1WA5A

Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for the Assembly of a Nuclear Export Complex
pubmed doi rcsb
source organism Canis familiaris
molecule tags Nuclear transport
total genus 54
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wa5A00
2ZJAA 3Q7QA 3AKYA 5ANRB 4DSNA 2ZRDA 4JBXA 3R9XA 1T91A 3ZQ6A 2CJWB 1RRFA 4G1UC 4CEJB 4D82A 4JBYA 2W83A 1CJVC 3DZ8A 3K70C 1VIAA 3HPQA 2NZJA 1OKKA 3DMDA 3GFPA 4JVMA 1CP2A 2AKAB 4Z1MA 2A5YB 5L8VA 2QUZA 2C99A 3X1XA 1TTTA 1ZIPA 4Q1BA 1K8RA 1ZBDA 4RFVA 4MGYR 2VA8A 1G7TA 1P2UA 1FP7A 1PZNA 1VYTA 4Z8XA 5J4LA 4JVNA 3NIBA 2BEKA 2ZRKA 1KTVA 4PR0A 2FPLA 1C1YA 2W6JD 3NBXX 1U0JA 2FE4A 5IRCD 2O8CA 1VECA 1DO0A 1SXJD 2Q3FA 1AS3A 3OZXA 4JLJA 4TLBA 4PAMA 3OFNA 1SKQA 2P5SA 1R5OA 3GJXC 4XD7A 1KOFA 1FX0B 3BC1A 4O25A 2F3TA 5F98A 4JLOA 3EC2A 1G1MA 3P27A 3BORA 4FIDA 1VCIA 2ZU0C 1IN4A 2YYZA 3K9NA 5EZ6B 1J90A 1ZCBA 4YDSA 5FR1A 4A8JC 4NPHA 1XJCA 3QKSB 4CYMA 2BOVA 2GZAA 3KQHA 3FKQA 2IX3A 1IJEA 1XTRA 1D2EA 4CRWB 4UXJA 2JLVA 1KY2A 4YDHB 5EUQB 3RC3A 3MWYW 4OQMA 1ZINA 4Q02A 5IK2A 4KITB 3T1VA 3LAWA 4AKGA 2I3BA 3EIEA 4HZUA 2QA5A 6Q21A 1BOFA 3SS8A 2QTVB 2ZXUA 4AI6A 2LCFA 2VP5A 1G291 2WICA 2A30A 2QTHA 3WYFA 4DSTA 4ZCMA 2NO0A 3OEED 5CLLA 1ZIOA 3PV0A 4N0DA 3SYLA 1NBMA 5DYIA 5FBLB 1T6NA 3KJGA 4JLBA 4MGIR 4DLZA 2XOKA 2REXB 4I4LA 4ZIRB 3QE0A 2I1QA 2IYTA 2P5TB 2YC4C 2G1KA 2OFXA 4ZDJA 1Y63A 1YVDA 4Q9KA 4DCVA 3PENA 2AWNA 3T1QA 3WXMA 4CIDA 4QKQA 1OIVA 2J3EA 3THYB 3O8DA 2RGNA 5LB2A 4LV6A 1DADA 4ARZA 2PCLA 2G83A 1KDRA 4FMDB 4JKIA 1L4YA 2OO7A 1FQJA 1NIJA 1QHSA 4IOJA 4OBEA 3KTAA 3F5FA 4DWJA 4PANA 3GFOA 2IYXA 1M1YE 1MH1A 4LYFA 1WE2A 2OCYC 4G5SA 4BE7B 2RGGA 4A15A 1Z6AA 2XZPA 4TL6A 3OE7A 2ZI3A 2E1RA 3BOSA 3D6TB 5FBWB 3CH5A 2Q21A 4EPRA 1FNMA 3IIKA 3GJ8A 1NVVR 1OFHA 2ZUCA 1OXTA 3BH7A 3KB1A 4PO1A 1M74A 1HTWA 4C2UA 2G6BA 1EXMA 3FHOA 3QF7A 4FCTA 4Z8YA 3RC8A 2JDID 2WJIA 1ZUNB 1II8B 2NO7A 1U0HC 3MWLA 4JVSB 5HZHA 4LK2A 2ZYUX 1AQUA 4IHQA 1IXSB 3I92A 1FP6A 3LXXA 1IJFA 3LRPA 5IDVA 3SC3A 3J81k 4E07A 1TPZA 4MQBA 4BFYA 3PJRA 3AV0B 1N5JA 1XTSA 1D6JA 3G5UA 3P1JA 3B13B 1XP8A 4PHGA 3CRRA 2DWOA 4NH0A 3SNHA 1WB9A 4EKDA 1JAHA 1KI6B 5SZHB 1W36D 3O47A 4AG5A 4ZO4A 4EPVA 3QY0A 2C96A 1G7RA 5JRJA 3B1VA 3PCRB 2V3CC 4RFSB 4O2LA 4R2IA 1TUIA 4Q7LA 2G1JA 3U60B 4MRVA 2BVNA 1GAJA 1FUUA 1KI7A 1WRBA 3VR4A 5BYJA 4DVGA 1Z08A 4M1YA 3NBFA 3VR3A 4URUR 2NPIA 1ZM7A 4OQFA 3QF4A 2WWFA 5JWOA 1N6NA 4MYHA 2FFAA 3AVWA 2P6UA 2GJAA 5F2EA 1TQ4A 1J8YF 2BMJA 4DLYA 2GNOA 2DFNA 4MGZR 1G41A 2QAJA 1NSFA 2YKGA 1J99A 2WJVA 3L0PA 4LRWA 3V9PA 3L43A 1T0JB 2ZRIA 1BYUA 2RGBA 1W7AA 1P9RA 4DC9A 2G0TA 2FEMA 2ERYA 2R6DA 3IHLA 121PA 3QVVA 5LPNA 3FHTA 2X1VA 3EPJA 5HTKA 4EFLA 4TLAA 4FD2A 4DSOA 4YONB 5JCPA 2C9CA 4IVQA 4MRPA 5KSYA 2OXCA 3CBQA 1DEKA 3SOPA 1IN8A 1G6OA 4TQ9A 5DHFA 1XTIA 2W6JA 2R44A 1R5BA 4PSAA 5FUXA 1G18A 3TUZC 4M22A 2VIIA 3FOZA 5L3RA 2E87A 1I4DD 2AX4A 5FL7A 5BWMA 5EXTA 3RS4A 3KX2A 4GOXA 4XTCS 4Q7JB 3VR1A 2AN9A 2A78A 5BW8A 2PMKA 5JJLA 3A1UA 3H84A 1QHHB 1ZMXA 5FR2A 5FI1B 4K81B 4FMBB 4Q01A 3VNUA 1L8QA 4HUTA 2ZPTX 4PQYA 2V6IA 2ZRPA 4NBSA 3WRYC 3QPWA 4NYJR 4KVGA 3BFVA 4O2RA 5A0FA 4LCBA 1W46A 2ZI5A 1XBTA 3EW9A 2QL6A 2OM2A 4HI0E 3THWA 4DT1B 4D0GA 3B78A 1ELOA 5K8TA 5AJYA 4YMVA 3I61A 4D26A 4NYIQ 2W2TA 1HEIA 3GLIB 2CE2X 1RYHA 1T8TA 1KYIA 2BBSA 3KKOA 3PUWA 5E4FA 1MO6A 2D06A 3DM9B 3H0KA 3NC1C 4D6PA 2WAXA 4D25A 2MSDB 2YWFA 1TU3A 3MMPA 1PV4A 2GCNA 5JWRA 1XEWY 3SJCA 5L3QB 3ZVMA 4AYXA 3QKUA 2D3WA 2H16A 4BFWA 2ZSFA 2ZS8A 2GXSA 3D8BA 1WCV1 3UANA 2V7QA 1BO6A 1XWIA 2FGKA 2XSZD 5H70A 1UDXA 2YOFA 1U8AA 4N1AA 4E03A 1EG7A 1GG2A 2WAYA 1Z06A 4JLNA 2WMOB 2WTUA 1SKYB 2H57A 3TK1A 4B73A 3AF0A 4A4DA 4DJTA 4IDHA 3HR7A 2KJQA 1YKSA 2W0MA 2F7SA 3SU8A 2AK3A 4BEJA 2JATA 2MMCA 1SHZA 2XJ4A 2NTYC 4AY2A 4GP6A 2IUUA 1KO5A 3CZQA 1E9DA 5HPYB 2Z0MA 5LB4A 3THXA 4ASUD 1FUKA 3AVOA 5CDFE 1MKYA 1SZPA 1YE8A 2JDIA 2ZR7A 3ZZTA 1HE1C 4IDNA 4QGAA 4Q1EA 3AKEA 4YMTA 5FOTA 3L8ZA 2ZJZA 1MO3A 2XX3A 1KDPA 3QXCA 1X86B 2GZDA 3SN6A 1DAKA 4EJSA 5J4HA 4EPTA 2XNDA 1VHLA 3WBKA 4Q19A 1SQ5A 1E79D 1KY3A 2FA9A 4Q4JA 1TF7A 2CK3D 2IYWA 2RGCA 3A8TA 1XPRA 3K09C 2H7VA 2YHSA 1UBEA 2ZE7A 3HDTA 3CWZA 3OF5A 3SFZA 3T15A 4QJ4A 3KJHA 3WMEA 2IHBA 2R62A 4A2QA 3THOA 2REBA 3QI2A 2IYVA 2VSOA 3U7GA 1DS6A 4GOJA 1FPMA 4NMMA 3A37A 1Q12A 4WIAA 3KKNA 3RS7A 3DMNA 4TL9A 2BM1A 2R6AA 4URXR 3R8CA 1ZNXA 1US8A 1E2KA 1ZCAA 4V0NA 2YWEA 4IDQA 3TRFA 1UM8A 1DAFA 1RJ9B 1W5TA 4XSHA 4QBIA 2F9MA 5FPSA 5A4JA 4NONA 3KXLA 1GL9B 2F1IA 3UG7A 3NG1A 2J0VA 2QAGC 4GZLA 1XD2A 4PSKA 2CXXA 4B2PA 3IGFA 3RRMA 3HP1A 5D3QA 3I32A 4UNPA 1CR0A 2WWWA 4JL5A 2GCOB 3ADKA 4M2LA 3ZH9B 3AP1A 1GDDA 4B3CA 3AUYA 2DHRA 3TW4A 3ZLJA 3AVYA 4GRAA 4JLKA 1OF1A 5EE1A 4G5GA 1W5SA 1KSFX 2ZE6A 4Q4AA 5SZIA 2C2HA 1GTVA 4ABYA 3W90A 4K46A 5LDDC 2J46A 2IWRA 4B6FA 2BCJQ 1AZTA 1VMAA 1YRBA 1M34E 4DDTA 1Z0DA 4D80A 3LO5A 4PTLA 3KXIA 4PZYA 1KNXA 4C0HA 4FMCF 2QMOA 1G3RA 2H18A 3W8RA 2BMDA 2IYRA 3KQUA 2ZREA 1CKEA 4W7SA 3CNLA 1XD8A 3PG5A 5GJWC 5J40A 3UPUA 2KI5A 3EASA 3OHMA 1ONBA 2AKYA 1RZ3A 2WWYA 3M6AA 3EWSA 4XVQA 3I3SR 3OIVA 5L3VA 4NYMR 1TADA 3A4MA 1VG8A 4PHHA 1T5LA 1AJEA 3TJZA 1E2PA 5BN4A 1GVNB 3LLUA 5DI3B 3AVTA 4V0LA 1ZRHA 2VH5R 1W2HA 2EFEB 1KIMA 2FSGA 2GVDC 3EIQA 3LQQA 3TR0A 4HDOB 1U99A 1QDEA 1JJ7A 221PA 1ZUHA 1ZP6A 1R10A 1G8PA 4NCJA 1II0A 4ZKEA 1AA9A 1G8FA 3E5HA 1XDBA 1BYIA 4EPWA 4BLTA 5UKDA 4WXPA 4PO8A 4WZAE 3I5XA 4POAA 2L0XA 3T1OA 2D62A 5CIWA 4Q1CA 4OQLA 3VMFA 3X2SA 1U8ZA 1YJ5A 2H8KA 2OLKA 2W2VA 4JLVA 1XEXA 3LXRA 2PT5A 1OFTA 3TSZA 1Q44A 3Q7PA 4RVCA 1HH4A 621PA 1MT0A 4UXHA 4QHSA 1NN5A 3K0EA 5FPHA 2ODEA 1AKYA 2ATVA 3QXXA 2FV8A 4ZV4A 4F4CA 4M1KA 4MKIA 2XXAB 4P3YA 1G7SA 3GLIE 1IY1A 4LJ5A 3CLVA 3ONWA 3TMKA 3T5DA 4DDUA 2A7QA 2RGDA 3X1WA 2ZITA 2V1XA 5JEEA 3RSOA 1OT3A 2QENA 2FN4A 4I99A 4KBFA 1NF3A 4JLAA 4XH9B 3ICQB 4RJLA 1M2OB 1GL6A 1DG1G 1UF9A 1ZJ6A 2QM8A 2CHVA 3VAAA 4ASUA 3U4QB 4WW0A 3EZ6A 4FN5A 3H4MA 4JLDA 1HUQA 3MJRA 1VCOA 4LV5B 3H2YA 1TU4A 4NU0A 2ORWA 2VHCA 2BHRA 2DPXA 4QGGA 4ITRC 2ZRCA 1FL9A 1XU4A 2ZJ8A 2RHDA 3LD9A 4ACAA 4CF7A 2JIZD 2LKCA 2WOOA 721PA 2ZAOA 1SKYE 2X2EA 1RPZA 1Z0AA 3TQCA 1IY0A 3CW2A 2OCAA 2ZROA 3QSYA 1JAIA 1MRNA 3GJ7A 2QSYA 4Q47A 5GVRA 2J45A 3CPEA 4XWAA 4B74A 3Q72A 3NKVA 1VG1A 2AR7A 4Q18A 1MABB 3UMFA 4HAUA 1YZTA 1L7VC 2F43A 1KMHA 1NN1A 2UZIR 1SVOA 3NEJA 2IF0A 3HPRA 4L5BA 5KOYA 1AGRA 1W0JD 3BH6A 2JAQA 1YHNA 5KDDA 3BAFA 1RW4A 4LV8B 5A5GA 2FDCA 2I1VB 1KK1A 1WMSA 4DSUA 4F7WA 1SVIA 1YR9A 2B92A 1L2TA 2IYLD 5FH9A 3I72A 3SHWA 3IUYA 1DVRA 2AL7A 5FL3A 3IPYA 2Z5FA 3H86A 3LBNA 5H68A 1FMJA 4ZCIA 1QRAA 1B23P 4MUAA 4RCZA 1SVWA 5IT5A 3SE0A 2J0UA 4QJ5A 2YJTD 3VQTA 4C0JA 4I81A 2O8CB 1RYFA 3FDIA 1GOTA 2EWVA 3O8CA 2IL1A 3X1ZA 5FUWA 1NN3A 2UKDA 3CZPA 1JI0A 2KB0A 3K53A 4QBGB 5JLJA 4KO8A 3SJZA 4A6XA 2ZSEA 1GRNA 3LBIA 3A1TA 1OHHA 2KSQA 2IYZA 3P32A 4A9AA 2D74A 4KFSA 1GKYA 3AVXA 2CVFA 3ASZA 2WWXA 3I1FA 1TQ2A 5JSZA 4L15A 3TSOA 1FMLA 1HT1E 1TQ6A 4HLCA 3SFVA 4M1MA 4HB4A 4ZPXA 1ESNA 1CBUA 2MSEB 1DPFA 3QENA 2ZUDA 5KTYA 5JS7A 2IWHA 1E2JA 1R6BX 4WVFA 3QNUA 2BJVA 4C0AC 1XFAA 3FGNA 1WBBA 1PLKA 1GFIA 1VDZA 1Z47A 2A9KA 1E2IA 3A1VA 4TT3A 1X6VA 3ADBA 3DM5A 2IT1A 1XTJA 2O52A 3LV8A 1NMXA 2VHQA 3AP2A 2QGZA 2QGNA 3IILA 2Z83A 1KK3A 1IXZA 4GL2A 3FMPB 3IHWA 3GPLA 2QQ0A 3T06B 3RYTC 4M9QA 3TVDA 3E70C 2BM0A 4LBYA 1Q21A 1U9IA 2FPMA 3MFYA 4LHZA 3U7FB 3GCGA 3KUDA 4HATA 3DEFA 1KSGA 1QVAA 3PR1A 4TYNA 1KO8A 3BERA 2JLQA 1JALA 1VPLA 4PC6A 4DLWA 1N0VC 2WJHA 2IXGA 1JR3A 1EK0A 1R0WA 4ARZB 3AVUA 2A5JA 2NMVA 1JQJC 5FUYA 1HURA 4MYTA 3KTAB 1CIPA 1A4RA 1ZNWA 4AYTA 1QHXA 5FOXA 2AD1A 1VIYA 3TGPA 4U7DA 3EZ7A 1M6NA 2FPKA 1KKLA 3REGA 3AP3A 4Q1AA 5BN5A 1SHKA 2FGJA 3LDAA 2GRJA 2GJ8A 5CM8B 1HA3A 4A8JB 1KI1A 5KNDA 2CCJA 3PUZA 3FVQA 2J87A 4HLUA 4AK9A 3EPLA 5BYKA 2QPTA 4M9ZA 3QKRB 1RFLA 3N70A 4QNRA 4JSYA 5CITA 3ZD6A 2J9RA 4JMPA 3NH9A 2QP3A 3VTKA 2ZRAA 5JFGA 1QBKC 4KAXA 3PUVA 1U90A 3EPHA 1TEVA 2UVQA 3ZIAD 1DTSA 2YC2C 3DKVA 1J7KA 3MCAA 5F9FA 1GKUB 2HXYA 3FKSA 4KODA 2ZEJA 2WSSA 3ZJYA 3GEIA 2C77A 1YZNA 1X1SA 3EA0A 1MOZA 3A36A 2RGNC 1CRPA 4NCIA 3W6OA 1EWRA 5CLQA 2JIZA 3BK7A 3DPUA 2IS2A 4MYCA 1OYYA 1U94A 4B2LA 4QJ3A 4TTRA 2CMKA 3B60A 3R8FA 1JNYA 3OEHA 4DCSA 1KGDA 2OBLA 4TYPA 2KBFA 2GK7A 3HU1A 2C5LA 3SHFA 3L0SA 3T61A 1R4AA 4CT4B 4TZ6A 3QPVA 1YQTA 4TMWA 1XF9A 2DWQA 3GLHB 4Q4HB 1COWD 2J7PD 2O0KA 3U6BA 1T3SA 3CM0A 5C1BA 1ETUA 2LWIA 4YXWD 3X1YA 1TEXA 1KHTA 1LNZA 2V54A 1D9ZA 2ZAMA 1W0JA 3FMOB 4PC2A 1N25A 4RZ2A 4US1R 3D7MA 4HZIA 2VQSA 1EFTA 4YMWA 1LVGA 2WKPA 4ERNA 1NNEA 2W6IA 2JJ1A 4EIWA 3U3OA 3X1DA 5TMPA 2IK8A 1E96A 3U3RA 3VX4A 2ZSAA 2UZ3A 2ORIA 1E2HA 2OE2A 1QHGA 5HZKA 4TSFD 3M1IA 3IO5A 1NI3A 4LPSA 1E94E 5C4GB 1J8MF 3AQ4A 2J41A 3UG6A 4OJQA 4OI1A 4LJ8A 1IY2A 1OLOA 4QG7A 2XZLA 2QMUA 3T34A 1G3UA 2BKEA 2F1JA 4JKYA 1UAAA 1NLFA 3ICEA 2C03A 1R5NA 2IXEA 1KI3A 2GILA 2NGRA 4N0EA 1P3JA 2FMXA 1GP2A 3G0HA 2O8DA 1G17A 4QOSA 4PXAA 3IPXA 5JS8A 3LVRE 2GDJA 1JPNA 4U00A 5BN3A 1XD9A 2C8VA 3UWOA 4DRZA 1QG4A 1KI4A 5GJVC 2IW3A 3CF6R 4FCWA 1UEIA 1PJRA 2N1BA 2ONJA 3THWB 4KJZA 4DHEA 5B2ZA 5TY0A 4BUJA 2CNWD 1G7CA 4TLCA 5DN6D 4JS0A 1N5IA 3ND9A 2QRNA 4OHWA 3TVTA 2WV9A 2IXFA 4B3DA 1BKDR 4URWR 4KV9A 4A0GA 1XB2A 1F2UB 3RNLA 2P6RA 4A0FA 4HB0A 1N0WA 1XCMA 3FYHA 1K5DA 2IBMA 1N6KA 3AB3A 2B6HA 4LHXA 4DZZA 4W5WA 5IF9A 4QM6A 2O0JA 2YNMA 2QE7D 2VHJA 1EFRA 4V0MA 3CPJB 1FQKA 4RZXA 3OAAD 4LOAA 5FOSA 3SR0A 2O8BA 2JEOA 4C0KA 3WMFA 2OESA 2IHYA 4Q21A 4GI7A 1KNQA 4KBGA 4XWKA 1MRSA 4NKRA 1JPJA 1P7CA 5G3ZA 2XJ9A 3R9WA 3SYKA 4UKDA 2FFBA 3B1WA 3RWMB 4HSEA 5KPJA 2ZR9A 4NL4H 2D4HA 5EXPA 3T12A 3RS5A 1EFCA 1E2FA 4R98A 1SVMA 1PUIA 5B58C 4LJ9A 4KSBA 1DBSA 4C3ZA 2O8EA 3U6KA 1AS0A 1CS4C 3THXB 2P67A 1NG9A 1A1VA 5F9HA 4A36A 1W47A 2GF0A 2HLDD 2KWIA 4Q9HA 4DEYA 3CRW1 2NPFA 2CLSA 3UMSA 3CRQA 2BIFA 4V0OA 2OILA 4BLOA 1ZD8A 4HUQB 4EJSB 1CRQA 1VG9B 3GMTA 4HLDA 4PC1A 1CJMA 3ZQJA 4DDWA 1GNQA 2FZ4A 1NY5A 3DDCA 3P20A 1RC8A 1FOEB 1XX6A 3L8YA 4Q4JB 5FOVA 3DVLA 4MGKR 1E1RD 1YZKA 2WJJA 4C7OB 5AUNB 1NMZA 3QVUA 1WQ1R 1SXJA 1Q3TA 2ZI4A 3PITA 3O8RA 4R7ZA 1NIPA 3B9QA 4P33A 5CB6A 4DCTA 1NVUQ 5TARA 1GNRA 1NVWQ 2BBOA 4JYCA 1RIFA 4MA4A 3VR2A 3LW7A 1HQYE 2PZGA 3RLFA 1N3BA 1R2QA 2WJYA 3W8NA 2JLUA 2AD5A 2EFGA 3CX6A 4RY2A 4FMCB 1Z63A 3RRZA 4FI3C 2W00A 2ZRLA 5FFMA 2DY1A 4QXAA 3VU9B 3SJBA 4YXWA 5AJZA 3RWOA 2IA5A 2QORA 2C98A 4TYQA 5GVSA 2QMHA 5J5CA 1XD2B 5EP2A 5E7JA 4PC7A 3N2EA 3B1XA 1AQYA 3A4NA 3DOFA 4YQFA 1NKSA 3CB4A 5CDFA 5M04A 4G5RA 2ZS9A 1E9RA 2VP9A 2IUSA 4EJSC 5L3SA 1Z5ZA 5G40A 4WOPA 2OBMA 1BS1A 1B0UA 3OEEA 1IBRA 1G8YA 2RMKA 1JB1A 2RGXA 4KXFB 4Q4AB 5J4KA 4QNMA 1KZGB 1RRGA 3CRVA 3GLGA 2OBNA 3Q8XB 5FUVA 3W6PA 4TSFA 3GLHE 3K0CA 1FTNA 5LD2B 2OSBA 2BCGY 4URVR 1W1WA 4GP7A 1TNDA 1XCPA 5CK4A 2JLZA 1Z29A 2DFLA 4RCYA 1JEEA 3NBYC 3GD7A 1YR6A 3QUSA 4Q03A 1OB5A 2JGNA 5FI0B 2ODBA 4DBLC 1KI9A 2H17A 3PQCA 3D31A 3KUCA 3DL0A 2EYUA 1Z2CA 2JJ2D 3GLFB 2FSFA 1L4UA 5SZJA 3ASYA 1II8A 5E95A 5AUPB 4PPQA 1XXHA 4JYBA 1U8YA 1WDTA 4IVRA 1Q3HA 3TNFA 2D7DA 1Q20A 3TUJC 2J7KA 2KE5A 3UIEA 3K9HA 1PLJA 5G41A 1JJVA 2G9NA 1HE8B 2N42A 5FTMA 2YVUA 2DCUA 2AFHE 3W34A 3PVSA 1S2MA 2B8WA 3B6EA 1E4VA 2F1RA 4DLSA 2OCBA 1NJGA 5FTNA 1N6IA 1A2KC 2FG5A 4W9MC 4XJXA 5CIQA 1KI6A 3PFIA 2QAGB 3V4FA 4KFTA 3FB4A 4ESHA 4WZBE 1KO1A 4RFSA 4AKHA 1KK2A 5AJXA 2WPDD 5F3WB 1ZVQA 4Q9IA 3WP1B 2WIBA 1H8HD 2HJVA 5LD2C 2V1UA 2XNSA 5C46F 3QBVA 3QXJA 2GAAA 3U3KA 2GWHA 2ZSDA 1M7GA 3AVVA 2BJWA 3KL4A 1JR6A 3P4XA 3TW8B 2DBYA 5CYPA 5E3HA 1AN0A 3VHLB 4KYUA 4G01B 3LW8A 3U5ZB 1LFDB 4EAQA 1RRCA 4KVAA 1CLUA 3ZD7A 4V0KA 2ZIAA 4LJ4A 1KDOA 1X3SA 2PZEA 3I8XA 1P6XA 3RANA 3AF3A 4HAXA 1MO4A 4CEHA 1XJQA 1Z28A 2GVZC 5KDOA 3A1SA 4PC3A 3GP8A 2KBEA 3W5JA 3NDBB 1NVVQ 4URZR 3TSWA 5KHOC 2HDNB 2OAQ1 3K0AA 1ZC4A 2BKUA 2XITA 2P65A 2EFCB 1E2QA 3KQNA 5DO9A 1OH6A 3T5GA 2NG1A 3TLXA 5E7MA 2O8FA 4HDCA 2ZJ2A 4EPYA 4PHFA 4MKFA 2ODWA 1E9AA 3EARA 4HYYA 3WY9A 4I1UA 4B48A 3FHCB 4CEIA 4B35A 1P72A 1UADA 3B9PA 4LX0A 1AK2A 2K5UA 4JJZA 1S4QA 2RAPA 1NLYA 4OHZA 2F43B 2IEZA 1KMHB 4A0HA 5EZ5A 1EESA 4MH0R 4P4SA 1F2TA 3R7WA 4BWYA 5J4YA 3DHWC 3EWAA 2WZQA 2VEDA 4UXIA 1SVKA 3MSXA 1UDWA 4TZ0A 4DT1A 4A0RA 1SVLA 1I2DA 1JBKA 4X8LA 1GKIA 4IFEA 3GLIA 2QP9X 4NTZA 2P0EA 3FMIA 2JLRA 4FINA 1R0YA 1N6HA 2ZRBA 4C0LA 3FPAA 4E22A 4EFMA 5B57C 1QG2A 2AK2A 1F6BA 5JCZA 5L3QA 3EC1A 1UEJA 5JJKA 4B2IA 1XNJA 4C0SA 5DGXA 1ZYUA 4LJYA 3CRMA 1MO5A 3TAUA 5EE0A 2D2FA 2JLWA 1G5TA 1Z0FA 3CNOA 4D4MA 1GNPA 1XTQA 5P21A 2G77B 2OXRA 1PLLA 2CL7X 4GBMA 2R2AA 3ZZ0A 1UKYA 5DLQC 1IQPA 3K9GA 3ZS8A 4PAOA 2GTPA 4LJ6A 3U7EB 1X8JA 4HDQB 3CF0A 1OJLA 2ZRNA 1BMFD 2OG2A 3BGWA 3K0FA 4TMTA 3ZDQA 4GSYA 2AHOA 2YV5A 5JSZB 4PAQA 2VP0A 1D2MA 1DAHA 4OQNA 4N3NA 1DG3A 1YZUA 2PH1A 4LC0A 2FOLA 3AF4A 1UKVY 3NEYA 1ESMA 3VR5A 3KQLA 2XSZA 3AGPA 3MAAC 4DCUA 5DIFA 1R7RA 4RD2A 4V02A 1R8QA 5HE8A 1KMQA 2FSHA 3I73A 3B2EA 2ZJBA 1OXUA 4BZQA 2RCNA 1FW6A 1KKMA 3KXKA 4CZ2A 3AUXA 2CL6X 2F3RA 3L82B 1Z0IA 2C04A 3F8TA 3LH5A 3SEAA 1SULA 4A92A 5DI9A 4OI4A 3C16C 4NYJQ 4NCKA 4AD8A 1G20E 4ILEA 2IS4A 4IXNA 1AS2A 3IKJA 2NO6A 2VBCA 5LBIA 4Q48A 1VCMA 2G3YA 3TR5A 4ACBA 1UKZA 1T3LA 4DIDA 4IOMA 2QBYB 4EQ6A 2QM7A 3BXZA 5FPYA 2JLSA 4AKIA 1S3GA 2V9PA 3IIJA 4CT5A 1O3YA 2OV2A 2ODNA 4OHYA 3GLFE 2OFWA 1VCNA 5G53C 2PLRA 2QROA 1OKKD 3AF1A 4Z1MD 2A2ZA 1W44A 3NDPA 3P4YA 3DO6A 3ZGXA 4LYJA 1KI8A 3WNCA 2EVWX 4M53A 1NN0A 2ZYWX 2ZM5A 3KDSE 1DE0A 1E79A 1GUAA 1KAGA 4LJAA 2CK3A 1T4GA 2GK6A 5JECA 1DO2A 2ZR0A 1CULC 5KYKA 1QHYA 1UKEA 3ZVNA 4XWOA 1EX6A 4RD0A 1E0KA 1N5LA 3JZMA 1XTKA 1T3HA 1IAQA 2ZJOA 2A5GA 4C4PA 3ZVLA 3OFND 2X2FA 2J0QA 3FFBA 3RS3A 4U02A 4XD7D 4KCGA 2HXSA 5JRZA 2GCOA 1TUEA 4FXPA 3UMRA 5K8LA 3IO3A 3QOFA 1U9IC 1ZUIA 1T5IA 3AEZA 5DNYB 5JEDA 3HU2A 3PUXA 1XMVA 5JBQA 3LX5A 4DB4A 2EW1A 1OFUX 4P0TA 5H8WA 1P9WA 1LS6A 4OI0A 1I4TD 1G19A 2QG6A 2ZRMA 5IK2D 5JMTA 1GSIA 1Q1ZA 4C0BA 1M7HA 2AXNA 5D3MA 5DHAA 1GZSA 2YZ2A 1JEDA 3MJHA 5TV2A 1U98A 2QY9A 1Q22A 2XTNA 1F3OA 3K70D 1K6MA 4HLUC 4JVLA 2RKOA 2WJGA 3AGQA 3U3MA 2P3SA 3KKQA 4OK3A 2XOKD 2ZTSA 4IRUB 4JL8A 2CDNA 3BRWD 2H92A 3RVBA 1KZ7B 1ZM9A 2N46A 4YMSA 4DDVA 1G16A 2F55A 4DXAA 1CR2A 4B6EA 4HZUB 4BFXA 4Q00A 5FBVB 1D9XA 1Z6TA 2Z43A 3OIWA 5FTLA 1E1QD 1YRAA 1E2NA 2VHTA 2ZI9A 4TTQA 3QXHA 3K0SA 3U44A 2ZVPX 4B47A 2EYQA 2Q9AA 2GAOA 3MG9A 1F5NA 4Q7MB 1F60A 4F93B 2DB3A 1LV7A 2VO1A 4TMXA 4RSGA 2IF2A 2PJZA 3K1JA 4R2HA 4A82A 4CW7A 3IQWA 1KSHA 3B85A 2SHKA 1W0KD 4TMZA 2E9SA 3OE7D 2QU8A 4XOIA 3CH4B 2VF8A 4L9WA 5H1YA 3QBTA 1GM5A 2FJUA 3A58B 4LJ7A 1Q57A 2J0SA 5HCNA 3QQ5A 4QBHA 1G64A 3GJ3A 3Q5DA 4S35A 4Q9LA 4A6PA 1EX7A 1DARA 4PZZA 2XTZA 3VR6A 1UBCA 5AWFC 5CB8A 2O8DB 3CPHA 2WKQA 2RB4A 3WRXC 2OEPA 1T0HB 2GETA 4O0MA 2G88A 5JWHA 2QN6A 2BC9A 3LQRA 3C41J 2JLXA 3U61B 2VPPA 4E5UA 2V4ZA 4QHYA 5IHPA 3ADCA 1NVXQ 2OFOA 2Z4SA 4OYHA 3I62A 2QRZA 2X8AA 4GMDA 4LZZA 1TX4B 2Z4RA 1I4LD 2ZE8A 3GFTA 5CJ2A 1Z0KA 4NE2A 3U4QA 1NSTA 2HCBA 3AKDA 3L0OA 4X8HA 4GNKA 821PA 3L2OB 4M0LA 1Z2AA 3TIFA 4E09A 4B71A 1VKJA 1UBFA 1T9HA 2ZRFA 3DOEA 3AVQA 2HT6A 2R6FA 4NZYA 1S1CA 2Q3HA 1CU1A 4LHVA 4NYMQ 2EFHB 3EG5A 5AK0A 1E4YA 4HAZA 3ETLA 2DYKA 4OHVA 2QEQA 4GFDA 5FOUA 1Q0UA 2FH5B 2IYQA 3BWDD 4GMXA 1E9SA 4BASA 3E1SA 4QL3A 3EX7C 2XEXA 2O8BB 1MABA 3A1WA 4PHTA 1XMIA 4O3MA 3ADDA 4UJ5A 4US2R 1Z07A 3RSLA 1NY6A 5EP3A 3EZ2A 4K8OA 1LW7A 4WZ6A 2QT0A 4NYIR 4HAVA 3QXSA 1J70A 2Q0HA 3PUYA 2GKSA 1CR4A 1OSNA 2IYSA 3B8HA 2F1HA 2WWHA 3QF4B 1S1MA 1LB1B 3BE4A 3FWYA 4ON9A 4S2EA 2O8EB 3VKHA 2VYFA 4IOLA 4HEJA 1GITA 3BFKA 4BRWA 3CF2A 5C18A 2NIPA 1M8PA 3ZVRA 4GT1A 4D4KA 2REOA 4US0R 4U5XA 5KSPA 2MMGA 2WWIA 5AJWA 3GEHA 5G3YA 4D0NA 1JR3E 1XEFA 1NG1A 1P73A 5B64A 2F6RA 1KJYA 4KSCA 2GBLA 4Q1FA 1QF9A 4OK5A 5FL7D 3V00A 3WHLA 3MWJA 3PEWA 2G0NA 4F4JA 4QGHA 5KUTA 1P62B 2PX3A 3S1AA 4QM7A 1WA5A 2GHIA 2ORVA 3IEVA 1YR8A 1GL7A 3EPKA 3KQKA 1G9XA 1ZNZA 4L16A 5FOWA 3RHFA 3REFA 4JT4A 2I4IA 1F48A 2NZ8A 3BB3A 2RGEA 1SXJB 4C2TA 2OCPA 2YOGA 4XIGS 3HJNA 4MRSA 4DLVA 4JZKA 3GJ4A 1QHIA 3U7HB 1W4CA 2FSIA 3M4YA 1OH8A 5KPDA 1IHUA 3HR8A 2ANBA 1CJTC 2XB2A 3PIRA 5B30A 2J5XA 5GJBA 1A5TA 4F38A 1H8ED 4KFUA 1OE0A 4LPKA 2CEAA 2ZVQX 5AJVB 4NDZA 3KKPA 2O0HA 3KKMA 5HCIA 2WWGA 2ERXA 4GOKA 1G3MA 3GQBA 4GPTA 1X1RA 2TMKA 3BBPA 4TN1A 3MD0A 4IOKA 4M8NE 1YR7A 2WVJA 2ZI7A 1ZC3A 4HAWA 1ZM4A 3G82C 4AKEA 4JSTA 1R0ZA 4AWXA 1K5GA 1G3QA 4LDJA 5K8UA 2GF9A 1P9NA 5FPTA 2CVHA 2V7QD 4LY6A 5FTJA 3C4JA 5L3SB 2R8RA 2W58A 4LWZA 2NQ2C 4LYHA 3OIUA 1E1QA 2Q3MA 3TBKA 3UXMA 2ZYVX 3NWJA 2FFHA 4W5JA 4IJMA 4P31A 4B44A 1QHNA 1Z83A 1S9HA 4DB2A 3GLGB 4A1FA 3CWQA 3JVUA 4KLNA 2AXPA 4ZDKA 2BMFA 4AYWA 4PX9A 3NVAA 2IYUA 4JT2A 1SXJC 1W0KA 4TLEA 2RH5A 1E3MA 1U0LA 5JZVA 2VSXA 1ZD1A 1S96A 2YWHA 3C8UA 5HR5A 2BDTA 1RKBA 1U2RA 5EP1A 1S9DA 4A8JA 4M1OA 2CL0X 3N2IA 2XZOA 3FFAA 1W4RA 1P61B 1AZSC 3QKRA 5SZKB 3SBDA 3DKPA 1TF2A 1E0JA 3AVPA 2CJWA 4B32A 4CEJA 2QQEA 2ZJ5A 3BS4A 1HV8A 1KI2A 2ONKA 4MKHA 2IYYA 1OW3B 2BMEA 2QTFA 1XXHB 4Q9JA 3IIMA 4X8MA 3NHBA 1NBME 4ZI3A 3UATA 1BH2A 2W2XA 4I1OA 4OQXA 3WP0A 4BRUA 1PVOA 2QT1A 1HT2E 4Q4LA 2XNDD 4B43A 3KB2A 1A82A 3WNDA 2WBLC 1ZNYA 4V03A 1Q1EA 2VF7A 5EE9A 1DELA 4OK6A 5C4MA 4QRHA 2DFTA 2ZS7A 3CR8A 4NCHA 5EE5B 2GEDA 2WIAA 3CKLA 3EZFA 4MRRA 5TXGA 4KYIB 1PUJA 4BLQA 4PFSA 1E9CA 4M1SA 1FX0A 4MYUA 5EQTA 5TVKA 5EP4A 1D8TA 3K0CC 3JVVA 4G5OA 3IEUA 2CE7A 3P26A 3ZIAA 3ZZUA 3OESA 1XZQA 1BIFA 1OV4A 4H1UA 4OHXA 2QP4A 5FBQB 5TB5A 2HF9A 4GDFA 1ZW6A 2IUTA 2PL3A 3NC0C 3V4RA 3BB1A 4ZDIA 3QKSA 4Q4HA 2B7CA 3GLHA 3I5YA 1E2MA 2H1LA 1G3IA 5AUOB 4M21A 1W36B 3FMFA 4QGFA 3ZYCA 2QNRA 1QZXA 1OH7A 2GXAA 4G3XA 4URYR 3NHAA 4X8OA 3QG1A 1G4UR 2PX0A 2GZHA 3AM1A 1W4AA 2MSCB 4IDPA 1U81A 1FFHA 1KDTA 1P2TA 1S0UA 3LFUA 3TQFA 1EFHA 1ANKA 1US8B 5KO2A 1XEWX 5EE3A 4CEHB 3AKCA 4TQUS 2FF7A 1Z6YA 2J1LA 2PZFA 4L4UA 4TL8A 4V0ME 1COWA 4RD6A 2J7PA 5GADl 1E99A 3C5CA 3K0AB 2R6CA 4PPFA 1G6HA 2Y8EA 3SDZA 5KNCA 4R71A 4ZIRA 1Z3IX 1NJFA 2C78A 1YZGA 2A5FA 3Q85A 2HUPA 2C9YA 2O8FB 4NHOA 1P2VA 3QEOA 4B3GA 4HLQB 1DAIA 4BLPA 1OIXA 2QPOA 3THYA 5J4VA 2QZ4A 2VP2A 4CEIB 2JCSA 3LY5A 1TMKA 4C9BA 4EPXA 1E9FA 5FTKA 1WBDA 1D2NA 4JLMA 1J2JA 1W48A 4DUGD 2C95A 2BBWA 2ZJYA 2V6JA 2DFKB 4MKGA 4WAUA 1W36C 4LBWA 1F2TB 2HYDA 4P4SB 3R7WB 3CR7A 4TTPA 1GRRA 3F3YA 3LA6A 4QBFA 5AR1A 4A2WA 1KO4A 2FWRA 1N6OA 2FNAA 4IW3B 2GCPA 4XVRA 3R20A 4KLZA 1Z22A 2H5EA 3VKWA 1H8EA 1XJ0A 2GXQA 4RD4A 4Q7KA 1E2DA 1XMJA 1IXRC 2GEUA 2ZANA 2ZUBA 1W2GA 1ZM3A 5JI3E 2Z6VA 3A6PC 1F2UA 4NP6A 5FBRB 1X8LA 2IS6A 3L0IB 1NP6A 3GEEA 4OL0A 1YU9A 3BFXA 1P4SA 4Q66C 3M0EA 3N5CA 2ZETA 4TWZA 4LBZA 4TQAA 1ZM2A 4J0QA 2ZSBA 1V43A 1SXJE 2DWPA 4LHWA 5EXXA 4MDFA 4BPBA 2CNWA 2QPAA 2PT7A 5DN6A 4FMDF 2QSZA 4DIEA 1TL7C 2OLJA 3WMGA 1DAGA 1HQCA 2QI9C 1HYQA 2EQBA 2PBRA 1S8FA 1IN6A 1WXQA 1N2CE 2WOJA 4ZI2A 3QG5A 1Q1BA 1XCGB 3K0FB 3WHKA 1RRPA 3BD9A 4JIMA 2A3RA 3C7KA 1II9A 3Q3JB 3QPUA 5EJEA 3UWKA 1CJKC 1JXOA 2XGJA 1XEXB 3VFDA 3PEUA 2QE7A 3CIOA 4BFVA 2GJKA 2CHGA 4RZUA 4EUNA 3OAAA 3B82A 1CJUC 1Z6XA 4MDEA 3CX8A 3SI7A 2AWOA 2CHQA 2HEIA 3CONA 5AUQA 2XB4A 4XTRA 1IN5A 4KFRA 3MLEA 3SBEA 2NO1A 4XVUA 1E32A 4B3BA 4B76A 1P5ZB 2RGAA 2WSMA 4PPGA 3PXGA 4ZCLA 1NLZA 4HAYA 2WKRA 1N0UA 4II7A 3IDQA 5HKKD 2GESA 4HUQA 1UFQA 3GLGE 4RD1A 3F0TA 1DOAA 1E6CA 2B7BA 4DKXA 1D5CA 3H1TA 3WYAA 1NRJB 2HV8A 3NH6A 3C14C 1LTQA 4Y0AA 5JHGB 1G8HA 1E2GA 4I1SA 5DE3A 4M1TA 3I4LA 5GJCA 4C7OA 1CEEA 2GJ9A 4EQ6B 2PEYA 4UNRA 1FNNA 4Z54A 3KZ1E 2HLDA 4EDHA 2PEZA 4TMKA 4C0QC 4QC2A 4LI0A 3SYNA 5CJPA 4B34A 4YC7A 4W5HA 4P4TA 4EFNA 3QJYA 1QVRA 1YZQA 1OFIA 521PA 3K8YA 4IKEA 4PQFA 1XXHE 4BGDA 4CGZA 4OKSA 4LYAA 2OHFA 4D0LB 1QHHA 2VLIA 5KSOA 3CX7A 4OJKA 2VRWA 3D3QA 3AF2A 1E1RA 4WXRA 2DR3A 3VU9A 4D4LA 4YMUA 2ATXA 4BFSA 1GWNA 2FU5C 1IM2A 1S3SA 1Y3AA 3RS2A 3A4LA 2CCKA 3GJ0A 5CM9C 4F4IA 1OPXA 1E0AA 1I2MA 4PO9A 1JXMA 2AFIE 1IN7A 4BLRA 5TDHA 1G5RA 4IEEA 3WBJA 2PMDA 5JJIA 3CNNA 4P4UA 2ZE5A 1ZU4A 2OZEA 4PSVA 1E9BA 4TL7A 2BV3A 3LVQE 4LGMA 1OHHD 1MV5A 3ECCA 3HWSA 4G5QA 1E9EA 2J0UB 1ZD9A 4M1WA 3NBZC 3MGCA 2HYIC 3KFXA 1LS1A 4NCNA 5DSZA 1E2EA 1CTQA 3B7GA 3Q9LA 4L8GA 4B3FX 4WBSA 1OXXK 1M7BA 2X77A 4DLXA 2VP4A 1ZU5A 1H65A 1E2LA 2GJSA 3TUIC 5D3MB 4ESVA 3VNVA 1ODFA 3K09A 3MWKA 1UJ2A 2NOAA 1C9KA 1W4BA 4MRNA 3GLFA 3BJIC 2CLCX 2XAUA 3AH8A 4LBVA 4TT3D 3R9IA 4DUGA 1V5WA 3K9LA 1W49A 4RD3A 2W0SA 2HJGA 2VHUA 3HU3A 4UJ3A 3W3ZB 3RABA 3RAPR 4PPNA 1HY3A 2ZU6A 4JLPA 2VTKA 1MR3F 1JECA 3EZ9A 4IEIA 4LC1A 2CLDX 3RRYA 1JQLB 4KU4A 1N6RA 3U2QA 1AKEA 1VTKA 4UNQA 4AG6A 2BBTA 1N6LA 2JJ2A 2CCGA 1EGAA 1JR3D 4F92B 3U44B 1WF3A 2QAGA 2V8OA 5KU1A 3W6NA 1C4OA 1O87A 1TQDA 2ZI6A 2ZRHA 4M9SA 4BZPA 4UNNA 5J47A 1VG0B 2HF8A 2JA1A 3CUEF 1X8KA 2P6NA 4AC9A 1A2BA 3B1YA 3HYTA 4IXMA 4BFUA 2X19A 2ZRJA 4DLTA 2ZYTX 4ZKDA 1DAMA 4Y0VA 4UQOA 2HT1A 4IDOA 2Q9BA 1XRJA 3ZS9A 3O8BA 4BLSA 1RE0A 4Z51A 2BWJA 4IFBA 1DAEA 1GILA 4TLDA 2BEJA 1KJWA 4BFTA 5EUMA 3NXSA 4IVPA 1G8GA 4D81A 3SQXA 4FWIB 5EXSA 1G21E 5DH9A 3DZDA 3T1TA 4C30A 2GA8A 1A7JA 4B33A 5DYGA 3B5JA 1XMSA 3W3AA 4B75A 3IQXA 4JL6A 1N5KA 2Q9CA 2WPDA 4QHTA 5DISB 3MRSA 2IC5A 1IOZA 4LHYA 3LWNA 1H8HA 5KSZA 2P2LA 2F9LA 1P60A 3U3JA 3PEVA 1OB2A 2O5VA 3Q5EA 1VYVA 3C5HA 2ZRGA 2FFQA 4YLGA 2PJRA 1RJ9A 4M4SA 2FEOA 3RS0A 3FKSD 1KO7A 4QFMA 4LUCA 2WSSD 3CO5A 3MUFA 3JZAA 1OYWA 1LY1A 4XSGA 1KJZA 3IBGA 1EWQA 2XTMA 1AM4D 3ND8A 4KI0A 4M9XA 5HKKA 1TAGA 1CXZA 2Q6TA 3C15C 4GZMA 3SQWA 3EXAA 3OEHD 5HE9A 1SVSA 4Q1DA 2HCJB 1G4AE 1OXVA 2PCJA 3SZRA 4BFZA 2FZLA 4RKEA 4RZ3A 3QIAA 4JBWA 5KNBA 2D7CA 1P75A 2A5DA 1VYUA 3LNCA 4AURA 2B21A 2PLFA 4HB3A 2R9VA 5JI2E 1T8UA 2WM9B 1E98A 2C9OA 5CYOA 3QEJA 4CVNA 1GRQA 1CR1A 1WP9A 3VHXA 421PA 1R8SA 2ANCA 3RDPA 4TYYA 1OH5A 1TF5A 2WMNB 2IEYA 3LBHA 3W5IA 4F91B 1EFUA 2W6ID 2JJ1D 3W9YA 1Z8FA 1P2SA 4LSGA 2YWGA 4H9GA 3OIYA 2EU8A 1UBGA 3GJ5A 4KHZA 2VL7A 4UNSA 2YOHA 1NBMD 2OT3B 4L9SA 2GXUA 3WNBA 1NKTA 4TMVA 2JASA 5DI3A 2IS1A 5E7IA 3KJEA 3I8SA 4G0NA 4PZLA 3FE2A 2OAP1 1FZQA 2ZQ5A 4RKFA 1N6PA 2OUKA 3LLMA 3S1AB 4Q5IA 3TAHA 4BECA 4CDGA 1SGWA 1KK0A 3IBYA 2JJ8A 4ZDWA 4MITA 4D2IA 1Q1QA 4WA7A 1ZAKA 4FW9A 5JHHB 5ELXA 1Z0JA 4TYWA 1OXSC 3NTUA 5CK5A 3PEYA 4BEBA 3TE6A 3WYGA 2NO9A 3QKTA 1LF5A 3FTQA 4MUBA 4R9UC 1LF0A 5KDLA 2B8TA 3TKLA 2J59A 1BMFA 2LKDA 1FTSA 2XXAA 1UPTA 3E2IA 2YINC 1YZLA 3KFVA 1VHTA 8OHMA 2RHMA 3BIFA 3K70B 3SJAA 4AIIA 1E0SA 1XZPA 3KJIA 1CF4A 2D2EA 3GJ6A 1E69A 2VP6A 2ECKA 2FX3A 3TH5A 4P32A 3BH0A 4B3XA 4H1VA 4BQSA 4D4JA 3B1ZA 4PQRA 2GBLC 4DLRA 3T35A 1EFRD 3UK6A 4BZXA 2EWWA 2V55B 2JLYA 3BB4A 2QBYA 1GIAA 1XPOA 4HB2A 1KSJA 4A2PA 1Z6GA 3RRNA 2R6GA 1NL3A 4JJKA 5BXQC 4FWTA 1KAOA 1NMYA 4I1VA 2QMEA 3VKGA 3EA5A 2EFDB 1RVDA 4FCVA 1AGPA 3EAQA 3UKDA 1R0XA 3VX3A 1AIPA 1IONA 1OIWA 4DCNA 4DLUA 2WHXA 4DEXA 5C2JB 2CBZA 3EIHA 5FPKA 3HYRA 2ASEA 2VSFA 3LX8A 2GEVA 1XPUA 5BQ5A 4OI2A 2R65A 1G5PA 5K8IA
chains in the Genus database with same CATH superfamily
1A8SA 1FDSA 2ZJAA 4NBTA 5JZ9A 5CD9A 1VA4A 2AFVA 4GQAA 4UCWA 4B4OA 3UHAA 1ZAYA 3T0IA 4OL9A 4COOA 3A4TA 3LRXA 4CU2A 2NACA 2W6NA 3DZ8A 4QWMA 3K70C 2X76A 4IILA 1EUYA 1OKKA 4K87A 3PRKE 2AKAB 2Y9PB 5ALJA 4TXMA 2X58A 2BRUA 1TTTA 3JQBA 1K8RA 1NXTA 2PA3A 4UNIA 4D9KA 2XHZA 3DT6A 3D43A 1G7TA 4B4DA 4PS0A 1RXVA 3IR5A 3ZWAA 4Z8XA 4N6NA 3GI1A 4YP1A 4JVNA 4DJ5X 4FT2A 1SC1A 2QNBA 3FMGA 4MVJI 2ZRKA 4IKOA 1XKQA 1KTVA 2B4QA 2FPLA 4PR0A 1K7XB 4TUYB 1C1YA 2W6JD 1USGA 4HDKB 1MC8A 1NQWA 1Y8CA 3PQ7A 3WGIA 3GYBA 5IRCD 2LIPA 2PQMA 1LLQA 2BISA 1AS3A 3CUTA 1TCUA 2WM8A 3MWDB 3U7JA 1E64A 1SH7A 1NNI1 1RCUA 1RFGE 4IG4A 4YP6A 3BC1A 3D8NA 4ODIA 3FDXA 1X0VA 2OUIA 5J2UA 2I91A 4ZEOA 3K6SA 2R96A 1VCIA 2ZU0C 1IN4A 3T7AA 3VPHA 5IC6A 1J90A 4LC9A 2YNMC 3L92A 2QG9A 4HGQA 5FR1A 5IM5A 1D03A 1MNAA 1SOMA 5T64A 1XJCA 3QKSB 4ZQFA 2FVXA 1NNLA 4CYMA 1N1GA 4HD8A 4ZI5A 3KQHA 5IVHA 2J32A 3EGIA 1KFEB 3L6UA 4BQIA 2ARKA 4CRWB 4DR7B 4ID3A 2WT4A 4A6PA 4ER3A 1IM8A 2VN8A 4YDHB 4EG0A 3L8HA 3EH1A 3O75A 4RKRA 4HRVA 4EVIA 2QRGA 1Q77A 3IMEA 3UY4A 4XZ3A 1L9KA 1EGQA 4MXDA 4RDXA 1N36B 4IKPA 2GN9A 2WE7A 3EIEA 1Z74A 1BOFA 2BFNA 3DFMA 3G9XA 3STHA 1GU0A 4MUIA 1G291 3KZCA 1YBHA 4Z6KA 1EDOA 2ZJFA 2EGGA 4OGFA 3NIFB 4DIFA 1KH3A 2QTHA 4R69A 1QK5A 4Y1RA 1IHDA 1PR6A 1TCBA 2A0UA 3PV0A 4K6GA 2P1RA 4G09A 2R5FA 4WUVA 3KJGA 5DYIA 2I7VA 4I4CA 5HRCA 2ZVJA 4TRRA 4DLZA 3K96A 2FCAA 1GRCA 1RHRA 2IYTA 4L6CA 3H2GA 1IBMB 3N53A 5H4HA 1Y3CE 3ICCA 1Z2DA 2JIDA 1W75A 1WB6A 2WFMA 1GGFA 4Q9KA 3B12A 4UUAA 3C3BA 3WIDA 3PENA 4B9AA 4CIDA 5JW6A 3QPAA 5DBIA 2EG9A 4EYKA 2IBTA 2EP5A 1PKEA 5E2IA 2G72A 2BFCB 3IODA 4M99A 1DADA 4P9NA 4DE5A 4KX3A 2HWXA 4NESA 3I8OA 3SWWA 2RC6A 1L4YA 2ZWAA 3SVLA 5ICEA 1V6CA 3GK3A 4HXEB 1KY5A 4GSLA 2I4MA 2OVBA 1NW9B 4RORA 3K9BA 1O89A 5A3QA 4F56A 1MJFA 3IVRA 3C5WP 5JSHA 3F73A 2OCYC 3K35A 2JIMA 1YMVA 3UB2A 4BE7B 1AV7A 1Z6AA 2XZPA 3MQ2A 1SG0A 2EEZA 2ODQA 3PHCA 3JQAA 3S70A 1KVSA 2Q21A 1Z8NA 4M88A 4MUHA 1R4NB 1G66A 1NVVR 4GKBA 4HCJA 3IC5A 3LPCA 1OFHA 5CCEA 2ZUCA 1EFAA 3FUXA 1H23A 1P1BA 1FTQA 2HCRA 4C2UA 2WYIA 1BX0A 1Q91A 2I2XB 2HSWA 4XM2A 4Z8YA 1Y5NA 3EE6A 3RC8A 2JDID 2WJIA 2H1SA 2VDKB 3AUSA 1GXSA 1M9NA 4DWVA 3CE9A 4NENB 4PYNA 3DHNA 2HCTA 2O9JA 2DCMA 2FW1A 4WJZA 4A1OA 4AZ3A 3LXXA 4M0PA 5SYMA 1NOJA 5C1DA 4Y6SA 3SC3A 1D0SA 4P3XA 1RRMA 2RH9B 4KE7A 4KWTA 4MI6A 4BFYA 4B3TB 3PJRA 3G9UA 1E4OA 3QFRA 3D6UA 2PUTA 1G2PA 3SVTA 3G5UA 2C3MA 2Q07A 5KTRA 4NH0A 1WB9A 1X3LA 3NUGA 3DLBA 5M29A 1W36D 4ZO4A 4H3SA 3PCRB 1L4HA 4QOIA 3FPHA 3L4SO 5AKEA 4ANFA 4MV1A 4YYZA 4I6JA 3EQ6A 1YQGA 1FB5A 4GE3A 3H5TA 2W93A 5ALTA 1TUIA 1Y48E 2X9LA 4Q7LA 4YK7A 1QVZA 1JEOA 2SECE 4L0CA 4BU0A 1WRBA 4IXWA 5BYJA 1JLLB 1ZM7A 3ZXUB 1LDYA 1USKA 4O2AB 1T5TA 2QQGA 2MOKA 1JMYA 3U4DA 2BH2A 1KQFA 3WHPA 2EV9A 3GAFA 4AJ4A 8AT1A 2ZK7A 5LMCA 3AL0C 2XZLA 2GNOA 2XTAA 3AFNA 4MGZR 3LCVB 2ZZKA 2WJVA 1O6CA 2VNJA 3L43A 5EJ6A 1IYZA 3O73A 1N2OA 2O06A 4Y7CA 2GUWA 1P9RA 3NNNA 3FHTA 3QVVA 3CKYA 4HXYA 4BVBA 1YAHA 4YUXA 4ZCSA 5E8RA 1XQVA 2HFKA 2X1VA 3AWIA 4WFJA 5HTKA 4ETMA 4FD2A 1XAHA 4J1TC 5L3QA 3DVRX 1H2HA 1BH6A 1ZD2P 3BMOB 3P9YA 3E7WA 2OXCA 3WMRA 5A7HA 1SKBA 1KETA 1KIAA 3LSTA 1G6OA 1ADBA 4GU5A 2ATCA 4TQ9A 2EX0A 3E3AA 2AQIA 4Z7OB 4AP5A 2O59A 1JXAA 4WEQA 3RK1A 3RF7A 4EHHA 1W5BA 1PO7A 4FHZA 3TX2A 4BVGA 4CLXA 1J09A 2Z9CA 4MTCA 4YCCA 3RTCA 1Z0ZA 1I4DD 5DJ5A 2AFHA 4M7RA 3RS4A 4GF5A 2YIDA 2LBPA 4XTCS 4GOXA 4N47A 3UHPA 3VR1A 4W5QA 1IK6A 2AN9A 3QE3A 5BW8A 2ID9A 4ZGBA 2Q0SA 3C5VA 4NS1A 3H84A 1EQAA 2NU8A 4ZMSA 4FNAA 1CR6A 4IDCA 2UYOA 4H4DA 4DWOA 5JXJA 2QN2A 4FMBB 5T8KC 4OKIA 3VU0A 4HUTA 1P7PA 2ZPTX 2YBEA 3N2YA 1WMDA 2OZVA 1BWSA 2V6IA 4CLDA 4MULA 2OCKA 4NYJR 4OA5A 3JWGA 4JUBA 5BSWA 1KRWA 1NLUA 2X3UA 3BFVA 2RI1A 4QLBA 3JWIA 1W46A 1FFYA 1NYTA 2P2DA 2ZI5A 3PA8A 2O3QA 3EW9A 4ZOLB 1J0BA 1KDZA 4HGPA 2XV1A 1Y89A 1PRYA 4DT1B 1ELOA 3TWOA 3FLBA 1S2IA 1SCAA 4D26A 4NYIQ 1EZZA 3CGGA 3AOEA 4ZJZA 1RYHA 2B4TO 1KYIA 3KKOA 4NFYA 3JY6A 3NOQA 4ZRMA 5CDSA 1TJ5A 4D25A 1GR0A 2MSDB 4AS1A 4FONA 4EENA 2IU3A 5L3QB 3QGMA 4L5CA 4HV4A 2XADA 4Q3NA 4AJEA 4JQYA 4AYXA 5DXJA 4BFWA 2XUDA 1MTOA 2FWIA 3JQPA 1V8BA 5F1OA 5L6LB 3D8BA 3MMSA 4EHLA 2I9KA 1NF2A 2ETXA 4BNIA 2XDQB 2QN3A 4WFIA 2AQ8A 1WCV1 4GDMA 4AKTA 1P6UA 1GSOA 1XWIA 2FGKA 2XSZD 5H70A 5HVNA 2G06A 2TMGA 3AIOA 4J94A 1JEQB 4GC5A 3ZCSA 4RXTA 5JFTA 2JVIA 3FETA 1XKTA 2ISSD 4E03A 3BEDA 1GG2A 2IPOA 3QOXA 1Z06A 2QTRA 4LF9B 3D3NA 3ZCXA 3GFFA 3Q0TA 5F2KA 2FMIA 1T8WA 3FPGA 3TD9A 2WTUA 1PFKA 1MP0A 4QGBA 5FV7A 2QZSA 3TK1A 4B73A 3AF0A 3A9RA 4A4DA 3HR7A 2L69A 1IU9A 2RHGB 3PXAA 1D6NA 1WKBA 2LDXA 4GMGA 5ILOA 3FOAA 1QP0A 2AK3A 4WMLA 1ZIXA 5DULA 2JHPA 2NTYC 3NB0A 1EFVA 2IUFA 1TPYA 4IGIA 3VYVA 3ZK9A 4AJNA 1KEEA 5EYPB 5EHNA 5JNLA 1M2KA 2H1HA 3HB5X 1Q0HA 1QYXA 2R1TB 1BEUB 2FSVC 2Z0MA 3IB6A 4CCSA 2IZ0A 4XUEA 3STUA 4KIJA 1MKYA 2IIVA 4D3FA 4D96A 2GR9A 1SZPA 4OO3A 5CDFE 3T5PA 1TYEB 4U7PB 3RYHA 2AN3A 3NIDB 3OZIA 4IDNA 5A6VA 2RE8A 2GZ2A 1R3UA 2H4FA 3QKWA 2C1EA 1T1IA 1C1HA 4GECA 4NOLA 4CKBA 1VJCA 4OV6B 4ESEA 2YJ6A 3LIIA 2VCEA 2XX3A 3D5QA 4ZAZA 1X86B 2NV6A 3MOIA 1U3WA 4FE7A 4WCFA 4G86A 5PGMA 3VU3A 4EPTA 4MHTA 3C1AA 4HQRA 2ONYA 1B00A 1VC2A 5AHXA 4TN5A 2WIKA 5CURA 5MGNA 2OENG 4W8GA 4PFJA 1BEZA 4R6XA 1HX7A 1XQ6A 4N7RA 3VMMA 2CK3D 2IYWA 2IV7A 3T3NA 3QUQA 1SD5A 2CVQA 2RGCA 2X6QA 1NQUA 4IQ0A 3K09C 4ME6A 4UHJA 1UBEA 3HDTA 4DA4A 3OF5A 4BKOA 3UW1A 3KJHA 3QTTA 1JVBA 3EDCA 2R62A 4A2QA 2P1DA 1E6EA 5BUSA 1E6WA 3THOA 3QI2A 1NV9A 1U8CB 2FW6A 2JRCA 4MP3A 4MRMA 4RL4A 4QUKA 5DSXA 4CWAA 4ZHQA 3FUTA 5JTUA 1FPMA 2P2YA 4NMMA 3V8VA 4O2AF 5K8VA 1Q12A 5EUCA 2HDWA 2H7XA 3DMNA 4ZVNA 4AN0A 2GBIA 5KTKA 7YASA 1ZNXA 1ZCAA 1TW2A 4Q05A 3IBTA 3CZMA 2BGMA 4MW5A 5AVOA 1BX1A 2VTDA 2R7NA 1DBWA 3NV9A 1DAFA 3D3EA 1W5TA 4IDQA 4XSHA 5E3JA 1OAOA 3SMQA 2F9MA 2W22A 2G04A 3PUHA 4A0SA 2HHHB 1YDHA 2W6QA 3IXMA 3KXLA 5H9VA 1AF7A 3IUJA 4CMAA 3E9QA 4D46A 1AO3A 1R00A 3UG7A 4ENSA 1DQNA 1ONSA 2J0VA 2UYQA 2HFJA 4QPCA 2Q3CA 2B4AA 2I2CA 1DUIA 4J7AA 4B2PA 4DG5A 1F0PA 5CFOA 1FDRA 3LXMA 1EX9A 4LNAA 4ZAWA 1YFLA 1LBEA 1DRWA 3N39C 2GPBA 1AZLA 3K2EA 3AXSA 1E1CA 3C43A 2WYOA 3HCFA 2WWWA 4M2LA 3ADKA 1DEOA 4MVJH 4R1UA 3S2ZA 1J24A 5B2FA 1GDDA 1L7PA 3WA7A 1GG9A 3TW4A 3ZLJA 3EZNA 2Q7XA 1LK5A 2BZ1A 2CF5A 2H1VA 2EBFX 2V0NA 2E2WA 2VEOA 3IAUA 3CQ9A 3FPEA 3PLNA 2PR7A 4CL0A 4E5VA 3OC6A 4CUZA 1YQQA 3H7IA 5I48A 3W90A 2QRQA 4FSXA 4GZ3A 3DF9A 1ITZA 5DLYA 4DSZA 3LUJA 5IFKA 4B6FA 2O14A 1UBLS 4BNXA 3EN0A 4RPIA 2QY6A 4Y6QA 1HQDA 4PRLA 3GUCA 3V9AA 4A03A 3DDHA 3D4LA 1V5IA 3GB9A 3HA7A 1Q1AA 1G3RA 2H18A 2AT1A 4ZCPA 2BMDA 2O5CA 2AVDA 3K5WA 1P4HA 1CKEA 2YY7A 3KQUA 2BFFA 1VL0A 3BAZA 3AZPA 4IIJB 4OHBA 2QR2A 1GA6A 1U1FA 3O31A 3OHMA 2GZSA 3JRWA 2YHIB 3RFTA 1ONBA 5KYGA 3HRHA 2WWYA 2IVZA 3M6AA 2XUPA 3EWSA 3ETHA 2YS6A 3CISA 3DMPA 2P40A 3I3SR 3QLUA 3HN2A 2OV4A 4CL8A 3QBJA 4HO1X 4R1NA 1L5SA 3TJZA 1AJEA 1N77A 4LOLA 1GVNB 3LLUA 5JAPA 2PGJA 1BXKA 2OYCA 3IEPA 3CVWA 1W2HA 3QOYA 4QDJA 3QNMA 3ROTA 5M2QA 3Q3IA 3P2EA 2FSGA 3TR0A 3IMCA 1U99A 3W1VA 5CVCA 3IQHX 2NXEA 1D2GA 2JVJA 2O2SA 4AUMA 2P1ZA 1R10A 4NCJA 2VJKA 4MCJA 4NRDA 2YRWA 5EFZA 4GPD1 3IAM1 3PPIA 1I80A 2Q4DA 4BLTA 2IODA 3CUKA 4LQ4A 4U9IS 1TO6A 2W70A 3HADA 3I5XA 3N7TA 2BSQA 4HRYA 4Q1CA 3N2GA 1AZWA 4OQLA 3AXTA 3ZU5A 4CM9D 2O7RA 2W2VA 3EIUA 3FROA 4KO3S 4AJJA 4CXMA 1F4LA 3O03A 4RDCA 3RJZA 4FHGA 4MLPA 2AG8A 1WULS 2D1FA 1NXSA 4HGNA 1NN5A 2D0PB 1D1SA 4QHSA 4CF5A 5KREA 1V47A 1QQBA 3UVEA 2FV8A 4XB6B 2H3HA 3D5EA 3O2SB 4M1KA 2XXAB 2QW0X 3GLIE 2V5VA 4DMLA 5TS2A 1VFPA 3T5DA 4DDUA 4AQ7A 1J0EA 3T54A 4MI3A 1E66A 2ZITA 2V1XA 3NIWA 1I5OA 1TRHA 2AOTB 3HHPA 4G8CA 5EOVA 3FCUB 3RSOA 1S01A 4KBFA 1A9PA 4PBRA 1Y1RA 4DV1B 4XH9B 3HKEA 2A1UA 2XB6A 4P36A 5HJ7A 4L72A 2IH5A 3ICQB 1GL6A 2ZFUA 3U39A 1DG1G 3H2BA 2I62A 5IF3A 1BU8A 2H3EA 2QM8A 2CHVA 5IXSA 3VAAA 3PQ3A 1DKLA 1J2UA 3PNYA 4ZYVA 4OXQA 4WW0A 4DA6A 4EUSA 3I23A 4JLDA 5EERA 3L1HA 5E4TA 3JD4A 3LC0A 1SQFA 3D5TA 1A97A 4PBTA 4QGGA 5HIMA 4Z5XA 1H2YA 1FL9A 2ZRCA 4GMFA 3WGLA 4EI8A 4XQ9A 4H7JA 2ZJ8A 2PT9A 1Y9EA 3KT8A 5EA2A 4JLSA 3RKUA 2JIZD 2LKCA 4ACAA 1U7TA 4CTJA 2NZUG 4CF7A 5J23A 2LNDA 2Z5VA 2GVNA 5C52B 5GQSA 2X2EA 4P7JA 2YQ5A 4IS2A 3RU3A 4F21A 3HLTA 3BL6A 4MKXA 3CW2A 5IXYA 4R51A 4TWJA 4DR3B 3QOWA 3QSYA 3FDJA 3IR6A 1JAIA 4Z53A 2Y1CA 3IIIA 3Q72A 3NKVA 1CDZA 1MABB 1NURA 1PJ8A 3DBHA 1YZTA 4HAUA 1Z4NA 2IJGX 4KE8A 1L7VC 2VF4X 3FPBA 5CTJA 3ROXA 3VAYA 1MEJA 4YJGA 4DKJA 4E5YA 2PS3A 2O54A 4RGYA 2C2WA 3HPRA 4FDMA 3K2IA 2A1TR 1XLTA 3K1TA 5IUNC 1NZJA 1X1TA 2FQYA 3P52A 4DXDA 2XCLA 4RY9A 2FF5A 1W0JD 3BH6A 4HEHA 1YHNA 1GPH1 1M6YA 1CETA 2NVUB 3TIVA 1WD5A 2FDCA 2I1VB 2QAIA 1KK1A 1WMSA 4JUIA 1CY1A 1LV8A 2PGIA 1ICIA 2JGAA 1KBQA 1YR9A 2Q5LA 1PHRA 4MUGA 3UJHA 1YJAA 3SHWA 2DSTA 3IUYA 1DVRA 2Z5FA 3H86A 3FTEA 1FMJA 1QRAA 1QFSA 3M5WA 2OQ2A 3U09A 4FYMA 1B23P 3HDJA 1ZR2A 4ZICA 2ONZA 4DL9A 5IT5A 1CYEA 5JYEA 4DM4A 3OT5A 3VV3A 3CLKA 4RJTA 1LSJA 3O4HA 1H4QA 3MHTA 1I6LA 3BREA 3FDIA 1GOTA 3A11A 4R8KA 2P9EA 1PK9A 1BKYA 3H1FA 3AY0A 3EDYA 3L4KA 3I6MA 2WMYA 3VPDA 2H2AA 3I4CA 3EYAA 1W59A 3H5IA 1NN3A 5FUWA 2UKDA 3CZPA 1M8GA 1OX6A 1PT9A 2V45A 2XNCA 2KB0A 4M83A 3K53A 5GOTA 3V7NA 4D8XA 5DNCA 5JLJA 4A6XA 4QU5A 3RTBA 3DLIA 4JP2A 5L51A 1JQEA 4XUDA 1DAPA 1OHHA 2IYZA 2KSQA 4G4GA 2C0PA 2DWCA 2NN3C 3GN1A 4KFSA 3SBOA 3AVXA 3AYXB 3I1FA 1Z9BA 5INTA 1M6HA 1ZCZA 2H63A 4OQPA 4WUTA 1FC0A 4DIKA 1JAYA 1G98A 1VPEA 4Y9TA 3EWNA 3GCDA 1HT1E 3LUHA 3NO4A 3ORFA 3KYBA 4M8SA 4RF4A 3SFVA 1C4XA 1SUPA 4J0GA 5I7EA 4HB4A 4ZPXA 1ESNA 2MSEB 1SRRA 2FOXA 4NJEA 5ICFA 5KTYA 4IIJF 2IWHA 2YN2A 2DZDA 2VSNA 3F5SA 4I6GA 4WVFA 4F8JA 3QNUA 4X24A 3UEOA 1N8SA 3BSSA 3FGNA 1XV5A 1GVHA 4QOFA 1WBBA 5DTQA 3B3GA 5NULA 3E2MA 1X6VA 2X5JO 2VJOA 1J20A 3IX7A 4LCEA 5IG2A 2WV7A 3DCJA 3BZBA 3RODA 4IFTA 4CKEB 2E55A 2QGNA 2DQZA 4EKYA 3FB1A 3QELB 1KK3A 2CUNA 4UCFA 5A6SB 3PHHA 1KC1A 2OA0A 1E3DA 1XELA 1J21A 4EFDA 2ZM5A 2QQ0A 1H5UA 4IHJB 4B85A 1F4PA 1SKAA 1CV2A 1G9TA 2BM0A 3E70C 1U9IA 2FPMA 3MFYA 4LBYA 3U3XA 3UMGA 4QTZA 1ZHOA 2BHNA 3DJYA 1YULA 4S04A 4GYJA 5LN1A 4CODB 2EIHA 4TYNA 4ENUA 5KQSA 1KO8A 2YCBA 2JLQA 3BERA 4PC6A 4JC5A 5ESRA 2JHFA 2O6LA 1ZUD1 5DIZA 4RJJA 3E4CA 4NMHA 1R0WA 4ZAFA 1LLCA 3HJUA 5E9WA 5AHKA 2JZNA 1CIPA 2CXUA 4QXQA 1BA2A 5FOXA 3N7AA 3BCHA 2WB2A 2JGMA 4QEZA 3WGMA 3B38A 3SPXA 5IDYA 5A2GA 3AP3A 4HWPA 1XAGA 2AX3A 2I4TA 2C4KA 1B42A 4K3VA 1MX1A 2FGJA 1W35A 2X14A 4JI6B 1P9LA 1PWHA 2HIHA 4MKZA 5DM1A 4FK8A 4B0PA 4A8JB 4EF6A 2G5PA 3I83A 5LZ4A 1RLJA 2WTXA 2ZIUB 3O95A 4AK9A 3EPLA 2Y1LA 1FRZA 2QPTA 1CF9A 1ZX1A 1EJ0A 1JDPA 4YP5A 5ECGC 3OQ1A 4BY9E 3M9XA 1ECBA 3L8FA 4IICA 4E5MA 1CJSA 1RBZA 3NH9A 3OICA 4J0EA 5ED0A 5L4NA 1RNLA 1HZZC 2ZRAA 3G1UA 2JCVA 1KZYC 1BVYF 1LCIA 2VBGA 4LIPD 2HBZA 1QBKC 1G5FA 2H51A 2Y05A 4KAXA 1EK2A 3PUVA 4MQ6A 1QCDA 4PCUA 4RQAA 5DK6A 1T9ZA 1TEVA 2AOXA 3UV3A 3QLVA 4IINA 4EVSA 4N3CA 1BCSB 2HHCA 2SBTA 4I46A 3TFQA 5FLEX 3IUBA 2BGGA 2C7BA 2EXXA 1Z6PA 3ZCRA 4EB8A 2CFIA 5BW4A 2HXYA 2QLFA 2NO5A 3FKSA 3U3ZA 1OZAA 3WRVA 4FT4A 2WSSA 4DN6A 2F62A 2CVPA 2KX7A 3K9QO 3IEIA 3EFEA 1UPAA 2HRQA 1VOTA 3A6LA 1FW8A 1MOZA 3O92A 1EFPB 3PDWA 2WABA 1OWLA 4W5NA 4TV9B 5CLQA 4BB6A 5KU7A 1QQTA 1YVUA 1C7EA 2XQGA 1P6QA 3BK7A 3JVDA 3NBAA 1NE7A 4RLFA 4ARSA 5A03A 2V8BA 1EE1A 4IRXA 5KTOA 2CMKA 3B60A 4Q37A 4CFSA 5IBCA 4EKEA 3OZAA 4ITUA 5AW5A 3A6GA 2XIQA 3F7NA 2W2LA 4CMIB 2GK7A 4JJAA 3HU1A 4JBNA 2OYRA 2C5LA 2P2ZA 2GFHA 2NYRA 3T61A 4AICA 1G8SA 5K1ZA 1CZUA 3GLHB 4YMLA 1KZ9A 3QRWA 3OCYA 1VPWA 3MTJA 4KQ9A 2RGRA 5C1BA 3X1YA 4RX1A 1TEXA 4XYEA 3V6LA 5HGXA 5IJZA 2UZ1A 4RVOA 1ZESA 4LHEA 1I2ZA 3E8XA 1N25A 3P0HA 4RZ2A 1XRLA 3D7MA 4HZIA 1NM5A 1XVVA 3EHDA 2JA2A 3BX1A 4A27A 6NULA 1GTSA 4ERNA 2I6TA 1P1HA 1HT0A 4EIWA 1VE5A 4DMGA 1QV7A 1YCDA 4YJKA 3U3OA 3IESA 4LMBA 1FVOA 5CXXA 1P4GA 5TMPA 5BQXA 4E5SA 1GCIA 4B8YA 2UUCB 4FYYA 1YVEI 3SR3A 4TVOA 1XJWA 1YB5A 4XGRA 4CIBA 3CA8A 1OQAA 1R4MB 5EMNA 1V2GA 2XMBA 3PU6A 4QQKA 1ST3A 2DJ5A 1OROA 3Q40A 3DMRA 3PK0A 4Q6BA 1JH9A 4Q24A 1WPRA 1IY2A 1XL1A 3A4VA 5EJMA 1RWBA 1E1DA 2QMUA 3C3XA 4MQMA 3IVMA 2BKEA 4TMFA 4CTMA 5FLYA 1NLFA 3ICEA 3PB3A 3AFGA 1R5NA 4E2YA 1N2JA 2COUA 2VHWA 4TS9A 3TI9A 3C3CA 4N0EA 2VQEB 1BDHA 1ZHHA 3M81A 3UA3A 1GP2A 3AIMA 2O8DA 4QOSA 3WO0A 4PXAA 2XE4A 2GDJA 4FC6A 2VHVA 1FYWA 1XD9A 5AJTA 3UWOA 3V4VB 1KI4A 4BB0A 3F71A 3LDFA 1SIUA 4XOUA 4IO0A 1O8BA 5GINE 2VNHA 3RIYA 3VSCA 4BZZA 3THWB 4J3FA 1GTG1 2Z1MA 5B2ZA 2QRVA 4G0VA 3TSCA 2XVAA 4UU7A 5ARBA 5JYBA 1NP7A 4ALKA 5DN6D 4JS0A 4N18A 2G7ZA 2HMWA 3MCWA 3UTDA 1N57A 3ROFA 5FAKA 3F6PA 4OHWA 2CLEB 1VIMA 2DECA 1BKDR 1GTL1 2Q6LA 3G23A 2D2IA 1UL1X 4QBTA 3IRVA 1K97A 4PINA 2DPHA 4IHJF 3ELYA 1P8AA 3E53A 1NUAA 2IY8A 4HB0A 4A0FA 4CKZA 3TNJA 3NBMA 3MTEA 4PEVA 4OJTA 2BY4A 2FEPA 3B6KA 2D59A 4KBYA 5DV9A 4C4RA 2CZGA 1K5DA 5EJ8A 1VPTA 2EL9A 4IJUA 1O0CA 4RHFA 5DHSA 4LSMA 4CM3A 1S2LA 1B1AA 3QEMA 4W5WA 3UTCA 4EKNB 4KUEA 2YNMA 2XUOA 2VHJA 1EFRA 4QDXA 4W5RA 3HE3A 1UWLA 3TDMA 4E1VA 4RZXA 3OAAD 4BJ3A 4X45A 4LOAA 1ABFA 2ACWA 2UZ0A 1MO2A 4ZT2A 3RSSA 1Z6ZA 3D6HA 1BN7A 1F4VA 4IJ5A 1TT5B 3PNQA 4NKRA 4RIEA 3ZOKA 3VOBA 4L5JA 5G3ZA 4EK9A 4Y2YA 4IIYA 3EOZA 3BWCA 4UKDA 5CNMA 3ZHRA 3DDSA 4DNQA 2HMUA 3MTGA 2NU9A 4HDRB 4O59O 1Z4PX 1Z75A 1TJNA 3KJZA 4WV3A 3RS5A 4WQMA 1OY1A 1NUSA 5B58C 2JFWA 4ZEXA 3QPCA 1COZA 4EZEA 5LSAA 3TM5A 2ZYIA 4HEA6 5U1PA 4RDIA 3I6QA 1AS0A 1CS4C 3ELBA 4RLSA 5H0IA 3THXB 4AXBA 4TUYA 3OIGA 3D4BA 3L1JA 5F9HA 4XPIA 4Y2UA 1W47A 3V4ZA 4HDKA 4OXKA 4A36A 2HLDD 4BNMA 1X7WA 2R4TA 4KQ6A 4Y30A 1YD7A 2A14A 4Q9HA 3S8EA 4FDTA 2CLSA 1WABA 4YRZA 4BLOA 3NHFA 3VSDA 4AMBA 4CMGA 2OECA 1KP3A 3NNSA 3WKAA 5I7AA 3GMTA 5KWSA 3J81A 4GS5A 2K4MA 3N74A 3TZHA 2TMYA 4CV1A 1I5EA 2IH2A 1ES9A 4C29A 2FZ4A 2PU5A 3ASUA 3DDCA 3E0XA 4PG4A 3WDMA 1FOEB 5F64A 2C7PA 4E11A 3ZU2A 3DZIA 4G4IA 4MGKR 1E1RD 1X70A 1YZKA 4DCMA 4D5GA 4C7OB 4TV9F 3QVUA 5AUNB 1F06A 1JHMA 4DV2B 3RT9A 4FDUA 5K03A 2NQ8A 2H4WA 3VBCA 1EEXB 4BS9A 1Q3TA 3G5TA 1HYHA 3AZOA 2PR2A 1DC8A 3GZJA 1NIPA 3I64A 3NT4A 3OSZA 4FR5A 1ILWA 2QZJA 4PLCA 4QATA 1RI2A 2VQ6A 1U9ZA 4I2VA 3ZDYB 1AMUA 5CVDA 2BBOA 3QP9A 3L0DA 1IBSA 3LW7A 5EMJA 2WYVA 5KYUB 2QF7A 2MWMA 3UBTA 1HQYE 1MJGA 3RLFA 2OD2A 3V55A 1GN9A 2CZQA 4B87A 2AD5A 2HM7A 1EHIA 3CX6A 4TX1A 2HQ1A 3UAXA 2JLUA 3RRZA 3GF4A 5FFMA 2OXTA 1P0CA 2QRLA 2VHXA 4PO3X 1C1DB 1N75A 4BNKA 3G49A 5JS2A 3USZA 2B5WA 3RWOA 3KQWA 2IA5A 1PJTA 2L17A 1AKMA 1AXEA 4KO4S 2FLVA 3P45A 4R41A 4N54A 4V0RA 1N3IA 1PD1A 2VG8A 2QMYA 2VPYA 3C24A 4TYQA 5DHQA 4YUVA 4RY8A 1KQPA 3EVNA 3UHJA 3QU5A 4PC7A 3E18A 2CMDA 3WGKA 3LX4A 1O4VA 1M2NA 4TM8A 3A4NA 3RC1A 5LFAA 1D5WA 3WIBA 4B46A 3BGVA 3FSGA 5M04A 2ZS9A 5L3SA 2Z3WA 2IUSA 3P9ZA 3GBPA 1GZUA 2BFCA 1BS1A 4EO9A 5JXWA 3Q9SA 3ZPXA 4BKQA 4B3MB 3KUUA 3V33A 1G8YA 5J4KA 4AS3A 1U7ZA 1A3CA 2Z9BA 2QVLA 1TFUA 1KZGB 3B9RA 1ZZGA 4QNMA 3ZV7A 2OBNA 1J0AA 5A9SB 3R3XA 1G20B 5AVUA 4TSFA 5KNLA 2BSAA 2BCGY 1IFXA 3OLQA 3PWKA 3KT0A 2NPOA 2PL9A 1TNDA 3ZNPA 2I6UA 5CK4A 1EEHA 3KUKA 4HVLA 4RCYA 1JEEA 1BJRE 1T4CA 3NBYC 1X7ZB 2PVCA 2QUIA 4Q03A 4PNPA 1JHUA 4QDZA 4EEKA 5FI0B 2ODBA 5GM2A 1AT1A 1LDGA 1NONA 3D31A 1LC3A 4ND3A 2B2NA 4GUAA 2BEWB 1Z2CA 4PCAA 3ZHCA 1QP4A 2Z57A 2JF0A 3CWCA 2V6MA 4L78A 4G25A 2QUAA 5E95A 1IEQA 3FTCA 5HG0A 5AUPB 1GG5A 2FEKA 1P4JA 4GR9A 1U8YA 2YV2A 3ADPA 5L7YA 2H07A 2AVNA 1KWKA 2PRIA 4INPA 1XSEA 3TUJC 2KE5A 5TPZA 1JTFA 3K9HA 4QYIB 1PLJA 3RVQA 3UIEA 1THGA 2IE0A 2G9NA 2EGHA 4IIUA 2B36A 4W1SA 1S2MA 1SN7A 3B6EA 1KH2A 2F1RA 2XDAA 3R5FA 5BR7A 1CWUA 3T5BA 2YIJA 4DLKA 3JWHA 3U19A 3URKA 5J5AA 4RKQA 1A2KC 2FG5A 3KDPA 4XJXA 2D1TA 4V2UA 1WXHA 3OPYB 2R6HA 3MGKA 4LTNA 1X1BA 2HIMA 2OB2A 4WZBE 2BE7A 2PD6A 1AKRA 2EATA 2FN9A 3GLTA 4RO0A 5AJXA 3DE6X 5HS6A 5LLDA 3OPVA 3WP1B 1YS2X 2Y1EA 4DV7B 5KNCH 4J3JA 4RPCA 1QGZA 1WUKS 2HJVA 4ISCA 3FLMA 3C39A 1QRDA 3WOVA 3ANXA 2V1UA 4RW0A 1JLLA 2JFOA 2RI0A 1GEEA 1FYVA 5E2BA 5HUHA 1JE1A 3BA6A 1EVQA 2R7AA 4KR2A 4X71A 3OH8A 4F0JA 5AW9A 3KDAA 4EM6A 1I36A 1VJRA 4AWAA 1V3UA 5EQFA 1K7YA 4JWTA 1YZYA 2DBYA 2PN1A 5CYPA 5HIKA 4RACA 4FYJA 2B20A 4PVDA 3C8MA 1NATA 2WF8A 2JCXA 1LRJA 3GL9A 3I01A 1WSBA 1LFDB 1F6WA 1VHQA 3P9IA 4QYWA 1MJNA 1OTXA 1CLUA 3MILA 4WEOA 4ZEWA 1CP3A 3T1HB 1VKZA 1L5HB 1XCBA 3SCZA 3TLZA 4OXYA 2ZIAA 2TECE 1M8FA 1P6XA 4IIFA 5A3VA 4CR7A 1PBNA 1RCFA 4ITVA 4X90A 1XJQA 5HM8A 3VPSA 2F64A 1VLLA 1CVRA 3ZI4A 5KDOA 4PC3A 2XYGA 3FOBA 2IXAA 2KBEA 3P0FA 2PIDA 3PC6A 4HPXB 4FBGA 3I05A 3NDBB 4X64B 2DPYA 2MTBA 3K0AA 4G89A 5G4LA 1N2HA 2FKAA 2XITA 2XGSA 5I9IA 3CUSA 3TNYA 4F3TA 3KQNA 3TEFA 1R4ZA 2XNJA 4KE6A 4X1IA 3E7PA 5DO9A 3T5GA 5I7UA 2O4CA 4HGYA 3IAS1 2WSYB 2O8FA 2HHLA 4HDCA 1QCZA 1SHUX 2CFOA 2B1RA 1R8YA 3HO6A 1FFCA 4HRAA 1O96A 3RVLA 3R9KA 1OJ7A 2QLTA 1I5RA 4GI1A 2W48A 3FZNA 1MA0A 4I1UA 3WQQA 4B35A 4QX6A 1P72A 4X7PA 2CUKA 3UF0A 3KEQA 3TW0A 4IG9A 1AK2A 1TIPA 1J1ZA 3CZ9A 4BGUA 1QOZA 3N0VA 1NLYA 4ZVLA 2F43B 2IEZA 4N41A 1EESA 4RH3A 3KIPA 1Z4MA 1F2TA 1Z4JA 3MINB 4BWYA 1JHRA 4Z9XA 5AI4A 7AT1A 1VHWA 2RI6A 3EWAA 2WZQA 4ZOLA 2DKOA 1DKNA 4UEKA 4UXIA 3VHXB 3MSXA 2NAFA 5IULC 3FDZB 2GERA 3ANTA 4DT1A 1ZMRA 1JBKA 2QGFA 1KXJA 4MYDA 2ESRA 4IFEA 1AQIA 2QP9X 9MHTA 3FMIA 5JV5A 1SJ9A 4G97A 1L5WA 2JLRA 1U3TA 2VHYA 3ZTWA 1N33B 4RMIA 1N6HA 1NQVA 2QUJA 5JNRA 3FPAA 4E22A 1IUOA 1NGSA 2AK2A 1F6BA 2HL6A 3DULA 4A8HA 2PKWA 2FR8C 2QX7A 3C3WA 4R2KA 1F3LA 4B2IA 3N6RA 3GEGA 4LJYA 4S1VA 4W82A 9GPBA 3T5AA 5FJJA 4UHEA 3DMGA 3CRMA 3JARB 4MPDA 2BD0A 2ZDQA 5DMHA 3O3MB 5EE0A 5K8JB 5K5EA 2UXBB 1KDVA 1GNPA 4RF2A 1ZGZA 1XTQA 2ATIA 2OP0A 2VF2A 2EX1A 1Z3CA 3HGMA 2FRVA 2G77B 3LL4A 4QD3A 3JATA 3K9GA 1JEQA 5K8CA 1ZY2A 3LUPA 1X8JA 4BNTA 5A7FA 2TMDA 4ABTA 1Q0QA 2PBLA 2QUKA 1BMFD 1KY4A 2OG2A 3BGWA 3IUQA 2PKEA 4S1PA 4UDNA 3KUXA 4XPZA 3L6BA 4TMTA 3W2FA 1RXEA 4K9RA 1VHJA 4GSYA 4DAOA 2PMFA 3HJTA 4Q12A 3X44A 2R1VB 1FUIA 5JSZB 1TM5E 1FTYA 3UFBA 1DAHA 1IZ8A 3HABA 4OQNA 5JASA 4IDFA 4FYHA 4RF5A 4N12A 2VDQB 3GAMA 2ERCA 1VKRA 2FOLA 3OFJA 4OP2A 1UKVY 5E1BA 1BN6A 4FGUA 4ROTA 2POCA 4RV4A 1QSGA 3OZFA 4XAQA 1UJ6A 4F3RA 4YV2A