1WA5B

Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
502
structure length
463
Chain Sequence
FVPEYRRTELRRRRDTQQVELRKAKRDEALAKRRNFQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for the Assembly of a Nuclear Export Complex
pubmed doi rcsb
source organism Canis familiaris
molecule tags Nuclear transport
total genus 176
structure length 463
sequence length 502
ec nomenclature
pdb deposition date 2004-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00514 Arm Armadillo/beta-catenin-like repeat
B PF01749 IBB Importin beta binding domain
B PF16186 Arm_3 Atypical Arm repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 1wa5B00
3WOYA 4ADYA 4UQIA 5KLRB 1UKLA 2IW3A 4CRUB 3TPOA 1UPLA 4GMNA 5E6QB 2JKRA 4P6ZB 4EV9A 4I5NA 5BZVA 4V3OA 2QMRA 2Z5MA 4BPLA 1EE5A 3KNDA 2BKUB 4CB8A 3OUWA 4U5NA 2BNXA 2NPPB 4CB9A 4CRVB 2JAKA 5KLTB 2VGLA 4B8OA 4V3RA 3QMLC 4BQKA 4RZPA 2IAEB 1W9CA 4MFUA 3GNIA 4K92A 4YJEA 3FGAB 5B56A 4HXTA 3EBBA 3W3UA 3O2QA 4B8PA 3AU3A 4H3KA 3Q0QA 2NPPA 4OIHA 3NMWA 2IAEA 3GRLA 3FGAA 3IFQA 2F31A 3K49A 4IMJA 1O6OA 2NYMB 3K62A 4ZDUA 4PVZA 5AEIA 3ODSA 4PLSA 4YGXA 4OO6A 1O6PA 1Q1TC 4P6ZG 4DB8A 2RU4A 3ZHPA 2QNAA 3UVUA 5KLAA 2OT8A 3OBVA 5BZUA 3C2GA 3TJ3A 1BK5A 2NYMA 4YJLA 4IMIA 1XQRA 1BK6A 1EJLI 1QGRA 3UKYB 2JKTA 3EG5B 5SVZA 2JKRB 3WOZA 1IB2A 4CT7B 1PJNB 1PJMB 3UL1B 3WPTA 2C1MA 4B8JA 3Q0NA 3BX3A 1IQ1C 1JPWA 4UWXA 2OF3A 3GQ2A 2XA7A 1V18A 3L6YA 1W63B 3ZINA 3LTJA 3TX7A 4HTVA 3Q0PA 4TNMA 2PKGA 1XM9A 1I7WA 3UKXB 1OYZA 3LTMA 1HO8A 3GB8A 3UKWB 4D4EA 2WTKA 4DZSA 4R11A 4V3QA 1EE4A 1UN0A 4FFBC 2VGLB 3BSBA 5JJAA 1GCJA 1WA5C 4FZAA 4R0ZA 3VE6A 3BSXA 4CBAA 5HUWC 1W63A 2X1GF 5EWPA 3UL0B 3QGBA 3ZKVA 3O2SA 3TPMA 1Z2CB 4DB9A 2BCTA 5BYMA 4I2WA 1M8XA 2QK1A 3GVOA 3C5WA 3PSTA 3L3FX 4FZDA 5HHGE 4U58A 4UAEA 1JPPA 1IALA 4EVPA 3ZIPA 3L6XA 3Q0LA 4HNMA 1T08A 1TH1A 5SW9A 3K4EA 4FDDA 4E4VA 2QK2A 2Z5JA 2RU4B 4KZGA 1G3JA 4CT6B 4DJSA 5KL1A 4PLQA 4B18A 3QG9A 2JKTB 2P8QA 3LWWA 3WYFC 4UADA 3EA5B 2IWHA 3NMZA 3OPBA 3C2HA 4DVGB 3O4XA 5J3VA 2XA7B 4NEEA 1Y2AC 2NYLB 3QHEA 4QMIA 3V6YA 4DB6A 2H4MA 4I5LA 3Q0RA 4U5UA 4MZ5E 1M8YA 3L3QA 3O2TA 3K5QA 3RZ9A 3BCTA 1I7XA 1QZ7A 3ODRA 3BWTA 4JW2B 3ZIQA 4EV8A 3BTRC 2Z5NA 2Q5DA 3QGCA 4U54A 1M5NS 3V71A 3K7WA 4Y5JA 2NYLA 4QMHA 2YNRA 3DW8A 1M1EA 3H3DX 5EKGA 4HM9A 4EVTA 1M8WA 5SWFA 5FC8E 3Q0OA 3FEXC 5D5KC 3DADA 3V74A 4UAFB 4DBAA 4GMOA 2IE4A 1IBRB 4O27A 4FQ3A 2JDQA 1U6GC 5CTTA 3NMXA 4FZFA 2BAPA 3TJZB 2GL7A 4MFVA 3GVTA 1JDHA 3FEYC 4U5LA 5HUYC 3ZIRA 2Z6HA 2C1TA 3Q0SA 1LRVA 2Z5KA 3RZXA 3IBVA 3BX2A 5K9SA 4D49A 1F59A 1B3UA 5K6SA 2IE3A 4CV5B 4JLQA 1EJYI 4YK6A 2IX3A 4U5VA 4A0CA 5BZ1A 2Z6GA 2Z5OA 3A6PA 1Q1SC 3K61A 1QBKB 4G3AA 4YI0C 3UKZB 4EVAA 3K5ZA 4PLRA 2FV2A 5LSWA 3Q0MA 4U5SA 3ND2A 2PF4A 4LACA 3PSPA 1QGKA 3VWAA 3K5YA 4K6JA 4MZ6E 4XZRB 4BA3A 3NOWA 3K7VA 2YNSA 4L7MA 3TT9A 3ZIOA 5H2XA 2W3CA 4NZWA 1XQSA 4QMJA 3T7UA 5KL8A 3Q5UA 4U5OA 5DN7A 4RV1A 4UQIB 4H3HA 3GAEA 4U3JC 3OQSA 1UPKA 2X19B 2DB0A 1M8ZA 3GS3A 5EKFA 3OUXA 1WA5B 4I2ZA 1LUJA 4R10A 5H2WA 3K64A 2YJYA 4RXHB 5BZ5A 4WV6A
chains in the Genus database with same CATH superfamily
3WOYA 4ADYA 4UQIA 5KLRB 1UKLA 2IW3A 4CRUB 3TPOA 1UPLA 4GMNA 5E6QB 2JKRA 4P6ZB 4EV9A 4I5NA 5BZVA 4V3OA 2QMRA 2Z5MA 4I3NA 5CL9A 4BPLA 1EE5A 3KNDA 2BKUB 4I7IA 4CB8A 3SLAA 3OUWA 4U5NA 2BNXA 2NPPB 4CB9A 4CRVB 2JAKA 5CLBA 5KLTB 2VGLA 4B8OA 4V3RA 3QMLC 4BQKA 4RZPA 2IAEB 1W9CA 2XOAA 4MFUA 3GNIA 4K92A 4FP7A 4YJEA 3FGAB 5B56A 4HXTA 3EBBA 3W3UA 3O2QA 4B8PA 3AU3A 4H3KA 3Q0QA 2NPPA 3BVSA 4L4HA 4OIHA 3T8SA 3NMWA 2IAEA 3GRLA 3FGAA 3IFQA 2F31A 3K49A 4IMJA 1O6OA 2NYMB 3K62A 4ZDUA 4PVZA 5AEIA 5CLDA 3ODSA 4PLSA 4YGXA 4OO6A 1O6PA 1Q1TC 5CLEA 4P6ZG 4DB8A 2RU4A 3ZHPA 2QNAA 3JY1A 3UVUA 5KLAA 2OT8A 3OBVA 5BZUA 3C2GA 3TJ3A 1BK5A 2NYMA 4YJLA 4IMIA 1XQRA 1BK6A 1EJLI 1QGRA 3VLEA 3UKYB 2JKTA 3EG5B 5SVZA 2JKRB 3WOZA 1IB2A 4CT7B 1PJNB 1PJMB 3UL1B 3WPTA 2C1MA 4B8JA 3Q0NA 3BX3A 1IQ1C 1JPWA 4UWXA 2OF3A 3GQ2A 2XA7A 1V18A 3L6YA 1W63B 3ZINA 3LTJA 3TX7A 4HTVA 5CLAA 3Q0PA 4TNMA 2PKGA 1XM9A 1I7WA 4I1EA 3UKXB 1OYZA 3LTMA 4L4IA 1HO8A 3GB8A 3UKWB 4D4EA 2WTKA 4DZSA 4R11A 4V3QA 3ZIKA 1EE4A 1UN0A 4FFBC 2VGLB 3BSBA 5JJAA 3SL9A 1GCJA 1WA5C 4FZAA 5CL4A 4R0ZA 3VE6A 3BSXA 4CBAA 5HUWC 1W63A 5CL6A 2X1GF 5EWPA 3UL0B 3QGBA 3ZILA 3ZKVA 3O2SA 3TPMA 4JW3C 1Z2CB 4DB9A 2BCTA 5BYMA 4I2WA 1M8XA 2QK1A 3GVOA 3C5WA 3PSTA 3L3FX 4FZDA 5HHGE 4U58A 4UAEA 1JPPA 3VLDA 1IALA 4EVPA 3ZIPA 3L6XA 3Q0LA 4HNMA 1T08A 1TH1A 5SW9A 3K4EA 3JXZA 4FDDA 4E4VA 2QK2A 2Z5JA 2RU4B 4KZGA 1G3JA 4CT6B 4DJSA 5KL1A 4PLQA 4B18A 3QG9A 5KUBA 2JKTB 2P8QA 3LWWA 3WYFC 4UADA 3EA5B 2IWHA 3NMZA 3OPBA 3C2HA 4DVGB 3O4XA 5J3VA 2XA7B 4NEEA 1Y2AC 2NYLB 3QHEA 4QMIA 3V6YA 4DB6A 2H4MA 4I2SA 4I5LA 3Q0RA 4U5UA 4I8MA 4MZ5E 1M8YA 3L3QA 3O2TA 3K5QA 3RZ9A 3BCTA 1I7XA 1QZ7A 3ODRA 3BWTA 4JW2B 3ZIQA 4EV8A 3BTRC 4U2XD 2Z5NA 2Q5DA 3QGCA 4U54A 1M5NS 3V71A 3K7WA 4Y5JA 2NYLA 4QMHA 2YNRA 3UJ0A 3DW8A 1M1EA 3H3DX 5EKGA 4HM9A 4EVTA 1M8WA 5SWFA 3VLFA 5CLCA 5FC8E 3Q0OA 4A3VA 3FEXC 5D5KC 3DADA 3V74A 4UAFB 4I96A 4DBAA 4GMOA 2IE4A 1IBRB 4O27A 4JW2A 4FQ3A 2JDQA 1U6GC 5CTTA 3NMXA 4FZFA 2BAPA 3TJZB 2GL7A 4MFVA 3GVTA 1JDHA 3FEYC 4U5LA 5HUYC 5CL5A 3ZIRA 2Z6HA 2C1TA 3Q0SA 1LRVA 2Z5KA 3RZXA 3IBVA 3BX2A 5K9SA 4D49A 4I6IA 1F59A 1B3UA 5K6SA 2IE3A 4CV5B 4JLQA 1EJYI 4YK6A 2IX3A 4U5VA 1LSHA 4A0CA 5BZ1A 2Z6GA 2Z5OA 3A6PA 1Q1SC 3K61A 1QBKB 4G3AA 4YI0C 3UKZB 4EVAA 3K5ZA 4PLRA 2FV2A 5LSWA 3Q0MA 4U5SA 3ND2A 2PF4A 4LACA 3PSPA 1QGKA 1TE4A 1N4KA 3VWAA 3K5YA 4K6JA 3UJ4A 4MZ6E 4XZRB 4BA3A 3NOWA 5CL3A 3JX7A 3K7VA 2YNSA 4L7MA 3TT9A 3ZIOA 5H2XA 2W3CA 4NZWA 3JXYA 5CL7A 1XQSA 4QMJA 3T7UA 4I0YA 5KL8A 3Q5UA 4U5OA 5DN7A 4RV1A 4UQIB 4H3HA 3GAEA 4U3JC 5CL8A 3OQSA 1UPKA 2X19B 4JKQA 2DB0A 1M8ZA 3GS3A 5EKFA 3OUXA 1WA5B 4I2ZA 1LUJA 4R10A 5H2WA 3K64A 2YJYA 4RXHB 5BZ5A 4A3TA 4I37A 4WV6A
chains in the Genus database with same CATH topology
3WOYA 4ADYA 4UQIA 5KLRB 1UKLA 2IW3A 4CRUB 3TPOA 1UPLA 4GMNA 5E6QB 2JKRA 4P6ZB 4EV9A 4I5NA 5BZVA 4V3OA 2QMRA 2Z5MA 4I3NA 5CL9A 4BPLA 1EE5A 3KNDA 2BKUB 4I7IA 4CB8A 3SLAA 3OUWA 4U5NA 2BNXA 2NPPB 4CB9A 4CRVB 2JAKA 5CLBA 5KLTB 2VGLA 4B8OA 4V3RA 3QMLC 4BQKA 4RZPA 2IAEB 1W9CA 2XOAA 4MFUA 3GNIA 4K92A 4FP7A 4YJEA 3FGAB 5B56A 4HXTA 3EBBA 3W3UA 3O2QA 4B8PA 3AU3A 4H3KA 3Q0QA 2NPPA 3BVSA 4L4HA 4OIHA 3NMWA 2IAEA 3GRLA 3FGAA 3IFQA 2F31A 3K49A 4IMJA 1O6OA 2NYMB 3K62A 4ZDUA 4PVZA 5AEIA 5CLDA 3ODSA 4PLSA 4YGXA 4OO6A 1O6PA 1Q1TC 5CLEA 4P6ZG 4DB8A 2RU4A 3ZHPA 2QNAA 3JY1A 3UVUA 5KLAA 2OT8A 3OBVA 5BZUA 3C2GA 3TJ3A 1BK5A 2NYMA 4YJLA 4IMIA 1XQRA 1BK6A 1EJLI 1QGRA 3VLEA 3UKYB 2JKTA 3EG5B 5SVZA 2JKRB 3WOZA 1IB2A 4CT7B 1PJNB 1PJMB 3UL1B 3WPTA 2C1MA 4B8JA 3Q0NA 3BX3A 1IQ1C 1JPWA 4UWXA 2OF3A 3GQ2A 2XA7A 1V18A 3L6YA 1W63B 3ZINA 3LTJA 3TX7A 4HTVA 5CLAA 3Q0PA 4TNMA 2PKGA 1XM9A 1I7WA 4I1EA 3UKXB 1OYZA 3LTMA 4L4IA 1HO8A 3GB8A 3UKWB 4D4EA 2WTKA 4DZSA 4R11A 4V3QA 3ZIKA 1EE4A 1UN0A 4FFBC 2VGLB 3BSBA 5JJAA 3SL9A 1GCJA 1WA5C 4FZAA 5CL4A 4R0ZA 3VE6A 3BSXA 4CBAA 5HUWC 1W63A 5CL6A 2X1GF 5EWPA 3UL0B 3QGBA 3ZILA 3ZKVA 3O2SA 3TPMA 4JW3C 1Z2CB 4DB9A 2BCTA 5BYMA 4I2WA 1M8XA 2QK1A 3GVOA 3C5WA 3PSTA 3L3FX 4FZDA 5HHGE 4U58A 4UAEA 1JPPA 3VLDA 1IALA 4EVPA 3ZIPA 3L6XA 3Q0LA 4HNMA 1T08A 1TH1A 5SW9A 3K4EA 3JXZA 4FDDA 4E4VA 2QK2A 2Z5JA 2RU4B 4KZGA 1G3JA 4CT6B 4DJSA 5KL1A 4PLQA 4B18A 3QG9A 5KUBA 2JKTB 2P8QA 3LWWA 3WYFC 4UADA 3EA5B 2IWHA 3NMZA 3OPBA 3C2HA 4DVGB 3O4XA 5J3VA 2XA7B 4NEEA 1Y2AC 2NYLB 3QHEA 4QMIA 3V6YA 4DB6A 2H4MA 4I2SA 4I5LA 3Q0RA 4U5UA 4I8MA 4MZ5E 1M8YA 3L3QA 3O2TA 3K5QA 3RZ9A 3BCTA 1I7XA 1QZ7A 3ODRA 3BWTA 4JW2B 3ZIQA 4EV8A 3BTRC 4U2XD 2Z5NA 2Q5DA 3QGCA 4U54A 1M5NS 3V71A 3K7WA 4Y5JA 2NYLA 4QMHA 2YNRA 3DW8A 1M1EA 3H3DX 5EKGA 4HM9A 4EVTA 1M8WA 5SWFA 3VLFA 5CLCA 5FC8E 3Q0OA 4A3VA 3FEXC 5D5KC 3DADA 3V74A 4UAFB 4I96A 4DBAA 4GMOA 2IE4A 1IBRB 4O27A 4JW2A 4FQ3A 2JDQA 1U6GC 5CTTA 3NMXA 4FZFA 2BAPA 3TJZB 2GL7A 4MFVA 3GVTA 1JDHA 3FEYC 4U5LA 5HUYC 5CL5A 3ZIRA 2Z6HA 2C1TA 3Q0SA 1LRVA 2Z5KA 3RZXA 3IBVA 3BX2A 5K9SA 4D49A 4I6IA 1F59A 1B3UA 5K6SA 2IE3A 4CV5B 4JLQA 1EJYI 4YK6A 2IX3A 4U5VA 4A0CA 5BZ1A 2Z6GA 2Z5OA 3A6PA 1Q1SC 3K61A 1QBKB 4G3AA 4YI0C 3UKZB 4EVAA 3K5ZA 4PLRA 2FV2A 5LSWA 3Q0MA 4U5SA 3ND2A 2PF4A 4LACA 3PSPA 1QGKA 1TE4A 3VWAA 3K5YA 4K6JA 4MZ6E 4XZRB 4BA3A 3NOWA 5CL3A 3JX7A 3K7VA 2YNSA 4L7MA 3TT9A 3ZIOA 5H2XA 2W3CA 4NZWA 3JXYA 5CL7A 1XQSA 4QMJA 3T7UA 4I0YA 5KL8A 3Q5UA 4U5OA 5DN7A 4RV1A 4UQIB 4H3HA 3GAEA 4U3JC 5CL8A 3OQSA 1UPKA 2X19B 4JKQA 2DB0A 1M8ZA 3GS3A 5EKFA 3OUXA 1WA5B 4I2ZA 1LUJA 4R10A 5H2WA 3K64A 2YJYA 4RXHB 5BZ5A 4A3TA 4I37A 4WV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOY A;  4ADY A;  4UQI A;  5KLR B;  1UKL A;  2IW3 A;  4CRU B;  3TPO A;  1UPL A;  4GMN A;  5E6Q B;  2JKR A;  4P6Z B;  4EV9 A;  4I5N A;  5BZV A;  4V3O A;  2QMR A;  2Z5M A;  4BPL A;  1EE5 A;  3KND A;  2BKU B;  4CB8 A;  3OUW A;  4U5N A;  2BNX A;  2NPP B;  4CB9 A;  4CRV B;  2JAK A;  5KLT B;  2VGL A;  4B8O A;  4V3R A;  3QML C;  4BQK A;  4RZP A;  2IAE B;  1W9C A;  4MFU A;  3GNI A;  4K92 A;  4YJE A;  3FGA B;  5B56 A;  4HXT A;  3EBB A;  3W3U A;  3O2Q A;  4B8P A;  3AU3 A;  4H3K A;  3Q0Q A;  2NPP A;  4OIH A;  3NMW A;  2IAE A;  3GRL A;  3FGA A;  3IFQ A;  2F31 A;  3K49 A;  4IMJ A;  1O6O A;  2NYM B;  3K62 A;  4ZDU A;  4PVZ A;  5AEI A;  3ODS A;  4PLS A;  4YGX A;  4OO6 A;  1O6P A;  1Q1T C;  4P6Z G;  4DB8 A;  2RU4 A;  3ZHP A;  2QNA A;  3UVU A;  5KLA A;  2OT8 A;  3OBV A;  5BZU A;  3C2G A;  3TJ3 A;  1BK5 A;  2NYM A;  4YJL A;  4IMI A;  1XQR A;  1BK6 A;  1EJL I;  1QGR A;  3UKY B;  2JKT A;  3EG5 B;  5SVZ A;  2JKR B;  3WOZ A;  1IB2 A;  4CT7 B;  1PJN B;  1PJM B;  3UL1 B;  3WPT A;  2C1M A;  4B8J A;  3Q0N A;  3BX3 A;  1IQ1 C;  1JPW A;  4UWX A;  2OF3 A;  3GQ2 A;  2XA7 A;  1V18 A;  3L6Y A;  1W63 B;  3ZIN A;  3LTJ A;  3TX7 A;  4HTV A;  3Q0P A;  4TNM A;  2PKG A;  1XM9 A;  1I7W A;  3UKX B;  1OYZ A;  3LTM A;  1HO8 A;  3GB8 A;  3UKW B;  4D4E A;  2WTK A;  4DZS A;  4R11 A;  4V3Q A;  1EE4 A;  1UN0 A;  4FFB C;  2VGL B;  3BSB A;  5JJA A;  1GCJ A;  1WA5 C;  4FZA A;  4R0Z A;  3VE6 A;  3BSX A;  4CBA A;  5HUW C;  1W63 A;  2X1G F;  5EWP A;  3UL0 B;  3QGB A;  3ZKV A;  3O2S A;  3TPM A;  1Z2C B;  4DB9 A;  2BCT A;  5BYM A;  4I2W A;  1M8X A;  2QK1 A;  3GVO A;  3C5W A;  3PST A;  3L3F X;  4FZD A;  5HHG E;  4U58 A;  4UAE A;  1JPP A;  1IAL A;  4EVP A;  3ZIP A;  3L6X A;  3Q0L A;  4HNM A;  1T08 A;  1TH1 A;  5SW9 A;  3K4E A;  4FDD A;  4E4V A;  2QK2 A;  2Z5J A;  2RU4 B;  4KZG A;  1G3J A;  4CT6 B;  4DJS A;  5KL1 A;  4PLQ A;  4B18 A;  3QG9 A;  2JKT B;  2P8Q A;  3LWW A;  3WYF C;  4UAD A;  3EA5 B;  2IWH A;  3NMZ A;  3OPB A;  3C2H A;  4DVG B;  3O4X A;  5J3V A;  2XA7 B;  4NEE A;  1Y2A C;  2NYL B;  3QHE A;  4QMI A;  3V6Y A;  4DB6 A;  2H4M A;  4I5L A;  3Q0R A;  4U5U A;  4MZ5 E;  1M8Y A;  3L3Q A;  3O2T A;  3K5Q A;  3RZ9 A;  3BCT A;  1I7X A;  1QZ7 A;  3ODR A;  3BWT A;  4JW2 B;  3ZIQ A;  4EV8 A;  3BTR C;  2Z5N A;  2Q5D A;  3QGC A;  4U54 A;  1M5N S;  3V71 A;  3K7W A;  4Y5J A;  2NYL A;  4QMH A;  2YNR A;  3DW8 A;  1M1E A;  3H3D X;  5EKG A;  4HM9 A;  4EVT A;  1M8W A;  5SWF A;  5FC8 E;  3Q0O A;  3FEX C;  5D5K C;  3DAD A;  3V74 A;  4UAF B;  4DBA A;  4GMO A;  2IE4 A;  1IBR B;  4O27 A;  4FQ3 A;  2JDQ A;  1U6G C;  5CTT A;  3NMX A;  4FZF A;  2BAP A;  3TJZ B;  2GL7 A;  4MFV A;  3GVT A;  1JDH A;  3FEY C;  4U5L A;  5HUY C;  3ZIR A;  2Z6H A;  2C1T A;  3Q0S A;  1LRV A;  2Z5K A;  3RZX A;  3IBV A;  3BX2 A;  5K9S A;  4D49 A;  1F59 A;  1B3U A;  5K6S A;  2IE3 A;  4CV5 B;  4JLQ A;  1EJY I;  4YK6 A;  2IX3 A;  4U5V A;  4A0C A;  5BZ1 A;  2Z6G A;  2Z5O A;  3A6P A;  1Q1S C;  3K61 A;  1QBK B;  4G3A A;  4YI0 C;  3UKZ B;  4EVA A;  3K5Z A;  4PLR A;  2FV2 A;  5LSW A;  3Q0M A;  4U5S A;  3ND2 A;  2PF4 A;  4LAC A;  3PSP A;  1QGK A;  3VWA A;  3K5Y A;  4K6J A;  4MZ6 E;  4XZR B;  4BA3 A;  3NOW A;  3K7V A;  2YNS A;  4L7M A;  3TT9 A;  3ZIO A;  5H2X A;  2W3C A;  4NZW A;  1XQS A;  4QMJ A;  3T7U A;  5KL8 A;  3Q5U A;  4U5O A;  5DN7 A;  4RV1 A;  4UQI B;  4H3H A;  3GAE A;  4U3J C;  3OQS A;  1UPK A;  2X19 B;  2DB0 A;  1M8Z A;  3GS3 A;  5EKF A;  3OUX A;  1WA5 B;  4I2Z A;  1LUJ A;  4R10 A;  5H2W A;  3K64 A;  2YJY A;  4RXH B;  5BZ5 A;  4WV6 A; 
#chains in the Genus database with same CATH topology
 3WOY A;  4ADY A;  4UQI A;  5KLR B;  1UKL A;  2IW3 A;  4CRU B;  3TPO A;  1UPL A;  4GMN A;  5E6Q B;  2JKR A;  4P6Z B;  4EV9 A;  4I5N A;  5BZV A;  4V3O A;  2QMR A;  2Z5M A;  4I3N A;  5CL9 A;  4BPL A;  1EE5 A;  3KND A;  2BKU B;  4I7I A;  4CB8 A;  3SLA A;  3OUW A;  4U5N A;  2BNX A;  2NPP B;  4CB9 A;  4CRV B;  2JAK A;  5CLB A;  5KLT B;  2VGL A;  4B8O A;  4V3R A;  3QML C;  4BQK A;  4RZP A;  2IAE B;  1W9C A;  2XOA A;  4MFU A;  3GNI A;  4K92 A;  4FP7 A;  4YJE A;  3FGA B;  5B56 A;  4HXT A;  3EBB A;  3W3U A;  3O2Q A;  4B8P A;  3AU3 A;  4H3K A;  3Q0Q A;  2NPP A;  3BVS A;  4L4H A;  4OIH A;  3T8S A;  3NMW A;  2IAE A;  3GRL A;  3FGA A;  3IFQ A;  2F31 A;  3K49 A;  4IMJ A;  1O6O A;  2NYM B;  3K62 A;  4ZDU A;  4PVZ A;  5AEI A;  5CLD A;  3ODS A;  4PLS A;  4YGX A;  4OO6 A;  1O6P A;  1Q1T C;  5CLE A;  4P6Z G;  4DB8 A;  2RU4 A;  3ZHP A;  2QNA A;  3JY1 A;  3UVU A;  5KLA A;  2OT8 A;  3OBV A;  5BZU A;  3C2G A;  3TJ3 A;  1BK5 A;  2NYM A;  4YJL A;  4IMI A;  1XQR A;  1BK6 A;  1EJL I;  1QGR A;  3VLE A;  3UKY B;  2JKT A;  3EG5 B;  5SVZ A;  2JKR B;  3WOZ A;  1IB2 A;  4CT7 B;  1PJN B;  1PJM B;  3UL1 B;  3WPT A;  2C1M A;  4B8J A;  3Q0N A;  3BX3 A;  1IQ1 C;  1JPW A;  4UWX A;  2OF3 A;  3GQ2 A;  2XA7 A;  1V18 A;  3L6Y A;  1W63 B;  3ZIN A;  3LTJ A;  3TX7 A;  4HTV A;  5CLA A;  3Q0P A;  4TNM A;  2PKG A;  1XM9 A;  1I7W A;  4I1E A;  3UKX B;  1OYZ A;  3LTM A;  4L4I A;  1HO8 A;  3GB8 A;  3UKW B;  4D4E A;  2WTK A;  4DZS A;  4R11 A;  4V3Q A;  3ZIK A;  1EE4 A;  1UN0 A;  4FFB C;  2VGL B;  3BSB A;  5JJA A;  3SL9 A;  1GCJ A;  1WA5 C;  4FZA A;  5CL4 A;  4R0Z A;  3VE6 A;  3BSX A;  4CBA A;  5HUW C;  1W63 A;  5CL6 A;  2X1G F;  5EWP A;  3UL0 B;  3QGB A;  3ZIL A;  3ZKV A;  3O2S A;  3TPM A;  4JW3 C;  1Z2C B;  4DB9 A;  2BCT A;  5BYM A;  4I2W A;  1M8X A;  2QK1 A;  3GVO A;  3C5W A;  3PST A;  3L3F X;  4FZD A;  5HHG E;  4U58 A;  4UAE A;  1JPP A;  3VLD A;  1IAL A;  4EVP A;  3ZIP A;  3L6X A;  3Q0L A;  4HNM A;  1T08 A;  1TH1 A;  5SW9 A;  3K4E A;  3JXZ A;  4FDD A;  4E4V A;  2QK2 A;  2Z5J A;  2RU4 B;  4KZG A;  1G3J A;  4CT6 B;  4DJS A;  5KL1 A;  4PLQ A;  4B18 A;  3QG9 A;  5KUB A;  2JKT B;  2P8Q A;  3LWW A;  3WYF C;  4UAD A;  3EA5 B;  2IWH A;  3NMZ A;  3OPB A;  3C2H A;  4DVG B;  3O4X A;  5J3V A;  2XA7 B;  4NEE A;  1Y2A C;  2NYL B;  3QHE A;  4QMI A;  3V6Y A;  4DB6 A;  2H4M A;  4I2S A;  4I5L A;  3Q0R A;  4U5U A;  4I8M A;  4MZ5 E;  1M8Y A;  3L3Q A;  3O2T A;  3K5Q A;  3RZ9 A;  3BCT A;  1I7X A;  1QZ7 A;  3ODR A;  3BWT A;  4JW2 B;  3ZIQ A;  4EV8 A;  3BTR C;  4U2X D;  2Z5N A;  2Q5D A;  3QGC A;  4U54 A;  1M5N S;  3V71 A;  3K7W A;  4Y5J A;  2NYL A;  4QMH A;  2YNR A;  3UJ0 A;  3DW8 A;  1M1E A;  3H3D X;  5EKG A;  4HM9 A;  4EVT A;  1M8W A;  5SWF A;  3VLF A;  5CLC A;  5FC8 E;  3Q0O A;  4A3V A;  3FEX C;  5D5K C;  3DAD A;  3V74 A;  4UAF B;  4I96 A;  4DBA A;  4GMO A;  2IE4 A;  1IBR B;  4O27 A;  4JW2 A;  4FQ3 A;  2JDQ A;  1U6G C;  5CTT A;  3NMX A;  4FZF A;  2BAP A;  3TJZ B;  2GL7 A;  4MFV A;  3GVT A;  1JDH A;  3FEY C;  4U5L A;  5HUY C;  5CL5 A;  3ZIR A;  2Z6H A;  2C1T A;  3Q0S A;  1LRV A;  2Z5K A;  3RZX A;  3IBV A;  3BX2 A;  5K9S A;  4D49 A;  4I6I A;  1F59 A;  1B3U A;  5K6S A;  2IE3 A;  4CV5 B;  4JLQ A;  1EJY I;  4YK6 A;  2IX3 A;  4U5V A;  1LSH A;  4A0C A;  5BZ1 A;  2Z6G A;  2Z5O A;  3A6P A;  1Q1S C;  3K61 A;  1QBK B;  4G3A A;  4YI0 C;  3UKZ B;  4EVA A;  3K5Z A;  4PLR A;  2FV2 A;  5LSW A;  3Q0M A;  4U5S A;  3ND2 A;  2PF4 A;  4LAC A;  3PSP A;  1QGK A;  1TE4 A;  1N4K A;  3VWA A;  3K5Y A;  4K6J A;  3UJ4 A;  4MZ6 E;  4XZR B;  4BA3 A;  3NOW A;  5CL3 A;  3JX7 A;  3K7V A;  2YNS A;  4L7M A;  3TT9 A;  3ZIO A;  5H2X A;  2W3C A;  4NZW A;  3JXY A;  5CL7 A;  1XQS A;  4QMJ A;  3T7U A;  4I0Y A;  5KL8 A;  3Q5U A;  4U5O A;  5DN7 A;  4RV1 A;  4UQI B;  4H3H A;  3GAE A;  4U3J C;  5CL8 A;  3OQS A;  1UPK A;  2X19 B;  4JKQ A;  2DB0 A;  1M8Z A;  3GS3 A;  5EKF A;  3OUX A;  1WA5 B;  4I2Z A;  1LUJ A;  4R10 A;  5H2W A;  3K64 A;  2YJY A;  4RXH B;  5BZ5 A;  4A3T A;  4I37 A;  4WV6 A; 
#chains in the Genus database with same CATH homology
 3WOY A;  4ADY A;  4UQI A;  5KLR B;  1UKL A;  2IW3 A;  4CRU B;  3TPO A;  1UPL A;  4GMN A;  5E6Q B;  2JKR A;  4P6Z B;  4EV9 A;  4I5N A;  5BZV A;  4V3O A;  2QMR A;  2Z5M A;  4I3N A;  5CL9 A;  4BPL A;  1EE5 A;  3KND A;  2BKU B;  4I7I A;  4CB8 A;  3SLA A;  3OUW A;  4U5N A;  2BNX A;  2NPP B;  4CB9 A;  4CRV B;  2JAK A;  5CLB A;  5KLT B;  2VGL A;  4B8O A;  4V3R A;  3QML C;  4BQK A;  4RZP A;  2IAE B;  1W9C A;  2XOA A;  4MFU A;  3GNI A;  4K92 A;  4FP7 A;  4YJE A;  3FGA B;  5B56 A;  4HXT A;  3EBB A;  3W3U A;  3O2Q A;  4B8P A;  3AU3 A;  4H3K A;  3Q0Q A;  2NPP A;  3BVS A;  4L4H A;  4OIH A;  3NMW A;  2IAE A;  3GRL A;  3FGA A;  3IFQ A;  2F31 A;  3K49 A;  4IMJ A;  1O6O A;  2NYM B;  3K62 A;  4ZDU A;  4PVZ A;  5AEI A;  5CLD A;  3ODS A;  4PLS A;  4YGX A;  4OO6 A;  1O6P A;  1Q1T C;  5CLE A;  4P6Z G;  4DB8 A;  2RU4 A;  3ZHP A;  2QNA A;  3JY1 A;  3UVU A;  5KLA A;  2OT8 A;  3OBV A;  5BZU A;  3C2G A;  3TJ3 A;  1BK5 A;  2NYM A;  4YJL A;  4IMI A;  1XQR A;  1BK6 A;  1EJL I;  1QGR A;  3VLE A;  3UKY B;  2JKT A;  3EG5 B;  5SVZ A;  2JKR B;  3WOZ A;  1IB2 A;  4CT7 B;  1PJN B;  1PJM B;  3UL1 B;  3WPT A;  2C1M A;  4B8J A;  3Q0N A;  3BX3 A;  1IQ1 C;  1JPW A;  4UWX A;  2OF3 A;  3GQ2 A;  2XA7 A;  1V18 A;  3L6Y A;  1W63 B;  3ZIN A;  3LTJ A;  3TX7 A;  4HTV A;  5CLA A;  3Q0P A;  4TNM A;  2PKG A;  1XM9 A;  1I7W A;  4I1E A;  3UKX B;  1OYZ A;  3LTM A;  4L4I A;  1HO8 A;  3GB8 A;  3UKW B;  4D4E A;  2WTK A;  4DZS A;  4R11 A;  4V3Q A;  3ZIK A;  1EE4 A;  1UN0 A;  4FFB C;  2VGL B;  3BSB A;  5JJA A;  3SL9 A;  1GCJ A;  1WA5 C;  4FZA A;  5CL4 A;  4R0Z A;  3VE6 A;  3BSX A;  4CBA A;  5HUW C;  1W63 A;  5CL6 A;  2X1G F;  5EWP A;  3UL0 B;  3QGB A;  3ZIL A;  3ZKV A;  3O2S A;  3TPM A;  4JW3 C;  1Z2C B;  4DB9 A;  2BCT A;  5BYM A;  4I2W A;  1M8X A;  2QK1 A;  3GVO A;  3C5W A;  3PST A;  3L3F X;  4FZD A;  5HHG E;  4U58 A;  4UAE A;  1JPP A;  3VLD A;  1IAL A;  4EVP A;  3ZIP A;  3L6X A;  3Q0L A;  4HNM A;  1T08 A;  1TH1 A;  5SW9 A;  3K4E A;  3JXZ A;  4FDD A;  4E4V A;  2QK2 A;  2Z5J A;  2RU4 B;  4KZG A;  1G3J A;  4CT6 B;  4DJS A;  5KL1 A;  4PLQ A;  4B18 A;  3QG9 A;  5KUB A;  2JKT B;  2P8Q A;  3LWW A;  3WYF C;  4UAD A;  3EA5 B;  2IWH A;  3NMZ A;  3OPB A;  3C2H A;  4DVG B;  3O4X A;  5J3V A;  2XA7 B;  4NEE A;  1Y2A C;  2NYL B;  3QHE A;  4QMI A;  3V6Y A;  4DB6 A;  2H4M A;  4I2S A;  4I5L A;  3Q0R A;  4U5U A;  4I8M A;  4MZ5 E;  1M8Y A;  3L3Q A;  3O2T A;  3K5Q A;  3RZ9 A;  3BCT A;  1I7X A;  1QZ7 A;  3ODR A;  3BWT A;  4JW2 B;  3ZIQ A;  4EV8 A;  3BTR C;  4U2X D;  2Z5N A;  2Q5D A;  3QGC A;  4U54 A;  1M5N S;  3V71 A;  3K7W A;  4Y5J A;  2NYL A;  4QMH A;  2YNR A;  3DW8 A;  1M1E A;  3H3D X;  5EKG A;  4HM9 A;  4EVT A;  1M8W A;  5SWF A;  3VLF A;  5CLC A;  5FC8 E;  3Q0O A;  4A3V A;  3FEX C;  5D5K C;  3DAD A;  3V74 A;  4UAF B;  4I96 A;  4DBA A;  4GMO A;  2IE4 A;  1IBR B;  4O27 A;  4JW2 A;  4FQ3 A;  2JDQ A;  1U6G C;  5CTT A;  3NMX A;  4FZF A;  2BAP A;  3TJZ B;  2GL7 A;  4MFV A;  3GVT A;  1JDH A;  3FEY C;  4U5L A;  5HUY C;  5CL5 A;  3ZIR A;  2Z6H A;  2C1T A;  3Q0S A;  1LRV A;  2Z5K A;  3RZX A;  3IBV A;  3BX2 A;  5K9S A;  4D49 A;  4I6I A;  1F59 A;  1B3U A;  5K6S A;  2IE3 A;  4CV5 B;  4JLQ A;  1EJY I;  4YK6 A;  2IX3 A;  4U5V A;  4A0C A;  5BZ1 A;  2Z6G A;  2Z5O A;  3A6P A;  1Q1S C;  3K61 A;  1QBK B;  4G3A A;  4YI0 C;  3UKZ B;  4EVA A;  3K5Z A;  4PLR A;  2FV2 A;  5LSW A;  3Q0M A;  4U5S A;  3ND2 A;  2PF4 A;  4LAC A;  3PSP A;  1QGK A;  1TE4 A;  3VWA A;  3K5Y A;  4K6J A;  4MZ6 E;  4XZR B;  4BA3 A;  3NOW A;  5CL3 A;  3JX7 A;  3K7V A;  2YNS A;  4L7M A;  3TT9 A;  3ZIO A;  5H2X A;  2W3C A;  4NZW A;  3JXY A;  5CL7 A;  1XQS A;  4QMJ A;  3T7U A;  4I0Y A;  5KL8 A;  3Q5U A;  4U5O A;  5DN7 A;  4RV1 A;  4UQI B;  4H3H A;  3GAE A;  4U3J C;  5CL8 A;  3OQS A;  1UPK A;  2X19 B;  4JKQ A;  2DB0 A;  1M8Z A;  3GS3 A;  5EKF A;  3OUX A;  1WA5 B;  4I2Z A;  1LUJ A;  4R10 A;  5H2W A;  3K64 A;  2YJY A;  4RXH B;  5BZ5 A;  4A3T A;  4I37 A;  4WV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...