1WA5A

Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
b'PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
molecule tags Nuclear transport
source organism Canis familiaris
publication title Structural Basis for the Assembly of a Nuclear Export Complex
pubmed doi rcsb
total genus 54
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wa5A00
2GA8A 2WIAA 2CL7X 3NC0C 3THYA 4JVNA 1OKKA 3A4MA 4B3FX 1C1YA 4JLJA 3UXMA 2WMNB 1G3MA 5H8WA 1L8QA 2ZRNA 4KCGA 2P2LA 1E9BA 1OYWA 3QI2A 2J7PD 3TVTA 2GXAA 3I92A 2JAQA 4DC9A 5FR2A 4KU4A 3FKSA 4NZYA 2F1HA 4JLDA 4AYXA 1QG4A 2R2AA 2GEVA 1EG7A 3GLIB 3H86A 5E7IA 4CF7A 1NMXA 4KFTA 1U9IC 2RGNA 2Z83A 3VU9B 3WYGA 4BEBA 4YXWA 3SU8A 1AZSC 3QXSA 4RD1A 4AI6A 2BKEA 2WSMA 2D7CA 3RC8A 3QEJA 4NYIQ 1HV8A 2QG6A 3QY0A 3K9LA 2G0TA 5F9FA 1EWQA 1SHKA 3P4YA 3ZVMA 4A0RA 1R5OA 1CRQA 3B6EA 2QSYA 4M9SA 3LA6A 4ABYA 2OFOA 4M9XA 3DKVA 3TIFA 4JYCA 4TLEA 1TQDA 4ZDIA 2EFCB 1Z28A 4A15A 5AUPB 1XB2A 5SZKB 1XCPA 3CR8A 4YQFA 4Q9HA 4TL6A 2REOA 5DYIA 1ZU4A 3ZZ0A 2A78A 3KDSE 5FPTA 4F38A 1RRCA 1KJYA 1KI4A 4C0LA 4NHOA 4FMCB 1W0KD 1T3LA 1XTKA 5HPYB 3BBPA 4U00A 5CK5A 4KFRA 3PEWA 4A2QA 4AG6A 2E9SA 3VX4A 1TNDA 3RC3A 2WKQA 3DMDA 1CIPA 3T15A 1E2IA 1G6HA 1XXHE 2C8VA 1P2TA 4EAQA 1K5GA 1NLYA 2R44A 5FTMA 1CJTC 3AUYA 4MYHA 5CJPA 2XSZA 4ZDKA 2YJTD 2GRJA 4JLKA 3TJZA 3X1XA 1F2TA 3LNCA 1YQTA 2ZJYA 3RS3A 2O0HA 2ZU6A 1F2UB 3HR7A 4I1VA 2WSSA 1OXSC 5UKDA 2OEPA 3B8HA 2GHIA 4PZYA 3OZXA 3SYLA 3U7EB 4ACBA 1XMJA 2BWJA 3A1WA 5EP3A 2QU8A 2WJVA 4F4CA 1D9ZA 2QTFA 3GJXC 4LI0A 4DEXA 4HYYA 3OEHA 1G17A 1MOZA 3R7WA 2FX3A 3SR0A 3CNOA 2VHJA 2IYLD 4BWYA 1W1WA 4B44A 1WE2A 1WRBA 3SOPA 4L16A 1XTQA 5CLQA 1MRSA 1OHHA 4HAXA 1M7BA 3C5HA 2NO0A 3O8CA 1Q3HA 3BH7A 3EZ6A 4P4TA 1ZNZA 2QP9X 4B76A 4QGGA 2J7KA 2DBYA 2V7QD 1E2JA 3KKNA 2QTVB 4OI1A 2VP0A 1KAGA 4QRHA 2O8DB 5H1YA 3GLGA 3J81k 4ASUA 3A4LA 4FIDA 1QVAA 1D2MA 3MWLA 4UXHA 4B3GA 4C9BA 1BO6A 4GPTA 4D80A 5KNDA 2GEUA 5JWOA 1DELA 3RRNA 2IS4A 3SFVA 1P62B 4IFBA 2O8DA 3P1JA 4MGYR 1ZM9A 4EJSC 3IUYA 3K09C 3MWYW 4LZZA 5JS8A 1KO7A 2F9MA 2FSHA 4XSHA 4BQSA 1XJQA 2PT7A 2J0UA 3NTUA 3NHAA 4PHTA 1Q21A 1EX7A 1OB2A 5KDDA 3RANA 1W7AA 1IN8A 1E9DA 2GXUA 2ZEJA 4RVCA 2OXRA 2GF0A 3P20A 3K0FA 5J47A 1NVVR 4KYUA 3SDZA 4HAYA 3QXHA 1UBFA 4L9WA 3THXB 3T61A 3ZD7A 5JJKA 2D3WA 4XVRA 1XRJA 3WHKA 1NRJB 3EXAA 2VO1A 1U94A 4MGZR 3EPKA 1VYVA 3I4LA 2AN9A 3BORA 3IO5A 3IDQA 2QAJA 4A0HA 4LV5B 2W58A 5KO2A 4Q1DA 5D3QA 1L7VC 3QBTA 4M53A 1NJGA 4MYUA 4LHYA 1PLJA 2BMJA 4XVUA 1QHXA 3SC3A 4ARZA 1HH4A 4CDGA 4JT4A 2WJGA 1KY3A 3CPHA 4EFNA 1YR6A 1YJ5A 1ZNXA 4BE7B 1DO2A 1F3OA 2VHTA 2ZQ5A 1A82A 1KY2A 3TLXA 1G5TA 3L8YA 5IF9A 5JI2E 4BZQA 4HZIA 2R6AA 1Z83A 2J1LA 2IYVA 3AH8A 2NZ8A 3SBDA 2X8AA 4Q5IA 2EQBA 4OYHA 2ZITA 2IC5A 2W2VA 3LXXA 3RAPR 4UNSA 2JIZD 1E1QD 1XU4A 3K0EA 4AIIA 1NP6A 3GPLA 2NMVA 1AQYA 2YC2C 5HE9A 2OBLA 1QZXA 1TU3A 1NBMD 1G5PA 4Q4HA 1NVWQ 1VG8A 2ZS7A 4IOMA 2N42A 3UK6A 4A0GA 2Z5FA 2O0KA 4OHXA 3CF0A 2B7BA 1KGDA 3NWJA 4PQYA 2XJ9A 4TSFD 5EJEA 3CRVA 2Z4RA 5B2ZA 3TW8B 1ZM2A 1GSIA 4MKFA 1NMYA 2J59A 1GVNB 2FV8A 3HPRA 5BYJA 3W9YA 4O3MA 1R7RA 3LLUA 2QP4A 1FQKA 4U5XA 2QUZA 3QPUA 5FFMA 2GBLC 2V8OA 2DFKB 3I72A 3W8RA 1NLFA 5EP4A 4M4SA 3UMFA 1UDXA 2IEYA 1F2UA 2FSIA 1G7RA 2H17A 1UDWA 4Q66C 121PA 4ACAA 1Z0IA 4BFSA 5TVKA 1Q1EA 4YMSA 3TKLA 2FOLA 2BIFA 2PEYA 5EE5B 4GP7A 2IWRA 3AVYA 1N5JA 3ADCA 2NG1A 3OIVA 2AKAB 2MSEB 1E2DA 4OQNA 1XXHB 1NSTA 4DLRA 4I4LA 4ERNA 5F9HA 1RE0A 2H8KA 2IHBA 1ZCBA 2QROA 1KKLA 3SZRA 3WP0A 4K8OA 4G01B 3RS4A 4TQ9A 2UZIR 1E9RA 2ATXA 3U7GA 3P4XA 1YR9A 4JJZA 4QC2A 1WP9A 3GLHB 4NDZA 5DISB 5GJCA 4CEIA 2OFWA 2QEQA 1EGAA 1GITA 5CK4A 1DG1G 3TSZA 1FX0B 3B5JA 5KU1A 1AS0A 2PBRA 2H16A 4C0AC 2NPIA 5AJWA 3GD7A 5G3YA 1ZM3A 1LF0A 2W83A 2ZRCA 3FOZA 2HLDD 4GZLA 3GLHE 5B30A 2FFAA 2ZTSA 2XZLA 4DCTA 1O3YA 1E2EA 2XNDA 3PUXA 4PPGA 2LWIA 1KDRA 2PZFA 4JS0A 1E4YA 3WHLA 1UEIA 4JVMA 1J2JA 3S1AB 1UJ2A 2FZLA 2WICA 2QPTA 3GJ3A 4OJQA 5DHFA 4ZI2A 1UBCA 2CK3D 4HAWA 3VR1A 1KI2A 3P32A 5EXXA 4DZZA 2CMKA 1ZP6A 1KDPA 4V0KA 3VR2A 2B21A 3A36A 2RMKA 3NXSA 3RVBA 4ESHA 1KSGA 2ZUBA 3T35A 4PC2A 1CR2A 5HCNA 5FPKA 2FPKA 4JJKA 4DT1A 1YU9A 3TH5A 3BIFA 3BERA 4YMUA 4PHHA 3BB3A 3DHWC 4GOKA 4Q1FA 5CLLA 4B3XA 1FUUA 1KO5A 4GDFA 2PX0A 3RSOA 3EIEA 3UWOA 2ZJAA 3CNNA 3G0HA 2XX3A 3LLMA 1G1MA 4CIDA 3TUZC 2G3YA 4DBLC 4PX9A 1G18A 4AC9A 2GBLA 2CHQA 3WRYC 1KJZA 3UWKA 3U7HB 1UF9A 4LHWA 4W9MC 2OE2A 2YOHA 2Q6TA 2QAGC 1F2TB 1YZNA 4LHVA 3M6AA 2IYYA 5F2EA 3IQWA 3QKUA 3SJAA 1U0LA 1XTRA 3EW9A 5L3QA 1WA5A 1AN0A 4JBWA 3U3RA 4OI0A 4NYIR 4X8OA 1N6KA 4QGAA 1CS4C 1RRPA 4ARZB 3PUWA 2KI5A 1ESNA 2GXSA 3U60B 2JIZA 1EFTA 2ZE7A 3A1SA 3PQCA 4ILEA 4HZUB 2BKUA 2OG2A 4Z1MA 4BLSA 4F92B 4FMDF 2VBCA 1TTTA 5A0FA 3MJRA 4B75A 1GFIA 2GJSA 1XZPA 4I99A 3RRZA 2DPXA 5J40A 1CTQA 2W2TA 1RVDA 4UNQA 3WY9A 4AKHA 3RABA 5LBIA 4NYMR 1TEXA 4URYR 4MUBA 4TQUS 3BOSA 3DDCA 1ZJ6A 3TQCA 1NNEA 1KK0A 4TT3D 2BMEA 5JHGB 2GJ8A 4Q21A 4QBFA 2WPDD 2QT1A 3T1TA 3TQFA 3PCRB 3PG5A 2OBNA 2VHQA 2HXYA 1DARA 3UMSA 1NN1A 1VMAA 4HLQB 4PFSA 1KI6A 3FMOB 2ZREA 1M6NA 4PANA 4LYHA 4XSGA 3SJCA 3VNVA 2GF9A 3EZ9A 3QF7A 4QHSA 2BBWA 4W7SA 3VAAA 4CT5A 1SVWA 4IW3B 2C95A 1W48A 2ZAOA 4PZZA 2OHFA 1SHZA 2IEZA 1SKQA 1FX0A 2EFDB 2QMUA 2Z6VA 2JLSA 3U44B 3SEAA 3BGWA 4F93B 4BFTA 4HB4A 1PUIA 2ZI7A 2H18A 3QBVA 2BJVA 4KBFA 1H8HA 1OSNA 3RLFA 2ZSDA 3L0OA 3REFA 3WBKA 4KITB 4QHTA 3RRMA 3U6KA 3JVUA 1IAQA 4Q4LA 2A30A 3N2EA 4N0DA 3ASZA 5HZKA 1N6NA 2XNDD 1TL7C 5HKKD 3TK1A 3U6BA 2EU8A 1RW4A 4B73A 3IIKA 2X19A 4QBGB 2J9RA 1X8LA 2IYUA 4ON9A 4L9SA 5FBLB 3IPXA 4NTZA 1N0UA 1Q0UA 5FTJA 4ZKEA 4EPRA 3R20A 4HUTA 1QHHA 1AS3A 1MKYA 5AR1A 1GKYA 2P6UA 2ZJOA 1IM2A 4US2R 1E2KA 2LKDA 4A0FA 2CBZA 3CO5A 2QM7A 2A2ZA 4E22A 1VG1A 1OJLA 4FD2A 1M1YE 1KHTA 4Y0AA 4B3BA 3NH6A 3HU1A 2IYXA 4JLNA 1DAHA 4E03A 1J99A 3KJHA 5J4KA 2F1RA 2BEKA 3H1TA 4Q48A 4DDWA 4KSCA 3U4QB 1UAAA 5H70A 2VQSA 1QBKC 3GLHA 3L2OB 1UPTA 1E1RD 1TEVA 3QVUA 4HLDA 4TYPA 5JCPA 1I4TD 2GJ9A 1JBKA 5AJZA 1MO6A 3KZ1E 3C16C 2PL3A 4A8JB 1G8PA 3PEYA 2BMDA 3A58B 4DLWA 5SZHB 5D3MA 4TMXA 5C4MA 1KK3A 2VH5R 5DE3A 1GWNA 2WAXA 4TLDA 1UKEA 4S35A 4DLSA 1NVVQ 3FMPB 5KSOA 1OH7A 1H8EA 5FTLA 2NOAA 1KI7A 1ZIOA 3B9QA 3MFYA 1A4RA 3NG1A 4II7A 4YC7A 3VKGA 1HE1C 3UG6A 2H7VA 2VSFA 3H2YA 3LD9A 4ZPXA 5K8UA 2Q3MA 1IXRC 1Q3TA 3ZIAD 5IT5A 3BD9A 3KFXA 4V0MA 4RFSA 3W90A 1JI0A 2FSFA 2V55B 4R71A 1ZNWA 1OFUX 5EZ5A 4XTCS 4JLAA 2V4ZA 3VQTA 4WZ6A 3I5YA 1HT1E 2WV9A 3NKVA 1N5KA 3TSWA 4LJYA 4DLYA 4B48A 2E87A 4DWJA 3BE4A 2UVQA 1R4AA 3CPJB 2FJUA 1KI3A 4OKSA 2BBSA 2W0MA 4FCWA 1R5NA 4M0LA 2FGKA 4RD2A 1GNRA 2ZI6A 2WWFA 3CONA 3L0SA 2NQ2C 4RD4A 3FGNA 5DN6D 5CIWA 1NN5A 4KSBA 3GMTA 5HTKA 3O8BA 3WNDA 1T9HA 2G77B 1T91A 1D8TA 2BHRA 3LBIA 4Q47A 4AWXA 1P75A 3TGPA 3AEZA 2ZRJA 3EG5A 4J0QA 1XPUA 1HQCA 3EPLA 1LB1B 2Z0MA 1GKIA 3FFBA 4GMDA 2AKYA 3DL0A 2GVZC 4V0LA 2VYFA 3K70C 1P3JA 2QL6A 1PLKA 2A5DA 1R0ZA 4ZV4A 2IXEA 3W3AA 4MRPA 5FL7D 1A1VA 3K9HA 4A6XA 1AZTA 4GZMA 3I62A 2WWXA 4GOXA 1R2QA 2FWRA 3OAAA 3FKQA 1N3BA 4PO1A 3EIHA 3C41J 3ICEA 2JATA 1N5IA 1E9CA 3QENA 3SQWA 2CEAA 3WRXC 1OKKD 2WVJA 1M7HA 3B7GA 1N6LA 2JLQA 1G291 2QP3A 2ZM5A 1CEEA 2KSQA 4URZR 1Q1BA 4DHEA 4Q1BA 3LW7A 4TLAA 5GJVC 3SQXA 1H65A 2VA8A 1NIPA 2Q9BA 4V03A 4TZ6A 2GESA 1T0HB 2BBOA 4QBIA 3X1WA 2ZRHA 2WM9B 2J7PA 4BFUA 4GL2A 3KB1A 5KDLA 1YZKA 2K5UA 1T6NA 1E9EA 3FKSD 1L2TA 3VU9A 2H92A 4QBHA 1OFHA 1ZC3A 2A5FA 4JMPA 3VR5A 1F48A 2V6JA 4CW7A 4TWZA 5CM8B 3MLEA 3ZVRA 1Q12A 1IN4A 1U0JA 3A6PC 2ZE8A 3B60A 2OT3B 1W4AA 3E1SA 3GLFE 5DSZA 3SHWA 3R7WB 3VHLB 1MABA 5F98A 2YKGA 1Z2AA 4IXMA 4XIGS 4D4MA 1TQ2A 3B82A 4URXR 3ZS9A 4TYNA 4JLBA 4IDNA 1GUAA 1MT0A 2CCGA 2MMCA 3I3SR 2X2FA 5EP2A 1A5TA 1E79D 4UNPA 4ZKDA 3H4MA 1GNPA 5ELXA 4E09A 1G3IA 2BBTA 2JCSA 1NSFA 4X8LA 2IWHA 3WYAA 4URVR 2WWYA 1OF1A 5JMTA 2ODBA 5EP1A 1LVGA 5FUXA 1P61B 4LWZA 5IK2A 3KKQA 2AL7A 3CUEF 2I1VB 2IYRA 3L8ZA 1T4GA 4OI2A 4A4DA 4M1KA 1W36C 3BFXA 3JZAA 1BYUA 2PT5A 4WVFA 3CH5A 1E9FA 1DG3A 2PH1A 4EJSB 1MO4A 3K0CC 2YWHA 4OL0A 2D4HA 3EZ2A 1W0KA 1VHLA 1TAGA 2C04A 2OCYC 2F3TA 4V02A 2OLJA 2ZRBA 3GFOA 3D8BA 1SXJC 1J90A 2DY1A 2IYZA 1H8ED 3GJ8A 4BECA 5E3HA 4Q01A 2XSZD 4DVGA 2ZU0C 2V3CC 2NO7A 1Z07A 2XTMA 2IA5A 4R2IA 2IS6A 4P33A 4Q7LA 3RNLA 2VP5A 1S1MA 3KQHA 2W2XA 1KNXA 4NU0A 3WYFA 1E96A 2AK3A 3TSOA 2D62A 1XMVA 3CR7A 2GXQA 4LUCA 2ZSEA 4KXFB 4FI3C 4LJ7A 4HB3A 1DOAA 8OHMA 1JEEA 4GMXA 1ETUA 5J4HA 1B23P 1UEJA 2RGBA 4G1UC 1DAIA 3A37A 2VP9A 4TTRA 1E3MA 1TU4A 3PUVA 3X1YA 2C03A 2ZS8A 2F1JA 2ZJBA 3OEHD 2WOJA 4V0NA 3RDPA 2ZVPX 2C78A 1J8YF 3U5ZB 1AIPA 4I81A 3MWKA 3B13B 1IOZA 2YHSA 4W5JA 3DM5A 2XNSA 3BB4A 4FCVA 4MYCA 1AA9A 4DB2A 3RS2A 1QHGA 1Z2CA 3FFAA 1II0A 2XXAB 1Z3IX 2AWOA 1P2UA 3C15C 4H1VA 3UATA 4XWAA 4CT4B 4MDFA 1E9AA 3BXZA 4L5BA 2WWIA 3K0AA 3E2IA 2YINC 1NKTA 1B0UA 2V7QA 5LB4A 1CJVC 2VF8A 4D4JA 1XWIA 3QXCA 3R8CA 2KB0A 3LH5A 1I4DD 1I2DA 1OXVA 3OHMA 2DWQA 2FPMA 3LXRA 4XOIA 3SJZA 4Q7KA 1YHNA 5BWMA 1PVOA 1Z29A 2C98A 2G1JA 2R6CA 3IO3A 1Z0DA 3EPHA 1UKVY 1U9IA 3CZPA 4KAXA 4PC1A 3AVUA 1NY6A 4KBGA 3Q7PA 2XGJA 4X8HA 2ORWA 2OLKA 3UKDA 2JJ2A 1IJEA 3QOFA 1X1RA 3DPUA 3MMPA 2W6IA 4PSVA 5EE9A 1EFRD 2C9CA 4P4SB 4OHYA 3IEUA 1X8KA 4HATA 1N0WA 1VIYA 2CL6X 3DZ8A 4IVPA 1JXMA 4B2LA 4C0BA 1G8FA 4WZAE 5SZJA 3Q8XB 4FXPA 2JJ1D 1VHTA 1YKSA 2VF7A 5JLJA 4RCZA 2J3EA 3KQKA 2JLZA 1Z0FA 1QHHB 2GJAA 1W49A 3H0KA 3WNBA 3FHCB 4OK5A 5L3QB 1RPZA 1KMHB 3LX5A 5FH9A 1WQ1R 4V0ME 3ZVLA 3KQNA 4A8JC 4C0KA 1E2GA 4HDCA 3BH0A 3NBYC 4WZBE 4OHZA 3UG7A 1XEFA 1G7TA 3BS4A 3GCGA 2P6NA 2HJGA 1C9KA 1HUQA 2QSZA 1NJFA 2F6RA 4PPFA 2IYQA 3N5CA 4FMDB 4LBWA 5G53C 4D0GA 3AVXA 2OV2A 2AXNA 4US1R 1RZ3A 3JZMA 2QRZA 3DKPA 4E07A 2MMGA 4IDQA 5IK2D 2V1XA 2GK6A 2QBYA 2HYDA 2W6JA 4MKGA 1TF7A 4M21A 1P60A 2PJRA 4FMBB 2GZHA 2BOVA 3OF5A 2C9OA 2B7CA 2REXB 5JRJA 1OXTA 2O8BB 1GP2A 3FVQA 3RWOA 1BS1A 1U8AA 2ZJZA 1VIAA 3T34A 1WF3A 3U3MA 3GLFA 1HEIA 2WMOB 2BMFA 3V4RA 1FMJA 3IIJA 5K8TA 3T06B 4C3ZA 2YVUA 4O25A 2BDTA 1QG2A 4QG7A 4BRUA 4JL8A 3JVVA 2JDID 4MQBA 4W5WA 4BRWA 3VKHA 4A2WA 4JBYA 2ZRDA 1K6MA 4EFMA 1BH2A 1KI8A 4DJTA 4RY2A 1SQ5A 1VYUA 1N0VC 4JIMA 5FOXA 4TMWA 1E1QA 2F9LA 3OIYA 3Q7QA 3R8FA 3KTAB 1NBMA 1G64A 3GFPA 4IVRA 2D06A 3AP1A 3WMFA 2EWVA 2FN4A 5JI3E 1DE0A 4TSFA 2AD5A 2BM0A 1AQUA 3EC2A 4TMTA 5JWRA 3SN6A 2GILA 4FWIB 2XB4A 4DDTA 4GNKA 2HYIC 2G9NA 5FTKA 1OH8A 1S0UA 3DEFA 1FUKA 4JL6A 2IS1A 3U3KA 2X1VA 3QE0A 4LYJA 2KBFA 4LV8B 2O8FA 4LJAA 3FWYA 5ANRB 1OIWA 4MRSA 4PAQA 2QAGA 1NN3A 2R9VA 2W0SA 4HDOB 2NO6A 2RGCA 1X3SA 2V54A 4O2LA 3QKRA 2GZDA 1FOEB 2O8CA 1XXHA 5FPHA 2FEOA 2O0JA 3ZYCA 2J0UB 2GJKA 1KNQA 1GL6A 1D2EA 4YONB 2QI9C 1A7JA 4URWR 3RYTC 2RHMA 1N5LA 2VP2A 3CRW1 1JJ7A 4AG5A 4DRZA 1COWA 3CLVA 4ZI3A 3C4JA 4YMVA 1LFDB 2VLIA 4Z8XA 2HXSA 2ZIAA 2QT0A 4BFVA 1KDTA 2HF8A 3PV0A 2JLUA 2ZI5A 4BLOA 1G3QA 3NBFA 4KJZA 1KZGB 1L4UA 3LDAA 1XEWY 1GG2A 2GNOA 2GCPA 5FI1B 2O52A 1W5SA 1IONA 4HZUA 3PXGA 3NDBB 3CBQA 3FHTA 2FFBA 4RZ2A 2DFTA 4LYAA 3AVPA 2JJ2D 1P9WA 3T1VA 1GL9B 4QJ5A 2W6ID 1EFRA 2AD1A 1UM8A 2HLDA 4L15A 1E2MA 2OUKA 3AF4A 4OHWA 3DO6A 5SZIA 4P32A 4UXIA 2ZRAA 4S2EA 1Q57A 2C99A 3AV0B 2ZRLA 1W36B 1E94E 1XNJA 2JJ1A 5AJXA 2V6IA 3IBGA 3TVDA 5C46F 1UBEA 4D0LB 4M1SA 1HY3A 1QF9A 3WP1B 1IN5A 3GJ5A 3GLGE 4PC6A 2ZYVX 2PJZA 721PA 1GAJA 1NIJA 5P21A 1P7CA 2IW3A 1DVRA 4PSKA 4UJ3A 5KSZA 1T0JB 4NYMQ 4Q9KA 2KBEA 4Q19A 2ORVA 3W5JA 5LB2A 3AVWA 4TMVA 3TR5A 2EW1A 2IT1A 5DYGA 2W6JD 3SNHA 4DIDA 3QSYA 2Q9AA 4FN5A 4Q9LA 3VKWA 2CLDX 3KJEA 1OE0A 2FPLA 4IJMA 4CRWB 3THWA 1KMHA 3LQQA 1IY1A 3FE2A 2HT6A 1Q22A 3TBKA 3THOA 1ZMXA 3EC1A 1T5LA 2IS2A 1D9XA 4EIWA 3I8XA 4PXAA 3ADKA 1Z8FA 3QKRB 4I1OA 2YNMA 3BFKA 2R62A 2EVWX 5CYPA 1XD9A 1N2CE 3UIEA 2JDIA 1CJKC 4DCUA 2Q21A 2FSGA 1GRRA 1FQJA 2GDJA 3A1VA 2XOKA 3AVOA 3OIUA 2OCPA 2R6FA 3ZD6A 1JPNA 1SVIA 2H57A 2BVNA 3GEEA 5JFGA 2GCOB 2WKRA 4C2TA 2PZEA 3MGCA 1IHUA 2J46A 1AK2A 2CXXA 4D25A 2A7QA 1US8B 3EARA 2OESA 4LOAA 4NMMA 4BLRA 2QMOA 2FFHA 5BW8A 2DWOA 1QHIA 4US0R 3FB4A 4U02A 4D82A 1JXOA 3CRQA 4R7ZA 2ONKA 2WOOA 1MR3F 3PEVA 2QMHA 1S2MA 5KNBA 2DHRA 1ZCAA 3KKOA 3KFVA 1ZVQA 2RGAA 3AUXA 3PUYA 2VSOA 1COWD 1RRGA 1XBTA 4LSGA 3SFZA 1X1SA 1Q1QA 1RJ9A 3TR0A 2I1QA 1W2HA 3AF1A 3GLIE 3MD0A 5KPJA 4B71A 3WMEA 5FBVB 2R8RA 2PCJA 1HA3A 5JEDA 1HYQA 3CX8A 3A1TA 1FMLA 3CB4A 2IF2A 3ADBA 5M04A 2O5VA 4YLGA 5LPNA 1WCV1 2AK2A 3AF3A 1ZU5A 1H8HD 3VR4A 3TAUA 5H68A 4MGIR 4JL5A 3KTAA 4KO8A 2CHVA 4QJ4A 3L0IB 5TARA 3QG1A 2C5LA 3IGFA 4GI7A 5FPYA 3PVSA 1EFHA 4TMZA 3IHLA 1XF9A 3QG5A 2IX3A 2EYQA 2LCFA 5GADl 1Z08A 5TY0A 4F7WA 4U7DA 2IYWA 4PZLA 5FOSA 5DI3B 5HZHA 2YWEA 4LPKA 5L3RA 1KSFX 4TTQA 4D2IA 1DPFA 3EZFA 2OFXA 4B47A 1P6XA 3F0TA 3VFDA 5G40A 4GT1A 4AYTA 4BFWA 2ZYWX 1NN0A 3KL4A 3D7MA 1G7SA 3NDPA 4OQMA 3RRYA 3U3OA 4RSGA 4TN1A 1KDOA 5G41A 1AGRA 3QIAA 2XJ4A 1VCNA 3O47A 2OZEA 5FPSA 5HE8A 3EA0A 4IXNA 3IIMA 5EE3A 3BRWD 3WNCA 2NIPA 2CHGA 2G6BA 1VG9B 3OFNA 4IEIA 4UNRA 1XCMA 4B32A 4EPXA 1TX4B 1CRPA 4OQXA 3ZZTA 4BLPA 4GFDA 5GJBA 4DLTA 5AUQA 4IHQA 2ZRPA 2QQEA 1AGPA 4XWKA 2O8EA 4P0TA 3PIRA 4DDVA 4WOPA 1ZBDA 2VL7A 2JASA 4ZIRB 2IUSA 4FMCF 4PO8A 5CDFE 3W6PA 3IBYA 4AY2A 2VTKA 2ZSAA 5JZVA 1WB9A 2W00A 2OM2A 2OAP1 2J41A 2YWGA 3C14C 1E2PA 4DLZA 1PJRA 3SJBA 4MDEA 4PO9A 4WBSA 2OCBA 5G3ZA 1Z22A 4MRVA 1W0JD 5DHAA 2PCLA 2WWHA 2QPOA 5DNYB 1R8QA 3CWQA 3ICQB 2FG5A 4B3DA 4IKEA 4D4LA 3FYHA 2CE7A 1BOFA 1R6BX 2JEOA 4BASA 3HDTA 3KJGA 5B58C 4DKXA 2IF0A 1QVRA 2ZAMA 1A2BA 2V9PA 4NCIA 5BN5A 3ZIAA 1KYIA 2ERXA 2FEMA 3EWSA 4Z51A 2YC4C 4DIEA 4KVGA 4MUAA 4EQ6A 2B6HA 1TF5A 5C2JB 4CGZA 2G83A 4PQRA 2XTNA 1ZD8A 4EPVA 4QKQA 1KZ7B 3WBJA 521PA 2ATVA 4DSUA 4ZCIA 2MSCB 3I61A 1HE8B 4LJ9A 2RGGA 2IYSA 2WIBA 4NCHA 2PLRA 2ZI9A 4UJ5A 1HQYE 2HF9A 1TUIA 3PJRA 3H84A 4A82A 4YMWA 4DCVA 3A4NA 3ZDQA 4G5SA 4F4JA 4HLUA 5EQTA 1T5IA 3B85A 2ZETA 1K8RA 4PHGA 221PA 3QPVA 4D0NA 5KNCA 3MRSA 1QRAA 1WXQA 2Y8EA 3KJIA 4LBZA 4PR0A 1US8A 1S9DA 4PPQA 5TXGA 3EWAA 1BIFA 2XZPA 2PX3A 5FL7A 1OH6A 4K81B 4Q9IA 3LWNA 4QGHA 5E7MA 1N6PA 2FH5B 1E0KA 1XX6A 1G8HA 2QMEA 2REBA 3MCAA 3OAAD 4O0MA 3W8NA 4CEJA 4ZO4A 4XVQA 1VG0B 2EFGA 4IOLA 2FZ4A 2WZQA 1U81A 1RFLA 4TMKA 2CDNA 2EWWA 2FNAA 4UKDA 5DO9A 5AJVB 5TDHA 4AD8A 3ASYA 2C96A 2F43A 5C4GB 2WWWA 3K9GA 3TMKA 4R2HA 5TB5A 1I2MA 5IDVA 2Q3FA 3LVQE 2TMKA 3AB3A 3ND9A 5JCZA 3ZGXA 4A6PA 3GQBA 2AXPA 2AWNA 1M34E 4TTPA 4C0QC 2IYTA 2QGNA 1S1CA 1T8UA 3NEYA 4FINA 3U3JA 4G5QA 3ND8A 1NKSA 1ZC4A 5GVSA 1KO8A 2EFHB 4G5GA 3RHFA 3IQXA 3X1ZA 1KSJA 3ZH9B 4M1MA 1Y3AA 3ZLJA 3K70B 1EWRA 4M2LA 3V9PA 1R0XA 3TUIC 2JLRA 1DEKA 3QF4A 3GLIA 2BV3A 1ELOA 3OESA 4G5RA 4QGFA 4OK3A 1Q1ZA 5KYKA 1F6BA 2FE4A 1E32A 4BFZA 1VPLA 1FFHA 4JYBA 1E79A 1XTJA 1XTSA 2HUPA 4C30A 1Z63A 2OO7A 4KFSA 1P9RA 4UXJA 1ZM4A 1U98A 2ZUDA 2ZRFA 3MSXA 1Z6AA 4BPBA 1ZRHA 4DSTA 3LX8A 4TLCA 1LV7A 1MH1A 4PAOA 1KK2A 4QNRA 5BQ5A 4MYTA 1SXJB 4LC0A 1KI1A 1R8SA 2CCKA 1SZPA 3V00A 3AVTA 3NVAA 4QFMA 1S8FA 4C0HA 5L8VA 3K0FB 3R9WA 2CNWD 5KUTA 1U0HC 1ZYUA 4EDHA 1CJUC 2OCAA 4QM7A 1N6OA 4MH0R 1TADA 1KKMA 4PAMA 1GKUB 4KV9A 4V0OA 4B33A 2PMDA 1ZINA 5FOWA 1G3UA 3DOFA 3PENA 2P6RA 1Z0KA 1R0WA 2DFNA 5JRZA 2YZ2A 5CDFA 2D2FA 4BLTA 2XITA 4RKFA 3T5DA 3CX7A 3GJ6A 3PR1A 3AP3A 3BJIC 4LYFA 1P2VA 1CXZA 1VCIA 1UADA 1YZTA 3AKCA 1VCMA 3A1UA 2R6DA 3DOEA 4HLCA 5A4JA 1YR8A 3Q3JB 4B2IA 5AUNB 4RD6A 5TV2A 1LS1A 4B35A 1E99A 4G0NA 2HT1A 4WXPA 1XZQA 2JJ8A 3QJYA 2QN6A 2XZOA 1IQPA 4HB0A 1YR7A 3K53A 1JB1A 1VTKA 5D3MB 2KWIA 1LW7A 4B6FA 3K9NA 3THXA 1IXZA 4M9ZA 4P3YA 2ERYA 4TL7A 2CCJA 1VECA 2ZS9A 1RJ9B 1ZUHA 2RGXA 4HAZA 5DGXA 2QPAA 5JBQA 4OJKA 3BFVA 1NLZA 2OSBA 3AVVA 3PEUA 2XEXA 2C2HA 3K0AB 3LY5A 2GZAA 3VMFA 4A92A 2B8WA 4C2UA 4RZUA 4FCTA 4KI0A 1MO5A 1LTQA 4TYYA 3U4QA 4HI0E 3X1DA 1ZD1A 2IL1A 4EPTA 1SXJE 1YVDA 3K0CA 3FHOA 1SKYE 1SXJD 2ZPTX 1X8JA 2ONJA 2DFLA 2QGZA 1D5CA 2ORIA 1W2GA 3E70C 3AQ4A 4AYWA 1FP7A 4AK9A 1T3SA 4IDHA 3T1QA 2J87A 3EPJA 3W6NA 4D4KA 2AR7A 1NY5A 1UBGA 4LBVA 5CITA 4H9GA 1II8B 2ZXUA 1BMFA 3GLGB 1MV5A 4DB4A 3O8DA 4P31A 1DAKA 2VHCA 3CKLA 4IDPA 3R9XA 2WJHA 1OIXA 1R10A 4EQ6B 1JNYA 4IOKA 3I32A 1OH5A 3U61B 1ZUIA 3B2EA 4LJ8A 1BYIA 4JLMA 5TMPA 2VHUA 4AKEA 1DTSA 4R9UC 2P65A 4XD7D 2CVFA 2CLSA 4L4UA 3C7KA 3LVRE 1WBDA 5KHOC 4WIAA 2VPPA 1E6CA 4A8JA 1XDBA 2PZGA 3K1JA 3VX3A 4F4IA 1K5DA 1KJWA 2PEZA 2P5SA 4UNNA 4EPYA 1XJ0A 1GRQA 5J4VA 2VSXA 4NONA 2FA9A 2AX4A 3SYNA 2LKCA 3KXIA 2IUTA 4KYIB 5KOYA 1JQJC 3HU3A 4R98A 1G16A 4ZIRA 1E98A 2R65A 3Q5EA 5JSZA 4OBEA 3CWZA 2JGNA 2GVDC 3V4FA 2NO1A 5FUWA 4B74A 1DAEA 4RFVA 3D31A 4XTRA 1NMZA 1CR1A 4ITRC 4ESVA 1AJEA 3HU2A 4EKDA 1X6VA 5JSZB 4Q00A 3IHWA 1KOFA 3SHFA 4TZ0A 2GWHA 1XFAA 3AKYA 2XAUA 2Q3HA 2F55A 3HJNA 4KLZA 4ZCLA 4EPWA 4IEEA 5IRCD 4LPSA 2MSDB 5J4YA 2HV8A 2OBMA 4Q1EA 1MABB 4ZDWA 2UKDA 4OHVA 3CIOA 1DBSA 1RYFA 4WW0A 2ZRGA 1FNNA 1KI9A 2AFIE 2F3RA 3K70D 4YXWD 2X2EA 4DCNA 3A8TA 2HDNB 3SYKA 5L3SB 1WDTA 5EZ6B 3X2SA 5E7JA 2A5YB 2E1RA 4EUNA 2A3RA 6Q21A 1SVOA 3Q72A 1G20E 5EUMA 3B9PA 1KSHA 4AURA 4AKIA 2CJWB 1FZQA 2FGJA 2ODEA 4Q1AA 4Q4JB 1SKYB 2B8TA 2FMXA 4YDSA 1G5RA 3F3YA 4Q7JB 1FTSA 3DZDA 2VP4A 3PFIA 4Q18A 1II8A 4Y0VA 3NBZC 3ZJYA 5L3VA 3CRMA 4Q4JA 1HURA 1KO1A 3BK7A 4AKGA 2J0QA 1XEXB 1FNMA 4JT2A 5KDOA 4D26A 2GTPA 5DI3A 3ZS8A 5AUOB 4DLXA 1TMKA 4NYJR 4RJLA 4WA7A 4KVAA 3SS8A 1KI6B 1R5BA 1XJCA 4JSTA 2DCUA 2WTUA 1V43A 1Z5ZA 1NVXQ 3QUSA 2XTZA 3VNUA 1VDZA 4HUQB 5FBRB 4MKHA 1W5TA 1SGWA 1Z0JA 3VR3A 3RSLA 5CM9C 1NG1A 3VR6A 4B3CA 4TL9A 4URUR 2HJVA 1CBUA 1IY2A 5FBWB 3T1OA 3QPWA 1L4YA 4XH9B 2O8FB 2IXFA 4KODA 4JVSB 3HWSA 2H1LA 3CNLA 3MG9A 2ECKA 2ZYUX 4NE2A 4W5HA 1HTWA 1SVKA 5CJ2A 1V5WA 4MGKR 5JECA 3ZZUA 1ANKA 1Z6TA 1G19A 3EIQA 1W46A 2ASEA 4HUQA 4K46A 1RC8A 3OEEA 4B43A 3QQ5A 2CL0X 2PMKA 2FF7A 4DUGA 4N3NA 4RFSB 4LY6A 5JJLA 2ZYTX 2FU5C 1OHHD 2RGNC 4XD7A 2WJYA 3QVVA 3F5FA 5KTYA 4RZXA 2X77A 1KO4A 2A5JA 4YDHB 1ZD9A 2ZI3A 3BB1A 3LQRA 2Q9CA 1T3HA 3AP2A 5HR5A 1OFIA 3PITA 4JKYA 2Z43A 4N1AA 4PHFA 2QRNA 4NBSA 4LGMA 4M1TA 2C9YA 1CLUA 3TRFA 1N6RA 2F43B 1NL3A 2FFQA 2Z4SA 4IDOA 4KHZA 4NCNA 1U90A 1ZM7A 1OPXA 1QHYA 3PUZA 4G5OA 2QQ0A 4NP6A 3DMNA 5CB8A 1FL9A 4M1OA 2GCOA 2CJWA 4X8MA 1G7CA 4QNMA 1YZGA 4MRNA 1D2NA 1JEDA 1GNQA 4HEJA 5AWFC 3THWB 1YZLA 2ZJ2A 1CU1A 3L0PA 4FWTA 1RYHA 2BEJA 5LD2B 4M9QA 2P67A 3GEIA 4LDJA 4DT1B 3QXXA 5KSPA 1OIVA 1PV4A 821PA 1A2KC 3DVLA 3BH6A 4YMTA 5BN4A 1S4QA 1JR3D 5EXSA 4ZCMA 1PUJA 4XWOA 5A5GA 5JEEA 1XD2A 3OE7A 4LX0A 4GSYA 4B6EA 2JLXA 3CZQA 2VEDA 4TLBA 3L82B 2ZANA 3KX2A 4TQAA 3VTKA 3C8UA 2I3BA 4JKIA 1W4RA 2XOKD 1G41A 4IFEA 1CJMA 1E2QA 1JJVA 1Z6GA 4Z54A 2RHDA 2NO9A 3IPYA 1X86B 1GOTA 4JLOA 2ZVQX 2YYZA 3U7FB 2I4IA 2ZE5A 3AKEA 5CYOA 1XD8A 2YV5A 1XCGB 4LCBA 4POAA 4FW9A 4A9AA 1MO3A 1N6IA 2BJWA 2D74A 3W3ZB 4Q9JA 4N0EA 1U8YA 1ZIPA 2P0EA 4M8NE 1FTNA 3CRRA 4NL4H 4LC1A 1OXXK 1XPRA 1KAOA 4DLUA 3BAFA 1GM5A 1E0SA 2F1IA 1U99A 5FOTA 1RKBA 2QE7A 3B1YA 1E0AA 4HLUC 4Q4AA 4DEYA 1KIMA 1BKDR 1G4AE 1FP6A 3M1IA 4QL3A 4JBXA 5EE1A 3N2IA 3NEJA 2PLFA 2D7DA 1VKJA 5AJYA 4GBMA 1J7KA 3FMIA 1Z47A 2RGEA 4IRUB 4XJXA 1E2FA 2NTYC 5JHHB 4LHXA 4BLQA 5AK0A 2ZJ8A 2O8BA 2NPFA 3W6OA 1DAMA 5EXPA 2RB4A 2ZRMA 1CR4A 1JQLB 3GP8A 1VYTA 1S96A 4OQLA 1JECA 1EFCA 1O87A 1QHNA 2CLCX 2G0NA 3NH9A 4A2PA 1YE8A 3D6TB 1W47A 5BXQC 1QHSA 1Y63A 2GETA 4RKEA 5FI0B 5DI9A 3QXJA 1W44A 1PLLA 4NCJA 3LRPA 4Q4HB 1MRNA 5E95A 2ZR0A 2JA1A 3N70A 3OEED 1N6HA 2G88A 1YRAA 2VP6A 4DUGD 2CVHA 2GKSA 1I4LD 1Z0AA 3EASA 4M1WA 3GJ0A 3T5GA 1GIAA 3ZQ6A 1UKZA 3QNUA 2FDCA 4OQFA 2V1UA 4MITA 1DAGA 1QDEA 1EK0A 1E4VA 3Q9LA 1TUEA 2NZJA 2BCGY 2D2EA 2HCJB 1KTVA 2F7SA 2J0SA 5KPDA 1LS6A 3HP1A 1E0JA 3ONWA 1M74A 4Q02A 1U2RA 1GILA 1GZSA 3TE6A 3D3QA 2L0XA 4NYJQ 4IOJA 3OFND 2RCNA 1UFQA 3GJ7A 4CVNA 4KFUA 4H1UA 1IBRA 4GRAA 4UQOA 421PA 2ANCA 3AF0A 2HEIA 621PA 1G9XA 3FTQA 2QBYB 1C4OA 1SVLA 1YRBA 3K09A 5E4FA 2RKOA 2DR3A 3KKPA 3P27A 3QKSB 4HB2A 1JR3A 4LBYA 1S3GA 4C7OB 1M2OB 3OE7D 2YOFA 5K8IA 1LY1A 2IBMA 5BYKA 4BEJA 1AM4D 4M22A 3QEOA 3WXMA 1OLOA 1Z06A 3GLFB 2QAGB 3NC1C 1M7GA 1TF2A 3IKJA 3REGA 4QHYA 2SHKA 2ZJ5A 3SI7A 1P2SA 2CK3A 2KJQA 3VHXA 2VIIA 2QM8A 1W0JA 1ZNYA 4G3XA 2QZ4A 2GCNA 2IUUA 1PZNA 5B64A 3KB2A 4NH0A 2OXCA 3QKSA 4Q7MB 2QTHA 2YWFA 3MUFA 5EUQB 5C18A 3ADDA 4OI4A 4DCSA 1DO0A 5FUVA 5CB6A 3CH4B 3C5CA 1ZW6A 2QENA 5FUYA 5C1BA 3LBNA 1S3SA 3BWDD 2EYUA 3W5IA 4CZ2A 2JLWA 3UPUA 1EFUA 5LDDC 3I5XA 3KUDA 3QF4B 2RGDA 3TNFA 3HYTA 2ZR7A 3ECCA 3LV8A 5F3WB 1NF3A 1SULA 1OYYA 4Q4AB 2ODNA 1IJFA 4A1FA 1SVMA 4DSOA 2WJJA 5FBQB 5IHPA 2QE7D 2WAYA 2NGRA 3CM0A 4CEHB 1JR6A 2QA5A 3EZ7A 4I1SA 3MWJA 3HR8A 3I1FA 1Z6YA 4BGDA 3K0SA 4LRWA 1E69A 1KMQA 1XPOA 2O8CB 2JLVA 1VCOA 3CF6R 3LAWA 4PTLA 4CYMA 3KQUA 4TYWA 1XEWX 4JLPA 3MAAC 4Z1MD 3G82C 2DWPA 2KE5A 4OK6A 3I8SA 1XD2B 1JAIA 1W4CA 1XMIA 3TAHA 1TPZA 2C77A 4MA4A 5EXTA 1M8PA 4PSAA 3NHBA 1TQ4A 2ZSFA 3ZQJA 2CE2X 4Z8YA 4HDQB 1E2HA 1EX6A 4TT3A 1N25A 3S1AA 3M0EA 2IHYA 1HT2E 1XTIA 1R0YA 2WPDA 3ETLA 3K8YA 3RS7A 4LK2A 4C0SA 4QJ3A 1YZQA 2GAAA 4PQFA 1GRNA 4PPNA 5LD2C 1CF4A 1XP8A 1P9NA 4LV6A 5BN3A 1NG9A 1F5NA 3EA5A 3B1ZA 4QOSA 2J45A 1E9SA 4DLVA 2G1KA 2IXGA 4B2PA 4RD0A 1UKYA 4BUJA 2YOGA 4C0JA 4F91B 1G21E 4C4PA 1IXSB 3T12A 3IILA 3G5UA 5HCIA 1IY0A 2J5XA 4BFXA 4CEJB 2VRWA 2ZE6A 3BC1A 3RS5A 1DADA 4GOJA 4I1UA 3RWMB 3TUJC 4LJ6A 3U44A 4PC3A 2WWGA 2H5EA 4HSEA 1NI3A 3AGPA 5J5CA 1S9HA 4RD3A 2WKPA 2ZROA 2DYKA 1JALA 2WHXA 3KKMA 3LW8A 2JLYA 2Q0HA 2AFHE 3CPEA 1FW6A 1RRFA 2ZSBA 1AKEA 3B1WA 3WMGA 4NPHA 3EX7C 2A5GA 1J8MF 2OILA 2QORA 3AGQA 3NBXX 2XXAA 3LFUA 4QM6A 4D81A 4DDUA 5HKKA 3HYRA 1T8TA 1W4BA 2N1BA 2ZI4A 3CW2A 2ODWA 4EJSA 2CNWA 5EE0A 1AS2A 3I73A 1J70A 3CX6A 4BZPA 1G3RA 4A36A 2DB3A 4BZXA 5FTNA 5FR1A 3M4YA 4TYQA 1OFTA 1IN6A 2A9KA 4NKRA 4DSNA 2O8EB 3LO5A 5GVRA 3UANA 1LF5A 1FPMA 1GL7A 1II9A 1OW3B 1P73A 4C7OA 3GFTA 2P3SA 2HCBA 1YZUA 1JAHA 5JS7A 4CEIB 5JJIA 2N46A 1XMSA 1E2LA 5DH9A 2QY9A 4P4UA 2XB2A 3THYB 1EXMA 1G6OA 5FOVA 3OIWA 3GJ4A 3Q5DA 3IEVA 1WBBA 4O2RA 5DLQC 1WMSA 5GJWC 3KXLA 1P72A 1G8GA 2B92A 1JR3E 1E1RA 4MKIA 4KLNA 1Q20A 3SBEA 3AF2A 2ZRKA 2ZRIA 1ONBA 2BC9A 3TW4A 2BM1A 2ZUCA 1JPJA 3QKTA 2GAOA 4D6PA 2ANBA 3FDIA 2RAPA 3L43A 3P26A 5FL3A 4RZ3A 3B1XA 5B57C 5L3SA 3E5HA 1CKEA 1F60A 3FMFA 1EESA 4Q1CA 3RS0A 3LBHA 2R6GA 4QXAA 1KK1A 2GK7A 1NBME 1TQ6A 1ZAKA 3Q85A 1OB5A 1P4SA 2BCJQ 4L8GA 1OV4A 1ZUNB 5J4LA 1OT3A 1G8YA 1SXJA 3B78A 3CF2A 3F8TA 5CIQA 4GP6A 2J0VA 4JLVA 1Q44A 2WSSD 4LJ4A 4RCYA 4JVLA 2UZ3A 1CULC 2IK8A 1Z6XA 1CR0A 3GEHA 1AKYA 4TL8A 3UMRA 4LJ5A 4EFLA 3SE0A 1DS6A 3AM1A 1G4UR 2GEDA 4BFYA 1ODFA 1P5ZB 4WXRA 1D6JA 1BMFD 1LNZA 2WBLC 3KUCA 4IVQA 4LHZA 3AVQA 3NIBA 4PC7A 3ZVNA 4WAUA 5FOUA 2AHOA 3AKDA 1DAFA 2OAQ1 4M1YA 5DN6A 1GTVA 3O8RA 1GDDA 1SVSA 1CP2A 4MRRA 1W36D 5JWHA 2P5TB 4CEHA 1ESMA 3R9IA 1E2NA 3EAQA 4JZKA 1U8ZA 3MJHA 5DIFA 4Q03A 2WJIA 4E5UA 2QNRA 5KSYA 1XEXA 3KXKA 2EFEB 4JSYA 3B1VA 3W34A 4DXAA 3KQLA 2ZR9A 3FPAA 1RIFA 4P4SA 3U2QA 4B34A 1IN7A 1OXUA 1NVUQ 3DM9B 4HAUA 4HAVA 4ASUD 2RH5A 3HPQA 4ZDJA 4NCKA 5K8LA
chains in the Genus database with same CATH superfamily
1WXHA 4RZHA 3RJ9A 1MEOA 2DT8A 1C1DB 4OF4A 2P8JA 5AVWA 1W2WB 5I47A 3H8WA 1YK0A 3JD1A 4EW3A 2R1UA 4XJSA 3UXMA 3T5MA 1DT5A 3L7MA 3QXGA 4R9SA 2O1SA 3U0VA 2ZZKA 5EHXA 1L8QA 2B5OA 3R76A 4DBVO 5ES3A 1H1DA 3FUUA 2GXAA 3DMTA 3H5TA 3I92A 4WKNA 4K0KB 3OTHA 5FR2A 5BW5A 4KU4A 5L7WA 5LQRA 5A5DA 3FZNA 2H2DA 1B74A 1KC3A 2EKPA 3BWVA 4KQ1A 4XAQA 4AYXA 3RU7A 2H9YA 2QB5A 4B8ZA 1XRSB 3A9UA 1NUHA 3TIGA 2OBBA 4E51A 5A6VA 3F6SA 4IDAA 1RI2A 1ESCA 1TVEA 1Y42X 1NUAA 4TSKA 4BMPB 1EG7A 2VJDA 3H86A 1ULHA 3SJ7A 3UJNA 2WZCA 3L7YA 4CF7A 1NMXA 3ZHZA 2GOYA 2HF2A 2QTRA 3WGLA 2WF9A 5LMUB 1U0FA 2RGNA 3VU9B 1CDDA 4BEBA 3SU8A 1IEVA 4FU0A 2FEKA 3GT7A 4Q6WA 2WSMA 2D7CA 3SCZA 3SEQA 2RC6A 3RC8A 1IZ9A 2J31A 4BEVA 4O5OA 1W34A 2E89A 3GUCA 4NBWA 4NQRA 4UVDA 3QY0A 2G06A 3QTTA 2G0TA 3ASVA 2C61A 3EFBA 2C0PA 4MUJA 4RGQA 3OKPA 4M9SA 2C1ZA 1YXMA 2QSYA 3B6EA 2AJ8A 2IOHA 4DYDA 2W2KB 3TIFA 2F1KA 3KQQA 4GH5A 4GOOD 1RM0A 2FR8A 2WF5A 3HM2A 4EHLA 3O2JA 2EFCB 2H07A 2B1IA 4ML3A 2XYQA 3BDIA 3RHSA 5AUPB 1XCPA 4X3OA 4YQFA 1MJNA 1O54A 1T5BA 2PYIA 2W2KA 1PEDA 4E5SA 2PO5A 4Q9HA 3EIXA 4TL6A 4YV1A 5INTA 2I4NA 2NADA 3OZ7A 5DYIA 3ZWNA 2A78A 3KDSE 2AG1A 3VOSA 1L5OA 1QUEA 2HXGA 4NHOA 4ETIA 2VWQA 3IQFA 3PWTA 4JP2A 4ALNA 3BBPA 1CQIB 4HL6A 4QDOA 5FWXA 1F7VA 4AG6A 4XDZA 1GLVA 1R4NA 5IXYA 1CUFA 2FXVA 4CM4B 3DGFC 1FYFA 1YQXA 3IAXA 4XKJA 1Y7TA 4GQBA 5T4BA 3GRUA 3KOOA 3HACA 5CJPA 4Z4QA 3HRIA 1GU1A 4I8IA 4MSUA 4FFVA 3R5FA 1FMTA 2V97A 3DDSA 1TTHA 1ZH0A 2ZJYA 3JU3A 4FGZA 3HR7A 4BJHB 4IIUA 5LBTA 3FHLA 3K1AA 2VNIA 3QJGA 1AMNA 3LPLA 3UJPA 2OEPA 3B8HA 1TYCA 1XC7A 3DBRB 3DHVA 3IQEA 3KEGA 3KT0A 3ONNA 5CXXA 4YPFA 4P86A 1XMJA 1YZYA 2EFJA 4KVZA 1MO2A 2BWJA 1E2UA 2WJVA 1LU9A 1DFIA 2PVPA 3H9GA 4F4CA 1WF6A 4DNQA 2QTFA 4DEXA 4LI0A 1AY0A 1BWPA 1WDWB 4OPMA 3R7WA 3KPUA 2X9NA 3X1JA 4A6DA 5CBPB 2ZCUA 1Q0LA 1M6EX 4H18A 4RTSA 3UOGA 1LW6E 4BWYA 5JU6A 3IQIX 3DJYA 2VJKA 1WRBA 3R74A 1C7RA 1M2OA 5CLQA 2W6NA 1I9CA 1OHHA 3CBGA 1EXWA 3C1UA 3GJSA 4FGLA 4HGRA 4MQLA 2W8BA 5C37A 3G1WA 5F2NA 3O8CA 2RCYA 4CM9D 1X1CA 2W6QA 1NE7A 5A2QA 1GD1O 2H2GA 1KOLA 3ER9A 4CKCA 5A9RA 3BXGA 5HKOA 1V7ZA 4UUBA 4F4UA 1IB6A 2DBYA 2G72A 3AHJA 3ETEA 3IMKA 3F49S 4GOLD 1E5VA 4C43A 5ELMA 5F7XA 4IH1A 5AD1A 2O8DB 4RGYA 3J81k 4FIDA 4BVLA 2C2WA 1D2MA 3EIOA 3EF1A 4YASA 4ZZ1A 4GPTA 3AJDA 4FPXA 3DMPA 5BSWA 2V9ZA 2HJSA 1TGYA 2OO5A 2IRWA 1P62B 5FP0A 1JKFA 1FVFA 3L8HA 2PYDA 1KO7A 4X1KB 4TRNA 1T1IA 5JYEA 3WQRA 4PZUA 3KYBA 1PZMA 4BQSA 2PT7A 3CPSA 1YS1X 2J0UA 3FNBA 4IF4A 4RIFA 3NHAA 4MJLA 4BCBA 1Q21A 1EX7A 1OB2A 3DLTA 4QIHA 2P2SA 1P7PA 4YECA 2A58A 4S1NA 1JG7A 4YAOA 4NLLA 3CH7A 2IOFA 2NVWA 4AJ2A 5CDTA 2WUWE 2RHHA 3M6WA 3UICA 1AH2A 2OXRA 1XZCA 3WLEA 3P20A 2FZ5A 1RJEA 3HN6A 3K0FA 4RUKA 3SDZA 4HAYA 4IV0A 4J0JA 3L46A 3R7FA 3T1HB 3THXB 3DE3X 2DLNA 4XA8A 3R7BA 2VPZA 5JJKA 2D3WA 3FBGA 4KUEA 4XVRA 1Z4IA 3WVNA 3HSYA 4MGZR 4DPLA 3EPKA 1V9CA 1C7FA 1IMOA 3IA7A 2XHEA 1AOXA 3I4LA 2AN9A 3GB9A 1HKHA 2PSSA 2HKIA 2QN8A 3I9JA 2QAJA 3TX2A 3LXMA 5E6SA 2B69A 3IT1A 4L50A 4MIYA 3VTZA 4BP1A 2E85A 4QEZA 2A92A 3PQ2A 3R24A 2BGRA 3OETA 5L4LA 2LVBA 2XYVA 1IG3A 1P45A 2ZRQA 4BMZA 2RBKA 3T5BA 1NJGA 4MYUA 2IPNA 1XP5A 2OYSA 2WM8A 5LZ9A 3SC3A 3O8NA 4A5SA 4C87A 1UK9A 3F5MA 3CPHA 3QITA 4XCXA 3UYKA 3D6VA 2J32A 4P35A 1Q0ZA 3RS9A 2VDJA 1ZNXA 4CF3A 1RQLA 1TIBA 1DO2A 5F76A 4EDFA 1F3OA 3HJUA 1E3IA 4MV5A 4QDUA 2C00A 4D4HA 3EGWA 3TLXA 5JFTA 3SR4A 5IF9A 2ORED 1BWQA 2Q6OA 4HZIA 4BZZA 3S2SA 2R6AA 2AA3A 5A71A 4XGKA 2LCIA 2X5NA 2ZITA 3HYNA 4GGOA 5ALXA 1L5GB 4EOGA 3HFGA 3EOBI 2D8AA 2P4EA 2XMSA 4OFWA 4Y6OA 3RAPR 4UNSA 4AJHA 1XU4A 3QE2A 4QXQA 3M4ZA 5JSHA 3HFJA 2P1RA 1N2SA 2YC2C 5HE9A 5KSWB 2YY6A 3GAZA 1NBMD 3MTGA 1X13A 2EGUA 4MUYA 1MPXA 3KJQA 4FBMA 5T8KA 3SICE 1L5RA 1RABA 1ZIYA 2ZS7A 3UK6A 4N9WA 4XIFA 2Z5FA 1UWKA 4WK6A 1FFAA 4PQYA 1YDHA 2XJ9A 4PIPA 1QU2A 1ZUWA 1DJMA 1PHRA 3DZHA 1ZM2A 1GXSA 1ONNA 4DWOA 1WDLA 2J59A 1V7QA 4BIIA 3LO8A 2P2ZA 4OGFA 2O05A 4O3MA 2B1QA 1EBFA 1R7RA 1XZIA 4JEMA 2YNMC 1R00A 3DAFA 3K9QO 4UUAA 4IJWA 3UJDA 1QX3A 2WUGA 1L5HA 1F2UA 3O3NB 5FI3A 3SF8A 1TC2A 2FSPA 4Y3UA 4ACAA 4BFSA 1ZI9A 3A9SA 4RGBA 4M55A 2BIFA 2PEYA 2ZZMA 1N5JA 3ADCA 3VAZA 1VP9A 2JGLA 3E22B 4LA4A 3SJUA 3LL4A 5L6MB 4BV3A 4R1QA 4TM8A 5F9HA 1KJ9A 1RE0A 2IHBA 1C2TA 1EP1B 2B82A 1PJ4A 2Z08A 3A6EA 3HB4X 3T7EA 3ZW7A 5IYZB 3WP0A 1GL3A 4PF1A 1VSTA 2OXTA 2JS7A 1D6NA 1Z13A 4Y2QA 1WUHS 3HB1A 2YIJA 2B35A 4K8OA 4AQYB 1H3EA 1MPTA 2G9VA 3HDGA 4X6LA 4CG1A 5A62A 4RVNA 3OTQA 2QY6A 3OKFA 4L4SA 4TQ9A 4XYMA 4WH0A 4TV8B 1XWWA 3Q10A 3P4XA 1O77A 4JJZA 3GLHB 3ZXSA 2W2MA 4CEIA 4HG2A 4D9BA 3IB6A 1ZOLA 2PUJA 3EAFA 3GHHA 3GNTA 2P40A 5JQWA 1C7QA 1O5OA 2ZYDA 3ANNA 4X62B 1UDBA 1BE8A 1ESEA 1ES9A 1YHZA 1YBMA 3AU9A 4OXKA 5SYAA 3TPFA 5KU1A 1AS0A 2X5JO 4I1PA 2NPIA 5G3YA 2PGDA 1ZD3A 4Q16A 2PU7A 5CJJA 4EMBA 3GR6A 2HLDD 1PGNA 4MW9A 2EW2A 2FKNA 4I50B 4YDQA 1W6UA 3DMYA 3P7MA 2AQKA 1LZKA 1Z8HA 2VUSA 5BMOA 1ONOA 2L18A 2XQJA 3KWJA 1B7GO 2D5LA 3C3BA 3DBVO 5K9ZA 3G79A 4OLBA 5HRUA 4ZU3A 2WA2A 3G2HA 4JS0A 4N01A 2B3DA 1L4KA 1DKUA 1G5HA 1KIFA 3JQFC 5TX7A 3EODA 3WHLA 1UJ2A 2WYHA 4RK0A 1GSOA 3NDIA 5DHFA 3RQSA 3RV4A 3PHLA 4MR7B 3VR1A 1WVGA 3N8KA 1OI7A 4O4JF 3T1YB 1W0CA 4IO1A 4O33A 4CKBA 1EWKA 3GXBA 4ESHA 4MS4A 2BFBA 4X00A 3T35A 3S8YA 3JASB 2C88A 3W0LB 5CX1B 1VA5A 2ODAA 2J5KA 2VHEA 2PL1A 4YUAA 1YU9A 5K6RA 4MI9A 3W7BA 4Q1FA 3BB3A 5JXGA 3U4MA 1J1UA 3L5KA 2YR0A 1FUUA 1KO5A 1QGUB 1T4MA 3UA3A 5EWJA 4YHHB 3RSOA 3UWOA 1GVHA 1YQDA 3G0HA 5LKRA 4JHLA 2OXFA 1G1MA 1TEHA 1TAQA 3LK7A 3VSAA 4CIDA 4CIWA 4DBLC 5KQLA 1LJUA 5TQ2B 2WUFA 2CY0A 3EBPA 1LC3A 3ANYB 4KMOA 5DBGA 3TZHA 3WRYC 1BGWA 3IMCA 4JJ6A 4J2HA 4Y9RA 3RRXA 1ISGA 1ZCFA 3LSTA 5REQB 1K6IA 1K98A 2ZG6A 3ZIDA 2E0IA 3LUCA 3HGQA 2QAGC 3ANXA 1YZNA 4LHVA 1YRHA 3GRYA 2RIRA 3IQWA 3EGDA 3KOZA 4ITVA 1U0LA 4S12A 5F2EA 3ZDEA 3EW9A 3EUAA 3PC2A 2QXUA 1M8FA 1UFKA 4LQLA 4C5BA 2VT3A 2XMPA 4MPDA 3E18A 2YXLA 3L7IA 1W88B 4U7TB 3WJ2A 3ZC3A 1CS4C 1RRPA 2WABA 3PUWA 3LDUA 1GFSA 1HEUA 1WZNA 3BZUA 4M0DA 5KZMB 3M9XA 4TTTS 3W5DA 4HZUB 1BEUB 1VLVA 3LLSA 4R3UC 4BLSA 2G04A 4F92B 2JG3A 4FMDF 2VBCA 1V47A 3K8OE 5DHRA 4I5EA 3V6LA 4N5HX 3MJRA 1QK4A 3RTDA 3ILHA 2GJSA 1XZPA 5EUBA 1H42A 3RRZA 5BP7A 5A7FA 1GZ5A 4KWHA 5TPWA 2E6UX 1VLMA 1R9MA 2BISA 2JFWA 1CCWA 2VBGA 1K2WA 3ZU2A 4UNQA 5MN4A 3RLIA 4OLFA 1U9CA 3QLEA 3ZY5A 3DMHA 4NYMR 1JF8A 1HNNA 4MUBA 4TQUS 2Q5LA 3WKEA 2WU0A 4FMPA 5FAXA 1I33A 1KK0A 2BMEA 1W59A 5HKLA 5JHGB 4Q21A 4AWAA 4OUDB 3SSNA 3VKFA 1KRWA 3AEKB 1L5QA 1J8DA 3BDAA 5HA5A 1CUUA 3FPHA 3ZJ4A 4MR7A 2H7CA 2PX4A 4R01A 4PFSA 2XMGA 1N3YA 3LP5A 3AUSA 1BW9A 1M6NA 2PZKA 3VR5H 3W05A 1XZHA 4PANA 1PJZA 3RC1A 4AO6A 4XSGA 3RT7A 3QF7A 4LNHA 2RDMA 1RZRD 3TMAA 1NUSA 2OSVA 5FYQA 3CYFA 5CCDA 4IW3B 5L3ZA 4O1MA 3KQYA 2C95A 2VP3A 3MVEA 1FFDA 4QJIA 2ZAOA 2IEZA 3HEBA 4PG4A 1VHQA 1BQ4A 1JJAA 1HE5A 1OX4A 2D2XA 3HZZA 1KJIA 4IAOA 1FS4A 2GZ3A 1G8JA 3SEAA 2PH5A 1YMVA 4A6EA 2GLXA 4WBNF 4JNKA 2VNAA 2NUTA 4K9MA 4ZZIA 3QBVA 1Y1RA 4BOYA 1OSNA 3RLFA 5AM1A 3HCFA 3TLBA 3REFA 4CR8A 1H6DA 1LWNA 2AEJA 4FWBA 1MFZA 4GIBA 4MS1A 1BVYF 3RRMA 5HIJA 2XYRA 3ZHVA 5CXUA 4CKCB 1PFKA 3VZPA 3Q98A 3ZLUA 4TV9A 5DCLA 3JVUA 1IAQA 2IHTA 5BSVA 2FPGA 1MA0A 2A3NA 4W8OA 3PNSA 5I7FA 4DA4A 1LRJA 1HE2A 2NYRA 4CG3A 4I1IA 4KZPA 4MCJA 4C29A 1WLYA 3H11A 1SBYA 5HXAA 3U6BA 1RWVA 4BMYA 2P4HX 2X19A 1UUFA 1C4KA 1LX7A 3A04A 4MQUA 4QELA 1R64A 2IYUA 2P9TA 4ZOLB 3EEBA 2BFCA 4L9SA 3O75A 4MUKA 1OI3A 1K6XA 3OD1A 3QBJA 4YA6A 4K87A 4FONA 5FTJA 1Y7LA 2TS1A 3C98A 1AS3A 1MKYA 5G4LA 1I2CA 4IINA 2Q8NA 2P6UA 3C7CB 2YFQA 2Y0DA 3DDWA 3PD7A 5JALA 3OZDA 1T1JA 2CF5A 2LKDA 1WVMA 2CBZA 2OO5C 3JRWA 4E22A 4RTQA 3TR6A 2D1SA 3AUJB 3I8OA 4BKRA 2YXNA 4BBAA 1OJLA 3COZA 1JR2A 2YUIA 2EJBA 4UUQA 4LC9A 4UE2A 4WPGA 2IYXA 5DJ5A 1DAHA 3AM5A 3G9QA 3K6KA 3MS2A 4E15A 1J99A 5LU9A 1H9AA 4Q48A 4G63A 3NRCA 4F8YA 2PFKA 1E8MA 1C0LA 3WGHA 4ZYZA 1R0CA 5H70A 2BFMA 1GYQA 2VWHA 3GLHA 4IZ6A 4ZGGA 1E1RD 1X2EA 3Q15C 3QVUA 2H6EA 4QEDA 2EJTA 1JBKA 1NMEA 2F8MA 1QIIA 1UZAA 1SBQA 3KZ1E 3OE5A 1FVHA 4QFCA 4CF6A 1Z8DA 1ZN8A 1U2DA 1DB3A 1G8PA 1U9YA 2FLWA 2BMDA 2XY4A 1L4GA 3A58B 1RC1A 5IYZF 5SZHB 4DLWA 1E77A 2EDAA 4TMXA 1M66A 3V1LA 3CO0S 2DKFA 4GI1A 5DE3A 1GWNA 2UZ1A 3GLKA 3C4VA 4ONEA 4IIYA 5DMXA 1WETA 2GHTA 4J0CA 3FMPB 1OH7A 3BWCA 3NIDB 1ZR2A 3NG1A 2XEDA 3G59A 1HE1C 3UG6A 2FW1A 4EF5A 3CSDA 4NE7A 2Q3MA 3KLMX 1SM4A 5F1YA 3BD9A 3T7TA 3PDCA 4RFSA 4NBVA 3W90A 1EP9A 1GPUA 3AONB 4J3NA 4YBRA 2WHYA 3JQAD 1NT2A 4G2TA 2IITA 2IHUA 4HGYA 2OQVA 3MGBA 3I5YA 4NXMB 2V9CA 3HMQA 1WSWA 2VQ3A 4O8CA 2O2SA 3TSWA 4B48A 4DLYA 4MS3B 4I55A 1H9CA 3BE4A 4HH4A 2HA2A 5EWLB 4J0DA 4NPAA 9ATCA 3OF2A 2BBSA 2W0MA 1QRTA 3BT7A 2FGKA 1A7UA 4CIYA 3BG5A 4RD4A 3WRVA 1QFZA 1Q91A 1H2FA 1H93A 5G4KA 4DQUA 3LC1O 2CSXA 1NN5A 2ZYGA 3PR3A 4GI5A 5HTKA 2IZZA 1T91A 4YYZA 1D8TA 2BHRA 2ZSJA 2G4LA 1JQ5A 3LBIA 4JN6B 3ZNPA 4JOBA 3EG5A 3H1PA 4J0QA 1YS2X 5AK6A 3W5BA 1XPUA 2AJCA 2DFVA 2QRVB 4BKPA 2TYSB 4EB0A 4GMDA 2BTOA 1W30A 5T4FA 2I22A 2GVZC 4V0LA 5BUSA 2VYFA 2O20A 3N1UA 4K3VA 1JH8A 2DBZA 5DNCA 3ITNA 1BKYA 3H7IA 1R0ZA 4KZKA 5H9VA 4YT5A 2BMWA 5DNUA 4A6XA 1N9GB 3I62A 1V5EA 4GVLA 2WWXA 4QDXA 4MLPA 2FWRA 5ALLA 4Z9FA 1V1MA 3EIHA 1T4CA 3FSGD 1J1ZA 1MXFA 3DD5A 2XE7A 3QNMA 2JFXA 1YH3A 1ZGHA 2ZSKA 4YJ3A 2DLDA 2X7XA 4GGMX 1VLZA 2WVJA 1M7HA 2C3PA 3QU5A 5H5JA 1G291 4E14A 2VH1A 1ZH4A 4TLAA 1DMRA 4C6SA 2X14A 3DQQA 1DNPA 4V03A 4TZ6A 2GESA 3ENNA 1IK4A 2AC2A 3GRRA 3L02A 3X1WA 4FOOA 4KP7A 2LIPA 1JEQA 1U65A 4R2XA 5KDLA 1EGQA 1T6NA 3RRJA 5LQCA 1TAUA 4IIJA 1MJ5A 1IOWA 3WK7A 1G8KA 4WFJA 5DYNA 1XTVA 1PU2A 3QMVA 2XKBA 1EWTA 5F9MA 3GEDA 2I87A 1ZK4A 2XGGA 4G2NA 3IFSA 4AROA 4EY7A 2IY8A 1WKVA 3A6PC 2Y1OA 1SUPA 3B60A 3EAGA 2JEYA 2OZLB 3JD3A 5KYUA 5DSZA 4P58A 3SHWA 3VHLB 2ACEA 1GPBA 2WJ6A 3QVGA 4QNNA 3QFRA 4B3TB 3FNFA 4IXMA 1TQ2A 3B82A 2H63A 1P4GA 4RWEA 2ZTLA 4BN4A 3R6TA 4DQDA 1OBVA 1MT0A 5BUQA 2A9OA 3I3SR 5EP2A 1E79D 5F3DA 4WLFA 4J3JA 1HMPA 1EE1A 1M6VB 1TO6A 2BBTA 2JCSA 4JU9A 4WDQA 4XW2A 3ENQA 4R9VA 2IWHA 4HD8A 4FZJA 4Z0NA 4URVR 1LPAB 1K63A 2ODBA 3NZEA 5JMTA 1LVGA 1SEVA 3SSOA 4ZC1A 4GSKA 4EHKA 1O6BA 4MVCA 2AL7A 3V2GA 4E4TA 2YZKA 2PZ8A 2HMVA 1EKXA 2D59A 2IYRA 4OI2A 3UAWA 1TCUA 1SA0A 5JNWA 5DBOA 2Y3IA 3CZRA 3OICA 3BFXA 3JZAA 5JXJA 4JC8A 4WVFA 4DV3B 1KEEB 2EBUA 3TI7A 4L4YA 2PH1A 1MO4A 2YWHA 1WO8A 4OL0A 1KAHA 2D4HA 2P75A 1I3OA 1SBHA 1FUYB 2OCYC 3HCEA 2J09A 2F3TA 4GYYA 2OLJA 4V02A 2NU9A 1IXYA 5AT1A 4Y6SA 5E3HA 4Q01A 4TVOA 4ZA2A 4DVGA 1Z07A 4RK5A 5JRDS 2II6A 1FLNA 1JAZA 1MAAA 4R2IA 2PKQP 4XIJA 4H3HB 5GMOA 2VP5A 3WJ1A 3TI9A 4C78A 2GRAA 2DSNA 1MJGM 2W2XA 1MLDA 4OKNA 5JLAA 3FTCA 4RKRA 3ZUPA 2O6LA 5C1DA 2D62A 2GXQA 5PNTA 3WISA 1BN6A 2ZSEA 4KXFB 2JI7A 4FI3C 4FJ0A 5G1OA 3LT4A 1C81A 5ILGA 3OWHA 13PKA 3NHUA 1ETUA 1IB0A 3WAKA 1B23P 1UH5A 4XASA 1MX1A 2RGBA 4UC0A 2VP9A 4QOFA 4TTRA 3NO4A 4IPTA 3CCCA 1IHPA 1OWPA 1XNHA 2C03A 3TOZA 3N07A 1QR2A 2PGJA 4GMGA 4V0NA 2FOIA 1SIWA 1AIPA 1OX6A 3B51X 2IP4A 4I81A 3A3PA 2PMWB 3B13B 5AI6A 1K5PA 4BLVA 4W5JA 4MYCA 2XNSA 3BB4A 3LUKA 3S55A 1AA9A 4CQJA 4IFTA 4J7UA 3Q5GA 4OAQA 5CGQB 4K9PA 3WSWA 2BHSA 3P2YA 1UBRS 2NSLA 2PD3A 4D74A 4ZYUA 4U7WA 3NT5A 5ETJA 1U3TA 4YAGA 3L4BA 1GPAA 4CM9A 2WD7B 4CT4B 4ZT7A 1E9AA 1R9GA 1VLJA 2O3UA 2X76A 4KH1A 1LSSA 1YHYA 4RQUA 4ZPJA 4B4UA 8MHTA 2VDVE 4KLCA 3QXCA 4L22A 1I4DD 4DOMA 2DWQA 2GX6A 1QONA 1K68A 1UDCA 1V6AA 4JLWA 3DAOA 4IG9A 2H0AA 5TPZA 4Q7KA 3SJZA 4D8UA 1PVOA 2ZB2A 5HEKA 4HPXB 2QTWB 4L4ZA 3IO3A 7GPBA 1JDSA 1QG6A 1K92A 4QGBA 1W94A 3NP7A 3RF6A 4F1KA 4MVJM 1QAOA 1ESZA 3CZPA 1IU9A 4E7PA 4Y6GB 2OP1A 1NY6A 4KBGA 4W6ZA 1HSOA 3Q7PA 4U6NA 3UN1A 2BTEA 1O96A 2D2IA 4ZOQI 3IE1A 1H4QA 4EHAA 3NALA 1T9GR 1X1RA 3ONDA 1BFUA 4UU7A 4ATNA 2BFDB 3OE1A 1KQNA 4AMZA 1P1KA 3C45A 3MMPA 5I7EA 2W6IA 1PZHA 3NHYA 4NEGA 4P4SB 3V48A 3IEUA 1ULAA 1CEXA 2DQ4A 4HATA 4EA7A 3K9BA 2CL6X 1GG5A 4HDSB 4IVPA 3PQ4A 3I28A 1BVRA 3VGPA 1NASA 1TA4A 2JJ1D 1L7BA 3FNQA 3FF4A 2JAXA 4IRXA 3N39C 1NYRA 2PZAA 1NV9A 2GJAA 1Z0FA 1BCSA 5L3QB 3R3WA 3FHCB 2GBCA 2O50A 2QD2A 2B3TA 1EDZA 2EJUA 3DFKA 4A8JC 3D7NA 3JWEA 2RH4A 3K16A 3LJKA 4H3VA 4QPJC 4L73A 1QYDA 1P7WA 1PL8A 4TWBA 5G4KB 4MWCA 5KYYA 2ZUVA 1OFVA 4RABA 3OQIB 5D3ZA 3PCXA 2P6NA 2GCIA 1C9KA 1HUQA 2QSZA 4FYKA 2A35A 4G1BA 2IYQA 4LBWA 5D6NA 2E49A 4OSPA 2V7GA 3DV0B 4GX1A 4M9CA 1XHEA 2HMTA 1GCUA 2DTEA 1R16A 1PWYE 1VHWA 2HA6A 1EFDN 3JZMA 2MMGA 4ZRNA 4P1ZA 5IK2D 4IV5A 3GYGA 4EB3A 1Q15A 1ABEA 4JA2A 2XXJA 4KE7A 3ZKAA 2PJRA 1RD4A 1K7FB 1Y0BA 2BOVA 2PXXA 4LI3X 2C9OA 4BNZA 2EKLA 4F06A 4J6EA 4DDKA 2ADFA 1BS1A 1U8AA 2BFBB 2X4IA 2GM4A 1IZ8A 3U3MA 1R0SA 1HLFA 1GN9A 3DZJA 4ZEWA 2YYSA 2BDTA 3V7YA 4ZMSA 4BX2A 3IOBA 4RSRA 4BRWA 1M2NA 2LNDA 3K2EA 4CTJA 3VKHA 3FYUA 4JBYA 2FP3A 1K6MA 3RFXA 1PZGA 5AQEA 3T3PB 4KI7A 1CUAA 4RY2A 3WIUA 1SQ5A 4K6CA 4JIMA 1N0VC 1KXJA 4MQ4A 1L5ZA 4CQMB 4KOAA 5TF4A 1E1QA 1C1XA 1SCUB 3AK4A 3Q7QA 4EEZA 1I7QB 2DLCX 1WSBA 4EATA 4C7VA 1QYWA 2Q4BA 1Q6ZA 1NBMA 4KHPB 1J07A 2HU5A 2D06A 2AOXA 3QMWA 4I9FA 1RAEA 4J0EA 4ZAVA 5KTMA 3AZOA 4MUEA 3WMFA 2FN4A 4M60A 1DE0A 9LDTA 3A14A 4IVNA 3EC2A 1Y34E 1USWA 3QTLA 3GWZA 4TMTA 5JQGA 5EAIA 5JWRA 1PRYA 4JQSA 1PW7A 3D81A 1KU6A 1H9BA 2G5PA 2G9NA 1OH8A 4YP9A 3AEYA 2H4JA 1FUKA 1ACJA 1VMKA 1XN1A 1YKGA 2X1VA 1ECBA 3JW8A 3HFSA 3L0DA 3MELA 4GBED 1L3BA 2QJOA 2HRZA 2WF7A 3FWYA 4LV8B 4LYJA 3WB0A 2C4KA 3NV7A 3OZSA 1QKKA 2NO6A 3G13A 2V54A 3IUPA 1XTTA 4OJMX 3QKRA 2GZDA 4W82A 2X8JB 1FOEB 2O8CA 4XDHA 2FEOA 1ECPA 3U4CA 3V4LA 4PNEA 3ZYCA 3AB7A 3MBOA 4ZU1X 1JJIA 5ECGC 2OD2A 1M2KA 4ZT5A 1P9OA 1A9ZA 3LMKA 4OAPA 3VDRA 3OA0A 3PLNA 4HAIA 4DR1B 2JAWA 2RKWA 3EF0A 3ELWA 4LVNA 2EG5A 1QSGA 4AG5A 2HGZA 2YVLA 4OO3A 4Q3AA 4Z8XA 1U3FA 1FYWA 2IPOA 3JQQA 5ED4A 1R6AA 1I7PA 4OLHA 2IBTA 5ICMA 2AC4A 1GG2A 2GNOA 2GCPA 2O52A 4B7CA 2OTCA 2HMYB 4BY9E 2K4MA 3H3JA 1IONA 1O94A 3KKLA 4MS1B 3U9SA 4W5OA 1YZVA 1NW9B 1YZHA 1UBSB 3AVPA 1J0BA 1JLHA 3HI4A 2Z2XA 3Q6IA 5KI6A 4GHWA 1GL9B 1LK5A 3U7JA 2W6ID 4BJ5A 4N49A 1CY6A 4YJ3F 5JPDA 2FZKA 2OC4A 4G0PA 2OUKA 3AF4A 1H6CA 4HS9A 4OHWA 5SZIA 1XRRA 5BN5B 4E13A 1JHYA 3P9SA 4URHA 4B9AA 3MOSA 3SMVA 1XLUA 2HPHA 1BEEA 1JA0A 1NSYA 1Z5WA 1E94E 2ZIXB 1JSXA 4CM8A 5C1IA 3TIIA 3TVDA 5C46F 1UBEA 3L0CA 4HPWA 1HY3A 2O6HA 4M0CA 5ALWA 5ARDA 1EUZA 3W3AH 4AZVA 5HP4A 3L7DA 4ESEA 2B8NA 3WP1B 3B6MA 2F62A 1IN5A 3ANTA 1KMMA 3CNEA 2I2XB 2FWMX 3GJ5A 4FNAA 4Y2GA 4EYOA 4RTOA 3HKCB 2O2GA 2GCGA 3FLAA 4NJEA 1NIJA 4JHXA 5AICA 1HKUA 1DVRA 1P7CA 2CVPA 2IW3A 3S3TA 2JB9A 2FFJA 5KSZA 1NQUA 4NYMQ 2CFRA 4OMCA 1BHJA 1OYOA 2GD6A 1K1EA 1S8OA 2KBEA 1DOHA 4YCAA 3W7VA 1GPWB 1A95A 2Z2IA 4TMVA 5TE9A 2NTJA 2IV2X 1F7UA 3AVWA 4PTYA 1I3MA 3O94A 2IT1A 3LUAA 2CVOA 2W6JD 3KQWA 3SNHA 5MFZA 3QSYA 4FN5A 3QE9Y 3KJEA 5AXDA 3TTWA 2R1VA 2EOAA 2FPLA 2Y1LA 2YQZA 4NE9A 3I09A 2ODTX 4BVFA 5IFLA 5HK9A 3GMIA 1KMHA 4P0PB 1IY1A 1NI4A 3H87A 1GA6A 3KHTA 4QYTA 1QK3A 4FCCA 4DLLA 1RWWA 2Y2UA 5BV0A 4K7JA 4FYXA 2I6FA 1UOOA 5LIPA 3B9BA 3I8XA 3ZV3A 2ONZA 3H8VA 3V4SA 5TNXA 4QPZA 4OQZA 1PD0A 2R62A 2ZPUA 3FLBA 4W8HA 3SZMA 3UIEA 2PR2A 2C83A 2IYAA 5CA0B 1E20A 4N0QA 3BMXA 1GZHB 4BP8A 2GDJA 4UHEA 4PWZA 3AVOA 4R2KA 5TS2A 2O2ZA 1UJ4A 3OIUA 2SKDA 3LQKA 3ZD6A 1DTWB 2NO5A 4Y30A 4EHJA 1SVIA 5JXWA 3GT0A 2RBGA 2P9FA 5C1PA 2H57A 3RUCA 2BVNA 2JKZA 3BKWA 3KSZO 1NP3A 2GCOB 5IVPA 5K5EA 4HH1A 5TQ0A 4F9TA 5AHWA 4EEKA 1N92A 2JJYA 1YS9A 3QUCA 3Q8KA 1NI5A 1ORRA 1D3AA 1P5FA 2J46A 3HJGA 4LF7B 1N0HA 1XO1A 4QQRA 3ZHOA 1TZJA 2WG1A 4YJHA 3QX3A 2WLSA 3FFTA 4KQ6A 2OG1A 1ZOSA 5K0TA 1KJJA 2C5EA 4C3OB 2IH4A 1JHUA 1GCIA 4G0YA 3GGDA 2C9ZA 4PQEA 3NPMA 3UM9A 5CVUA 1T2UA 1ZFNA 3M6VA 5BW8A 4LSWA 5K20A 5ELXA 4LFCB 5B7QA 2VZ9A 2DWOA 2C58A 3STWA 1Z2PX 2HH9A 1BW9B 1WTAA 3UUWA 1KVSA 1BJRE 3P0FA 3QHQA 3TXXA 2ONKA 2QTLA 2GZ1A 4BYMA 4QVIA 3I53A 1MR3F 1NVTA 1BJTA 1SUFA 3WLNA 1U11A 1GR1A 1MVLA 4EF4A 1ZCAA 2DKOA 3TCKA 4E3ZA 1B16A 3BCHA 3MTQA 2DEUA 3KFVA 1NC3A 2RGAA 1IIBA 3AUXA 2AI2A 2NAFA 3GGGA 3IQHX 3OUTA 2XLBA 4RU1A 4ZRDA 4LSGA 3SFZA 3PA8A 2Q49A 2BEUB 3TR0A 5LOVF 2I1QA 2ZW9A 4WJZA 1W2HA 4WXHA 5EI5A 3TW8A 4CG0A 4WMLA 4HQFA 2X42A 3MD0A 5KPJA 4B71A 5EJ5A 1PV2A 4LXXA 3V8QA 5JEDA 3S70A 1HYQA 1HEYA 1QLHA 1NXQA 2V74B 2I62A 2ZVJA 1G2QA 3CNBA 3OO0A 4QUGA 4TMYA 4D3YA 4DYHA 2O5VA 5LPNA 1WCV1 2AK2A 9LDBA 4JYZA 3TAUA 5H68A 1Z25A 1KQPA 2F64A 2PZLA 4IQGA 4JL5A 4KO8A 4MGIR 5CLGA 2Q99A 1QH0A 4G89A 2Y1XA 4QJ4A 4UTNA 2C5LA 2JIDA 3IGFA 3O8OA 2YDYA 3PVSA 1B0AA 4TMZA 4V1CA 3A70A 2B9EA 2I9PA 2HNKA 1GZ7A 1LI4A 4U7DA 1TO1E 2IYWA 3WNZA 1XG5A 5F21A 4IH9A 1AO0A 3ZKWB 1MW8X 1ZJ4A 1WXEA 1K08A 3EZFA 2O2XA 2G7ZA 1DUSA 4ABYA 1P6XA 3F0TA 4FEYA 5G40A 1UZLA 4GT1A 3VFDA 1J22A 2K2WA 3LUBA 1WMBA 1WHSB 3M5WA 2ZYWX 1NN0A 3KL4A 3NDPA 4BFWA 5CA1F 3A11A 2QW1A 3O73A 4ZYYA 5GIPE 4I8XA 2GEJA 1KDOA 5L8VA 3VU3A 4IQFA 4KXQA 1HBJA 2N47A 3L8MA 2OZEA 1YCDA 4O2BA 2C0CA 4PLHA 4TS9A 2R8XA 1P4HA 4LE2A 3SF8B 4QTZA 4EJ6A 3BCRA 4CTMA 2HA3A 4IMJB 2AFRA 1V6CA 2G6BA 1VG9B 2R5WA 2Y0EA 1ADBA 1OXKB 3OFNA 2DPGA 1PFUA 2XE4A 1EBUA 3RBZA 3RYIA 4B32A 1CRPA 3N2GB 4OQXA 4QOHA 5GJBA 1TD9A 2QZPA 5AUQA 4NC9A 5AVUA 2UZ4A 1GPNA 4RY0A 1DSSG 2JFBA 4AMVA 1AVTA 2DUUA 2ZRPA 4YJHB 3FTEA 1VL6A 2FK8A 4P0TA 3F7OA 3WWZA 4EHHA 4KQWA 5KOHA 5ALDA 4UQLA 5EA2A 4RXMA 3AF5A 1X8XA 3NIFB 4WBXC 5JAPA 3N6XA 4OJTA 1ZIDA 2OKCA 4DM3A 6LDHA 5J43A 3LCVB 1Q5PA 3MT7A 2ZSAA 3QEMA 3Q7TA 3ROMA 3X1KA 1M8GA 5JZVA 3C14C 4JV5B 4WESA 4MMXB 1E89A 3A9CA 1Z5PA 2D54A 3HQ4O 5K2MA 3TNDA 5DM60 4YRRA 1RP7A 5TSDA 1QLJA 2CJYA 2P62A 3EJWA 3FPGA 4OH7A 3D8TA 1PS0A 4I4CA 3JR7A 2QPOA 1UJCA 4INJA 2ZUFA 3ETHA 1Q74A 3ICQB 4IKEA 4D4LA 3VO9A 2JEOA 5B58C 3WLKX 3A6DA 3OTWA 4DKXA 1EJ0A 4UVEA 1QVRA 2ZAMA 4RTPA 1KL7A 2P1ZA 1H23A 1KYIA 2FEMA 3JCZA 1H5NA 4BO0A 3D4IA 3TE7A 3PPWA 3F6EX 3TBHA 1RQ2A 3D6NB 4G65A 3VVBA 2B6HA 5DZSA 4REMA 5C2JB 3E8MA 3BHIA 4CGZA 3DDZX 4C7BA 1HYBA 1IHYA 1ZD8A 2Q5FA 3N7UA 4EPVA 1NQXA 5CDGA 1R6TA 1E0DA 4UU1A 1NXSA 2YJZA 3I01A 3EGIA 4JUAA 4G0QA 4N82A 4UHCA 3AI3A 4JX8A 3P2KA 4WQMA 4CQMA 5TMDA 4GG1A 2QDKA 3E8SA 1U0OC