1WASA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL ASPARTATE RECEPTOR
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 51
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1wasA00
4Z9IA 2LIGA 4Z9HA 1VLTA 2D4UA 1VLSA 3ATPA 4Z9JA 1WATA 1JMWA 4H54A 2ASRA 1WASA 3T9OA 1LIHA
chains in the Genus database with same CATH superfamily
2WZGA 1TWHA 2GFHA 4DOZA 4JEBA 1U6HA 2VCBA 2IXNA 3TK0A 1JRAA 3JYHA 2W9YA 4XLNF 1NSGB 2YZSA 1WN0A 3PHF2 1GM5A 1IZMA 3DMDA 1B68A 3DI5A 2IYLD 2RSEB 3EH1A 3M15A 2IBFA 3AQBA 3VF0A 1NU7D 3JRMO 4HFFB 4LLEA 4AE4A 3AGTA 5JSLA 1D1AA 1OCOC 4HE8D 1M6TA 1CGME 2PX0A 3JCUQ 1LM3B 1TKNA 4NC3A 3PCVA 4XPXA 3RVYA 1TWAA 4ZLDA 3GWNA 4IJJA 4LDKA 3K1HA 2AWCA 4AK9A 1UFBA 2R7OA 3SXZA 4E0IA 4EHPA 2G3VA 1VK5A 3RF3A 4G0HA 3DE9A 4U5CE 1CGOA 4CS8C 4LERA 3TQOA 1M2VB 3NG1A 4P9FA 2WZFA 2HMZA 4MVZA 5CI8A 3NDBB 2HSQA 2WVOA 4M63A 2R7TA 2HJ3A 2I8BA 3OEOA 5COFA 1GGQA 3S28A 2JX0A 2OG2A 3TOLA 3CAXA 3AG3C 1F1MA 2XM0A 4YN0B 3LEVA 2PF4E 4C3EA 1U0BB 2NPUA 5COMA 4YT4A 4C7OA 2R05A 5JLIA 2EPMX 1OQCA 1ZHZA 2XLDA 5IY5C 1ST6A 3S9OA 4C7OB 1RXQA 2R7UA 3K1IA 1LI5A 2A6EF 4E7SA 2YRFA 3DJNB 4IAQA 3HKKA 3ZSUA 2J9UA 4DJ9A 2FAPB 5CIVA 5KYWB 4R32A 4YT5A 2OU6A 2YLDA 1FFTC 1TQGA 3JRTA 1H9GA 4IB4A 4IRUA 4ULWA 5JP7A 1NBBA 2OEVA 5JT4A 4O79A 2J46A 4IARA 4BJ5C 4CS9C 2NSFA 4JZAA 1Q0FA 4PFOA 3ZIBA 3C8ZA 4MNDA 1XZQA 2LCHA 4NCQA 1WTYA 5HSWA 3EGXB 3CQZA 4JTCB 4MVQA 2KSFA 4MTOA 2P0NA 2XS8A 4XEFA 4G7ZF 2Y3BA 3B29A 2LFFA 4WJ0A 1RKEB 5B3SC 5E3AA 4F4BA 2H7OA 1A7DA 4YT2A 1LKXA 4PR9A 3DAGA 3RYLA 3HTKC 2WVQA 4HEAJ 3NYLA 3X2QC 4AX2A 1WOLA 2HKVA 4XEKA 3EG9A 3M4CA 1Z63A 2C04A 2R7SA 3ZQYA 3U9JA 1FR0A 2J0XA 5KYYA 1JOGA 1OKKA 2IXOA 1BZ4A 4EBBA 4AL1A 4IWBA 4OIRF 2OOCA 1J8YF 5E3CA 2KC3A 3JSEO 2WL8A 3EJNA 4RDAA 3RQGA 4DVZA 3K66A 3GEEA 2ASRA 3JZ0A 1D0ZA 3QW1A 4N4WA 3VAYA 3U5SA 2OKUA 3DM5A 3T6BA 2EPOA 3Q7GA 3L8JA 1UG7A 3LNMB 1FTSA 2EIMC 3N0TA 3NRHA 3TD7A 4B6IA 4I1MA 3C63A 3WG7C 3U3BA 1YLMA 2Y3GA 2XXAB 2YL1A 4PJLA 2CNWA 3ZWIA 4CDVA 3FOOA 4PFPA 2IOQA 2LSEA 3DM9B 4DBQA 5JRAA 2L6HA 2YEVA 2R7WA 1FAPB 1AUEA 4MVSA 2A6HF 1ZU4A 2XLMA 3SXYA 1D1CA 1ZHYA 1I5NA 3U2MA 1LE2A 2Q9BA 1JPJA 1VTMP 1QLEC 1CPRA 2J9WA 3DKAA 4PJJA 3WAQA 4GYTA 1DOWA 4E17A 5FCLA 3RH3A 4BG0A 1OW8A 2CCYA 5CI9A 1PV3A 1E86A 1Q0GA 4ANJA 1LIHA 2ZPAA 5D92A 2PBEA 4G7OF 3EH2A 3U2LA 4U5HA 2NG1A 3FAJA 3PDMP 3QZCA 1H7IA 2XLEA 2VASA 4O6YA 3W8HA 2M4EA 5K0IA 4C3BA 1ORJA 1HMDA 5T1DB 1YYJA 3T6GB 1KNYA 2DYRC 1Z6AA 2UUHA 3AG2C 1BBHA 4YJWA 2HV6A 2HV7A 2Y69C 5B1AC 2P1AA 3EHNA 5DS6A 3C7JA 4CSAC 1M2VA 3C62A 3GEHA 3OA1A 3ZQVA 4D4NA 1H9TA 2GWWA 2XM4A 3KL4A 3GORA 2VH3A 3C8GB 3POVA 3ITFA 1WWPA 4GEHA 1VLTA 4K0DA 4X0RA 3W4YA 4JIOA 5AC4A 2XLWA 4UDVA 3G4XA 3QVYA 2AU5A 5L3VA 3GWLA 256BA 4YL0A 2XS1A 3LUTB 3HNLA 4KBLA 5AGFA 3VM6A 4U5GA 3KMIA 5E33A 5DS5A 3O6XA 1VOMA 1YARO 3NMKA 1Q0MA 5KYWA 2J0WA 4DVYP 1GS9A 2R7RA 1SMYF 3DXJF 3B0UX 2AWYA 1ZHTA 4BJTA 4JKVA 4BJ6C 3N2ZB 3T9OA 2DGJA 4BPMA 3K33A 3U0CA 1IW7F 1HMOA 1VLSA 2XL4A 2R7QA 2YL3A 5KYNA 1BDJB 5EHHA 1S05A 1A0BA 4XTKA 4CIHA 2HS5A 1MNDA 3JSZA 3NKEA 4JEAA 4JURI 4BJ5A 3G50A 4CS9A 3EGXA 3TJ6A 3RW0A 3BRJA 1L7CA 1TFKB 2YWAA 4MVOA 5DS4A 1G4US 1RMVA 3E70C 1QSPA 1U89A 4HFKB 3X1OA 1RKEA 2LP4A 2J7PA 3R2PA 3K6BA 3NYJA 3R7CA 4N6HA 3C18A 1CGNA 4L6RA 3IPMO 1DOVA 1OCCC 1TR2A 3ABKC 2Q9CA 2YHSA 3MYIA 1E83A 4E0HA 5HV9A 3UMIA 3B9QA 2G3KA 2NUTB 5JVEA 2Q9AA 1MMDA 2LFDA 3DE8A 4N6CA 1EQ1A 5BQIA 3S84A 4JTDB 1ZHWA 3MX3A 2ETSA 4LDQA 2Q00A 3ZDLA 2P7VA 3L8IA 2Y39A 3I5QA 2KJGA 1LS1A 3HLZA 3OWTA 1VMAA 4K1OA 1M56C 3TJ5A 5BQHA 3KYIA 2XL8A 3L34A 4JCZA 4JTAB 4P9TA 1CPQA 1HY5A 2XXAA 4A2NB 4EBKA 1NFOA 3O10A 2EILC 4I44A 3SXKA 3TULA 4PJMA 4MVMA 4XWJA 5KYXB 3G4ZA 5KYUB 2V26A 1YVIA 2D4UA 5DVWA 4U5FE 5FZTA 3IEEA 1YAUO 2YVKA 5TJ5E 1C17M 1E2XA 4WGZA 1XZPA 1EI7A 1MNEA 1RCPA 2W4MA 3LAYA 3LESA 2QTVA 3MBGA 1LE4A 4RBNA 5JUAA 2GDCA 2QY9A 3AGUA 4NTBA 1I4ZA 2D5RB 3JT1A 2OJQA 1SF8A 4FESA 2J8WA 1NZEA 4JC7A 2LIGA 3NKDA 3JYYA 4H4KC 3I5PA 3LLKA 2A0UA 3AJMA 2H8AA 4JJFA 4AL0A 3EQLF 1K04A 1S7ZA 2QLAA 2A68F 1WGWA 1AEPA 2V3CC 2XL6A 3N24A 3O55A 3W2WA 1GQAA 3B0VC 3A9CA 1OR2A 2VCCA 3SP1A 3EFOB 4XEVA 4YL1A 3RIPA 5A6BA 3S0XA 1APCA 1FNTc 1V4AA 2XRHA 1G8XA 1K05A 1LVKA 4O7GA 4YK5A 3C8GA 4CSAA 2ZXOA 5BQGA 4CJGA 1NU9C 5L0CA 1OCRC 2HZ8A 3DAFA 4Q7CA 1YA9A 4PACA 5T3TA 3S27A 4W8KA 4KI2A 1OW6A 2YQYA 3WHNA 1T6UA 1K40A 3CSKA 5COGA 5E2QA 4FWVA 5L0IA 3UGOA 3LLIA 1G4WR 1OW7A 2KGOA 3ABLC 5D91A 3IQCA 2BC5A 5AC5A 1TWCA 3AG1C 1OXBA 2BE5F 2PNOA 4MW3A 4N06A 2KYHA 4LDRA 1TWGA 1Z7Qc 3E9VA 1YZCA 1M57C 3ECSA 2EPKX 2QE9A 4XPYA 4PJNA 1V54C 3NMJA 4U9EA 1XWJA 1E84A 3CEXA 2J9BA 3W8IA 2MWQA 3EGDB 2L81A 3RFYA 3H2UA 2P61A 2YLIA 5L0JA 4FAPB 1NG1A 3NYMA 3RQEA 3FOPA 1O5HA 4QI0A 2P6VA 3VRCA 2GA0A 4GQHA 2X0CA 1OKKD 1OXKA 3HJCA 4CJOA 4CS8A 1SR2A 2A1DD 4CBEA 2F22A 4YL3A 3T4RA 1ZYRF 1D1BA 3GM2A 1Z3IX 3ZVRA 2J9VA 3FAPB 4I1OB 3ZTMA 2GAQA 2KK1A 3M4BA 3U3FA 4MTFA 4QI2A 2ZXRA 2XSEA 3U8PA 4ER9A 4XLPF 2ICWG 2A69F 2FFHA 2L6GA 2R02A 1WATA 4YWQA 2TMVP 4J30B 1VYKA 4DRHB 1QKRA 4JW1A 2NUTA 2L7AA 1RJ9B 3GM3A 3IQTA 4KNVA 2OEXA 5L0GA 2Q7RA 2H7BA 1PCXA 2G62A 1SYQA 1OCZC 1G5ZA 1ZW2A 1HE9A 2VCAA 1VB5A 2CNWD 2Y3DA 3MYFA 2HJMA 2RD9A 3NMIA 2A0BA 2BL2A 3PMRA 5A69A 2R7VA 2MHRA 3GEIA 4CDYA 1JR8A 3FMSA 3Q6MA 3V5XA 4ZLCA 1ZHXA 3EHMA 4K7BA 1NFNA 4JRZA 4U5BE 3ATPA 4W8PA 2J45A 3UR3C 3W2VA 2EIKC 1SZIA 2E87A 5F5HA 4CDAA 3UGPA 2NUPB 1YDIA 3QVZA 1WASA 2CDQA 2JD3A 5KYXA 4G78A 3LJBA 3DJUB 5KYUA 4BJ1A 4CS7A 1Y6DA 1A41A 1V74B 4CIPA 3T6JA 1RKCA 3S90A 1LI7A 4ONSA 1D0YA 2WB7A 1JPNA 4MVRA 2ZXWC 5A6JA 2YKZA 3DWWA 1A7VA 4XQ1A 1H6GA 4U5DE 3FDQA 1OR3A 3GM1A 2Y3HA 5B1BC 2WVNA 4EBJA 4O6NA 5DQZA 5F5FA 3VYWA 2W4BA 4CX9A 3V5ZA 1ZVZA 1L3PA 3FVYA 2EPLX 3DZAA 4EIYA 4KNWA 3LS0A 4MW8A 3S29A 1Z23A 1Y4CA 1YA7O 2DB4A 3Q7LA 5A6AA 5A6KA 1ORYA 1BR1A 1ORSC 1ZU5A 2L9JA 3K7DA 4PK4A 1O3UA 1QQ3A 1QPUA 3EFOA 4NTAA 2B0HA 3O39A 3AG4C 3RQFA 3B0PA 1Q0KA 4D4XA 5B3IA 4OIQF 1J8MF 3F47A 2R9RB 3ABMC 3IQ5A 3UMKA 1T01A 2R25A 1MMGA 4MVUA 5GPGB 4E7ZA 2KW3C 4U9DA 1T6QA 3DD7A 4NQFA 1C03A 5DQTA 3KPHA 4NY3A 5KYYB 4OIPF 2VB6A 3BEHA 4QDLA 1V55C 1HE1A 2C03A 3Q6NA 3ZG1A 3QW0A 4Q5SF 4AE4B 2R7XA 4JJGA 1AVOB 3FHDA 4J7TA 3V7OA 1A7EA 1YJGA 4P6IC 1JMWA 4DRIB 2XLOA 3RKOF 5L3QA 2L6FA 3JTLO 2X51A 2IXMA 3A11A 4I3MA 3SEOA 2HUJA 1BR2A 2XLHA 3HNJA 2LD6A 3H2VA 3US6A 1E85A 1D0XA 2PFDA 3H65A 4E18A 1HW1A 4WGYA 1EA8A 4C3DA 2EPNA 2HFIA 4EWCA 1JAFA 2B0JA 2YL0A 3GODA 3EGDA 4FX5A 4JCHA 5L0HA 2J7PD 2JPUA 3L0IA 3M1CB 3IHUA 2I15A 4EKWA 2CYDA 3UNGC 1LS4A 4J32B 2HMQA 5L0FA 2XLVA 3QMKA 1C02A 4JVSA 4OD4A 4LLCA 2QUPA 3I4UA 3K1IC 3KKBA 1ZZPA 4MQ9F 1VYIA 4NTFA 2W45A 4XPWA 4YT8A 1YYXA 5BUOA 1PD1A 3J06A 1O87A 1T5OA 2Z15A 2VC9A 3KYJA 3EPVA 4EUKB 1MQVA 1M2OA 2H7VC 1I4YA 5EGYA 3MLGA 3TOMA 1QZXA 2M64A 2OCCC 3WODF 2HSBA 3ASNC 1YZAA 3UMHA 2QNLA 4MTGA 4Z9IA 1N1CA 1RJ9A 1ZW3A 2PP4A 3EZHA 4KC9A 2CGEA 1R5ID 4O6MA 5F28E 3IQ6A 2IM8A 3GANA 4OD5A 5JS5A 4G7HF 4LACB 1R4TA 1W2WA 4Z9HA 1T9KA 4OINF 2IXPA 3FXHA 1PD0A 4DBRA 4IGGA 3B71A 2KQ9A 1LPEA 2EIJC 3LS1A 2DYSC 5EK0A 3SZRA 3ZC4A 4OIOF 2MYSA 4JE9A 2LK4A 2OJED 3U8VA 4BJ6A 2OQMA 3SNHA 2Q4FA 4ULVA 1BR4A 3EZIA 3U9MA 2CW0F 4RD9A 3AOUA 2DI3A 4WABA 3CZ6A 4J7YA 1FFHA 2NUPA 1EKYA 1Q0DA 2AVKA 3EG9B 2UUIA 3SXMA 4Z9JA 1TFOB 3MFNA 1MMNA 1FMWA 3M79A 1HW2A 1FMVA 4BEMJ 2AP3A 3QTHA 4A4AA 1MMAA 3LNRA 4U5EE 3L1MA 2EINC 3HNKA 3V5YA 3RVZA 5L0DA 1Z5ZA 2O9XA 3AQCA 3ASOC 2ZXPA 1KU2A 3KH2A 4DXWA 3ZTZA 5A6BD 3LEOA 2YL7A 1NLXA 4Q4ZF 4H54A 3SYNA 4DRJB 1T6IA 4BEJA 1QVXA 2R03A 2NSGA 3C8GD 2LQGA 3HNIA 2YLGA 5T3WA 2ZD9A 4MS2A 2KNHA 5DLJA 3F46A 4IAOA 2FGYA 1KTMA 2Q3TA 2WZLA 2PX3A
chains in the Genus database with same CATH topology
4Z9IA 2LIGA 4Z9HA 1VLTA 2D4UA 1VLSA 3ATPA 4Z9JA 1WATA 1JMWA 4H54A 2ASRA 1WASA 3T9OA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9I A;  2LIG A;  4Z9H A;  1VLT A;  2D4U A;  1VLS A;  3ATP A;  4Z9J A;  1WAT A;  1JMW A;  4H54 A;  2ASR A;  1WAS A;  3T9O A;  1LIH A; 
#chains in the Genus database with same CATH topology
 2WZG A;  1TWH A;  2GFH A;  4DOZ A;  4JEB A;  1U6H A;  2VCB A;  2IXN A;  3TK0 A;  1JRA A;  3JYH A;  2W9Y A;  4XLN F;  1NSG B;  2YZS A;  1WN0 A;  3PHF 2;  1GM5 A;  1IZM A;  3DMD A;  1B68 A;  3DI5 A;  2IYL D;  2RSE B;  3EH1 A;  3M15 A;  2IBF A;  3AQB A;  3VF0 A;  1NU7 D;  3JRM O;  4HFF B;  4LLE A;  4AE4 A;  3AGT A;  5JSL A;  1D1A A;  1OCO C;  4HE8 D;  1M6T A;  1CGM E;  2PX0 A;  3JCU Q;  1LM3 B;  1TKN A;  4NC3 A;  3PCV A;  4XPX A;  3RVY A;  1TWA A;  4ZLD A;  3GWN A;  4IJJ A;  4LDK A;  3K1H A;  2AWC A;  4AK9 A;  1UFB A;  2R7O A;  3SXZ A;  4E0I A;  4EHP A;  2G3V A;  1VK5 A;  3RF3 A;  4G0H A;  3DE9 A;  4U5C E;  1CGO A;  4CS8 C;  4LER A;  3TQO A;  1M2V B;  3NG1 A;  4P9F A;  2WZF A;  2HMZ A;  4MVZ A;  5CI8 A;  3NDB B;  2HSQ A;  2WVO A;  4M63 A;  2R7T A;  2HJ3 A;  2I8B A;  3OEO A;  5COF A;  1GGQ A;  3S28 A;  2JX0 A;  2OG2 A;  3TOL A;  3CAX A;  3AG3 C;  1F1M A;  2XM0 A;  4YN0 B;  3LEV A;  2PF4 E;  4C3E A;  1U0B B;  2NPU A;  5COM A;  4YT4 A;  4C7O A;  2R05 A;  5JLI A;  2EPM X;  1OQC A;  1ZHZ A;  2XLD A;  5IY5 C;  1ST6 A;  3S9O A;  4C7O B;  1RXQ A;  2R7U A;  3K1I A;  1LI5 A;  2A6E F;  4E7S A;  2YRF A;  3DJN B;  4IAQ A;  3HKK A;  3ZSU A;  2J9U A;  4DJ9 A;  2FAP B;  5CIV A;  5KYW B;  4R32 A;  4YT5 A;  2OU6 A;  2YLD A;  1FFT C;  1TQG A;  3JRT A;  1H9G A;  4IB4 A;  4IRU A;  4ULW A;  5JP7 A;  1NBB A;  2OEV A;  5JT4 A;  4O79 A;  2J46 A;  4IAR A;  4BJ5 C;  4CS9 C;  2NSF A;  4JZA A;  1Q0F A;  4PFO A;  3ZIB A;  3C8Z A;  4MND A;  1XZQ A;  2LCH A;  4NCQ A;  1WTY A;  5HSW A;  3EGX B;  3CQZ A;  4JTC B;  4MVQ A;  2KSF A;  4MTO A;  2P0N A;  2XS8 A;  4XEF A;  4G7Z F;  2Y3B A;  3B29 A;  2LFF A;  4WJ0 A;  1RKE B;  5B3S C;  5E3A A;  4F4B A;  2H7O A;  1A7D A;  4YT2 A;  1LKX A;  4PR9 A;  3DAG A;  3RYL A;  3HTK C;  2WVQ A;  4HEA J;  3NYL A;  3X2Q C;  4AX2 A;  1WOL A;  2HKV A;  4XEK A;  3EG9 A;  3M4C A;  1Z63 A;  2C04 A;  2R7S A;  3ZQY A;  3U9J A;  1FR0 A;  2J0X A;  5KYY A;  1JOG A;  1OKK A;  2IXO A;  1BZ4 A;  4EBB A;  4AL1 A;  4IWB A;  4OIR F;  2OOC A;  1J8Y F;  5E3C A;  2KC3 A;  3JSE O;  2WL8 A;  3EJN A;  4RDA A;  3RQG A;  4DVZ A;  3K66 A;  3GEE A;  2ASR A;  3JZ0 A;  1D0Z A;  3QW1 A;  4N4W A;  3VAY A;  3U5S A;  2OKU A;  3DM5 A;  3T6B A;  2EPO A;  3Q7G A;  3L8J A;  1UG7 A;  3LNM B;  1FTS A;  2EIM C;  3N0T A;  3NRH A;  3TD7 A;  4B6I A;  4I1M A;  3C63 A;  3WG7 C;  3U3B A;  1YLM A;  2Y3G A;  2XXA B;  2YL1 A;  4PJL A;  2CNW A;  3ZWI A;  4CDV A;  3FOO A;  4PFP A;  2IOQ A;  2LSE A;  3DM9 B;  4DBQ A;  5JRA A;  2L6H A;  2YEV A;  2R7W A;  1FAP B;  1AUE A;  4MVS A;  2A6H F;  1ZU4 A;  2XLM A;  3SXY A;  1D1C A;  1ZHY A;  1I5N A;  3U2M A;  1LE2 A;  2Q9B A;  1JPJ A;  1VTM P;  1QLE C;  1CPR A;  2J9W A;  3DKA A;  4PJJ A;  3WAQ A;  4GYT A;  1DOW A;  4E17 A;  5FCL A;  3RH3 A;  4BG0 A;  1OW8 A;  2CCY A;  5CI9 A;  1PV3 A;  1E86 A;  1Q0G A;  4ANJ A;  1LIH A;  2ZPA A;  5D92 A;  2PBE A;  4G7O F;  3EH2 A;  3U2L A;  4U5H A;  2NG1 A;  3FAJ A;  3PDM P;  3QZC A;  1H7I A;  2XLE A;  2VAS A;  4O6Y A;  3W8H A;  2M4E A;  5K0I A;  4C3B A;  1ORJ A;  1HMD A;  5T1D B;  1YYJ A;  3T6G B;  1KNY A;  2DYR C;  1Z6A A;  2UUH A;  3AG2 C;  1BBH A;  4YJW A;  2HV6 A;  2HV7 A;  2Y69 C;  5B1A C;  2P1A A;  3EHN A;  5DS6 A;  3C7J A;  4CSA C;  1M2V A;  3C62 A;  3GEH A;  3OA1 A;  3ZQV A;  4D4N A;  1H9T A;  2GWW A;  2XM4 A;  3KL4 A;  3GOR A;  2VH3 A;  3C8G B;  3POV A;  3ITF A;  1WWP A;  4GEH A;  1VLT A;  4K0D A;  4X0R A;  3W4Y A;  4JIO A;  5AC4 A;  2XLW A;  4UDV A;  3G4X A;  3QVY A;  2AU5 A;  5L3V A;  3GWL A;  256B A;  4YL0 A;  2XS1 A;  3LUT B;  3HNL A;  4KBL A;  5AGF A;  3VM6 A;  4U5G A;  3KMI A;  5E33 A;  5DS5 A;  3O6X A;  1VOM A;  1YAR O;  3NMK A;  1Q0M A;  5KYW A;  2J0W A;  4DVY P;  1GS9 A;  2R7R A;  1SMY F;  3DXJ F;  3B0U X;  2AWY A;  1ZHT A;  4BJT A;  4JKV A;  4BJ6 C;  3N2Z B;  3T9O A;  2DGJ A;  4BPM A;  3K33 A;  3U0C A;  1IW7 F;  1HMO A;  1VLS A;  2XL4 A;  2R7Q A;  2YL3 A;  5KYN A;  1BDJ B;  5EHH A;  1S05 A;  1A0B A;  4XTK A;  4CIH A;  2HS5 A;  1MND A;  3JSZ A;  3NKE A;  4JEA A;  4JUR I;  4BJ5 A;  3G50 A;  4CS9 A;  3EGX A;  3TJ6 A;  3RW0 A;  3BRJ A;  1L7C A;  1TFK B;  2YWA A;  4MVO A;  5DS4 A;  1G4U S;  1RMV A;  3E70 C;  1QSP A;  1U89 A;  4HFK B;  3X1O A;  1RKE A;  2LP4 A;  2J7P A;  3R2P A;  3K6B A;  3NYJ A;  3R7C A;  4N6H A;  3C18 A;  1CGN A;  4L6R A;  3IPM O;  1DOV A;  1OCC C;  1TR2 A;  3ABK C;  2Q9C A;  2YHS A;  3MYI A;  1E83 A;  4E0H A;  5HV9 A;  3UMI A;  3B9Q A;  2G3K A;  2NUT B;  5JVE A;  2Q9A A;  1MMD A;  2LFD A;  3DE8 A;  4N6C A;  1EQ1 A;  5BQI A;  3S84 A;  4JTD B;  1ZHW A;  3MX3 A;  2ETS A;  4LDQ A;  2Q00 A;  3ZDL A;  2P7V A;  3L8I A;  2Y39 A;  3I5Q A;  2KJG A;  1LS1 A;  3HLZ A;  3OWT A;  1VMA A;  4K1O A;  1M56 C;  3TJ5 A;  5BQH A;  3KYI A;  2XL8 A;  3L34 A;  4JCZ A;  4JTA B;  4P9T A;  1CPQ A;  1HY5 A;  2XXA A;  4A2N B;  4EBK A;  1NFO A;  3O10 A;  2EIL C;  4I44 A;  3SXK A;  3TUL A;  4PJM A;  4MVM A;  4XWJ A;  5KYX B;  3G4Z A;  5KYU B;  2V26 A;  1YVI A;  2D4U A;  5DVW A;  4U5F E;  5FZT A;  3IEE A;  1YAU O;  2YVK A;  5TJ5 E;  1C17 M;  1E2X A;  4WGZ A;  1XZP A;  1EI7 A;  1MNE A;  1RCP A;  2W4M A;  3LAY A;  3LES A;  2QTV A;  3MBG A;  1LE4 A;  4RBN A;  5JUA A;  2GDC A;  2QY9 A;  3AGU A;  4NTB A;  1I4Z A;  2D5R B;  3JT1 A;  2OJQ A;  1SF8 A;  4FES A;  2J8W A;  1NZE A;  4JC7 A;  2LIG A;  3NKD A;  3JYY A;  4H4K C;  3I5P A;  3LLK A;  2A0U A;  3AJM A;  2H8A A;  4JJF A;  4AL0 A;  3EQL F;  1K04 A;  1S7Z A;  2QLA A;  2A68 F;  1WGW A;  1AEP A;  2V3C C;  2XL6 A;  3N24 A;  3O55 A;  3W2W A;  1GQA A;  3B0V C;  3A9C A;  1OR2 A;  2VCC A;  3SP1 A;  3EFO B;  4XEV A;  4YL1 A;  3RIP A;  5A6B A;  3S0X A;  1APC A;  1FNT c;  1V4A A;  2XRH A;  1G8X A;  1K05 A;  1LVK A;  4O7G A;  4YK5 A;  3C8G A;  4CSA A;  2ZXO A;  5BQG A;  4CJG A;  1NU9 C;  5L0C A;  1OCR C;  2HZ8 A;  3DAF A;  4Q7C A;  1YA9 A;  4PAC A;  5T3T A;  3S27 A;  4W8K A;  4KI2 A;  1OW6 A;  2YQY A;  3WHN A;  1T6U A;  1K40 A;  3CSK A;  5COG A;  5E2Q A;  4FWV A;  5L0I A;  3UGO A;  3LLI A;  1G4W R;  1OW7 A;  2KGO A;  3ABL C;  5D91 A;  3IQC A;  2BC5 A;  5AC5 A;  1TWC A;  3AG1 C;  1OXB A;  2BE5 F;  2PNO A;  4MW3 A;  4N06 A;  2KYH A;  4LDR A;  1TWG A;  1Z7Q c;  3E9V A;  1YZC A;  1M57 C;  3ECS A;  2EPK X;  2QE9 A;  4XPY A;  4PJN A;  1V54 C;  3NMJ A;  4U9E A;  1XWJ A;  1E84 A;  3CEX A;  2J9B A;  3W8I A;  2MWQ A;  3EGD B;  2L81 A;  3RFY A;  3H2U A;  2P61 A;  2YLI A;  5L0J A;  4FAP B;  1NG1 A;  3NYM A;  3RQE A;  3FOP A;  1O5H A;  4QI0 A;  2P6V A;  3VRC A;  2GA0 A;  4GQH A;  2X0C A;  1OKK D;  1OXK A;  3HJC A;  4CJO A;  4CS8 A;  1SR2 A;  2A1D D;  4CBE A;  2F22 A;  4YL3 A;  3T4R A;  1ZYR F;  1D1B A;  3GM2 A;  1Z3I X;  3ZVR A;  2J9V A;  3FAP B;  4I1O B;  3ZTM A;  2GAQ A;  2KK1 A;  3M4B A;  3U3F A;  4MTF A;  4QI2 A;  2ZXR A;  2XSE A;  3U8P A;  4ER9 A;  4XLP F;  2ICW G;  2A69 F;  2FFH A;  2L6G A;  2R02 A;  1WAT A;  4YWQ A;  2TMV P;  4J30 B;  1VYK A;  4DRH B;  1QKR A;  4JW1 A;  2NUT A;  2L7A A;  1RJ9 B;  3GM3 A;  3IQT A;  4KNV A;  2OEX A;  5L0G A;  2Q7R A;  2H7B A;  1PCX A;  2G62 A;  1SYQ A;  1OCZ C;  1G5Z A;  1ZW2 A;  1HE9 A;  2VCA A;  1VB5 A;  2CNW D;  2Y3D A;  3MYF A;  2HJM A;  2RD9 A;  3NMI A;  2A0B A;  2BL2 A;  3PMR A;  5A69 A;  2R7V A;  2MHR A;  3GEI A;  4CDY A;  1JR8 A;  3FMS A;  3Q6M A;  3V5X A;  4ZLC A;  1ZHX A;  3EHM A;  4K7B A;  1NFN A;  4JRZ A;  4U5B E;  3ATP A;  4W8P A;  2J45 A;  3UR3 C;  3W2V A;  2EIK C;  1SZI A;  2E87 A;  5F5H A;  4CDA A;  3UGP A;  2NUP B;  1YDI A;  3QVZ A;  1WAS A;  2CDQ A;  2JD3 A;  5KYX A;  4G78 A;  3LJB A;  3DJU B;  5KYU A;  4BJ1 A;  4CS7 A;  1Y6D A;  1A41 A;  1V74 B;  4CIP A;  3T6J A;  1RKC A;  3S90 A;  1LI7 A;  4ONS A;  1D0Y A;  2WB7 A;  1JPN A;  4MVR A;  2ZXW C;  5A6J A;  2YKZ A;  3DWW A;  1A7V A;  4XQ1 A;  1H6G A;  4U5D E;  3FDQ A;  1OR3 A;  3GM1 A;  2Y3H A;  5B1B C;  2WVN A;  4EBJ A;  4O6N A;  5DQZ A;  5F5F A;  3VYW A;  2W4B A;  4CX9 A;  3V5Z A;  1ZVZ A;  1L3P A;  3FVY A;  2EPL X;  3DZA A;  4EIY A;  4KNW A;  3LS0 A;  4MW8 A;  3S29 A;  1Z23 A;  1Y4C A;  1YA7 O;  2DB4 A;  3Q7L A;  5A6A A;  5A6K A;  1ORY A;  1BR1 A;  1ORS C;  1ZU5 A;  2L9J A;  3K7D A;  4PK4 A;  1O3U A;  1QQ3 A;  1QPU A;  3EFO A;  4NTA A;  2B0H A;  3O39 A;  3AG4 C;  3RQF A;  3B0P A;  1Q0K A;  4D4X A;  5B3I A;  4OIQ F;  1J8M F;  3F47 A;  2R9R B;  3ABM C;  3IQ5 A;  3UMK A;  1T01 A;  2R25 A;  1MMG A;  4MVU A;  5GPG B;  4E7Z A;  2KW3 C;  4U9D A;  1T6Q A;  3DD7 A;  4NQF A;  1C03 A;  5DQT A;  3KPH A;  4NY3 A;  5KYY B;  4OIP F;  2VB6 A;  3BEH A;  4QDL A;  1V55 C;  1HE1 A;  2C03 A;  3Q6N A;  3ZG1 A;  3QW0 A;  4Q5S F;  4AE4 B;  2R7X A;  4JJG A;  1AVO B;  3FHD A;  4J7T A;  3V7O A;  1A7E A;  1YJG A;  4P6I C;  1JMW A;  4DRI B;  2XLO A;  3RKO F;  5L3Q A;  2L6F A;  3JTL O;  2X51 A;  2IXM A;  3A11 A;  4I3M A;  3SEO A;  2HUJ A;  1BR2 A;  2XLH A;  3HNJ A;  2LD6 A;  3H2V A;  3US6 A;  1E85 A;  1D0X A;  2PFD A;  3H65 A;  4E18 A;  1HW1 A;  4WGY A;  1EA8 A;  4C3D A;  2EPN A;  2HFI A;  4EWC A;  1JAF A;  2B0J A;  2YL0 A;  3GOD A;  3EGD A;  4FX5 A;  4JCH A;  5L0H A;  2J7P D;  2JPU A;  3L0I A;  3M1C B;  3IHU A;  2I15 A;  4EKW A;  2CYD A;  3UNG C;  1LS4 A;  4J32 B;  2HMQ A;  5L0F A;  2XLV A;  3QMK A;  1C02 A;  4JVS A;  4OD4 A;  4LLC A;  2QUP A;  3I4U A;  3K1I C;  3KKB A;  1ZZP A;  4MQ9 F;  1VYI A;  4NTF A;  2W45 A;  4XPW A;  4YT8 A;  1YYX A;  5BUO A;  1PD1 A;  3J06 A;  1O87 A;  1T5O A;  2Z15 A;  2VC9 A;  3KYJ A;  3EPV A;  4EUK B;  1MQV A;  1M2O A;  2H7V C;  1I4Y A;  5EGY A;  3MLG A;  3TOM A;  1QZX A;  2M64 A;  2OCC C;  3WOD F;  2HSB A;  3ASN C;  1YZA A;  3UMH A;  2QNL A;  4MTG A;  4Z9I A;  1N1C A;  1RJ9 A;  1ZW3 A;  2PP4 A;  3EZH A;  4KC9 A;  2CGE A;  1R5I D;  4O6M A;  5F28 E;  3IQ6 A;  2IM8 A;  3GAN A;  4OD5 A;  5JS5 A;  4G7H F;  4LAC B;  1R4T A;  1W2W A;  4Z9H A;  1T9K A;  4OIN F;  2IXP A;  3FXH A;  1PD0 A;  4DBR A;  4IGG A;  3B71 A;  2KQ9 A;  1LPE A;  2EIJ C;  3LS1 A;  2DYS C;  5EK0 A;  3SZR A;  3ZC4 A;  4OIO F;  2MYS A;  4JE9 A;  2LK4 A;  2OJE D;  3U8V A;  4BJ6 A;  2OQM A;  3SNH A;  2Q4F A;  4ULV A;  1BR4 A;  3EZI A;  3U9M A;  2CW0 F;  4RD9 A;  3AOU A;  2DI3 A;  4WAB A;  3CZ6 A;  4J7Y A;  1FFH A;  2NUP A;  1EKY A;  1Q0D A;  2AVK A;  3EG9 B;  2UUI A;  3SXM A;  4Z9J A;  1TFO B;  3MFN A;  1MMN A;  1FMW A;  3M79 A;  1HW2 A;  1FMV A;  4BEM J;  2AP3 A;  3QTH A;  4A4A A;  1MMA A;  3LNR A;  4U5E E;  3L1M A;  2EIN C;  3HNK A;  3V5Y A;  3RVZ A;  5L0D A;  1Z5Z A;  2O9X A;  3AQC A;  3ASO C;  2ZXP A;  1KU2 A;  3KH2 A;  4DXW A;  3ZTZ A;  5A6B D;  3LEO A;  2YL7 A;  1NLX A;  4Q4Z F;  4H54 A;  3SYN A;  4DRJ B;  1T6I A;  4BEJ A;  1QVX A;  2R03 A;  2NSG A;  3C8G D;  2LQG A;  3HNI A;  2YLG A;  5T3W A;  2ZD9 A;  4MS2 A;  2KNH A;  5DLJ A;  3F46 A;  4IAO A;  2FGY A;  1KTM A;  2Q3T A;  2WZL A;  2PX3 A; 
#chains in the Genus database with same CATH homology
 4Z9I A;  2LIG A;  4Z9H A;  1VLT A;  2D4U A;  1VLS A;  3ATP A;  4Z9J A;  1WAT A;  1JMW A;  4H54 A;  2ASR A;  1WAS A;  3T9O A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...