06A 2X0NA 3L8FA 1MW9X 1VI6A 2H7XA 3CIOA 2EQ5A 1LLFA 4IV5A 1MZPA 4ZHQF 2AXNA 5DBEX 2SHKA 3VYWA 4QG3A 3KJHA 2XVMA 2H1WA 1Z4MA 3KWJA 4PTZA 4ZN6A 1RHUA 1SD2A 1PZEA 1LVGA 3UGKA 1GQOA 2CZGA 2OESA 1AU9A 1JG3A 2Q4TA 3PDJA 5G3YA 3TK1A 2WQ6A 1GGFA 4GOKA 3LK7A 4WV3A 5PGMA 4EG0A 3FYTA 1P7PA 3RBZA 2B4AA 4GOOD 2PV0A 1KSHA 4UHDA 1A5SB 1E58A 2R44A 3ZD9A 4B84A 4HNAA 3FNQA 3LF2A 4BNDB 1EP1B 3Q40A 4JJKA 2Q7DA 2GF0A 1R4MB 3TM5A 3EEFA 4EYOA 3OX4A 1IBCA 3IDOA 1QP4A 3EPKA 3MWDA 5AT1A 3ZH9B 3C7DB 2B3TA 5GIOE 1OLSA 2XDQB 4FX2A 1C3OA 4I1PA 1VA5A 4EHAA 1PF7E 3FWKA 1K06A 1GSHA 1VHWA 2XF2A 1IZ7A 1SULA 4MVJG 2J7PA 4Y6GB 4D1YA 4XQGA 4RTNA 1GEGA 3RIYA 5FA5A 2YV3A 3U80A 2IDZA 3SBXA 4E11A 3ZGYA 4KXNA 4EHKA 5B37A 4JR1A 1I14A 5JVDF 4PICA 1CUZA 3CSDA 1AQIA 2CUTA 3VC1A 2JKYA 4KPUB 5IKXA 2PMBA 3B9RA 5JSKA 3Q8MA 5BWOA 2CLOB 5A5EA 3PXCX 6YASA 1UXHA 1G6OA 3DDOA 4XA8A 1DJPA 3TVTA 3UJDA 5BRJA 5K99A 1CF4A 1TYZA 1H4SA 2HRRA 5FPKA 2OGTA 4L57A 3CINA 4TTJA 1U4NA 5DT2A 2FWIA 2AEJA 2WWHA 2WW8A 3WQHA 3FPAA 3MWDB 4C2AA 2P30A 2P2DA 1BKYA 4HATA 4P80A 1OLSB 2C0PA 2FZ4A 5DOVA 4E1BA 2FXIA 3I04M 1C3OB 5B6PA 1L7VC 4KQCA 4V0MA 1ZXXA 3B1FA 1I51A 1ZRNA 4DNQA 5DDIP 4PS0A 1V71A 1SUFA 1IG0A 2X2PA 2ISQA 1QIIA 2A9JA 2GPJA 2Q3LA 3O1IC 4LSZA 5EWLA 2ORVA 3UV3A 3W1EA 1F8FA 3BMNA 2ZRCA 3X1MA 4E3WA 2WLSA 4U2GA 3AY0A 3NTVA 1XB2A 5IM4A 2FEOA 3FOCA 2WKPA 1CZUA 2R751 2DSTA 2ORYA 3AUXA 3NATA 4QBIA 1OH6A 2P91A 3ILYA 1QJ4A 2X86A 4O4LF 1DTSA 4GMXA 1L5KA 1BROA 2W6CX 2XUGA 2ACVA 3KPYA 3S1LA 3T94A 4WL0A 4D8YA 1S2NA 1IY9A 3FRIA 4IQ4A 1XSEA 5ELLA 2JFZA 1ZCAA 3PHGA 3WGHA 3ZNNA 5BQFA 1QONA 3PXDA 2IS6A 4I81A 1P2FA 5FOWA 3RIEA 1GIAA 4ZJUA 2B0JA 3B3JA 3H1BA 4PAQA 3ZH2A 3GRYA 1ZR2A 3KZVA 1PTKA 4EITA 1PK8A 1XK7A 1SWWA 2V65A 4ZAGA 2EHJA 1CF9A 3H2ZA 4UULA 4IOKA 4BJ5A 1R16A 2G82A 2JD2A 2E5LB 2A58A 4MCHA 2IXGA 1QDLB 5CLJA 4AW9A 5CCBA 3K16A 3GELA 3BMNB 1KFBB 3M6LA 5M3BA 1E79D 1FMCA 1KSJA 3SVTA 3HYSA 5BN5A 1GYQA 1EHIA 1XZIA 3A6KA 4RSGA 4YPOA 2VKTA 1NVAA 5JZVA 1FNMA 2JAXA 4QSMA 1A9RA 2AW3A 1XRRA 2RGDA 3GFPA 4XWGA 3N2EA 3CR3C 4G4JA 3AUYA 4NHOA 4UD2A 5LC1A 1PD0A 2IOQA 4DR7B 1ZGBA 4BASA 1JHZA 4RMJA 1DVRA 1JH9A 2I2CA 1FLVA 4H7EA 2OKGA 3N7AA 2OCIA 3N2YA 3E2MA 4HUJA 5IJ0A 2UU9B 3QFRA 3R6TA 4R3WA 5FF9A 4PFQA 1ULHA 2GWHA 2WD8A 3E82A 3WL7A 4B33A 3ONFA 4CE6A 3BGWA 1G9XA 4R05A 2Z9BA 3QI7A 3G59A 3Q3GE 4M7WA 1YZTA 3GEIA 3GLHE 3O8OB 2PGIA 1Y1LA 4P3NA 2A9KA 4QDZA 4QXOA 3TVYA 3WHLA 4BBZA 1OB2A 2NUTA 2RDMA 4MPRA 3SOPA 4HB0A 1P4AA 3N2ZB 5AXAA 2GZSA 1L4GA 3EXG1 3NETA 1T0HB 1GL9B 2AX3A 3RYCA 1J33A 2ERYA 4XLTA 3VO9A 4GHWA 3CLHA 2A86A 4LOLA 5T7BA 4ER6A 2X15A 1BVHA 4XJSA 2IYLD 1SRRA 3PA8A 3WIEA 4DF3A 5KYKA 4HVCA 2CD9A 1MX1A 3LV8A 1N34B 2FYTA 1CPYA 3OZDA 4LXIA 1KMQA 1MPXA 1EWRA 2J7PD 4UEKA 5L3RA 5IJ0B 1SQ5A 1OLXA 3N8GA 5KVCA 2OBFA 3QKRB 2FLVA 5CBPB 2J07A 4XD7D 3BGVA 4C88A 1BW9A 5FWNA 3IB3A 4J16C 1Z7WA 1E4OA 4QOHA 4TL6A 2FN3A 3TFWA 4C0QC 4LNUA 2FH5B 5K8UA 4EA9A 3IOMA 2VQFB 3FLMA 4BNZA 2LCFA 2NUTB 4JVOA 5C1DA 3P52A 2ST1A 2GM4A 4AI6A 2REBA 4ZEOA 3GRCA 3W5AA 2VTEA 4IHAA 2ZU0C 2ZWOA 4RJTA 1EWYA 4DMLA 5DYNA 2EG9A 3RYCB 1D03A 1L8LA 1WXXA 3NHJA 1PEDA 2QMEA 3UENA 5BSWA 1MOPA 2PKWA 1HE1C 3LE8A 5EESA 3OE5A 2IPAB 4CIXA 2V45A 2I8CA 3D59A 4YRGA 3UUEA 3LPCA 3VNAA 3LBAA 2W0MA 4EVRA 4JHXA 4LBVA 4YAKA 3MS2A 2YDYA 3UMRA 1OLXB 1XLTA 4PBTA 3TPZA 1H9BA 3BTSA 3W2EA 5IYZA 4PU0A 5JU6A 4Y1RA 2JFVA 3AM3A 3U4IA 2VTVA 1BW9B 1IUPA 1JE0A 3ZCQA 3E22A 2VXCA 3W8RA 2WUVA 4LNUB 4AS2A 1WE2A 2HJSA 3TQOA 1WP4A 4F97A 4GC9A 4WFJA 1KQPA 3JTMA 1DS6A 4WUTA 4V1CA 4D43A 2HCJB 4PBRA 4PPFA 2QJOA 4W63A 2JLQA 3TQCA 5JNUA 2R9VA 5JASA 1JKXA 4R1LA 3WS7A 2IU3A 2C2XA 2JZCA 1JR3E 3E9MA 4XR9A 1G5TA 1MV5A 3DB1A 2CHVA 3T52A 5KI6A 5IABA 4A91A 3EGDA 1NP6A 1OYOA 1VSUA 4NU0A 3USCS 2FMIA 2G70A 2IZ5A 2O3QA 2W7TA 3Q98A 4KHZA 1G5HA 1X1SA 5F1OA 2A1IA 3TX6A 1VDZA 1E1RA 1U1FA 1MC4A 4V0LA 4EEZA 3C6BA 4OXIA 2QNRA 3DE1X 5IYZB 1U28A 5JPIA 4Y1RB 4TMVA 3O4GA 4BECA 1J9ZA 4QUKA 2ZIAA 1ND5A 3E22B 2C2BA 2F3SA 4EI9A 3PE4A 2WTXA 1MKYA 1LK0A 3FPJA 1SXQA 5FIUA 1BDIA 3AR3A 2H31A 3DEKA 3OJLA 4IH1A 4PIVA 4O3MA 1CIVA 4B85A 1A77A 1GNVA 4C3VA 3QJGA 3TW8A 4L72A 2H2FA 2RAFA 3MRVA 1DCFA 2M1XA 3INTA 2O07A 1ZMBA 4L75A 1ZAKA 1F0KA 4J1NA 1GKKA 2AGVA 1NJ1A 1VCNA 1LTQA 2BMWA 2Q3CA 3EGDB 4KFSA 2XW6A 1FQKA 4X20A 3Q3HA 4X44A 5DI9A 2FJUA 2D7JA 4JVMA 1WTAA 3K92A 1R5BA 2IIVA 1DC5A 3SS9X 4K9SA 1OTHA 4C04A 3HCWA 2BGNA 1FJHA 3CGWA 2BEJA 4TLLB 3KLMX 5DTRA 2ONJA 3VDMA 1XJCA 1S8OA 3ICPA 3RT1A 4FKMA 4LGMA 4F93B 1YS4A 2PKRA 3TR6A 1A27A 2CWDA 1VIVA 1MC8A 2WAMA 1QIFA 5EZYA 4ABTA 2FU5C 5AVKA 5J4KA 3DLBA 2VSQA 1SHUX 4F8YA 5TEVA 1V3VA 3TW8B 2XX3A 3BXZA 1KOFA 1JYFA 2Z5LA 1JR4A 4OHRA 4KJXA 1MX3A 1KOJA 4MMYB 1T6XA 4ALIA 4X20B 3UPTA 1NY6A 1NYRA 3BHIA 3H2KA 1V48A 3MYYA 4BQNA 3TLXA 4YT8A 2HA2A 4M8NE 5CM2Z 1UPXA 1O94A 1KNQA 5DJ5A 2YN2A 3RBVA 1J8VA 2C4WA 2VH2A 4FFPA 4KQJA 4JZYA 1JLRA 1QRAA 4RY2A 1YOBA 4WVFA 4Q9JA 1RS0A 4HDAA 1VI5A 4UD6A 1KRHA 1KFCB 1XPJA 4QVGA 2B35A 4UTVA 1QG6A 3V80A 5JNLA 1IZ8A 3CRZA 4BJ1A 1JEYA 4TXNA 3M70A 4HX9A 3OY2A 4AQYB 4IIJA 2CDNA 4DCTA 2Z04A 3LF1A 5EZYB 1Z7EA 4R5MA 4Q5IA 2A5YB 4YUWA 1KDTA 2BBSA 3T7CA 1DGQA 3OLXA 4NYJR 5F1YA 1DJQA 1AB5A 4ZEVA 3QYAA 1BX3A 1OI4A 4LVCA 3F5QA 1JQ3A 4HAYA 3OC0A 1SGWA 2XRFA 1UC9A 4IDHA 1T0PA 3RK1A 5T8KC 1N9GA 3G9ZA 3M9LA 1KDOA 4NBTA 4DLPA 3TYXA 2E1PA 3QVVA 4GBMA 4Z7JA 3T5TA 3H8JA 5KVVA 1Y7HA 3P97A 1V5WA 3I61A 3T5CA 4B4DA 2C3OA 5EKSA 3WWZA 3QEMA 3ND9A 2PVPA 2C5SA 1ZOPA 4HAWA 1MJNA 4F9GA 4ZT7A 4IIJB 4M0FA 2JAUA 1J90A 2VK8A 2HNKA 2HHLA 2MOKA 2W48A 5F2KA 2D3TA 4YRKA 3QSYA 1POWA 1E3WA 1VCHA 4MR7A 1I7LA 1N32B 3DM9B 3K20A 3VU9B 1K89A 4QOJA 3D43A 3HB4X 2I3AA 3VH2A 3ND6A 3T3MB 2IL1A 3ER6A 4JOBA 1IJBA 2B9EA 1RLJA 1XKTA 2VQ3A 1JXAA 3IAM6 4EVQA 2GPTA 1N9GB 2ZB2A 1Z8HA 5B58C 1L5WA 1EKXA 5ANRB 4WIAA 4DFDA 3LPMA 1HFWA 4B3JA 3VHRA 1N75A 3BH6A 2MYTA 2IWRA 3QEMB 1EK0A 3VYVA 4QBGB 4TXMA 4HDMB 1UC8A 1GTZA 1UM9A 1MB0A 4KMSA 2AI3A 3GLSA 4HEA6 4TROA 4JL6A 1LW7A 4XPZA 3O3MB 5ICEA 1Z2AA 4MR7B 1E3WB 1B0ZA 1Y7PA 1KTIA 1WB6A 4XX0A 4Y2HA 1EVZA 1P4HA 4BFUA 2WYIA 4C2TA 3LHFA 1TYEB 721PA 1I32A 1ANKA 3DWEX 1QH8A 4I4NA 2X9NA 2DPMA 5FBKA 1HE2A 2LWIA 3ORSA 4WDQA 3BE6A 1T15A 4XKJA 1EX1A 2QM7A 1YE5A 3D6AA 4EW6A 1ORHA 5CEEA 3MJFA 1R5NA 3LJKA 2V9CA 1JR3A 3CPHA 1EWKA 4DW8A 1QVVA 2X0FA 2I78A 1B6SA 3OC6A 5JAHA 5HJEA 4OCZA 4H1TA 4KQ9A 3JSAA 4EY3A 3NW9A 4JUAA 3S1AB 2CLSA 2V1XA 4OSPA 5EE5B 3Q87B 1PQPA 1UM9B 2HNBA 1YJBA 1UBNA 2BBWA 3M6XA 4Q39A 3IVRA 1C3VA 3AF2A 4U8GA 3KD3A 1XMIA 3SS7X 3VZBA 5CBKA 3V7WA 3PJDA 2NZVG 4I4TA 1XLWA 3DUFA 3VR0A 1MN6A 1YU6A 3KAKA 4XX0B 1SUEA 2QLLA 5ES4B 2AXEA 5BW4A 2GZ3A 2AF3C 2HCRA 2QSJA 2CZCA 2X58A 3QKSA 2CY0A 4C0HA 4QATA 2PMKA 5B64A 1E0AA 4DC9A 1E2NA 2J9GA 1QH8B 3T7SA 3TJZA 2XITA 1O94D 2FN9A 3GVXA 1NI3A 1UJMA 2GJSA 2PWAA 3NOVA 3PGVA 5IN5A 1RI3A 2D0OB 3GCGA 4EG1A 4OP2A 5DN6D 1QKKA 2GJAA 1ZMTA 1U3DA 3D2AA 3LOUA 2MR5A 1TAGA 1CJMA 4JBXA 1G1MA 4IRUB 5TQVA 1EXDA 2O3SA 3IUQA 2NV0A 4M8KA 3AVTA 1XF9A 2BP7A 2W4QA 4RGVA 1FYEA 4G5QA 5ECDA 1A7KA 2XTNA 3RKRA 3RR2A 4C7VA 4I4TB 4EFKA 4NE9A 3RT9A 3MGGA 3DUFB 4L8WB 3HKBA 4NF2A 3F46A 4D9EA 1FNBA 3T4UA 4GSKA 1PJQA 1P0PA 3OLWA 3WYFA 4N12A 1T9KA 5TT1A 4X94A 2EDCA 5DFAA 1COWA 1RPNA 3WMRA 1D3AA 1EZ4A 4WJLA 4K40A 1S89A 3ENKA 5LDGA 3QX8A 4UXJA 4LXQA 3HCCA 3IJEB 1SCJA 2H2GA 3Q0TA 4KZPA 1G6Q1 5TB5A 3F1KA 1SJ9A 1ULBA 4X00A 1W93A 5I9SA 4ZEXA 1QR2A 3PDUA 2G28A 1D5WA 3O4HA 4JB3A 4NH4A 3SX2A 1XDZA 2DH5A 3V3KA 3AEZA 3PFKA 3ZZMA 1TD9A 5C18A 5BVHA 4RV4A 3D4BA 1QCCA 2XQJA 2YINC 4XQ0A 1F0PA 4HN4B 5EL0A 1N78A 2BP7B 1ULSA 3WB9A 3IERA 2WOJA 3SIXA 4LSMA 3AX6A 5GPBA 4WACA 1M6VA 4XQCA 1KK3A 4BIMA 3HKBB 3NTOA 3NYRA 4LMPA 5JAMA 2WRZA 4D3YA 1UK7A 2SKDA 1PR1A 4JI0B 3W05A 2ZYTX 2BY4A 4J0EA 4QELA 3DL7A 3HO1A 4L8FA 5FOXA 2C00A 1YIDA 2BN4A 2RGCA 5L95A 1O03A 3IHKA 5TS3A 2PAAA 3WQRA 2XYRA 3TNLA 1O4WA 5JATA 3PSHA 2AKYA 2F64A 3FFAA 4YPVA 5BVHB 1QKIA 5CDFE 4B71A 4DNPA 4M1EA 3NH9A 3SHOA 5COQA 1JFRA 2PNJA 3CFYA 1FFCA 4I0WB 4WA7A 1M6VB 3W6NA 5G0TA 5TX7A 5CA0B 5IWAB 2R8ZA 3BF8A 1MP0A 1KYYA 5KWVA 5LD2B 3B7WA 2J85A 5DK4A 5A5GA 2DWOA 4FOOA 3I0MA 2CVPA 1UMBA 2NADA 2NG1A 2R11A 3OECA 2H7VA 4X92A 3ZW9A 4RH1A 5AJXA 4X85A 2W6MA 4AO8A 1IBSA 1TLLA 1G2OA 1P0IA 2HPVA 1ZVMA 3QGMA 4MI3A 3WDMA 4BE9A 1YIOA 1N1GA 3I28A 2I7TA 3IJRA 5DSTA 3IE1A 3GFSA 2QTNA 1X9GA 3TAUA 5A5FA 4WBSA 1UXOA 3ZI7A 1OGYA 5A5VA 1XMOB 1U8UA 2ILTA 2X6QA 4LJ4A 4LMAA 1U31A 1K9SA 2H06A 3G1TA 2PJDA 1EE9A 1Z2NX 2J6HA 4G3XA 4GI3A 4LYGA 4D4LA 3DAFA 4AQDA 1NMXA 3F5FA 4KE8A 1G8MA 4QHYA 1DIRA 1CVLA 1L5MA 1QE5A 1RWXA 1X92A 3NWPA 4KOEC 1PUIA 1G7SA 1YDHA 1ZC3A 4WK4B 3N75A 1F8UA 4EPVA 2GM3A 5LQKA 2BI7A 4QAJA 3AU9A 2IYPA 3KIPA 4XWKA 3ICQB 1JLSA 1WNTA 4GFDA 1UADA 1P91A 3QUQA 2Q28A 3FB1A 1TIBA 2P8JA 3VPFA 4CMGA 2GK4A 1YOVA 3M5WA 2O7QA 3EXFB 3OFNA 2OBLA 4U7TB 2PQMA 1LNZA 1NJGA 2C96A 1WAMA 5B7GA 3C14C 1ZZEA 4KRYA 1T0BA 3KSMA 4RQAA 1ULTA 3R7DA 2XUDA 2ZTSA 3D7LA 3Q2OA 5FFNA 4Y2TA 1VG8A 2EG5A 3CRVA 4IMPA 3PLAE 4QQFA 3EQ9A 1LWOA 1HUQA 1V6AA 1NVGA 3Q9NA 4HP8A 4FT4A 3H5AA 1C1DA 3B6MA 4TMXA 4B6QA 3ZQ4A 4YQYA 3OEEA 4EY6A 4RSRA 4GL4A 1KIFA 4MKIA 4X6XA 4YMSA 2QD1A 2XRZA 3ORRA 3U3XA 4TM7A 2ZUVA 4FFMA 3L07A 1ZGHA 3DNPA 1AKRA 2RG1A 3U2QA 3REOA 1W35A 4GBED 5EMKA 1TB4A 1U2GC 4FIDA 3ZG6A 3DWGA 4Q01A 2WILA 2IY7A 1LA2A 2VA9A 2AHRA 1MGOA 3GJ3A 1EFUA 2YJ6A 3DYVA 1WXDA 3WISA 2J0QA 3EE6A 3KJGA 1EFTA 1MG0A 4KE7A 1QTQA 4K9LA 5CIYA 4C2BA 3GDWA 3QJYA 1P19A 1OH7A 2FW9A 3VSAA 1EFRA 5HRUA 4GPZA 3F4KA 1TAHA 4RF4A 1NBOA 5CURA 4ZCIA 1Q83A 5AHWA 5EIBC 2VHWA 3K31A 1C1DB 1UJ6A 3DLTA 1X1CA 3LSTA 5AJWA 3KLPX 4EMTA 2A33A 5ALYA 5CGZA 3EVDA 1E20A 2I62A 5E7QA 3K0CA 5C4IA 1Z37A 1HFEL 4EVSA 2JAWA 3QFCA 1AOXA 3CEAA 1JEOA 3RSSA 3BH7A 3HY4A 3K8ZA 2VXBA 1NG1A 3P2OA 1X87A 3DEFA 4ZCRA 5AUPB 2VRBA 3UMCA 2JJ2A 1I3MA 4GF5A 4TWBA 2VNJA 3GJSA 3RS3A 3WRYC 5HPYB 3H9QA 4PSKA 1KJ9A 3KZMA 1YB2A 1BMDA 3JZFA 4PXSA 4B8YA 4L4SA 1R9MA 3VISA 1WKCA 3AV0B 2E55A 3WJ1A 1SVSA 2EWVA 1OIVA 3ZV7A 5H5JA 2WJ3A 3BHNA 2H65A 3JD4A 4QEKA 4ZOAA 2QRKA 3PJRA 4AKGA 3E5MA 3ON5A 4QU0A 1KO4A 2CUKA 1B0UA 2LR0A 3FYHA 2Y71A 3HLYA 4ZTBA 4IZ6A 4ZI7A 3TG8A 1R66A 2ZAMA 3L41A 4OQDA 4KGDA 4QLOA 3I76A 1MNAA 2R60A 3N0VA 4J9UE 2BCGY 2C5EA 4N7RA 1C14A 3S2ZA 4C03A 3D6HA 1SKBA 1SG6A 1UIMA 1VIDA 2C7GA 4JI1B 1VJ5A 3AP2A 1F3OA 1IU9A 3RIGA 4DE5A 1EVJA 2YQ4A 4ZDJA 3DW1X 1VRCA 2QI9C 4UNSA 4WY5A 2IXDA 1E7MA 3KQNA 1TQ4A 3BULA 1QLHA 4K28A 5IBRA 1UPBA 1ZPDA 3H8WA 4ZAXA 3QFTA 3QLVC 1EXMA 2RGWA 3C8MA 4R9SA 3TKAA 2HZ7A 2I2WA 2ZCUA 1WQ4A 2VHCA 1LB1B 5E6SA 3IPRA 1N2IA 3AUUA 1G8PA 1Z7YA 3HNRA 4JBWA 1CB0A 5EUMA 2YHUA 2KBEA 2AJ8A 3OZEA 1LSJA 4TLEA 4TMYA 3VBCA 3VKVA 1NNEA 4MGHA 2QDXA 3U3RA 1AKVA 4LVOA 1Y3IA 2VC2B 3U17A 4P3YA 2Q21A 2I54A 1XZMA 3FY4A 1OX6A 5DGDA 1YTUA 3ZEIA 1GT6A 4ZIRA 4Q7QA 4ZQHA 4DPLA 3JWJA 1ZOIA 5CDFA 4FSDA 2PPVA 4GZ3A 3R8XA 2IKQA 5D3QA 1PQYA 4QUAA 3K53A 4ZU6X 1Y5LA 2QP9X 4QARA 5HZMA 4EGJA 3N86A 1AF7A 4JC0A 1QU2A 4TSKA 4ZI5A 1E1LA 4N48A 1C7QA 1GNSA 2BC9A 1JU9A 4MYSA 2WHRA 2H0RA 3E70C 3HRIA 4JQOA 4AUKA 5B36A 1O87A 4AZSA 1ZOLA 3EDYA 3MCAA 3FSGD 4D80A 5EJMA 5A02A 5FOVA 1M8JA 3ETJA 4O8CA 1ZKMA 2HNAA 3ZHVA 1D07A 1QAOA 4OHVA 4DUGA 5L6LB 4AZWA 4LPSA 1RPTA 2CXSA 3OEED 4NS1A 4BGEA 3DZHA 3ER9A 1L1QA 2H57A 1XMXA 2PRYA 3Q8WA 2A88A 4QD3A 2F90A 4X61A 4ZIRB 1JEDA 5E6UA 1VDMA 2GAFA 3EF0A 2PUEA 4JASB 2UUCB 1ABFA 2TMYA 5JCJD 1QM5A 3FYUA 4Z54A 4GMHA 3U09A 1R8YA 1QGED 2FQXA 2W6JD 2NLOA 1BZYA 3GWZA 1DADA 2A0XA 2Y05A 1HQYE 2G9ZA 1LU9A 2ASVA 3AIIA 3GA5A 3MGKA 1JEAA 3ZE2B 1ADJA 3UKOA 1TM7E 4MW0A 1P0MA 3BFVA 2FQYA 3ZE6A 1GDTA 1JW9B 1EAYA 3I34X 2JIBA 3F8WA 4LDZA 4O4JA 2AD5A 5HG0A 3TTWA 4BP8A 1M6EX 2OCPA 2ENUA 3NAGA 3NHZA 5THKA 1L5YA 2HU2A 1NT2A 3MC1A 4Y6PA 4DDVA 3RVNA 2IF0A 4MW7A 3T3IA 1U2TA 4QOSA 4OU5A 1W73A 3GLUA 1MT0A 2FVXA 5E6UB 4C78A 4CUJA 3OEYA 4XGQA 1BE6A 4GBGA 4OIFA 1YVRA 1E2UA 3RUHA 4WXYB 5JXGA 2PA0A 3FX2A 2HJGA 3FYUB 3H84A 4R01A 5I3ZA 3NASA 4JOSA 3A37A 4QJ3A 3I45A 4JCCA 4Z0TA 4V2IA 3NRCA 1IHYA 1AK2A 3M2PA 1U8FO 3GDGA 3QVKA 4JJ7A 4Q21A 4BMYA 1E5DA 4I3GA 1GDHA 1E8MA 4QRDA 5LFAA 2WLTA 5EQFA 4G8CA 1ESCA 4BGVA 3DLIA 4RD3A 4U4AA 1QZZA 3A4MA 4FNAA 4K3UA 1PLKA 4O4JB 5M5BA 1IWBB 3MMNA 3ZD7A 1E9BA 3UWSA 1E5XA 1HDYA 2QBYA 3M6WA 2I9KA 4IZHA 4KX3A 5AP9A 1ZRMA 3SEAA 4F4CA 4YY3B 1DOZA 3CUEF 1TZKA 5BXYA 3KO8A 2LZ0A 2FPMA 1JPJA 3P19A 3AG5A 5I7OA 4JJ8A 3SR4A 4OSEA 3AF4A 4XDHA 3FVQA 3QTBA 4YFVA 1OCEA 4HUQA 5EIAA 4C08A 1R1DA 3JASA 3Q8LA 5CAEB 1I3OA 2J45A 2ZFUA 1CY8A 4LZLA 3O31A 1AA9A 4RWZA 3DKIA 5EC8A 1GCIA 2ROQA 3VR5A 3W77A 4A0HA 3HJBA 3RRNA 5JW6A 1BA3A 3H6GA 4JCOA 4AD8A 1H6AA 1KI4A 1SQ6A 3F9RA 3DL0A 5JG7A 3I0ZA 3EFOA 5C8XA 4JLSA 3NVDA 1WZ2A 2DGDA 3HB1A 3I4CA 1RPAA 1GDDA 1MAAA 2DOKA 1NXXA 4DQVA 2GDJA 5WRFA 4UAVA 2UUAB 3D8SA 4KWIA 1LX6A 5A62A 2OHVA 3KB6A 5KVQA 3AZPA 3C6YA 2II6A 1FP4B 1WLYA 5CMLA 1Q0TA 2DR2A 5LZ9A 3KAJA 4TYMA 2VUHB 2I66A 1FW8A 2LXNA 2WQZA 1WM1A 3P4YA 4P8RA 5JCZA 2BKUA 5AK3A 3VZCA 3TLGB 4EA7A 4ZDKA 1JSLA 3ZJUA 4HUQB 2FE4A 2WUEA 3I72A 2CNWA 3I2HA 3JASB 1I80A 1VL6A 3BRQA 4OEHA 3IUBA 3OSZA 1ZJYA 2R2GA 1CB7A 1J2JA 1U80A 1HKHA 1IZ0A 5I9NA 2R6JA 3ZOZA 4LK3A 1PNTA 3AVXA 1TKCA 1OD6A 4I08A 3VR3A 2HYIC 1C5KA 2PX4A 4DUGD 3Q15C 1OF1A 2JGEA 1KVSA 1N2BA 2RBKA 4QOFA 1I2BA 4D0LB 3I23A 1A9YA 3AINA 5HFNA 3W2TA 5C7YA 1NN3A 5FYQA 3HRKA 1ZD8A 1DBSA 2CJPA 2GA9A 4B6OA 3DE5X 4D9FA 3JQQA 3FWZA 3PS9A 3SZRA 4FI3F 3DXXA 3LDFA 2VDJA 2ZYGA 1JJVA 1QFMA 3B6EA 5H83A 4IDNA 2GZAA 3GZTB 1NASA 2RHWA 2YV5A 4WEQA 4B5KA 1L4HA 5C51B 4UCQA 4CFYA 3CLVA 3BIOA 2FWPA 1H8EA 5MHTA 1LD3A 3S2IA 1G8JA 2DC1A 3DMTA 1XMVA 1RWBA 1UBFA 3L7DA 4FGKA 4W7HA 3I9MA 4ZQCB 1Q84A 3FAKA 3HUEA 4AX8A 1XDSA 3K09C 1P0CA 2RBEA 5COBA 4IFIA 2V5UA 5CBPA 2ZDGA 4RQBA 4GKBA 4I46A 1Y9JA 2APJA 4FIZA 3IDQA 4IM7A 4MKGA 2CFSA 3R3HA 4G63A 1A4IA 3DWFA 1WW2A 4IJUA 1QRRA 3E84A 3GJ8A 4XEUA 5EMNA 4J29A 1B15A 1N0VC 4K9KA 4LZWA 4LWPA 1NN5A 3GJ6A 1ZO8A 3RVJA 4PRZA 2A84A 3D5EA 3DEZA 3PFCA 3T7JA 2JCYA 4HT3B 1DZIA 3QY9A 4CM5A 3JZMA 4PGAA 4I4IA 1UFKA 5GP1A 5K3BA 1Y7LA 4EG5A 5FLEX 2PZAA 3EH2A 4AB1A 4HUTA 3BMQA 4KSYA 4BWFB 5BW6B 1RYYA 3V8QA 2C5LA 3KXDA 5LOVA 3CRNA 4WASA 1TQ2A 2XECA 3MT9A 2C4MA 4C4YA 4BZWA 2WKQA 3H5VA 1K3UB 1WWKA 1WEKA 5E1BA 1HQCA 1ZJ5A 1B0PA 1VFNA 2XKJE 3OFSA 1NHWA 2N1MA 1VKNA 2ZOSA 3A9SA 1M2KA 1O2DA 2GAJA 3EWIA 4R98A 4Z9XA 2AV6A 4JQYA 1H93A 2UVPA 3DOIA 4JL8A 1Z45A 3LBYA 4KK4A 3W2FA 3EZ6A 3E3LA 2QA5A 2EZTA 5AM0A 5IW8A 1E63A 2FP4A 1C3XA 2ZKIA 5KAMA 4QYSA 2ZE8A 2V7QA 5BPHA 1TF5A 1NF9A 2CBZA 4PPGA 5F73A 1YULA 1ZA2A 3MW8A 3RC8A 1ZN8A 5NULA 2BHTA 3CVOA 3BMQB 1MQ8B 1JU3A 2Y67A 5DHTA 1N5MA 5AVJA 3S6JA 3SHWA 2C2OA 4QYTA 5F9HA 1EU1A 1B3RA 2XHZA 3B3AA 4M55A 5D8DA 5THXA 5C9ZA 5LOVB 3GDHA 4E15A 3BSYA 2R96A 1OJ7A 4JZKA 2WE7A 3G82C 2B2CA 3B38A 4RLQA 4RVUA 3F74A 1IRXA 4JWKA 4A2WA 1A2OA 3PIRA 2RB4A 5CYGA 3LPAA 3TRKA 1DKNA 3ZCVA 2FR0A 2QYOA 4CIAA 4DC1A 3C7KA 1F4LA 4XOUA 4QLAA 2UVPB 4FDTA 2LGJA 3PVZA 4O2RA 2J5XA 2W71A 3RTAA 1WVMA 2AFHE 4DY4A 4B09A 3DFZA 1JDZA 1SXJC 3RADC 2JANA 1Y37A 3BX1A 3FIUA 1T0UA 3F5SA 4R8KA 1J1ZA 2FP4B 3UYKA 4D6PA 1W29A 2C9CA 5GY7A 2VATA 3MUFA 4X24A 3DXYA 2N42A 3F5DA 4HDRA 1IB6A 1YR9A 4MRVA 1OYVA 1UPUA 3TSZA 1PWZA 3ZK7A 3I6ZA 1G63A 4V1CI 1FRFS 3ZGXA 1SUWA 4UDYX 2G40A 3BXHA 3DMRA 1Z06A 2HW8A 3AYXB 1JJFA 3QMMA 3WL8A 2VJLA 1NOKA 1BNCA 1NW8A 1LPOA 3BA6A 2O7SA 4FBLA 4MZXA 4IIUA 4QL3A 3K8YA 3P0HA 4BN5A 4ED9A 3ZHCA 1YVPA 3WKDA 3KAQA 1VTKA 2VHVA 4OB7A 1Y3BE 4LQLA 1NNI1 3AETB 3E3AA 3G1WA 3UA4A 4NQZA 5DWQA 3UG7A 1NMYA 2IU4A 2PKCA 4UZEA 5EFOA 5FULA 1YRLA 1UOEA 5LQCA 1SWVA 1CUAA 2VDWA 3LOPA 2X22A 4AKIA 3ETDA 4C43A 1EE2A 1AHNA 2BMVA 1YL7A 3STXA 4OX9Y 4BFTA 4Y9DA 2PD6A 1B73A 5KU7A 5DTJA 4GH5A 3FJ1A 4R9RA 4HDRB 3R1IA 4Z8YA 1SEPA 3KJNA 1HFKA 2GERA 5A3VA 4Q3OA 4EJ6A 3GI1A 1IXZA 3ZGOA 4X8MA 4EF4A 5JJCA 2VCYA 2ZSBA 2WJIA 1A96A 4E5PA 2G67A 4UTNA 2PLFA 4PSCA 5BUQA 4LOIA 2CVHA 2IY9A 4JBYA 5IT9A 3WWYA 3RYIA 5CM9C 1JKIA 5JNTA 1TE2A 1GUAA 3VX3A 3MXTA 2BT4A 3S7TA 4RK6A 2PUFA 1A9PA 1BS1A 4V38A 4NEQA 5EWMA 5TGZA 3QE9Y 1YT5A 4CLRA 4PC2A 2ADMA 2VDWB 4J2TA 3TO5A 2FEPA 2PGJA 1PR4A 3ABQB 4KNVA 4N40A 4UUBA 3WDLA 1CY6A 3PU6A 3OJXA 4I5GA 4I9UA 5E0KB 4UHBA 4YPFA 1T4MA 4E2YA 2QJTA 5GZ1A 4RTMA 5ALUA 3SY8A 3KKZA 3CZ4A 2A5LA 3CXRA 4ZOLF 1OV4A 2F9LA 1F1BA 2H1IA 2WJ6A 1H85A 4KXXA 4MDEA 2GXSA 2R5WA 2J33A 4LG1A 5D5QA 3R0IA 1ZH6A 5D5HA 1J2UA 2QDKA 4ZO7A 5AKKA 1NATA 1WY5A 1T2UA 4MX8A 4F3YA 1E2MA 3LSYA 3H0KA 3O2QB 4CF3A 1J1UA 3RYIB 1RXIA 3CTMA 9GPBA 2FKNA 2HQOA 3HFRA 4FFDA 4F04A 4QE3A 2YRFA 1PYDA 2QG6A 2YZ7A 1SG0A 5EWMB 1NJ8A 2OYCA 3NNSA 1NY5A 5AYVA 5AVYA 3OZSA 4BJ6A 1AUVA 2JGFA 3F90A 2NMVA 1HNZB 2XAAA 3KTOA 4JEMA 2JI9A 1NV8A 4B81A 1RLUA 3P2IA 3HEAA 2AUMA 3OLQA 4UDOA 1FOEB 2MU1A 3UO8B 2IX3A 4JC8A 3CNOA 3RTBA 3IQXA 4MHOA 5EUCA 2FLWA 3CLSD 1MJ5A 2A0YA 3DVQX 3GJ7A 2EWWA 2VF2A 2ODBA 1OXBB 1BEEA 5KHLB 1QE0A 3AEYA 4GZMA 2Q1TA 4RADA 5K01A 1AZSC 1XTRA 1ZGCA 3C3JA 5ALTA 3X1KA 3E9CA 2HSGA 1CNMA 4BV2A 4ZXFA 1NVTA 2F55A 2YJZA 4TZTA 3BCSA 3RRXA 1DC3A 1HDEA 4K7JA 1G9TA 2B8WA 4WWHA 3ZHTA 5CDYA 4KUHA 2P68A 3WA7A 4E94A 3JQCA 3QU5A 4FDUA 2VQ6A 4YDSA 5CYFA 4OM8A 1JDSA 2AN9A 1JQBA 1P8AA 2P4UA 4LX8A 2G09A 2Q2WA 1CY2A 1WSDA 1JECA 5KNDD 4QFMA 1QHYA 3PUXA 2JA1A 4MRNA 1L5HA 4EJSC 2PWZA 1B2RA 1H1DA 5TQ0A 1D7OA 1U3GA 4XM0A 4KQFA 1XZCA 2F9FA 1ZCZA 2XZTA 1AUXA 3AFGA 4R8RA 5C3UA 4JYAB 3U1TA