1WASA

The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL ASPARTATE RECEPTOR
publication title The three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor. Structural comparison to the cross-linked mutant forms and conformational changes upon ligand binding.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 51
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1993-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1wasA00
4H54A 3T9OA 1LIHA 1VLTA 4Z9JA 2D4UA 2LIGA 1WASA 1WATA 1VLSA 4Z9IA 4Z9HA 1JMWA 3ATPA 2ASRA
chains in the Genus database with same CATH superfamily
3S0XA 1VOMA 4PFPA 2OOCA 4X0RA 4GQHA 4Q7CA 4MTGA 3EZHA 5DLJA 1VLSA 2YQYA 3SEOA 2HSBA 4BJ6A 5CI8A 2O9XA 3ZWIA 4DVYP 3EFOB 3JSEO 1TWAA 4BEJA 3EFOA 4IAQA 3M15A 3S90A 2B0JA 2AP3A 4RDAA 1Z6AA 3EHMA 4CS7A 5BQIA 1HW2A 3C8GD 3U2MA 5F28E 1LIHA 2P6VA 3T6BA 5CIVA 1FAPB 4ONSA 1H9GA 2IYLD 3ZQVA 2V26A 1MMGA 4FAPB 1A41A 2CW0F 3NMIA 3O55A 5FCLA 2VCBA 2FAPB 5DQTA 1SR2A 4BJ5A 1JMWA 2Y69C 3G4ZA 1TFKB 5A6KA 5HV9A 3J06A 3K33A 2QTVA 1Q0MA 4PFOA 1OW8A 3DAGA 3QW1A 1A7VA 4BG0A 1ORYA 5E3AA 5K0IA 1NZEA 3FAPB 1O87A 1V55C 4GEHA 3ZC4A 1D1CA 2L9JA 3CQZA 3GANA 4NC3A 3WODF 1H9TA 4MS2A 1ZU5A 1OKKD 3IQTA 2OEVA 1A7DA 4YT4A 3PDMP 2J9BA 4A2NB 4UDVA 4IJJA 4OD4A 2C03A 4EKWA 3AQCA 1OCCC 1RCPA 1Z3IX 1NU7D 4JZAA 5JP7A 1IZMA 2Q4FA 3KYJA 4WGYA 3G4XA 3SNHA 3UNGC 3KH2A 2A68F 2PBEA 4MW3A 4F4BA 3GM2A 5BUOA 3MFNA 2IBFA 5B3SC 2LK4A 2NUTB 4DJ9A 3ASOC 2NUTA 1GGQA 3I4UA 4U5GA 5F5HA 4EWCA 3LESA 5A6AA 2J7PD 4FWVA 4DRIB 2EIKC 3K1HA 3AGUA 2CCYA 5L0JA 2UUHA 3JTLO 4OIRF 3DI5A 4U5FE 2L81A 2LFDA 1WTYA 3NMJA 3U9MA 4HE8D 4JEAA 5D92A 5A6BD 1OR2A 1YYXA 3IHUA 1G8XA 1M2OA 2BC5A 2IOQA 1EA8A 2R9RB 2FGYA 2LFFA 3JYYA 1T6IA 2NG1A 4G7OF 2KSFA 2L7AA 3Q6NA 1BDJB 1NU9C 1MQVA 4BJTA 3I5QA 1I5NA 2CYDA 3NYLA 3O39A 3RF3A 3NDBB 3RH3A 4EBKA 2JD3A 3G50A 3ZSUA 3ABKC 2PP4A 2Q9CA 1MMDA 2AWYA 3MYIA 3SXYA 3ZDLA 2EPKX 1NFNA 1LKXA 4G7ZF 2J9VA 3B0UX 5L0IA 1XZQA 3VRCA 4NQFA 1ZU4A 3TJ6A 3O6XA 2LP4A 2Q9BA 3U8PA 3IEEA 4B6IA 2P1AA 4QI0A 3GODA 3HNLA 1M2VB 1V4AA 2W9YA 1M2VA 2XLHA 3GEEA 3FXHA 1Z7Qc 4CS9A 1YA7O 1PV3A 2HV7A 2ZPAA 4HFKB 3TULA 2A1DD 4QI2A 5FZTA 2IXMA 2P61A 3C18A 1OKKA 2NPUA 3POVA 1ZW2A 3CSKA 3ATPA 2PFDA 4DBQA 1BR2A 2OKUA 4PJMA 1Z23A 4JEBA 4N6HA 3FHDA 4XQ1A 4AK9A 4DBRA 5F5FA 4DXWA 3AG3C 1LE2A 4MVOA 1E86A 3S84A 3V7OA 1ZHTA 4JKVA 1OW7A 1V74B 3FMSA 4IB4A 2G3VA 1JRAA 1WASA 2J0XA 1K05A 1ORJA 2L6HA 4A4AA 1JPJA 1LM3B 2IM8A 4PR9A 4E7ZA 2J7PA 1FNTc 3L0IA 3MYFA 2H7OA 1VYKA 2XL8A 3DWWA 2XLMA 2R7WA 2L6GA 2Y3HA 4H54A 1BBHA 2FFHA 2QUPA 4MVUA 2EPOA 3HNJA 4CSAA 4AX2A 4J7TA 2B0HA 4OD5A 2YEVA 4O6YA 4L6RA 1KNYA 3S9OA 4R32A 3TJ5A 2YZSA 2HKVA 5KYWB 3K1IC 4M63A 2WZFA 4YN0B 4OINF 4O6MA 5KYWA 1E85A 1CPRA 4CDYA 3UGOA 3FAJA 1J8MF 3GEHA 2R7XA 1U0BB 1A0BA 3E9VA 1HW1A 2D4UA 4PACA 1OCOC 2HMQA 2VH3A 3B0VC 4Q4ZF 2GDCA 3MLGA 3C8ZA 4I44A 3R7CA 4PJNA 1Q0GA 3UR3C 1CGOA 1YAUO 2I8BA 2OG2A 3WAQA 3LAYA 3U3BA 1VYIA 2XLDA 4E18A 2OJED 3HNKA 3QTHA 1PD0A 2IXOA 1LPEA 3LNMB 5L0FA 2X51A 2Y3GA 3UMHA 4LERA 3OEOA 5EGYA 4E0HA 5HSWA 3DM9B 3KYIA 1MNDA 2Y39A 3DE9A 2ZXRA 4U5BE 2OU6A 3S28A 4O6NA 3L8JA 3N24A 3PCVA 3BRJA 5DVWA 4HFFB 4CJOA 2R7SA 1BZ4A 4NCQA 1HMDA 4NTBA 5B1BC 1HY5A 2HZ8A 1PCXA 3GM1A 1TWHA 5L0GA 4XWJA 3DM5A 5L0CA 1Q0KA 5EHHA 2M64A 4XEFA 1CPQA 1NG1A 1RJ9B 1APCA 1OXBA 2A6EF 2E87A 1RJ9A 2R05A 1LI7A 2XL6A 2ZXPA 2C04A 1VK5A 5DS5A 1HE1A 2NSFA 3PMRA 3QZCA 5E2QA 1YZCA 3DD7A 2IXPA 2QE9A 1WN0A 1Q0FA 4KBLA 5L0HA 5AGFA 2DGJA 3ABMC 1T01A 2PF4E 2RD9A 5AC5A 3LS0A 2GA0A 3JYHA 3QVZA 4CBEA 4HEAJ 1E83A 1NSGB 3NRHA 4I3MA 1OR3A 4IGGA 3AG4C 5L3QA 1EQ1A 3SP1A 1RKEB 5JSLA 1RKEA 2V3CC 1K40A 2EPNA 3OA1A 1TR2A 2XL4A 3Q7GA 4LLCA 3N0TA 4ZLCA 2YKZA 3ABLC 1QPUA 1GQAA 2WL8A 1QSPA 1QVXA 2R03A 4O7GA 2ETSA 2XLVA 3RQFA 5JRAA 3C63A 2YL7A 2I15A 3AOUA 4JRZA 4C3EA 1ZVZA 5KYXB 3ZVRA 5KYXA 4E7SA 4CIHA 1ZHYA 2R02A 2KK1A 3JT1A 3PHF2 1GS9A 2Q7RA 2YLDA 3JRMO 3H2UA 3RYLA 5KYYB 1Z63A 4U5DE 5KYYA 1C17M 2XM4A 2L6FA 4QDLA 3RVYA 3SXZA 1YYJA 2XRHA 1G5ZA 2GAQA 2Q9AA 2XLWA 4KNVA 3T6JA 3UGPA 2LIGA 1H7IA 4LLEA 1JAFA 3EGDB 5AC4A 4Z9HA 3EGDA 2QNLA 1MMNA 2DB4A 1CGNA 4YL0A 5EK0A 1MMAA 2D5RB 3F46A 4CDVA 2AU5A 3ZTZA 2HMZA 2DYRC 2QY9A 2R7QA 2ZD9A 5JS5A 3W8HA 1KU2A 1WGWA 4YJWA 1E84A 3DAFA 1MNEA 1AUEA 4YT5A 2HSQA 4E0IA 4EHPA 3MBGA 3C7JA 2EIJC 1NLXA 2W4BA 2EILC 1QQ3A 3E70C 1I4YA 2HUJA 4W8KA 4MVQA 5IY5C 3X1OA 1YVIA 2TMVP 2J9WA 1TFOB 3M4CA 4JCZA 4U5HA 1BR4A 2P0NA 3H2VA 1SZIA 1DOVA 1YA9A 4KNWA 4DVZA 4YT2A 1YDIA 3VM6A 2J45A 2XS8A 3KMIA 4CS8C 2Q00A 1B68A 1FMWA 3U5SA 1FFHA 3SZRA 2VCAA 5E33A 3DKAA 2Y3DA 2X0CA 4YK5A 1H6GA 2MWQA 3EG9B 3T4RA 3ZIBA 2JX0A 3EG9A 3IPMO 1V54C 1IW7F 5COMA 3TOMA 5GPGB 1Y6DA 2MHRA 4NTAA 3NKDA 4P6IC 1ORSC 2Z15A 5E3CA 4EUKB 1ZZPA 4OIOF 3WHNA 2VCCA 4PK4A 4IWBA 3T9OA 1LS4A 2J0WA 3W2WA 5T3WA 5L3VA 3H65A 4WGZA 3T6GB 1KTMA 2AVKA 2G62A 3B71A 3WG7C 4JVSA 4O79A 2DYSC 5JUAA 1A7EA 1FFTC 1QKRA 4YT8A 2Q3TA 1XWJA 1JPNA 3K7DA 1ZHXA 2YHSA 1W2WA 2AWCA 2ZXWC 2M4EA 1PD1A 5BQHA 2LQGA 3QMKA 2WB7A 3W2VA 4N4WA 1Q0DA 3GWNA 3UMKA 1T5OA 3OWTA 4H4KC 4JJGA 4K1OA 4KC9A 4U9EA 3CZ6A 3RFYA 2R7TA 1D0ZA 2NSGA 3A9CA 3DMDA 2XLOA 4PJJA 1TWCA 3B0PA 2R7UA 4GYTA 4EBBA 3EH1A 1D1AA 3LNRA 4MW8A 2YVKA 1YARO 1HE9A 1AVOB 1S05A 2PX3A 3AJMA 5COFA 1O3UA 2P7VA 2XSEA 2XXAB 1DOWA 1FTSA 4MVRA 1YZAA 3TOLA 2XXAA 4OIQF 2A0BA 3VYWA 2HV6A 1SF8A 3DXJF 1EI7A 2HJ3A 3LUTB 2VB6A 4BJ6C 4LDRA 3V5YA 2HFIA 1RMVA 1FMVA 2XS1A 3K1IA 2OQMA 3JSZA 5KYNA 2ZXOA 2HJMA 3EJNA 4K0DA 3JRTA 5JVEA 4G78A 1TWGA 2NUPB 1VLTA 5DS4A 1OCRC 2NUPA 4DRJB 256BA 4U5EE 4ULVA 2WZGA 4AL0A 1T6UA 2Y3BA 2A0UA 2A6HF 3EH2A 3FOPA 4D4XA 3U8VA 3U9JA 4D4NA 5DS6A 1T9KA 3RKOF 4KI2A 3IQ5A 1TKNA 4OIPF 3AGTA 3ASNC 3EQLF 3LJBA 4JTDB 3L1MA 1N1CA 1U89A 4IARA 1U6HA 2CDQA 5A6JA 4BJ5C 1ZHZA 3JCUQ 4Q5SF 1G4US 4J32B 1L7CA 4P9FA 1OCZC 3ZQYA 3K66A 1S7ZA 3AG1C 3NYJA 3O10A 3HLZA 2BL2A 1E2XA 1NBBA 1XZPA 3DE8A 5B3IA 2XLEA 4ZLDA 1EKYA 1O5HA 4XPXA 2BE5F 2F22A 2W4MA 3Q6MA 3VF0A 3GEIA 3LLIA 3S27A 1C02A 2YL1A 3B9QA 3RQGA 2YL3A 3S29A 4BPMA 2YLGA 3AQBA 3LEOA 4JJFA 2EPMX 3EZIA 3JZ0A 4AL1A 2XM0A 4JC7A 5L0DA 4MTOA 4YWQA 4LDKA 4N6CA 3AG2C 4ANJA 1QLEC 3W4YA 3B29A 4BJ1A 2QLAA 4CIPA 4JCHA 4JURI 3HNIA 4LDQA 4U5CE 2VASA 5TJ5E 1LI5A 2CNWA 2EINC 4JW1A 3NMKA 1M6TA 1ZW3A 3HTKC 4DOZA 2EPLX 1G4WR 4XEKA 1ZYRF 3IQ6A 4XLPF 1OXKA 4MVMA 2VC9A 4IRUA 2GWWA 3U3FA 5T1DB 1D0YA 4XTKA 2KC3A 4AE4B 1RKCA 1RXQA 2OEXA 2YRFA 1SMYF 3M1CB 2J8WA 3VAYA 2OJQA 4AE4A 4K7BA 4W8PA 4XLNF 1AEPA 1NFOA 2A69F 2WZLA 3GWLA 3HJCA 2R25A 3KKBA 4P9TA 1R4TA 2KNHA 1M57C 2KQ9A 3M4BA 4JTAB 2WVOA 5T3TA 1SYQA 4YL3A 4Z9JA 4C7OB 3ZTMA 4C7OA 1QZXA 2H8AA 3LLKA 2DI3A 1HMOA 2H7BA 3QVYA 4MQ9F 1JOGA 3N2ZB 5D91A 3C62A 1F1MA 4MTFA 4J7YA 3SXKA 5KYUB 3NG1A 5KYUA 2WVQA 4EBJA 2ASRA 3DZAA 4I1MA 3TQOA 1CGME 2LCHA 2R7OA 1FR0A 2PX0A 3C8GB 3SXMA 1I4ZA 3C8GA 3F47A 1WATA 3L34A 4WJ0A 5COGA 4YL1A 4Z9IA 5DQZA 4ER9A 1D1BA 3ZG1A 1Z5ZA 2KYHA 3CEXA 2KGOA 1OW6A 4G0HA 4CS9C 5B1AC 4IAOA 4I1OB 4U9DA 2WVNA 3FOOA 4FX5A 3I5PA 3L8IA 4JIOA 3GM3A 3EPVA 1T6QA 1Y4CA 2JPUA 3GORA 4XEVA 3U0CA 2RSEB 2J46A 5JLIA 1D0XA 2HS5A 3MX3A 3A11A 4CX9A 2OCCC 1VB5A 1GM5A 4JE9A 4CS8A 4N06A 2UUIA 3RW0A 1L3PA 1WOLA 3DJNB 3FVYA 2H7VC 1M56C 1YJGA 2ICWG 1UFBA 4CJGA 4G7HF 2LD6A 1LVKA 3ECSA 3HKKA 2LSEA 4NTFA 4NY3A 5CI9A 3TK0A 2R7RA 1WWPA 4J30B 3IQCA 2GFHA 3RQEA 4MVSA 4FESA 2YWAA 3ITFA 3W8IA 4DRHB 5A69A 3DJUB 1YLMA 3R2PA 2R7VA 1R5ID 3NYMA 1JR8A 4MNDA 2EIMC 4PJLA 2KJGA 1LE4A 1BR1A 3EHNA 2YLIA 3V5ZA 4CSAC 3FDQA 4CDAA 2MYSA 1VMAA 1ZHWA 3U2LA 5JT4A 4EIYA 3US6A 2KW3C 3Q7LA 2CNWD 1ST6A 2G3KA 2J9UA 1OQCA 4BEMJ 1UG7A 4MVZA 4ULWA 3BEHA 3K6BA 4XPWA 3V5XA 4RBNA 3RIPA 1J8YF 3NKEA 4JTCB 4RD9A 3LS1A 3LEVA 4C3BA 3TD7A 3CAXA 3EGXB 3RVZA 2IXNA 3KL4A 2CGEA 2W45A 3EGXA 1TQGA 3SYNA 3KPHA 1C03A 3X2QC 4E17A 1VTMP 1LS1A 2YL0A 3QW0A 5A6BA 5BQGA 4C3DA 3M79A 4LACB 4WABA 3UMIA 4XPYA 1K04A 2PNOA
chains in the Genus database with same CATH topology
4H54A 3T9OA 1LIHA 1VLTA 4Z9JA 2D4UA 2LIGA 1WASA 1WATA 1VLSA 4Z9IA 4Z9HA 1JMWA 3ATPA 2ASRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H54 A;  3T9O A;  1LIH A;  1VLT A;  4Z9J A;  2D4U A;  2LIG A;  1WAS A;  1WAT A;  1VLS A;  4Z9I A;  4Z9H A;  1JMW A;  3ATP A;  2ASR A; 
#chains in the Genus database with same CATH topology
 3S0X A;  1VOM A;  4PFP A;  2OOC A;  4X0R A;  4GQH A;  4Q7C A;  4MTG A;  3EZH A;  5DLJ A;  1VLS A;  2YQY A;  3SEO A;  2HSB A;  4BJ6 A;  5CI8 A;  2O9X A;  3ZWI A;  4DVY P;  3EFO B;  3JSE O;  1TWA A;  4BEJ A;  3EFO A;  4IAQ A;  3M15 A;  3S90 A;  2B0J A;  2AP3 A;  4RDA A;  1Z6A A;  3EHM A;  4CS7 A;  5BQI A;  1HW2 A;  3C8G D;  3U2M A;  5F28 E;  1LIH A;  2P6V A;  3T6B A;  5CIV A;  1FAP B;  4ONS A;  1H9G A;  2IYL D;  3ZQV A;  2V26 A;  1MMG A;  4FAP B;  1A41 A;  2CW0 F;  3NMI A;  3O55 A;  5FCL A;  2VCB A;  2FAP B;  5DQT A;  1SR2 A;  4BJ5 A;  1JMW A;  2Y69 C;  3G4Z A;  1TFK B;  5A6K A;  5HV9 A;  3J06 A;  3K33 A;  2QTV A;  1Q0M A;  4PFO A;  1OW8 A;  3DAG A;  3QW1 A;  1A7V A;  4BG0 A;  1ORY A;  5E3A A;  5K0I A;  1NZE A;  3FAP B;  1O87 A;  1V55 C;  4GEH A;  3ZC4 A;  1D1C A;  2L9J A;  3CQZ A;  3GAN A;  4NC3 A;  3WOD F;  1H9T A;  4MS2 A;  1ZU5 A;  1OKK D;  3IQT A;  2OEV A;  1A7D A;  4YT4 A;  3PDM P;  2J9B A;  4A2N B;  4UDV A;  4IJJ A;  4OD4 A;  2C03 A;  4EKW A;  3AQC A;  1OCC C;  1RCP A;  1Z3I X;  1NU7 D;  4JZA A;  5JP7 A;  1IZM A;  2Q4F A;  3KYJ A;  4WGY A;  3G4X A;  3SNH A;  3UNG C;  3KH2 A;  2A68 F;  2PBE A;  4MW3 A;  4F4B A;  3GM2 A;  5BUO A;  3MFN A;  2IBF A;  5B3S C;  2LK4 A;  2NUT B;  4DJ9 A;  3ASO C;  2NUT A;  1GGQ A;  3I4U A;  4U5G A;  5F5H A;  4EWC A;  3LES A;  5A6A A;  2J7P D;  4FWV A;  4DRI B;  2EIK C;  3K1H A;  3AGU A;  2CCY A;  5L0J A;  2UUH A;  3JTL O;  4OIR F;  3DI5 A;  4U5F E;  2L81 A;  2LFD A;  1WTY A;  3NMJ A;  3U9M A;  4HE8 D;  4JEA A;  5D92 A;  5A6B D;  1OR2 A;  1YYX A;  3IHU A;  1G8X A;  1M2O A;  2BC5 A;  2IOQ A;  1EA8 A;  2R9R B;  2FGY A;  2LFF A;  3JYY A;  1T6I A;  2NG1 A;  4G7O F;  2KSF A;  2L7A A;  3Q6N A;  1BDJ B;  1NU9 C;  1MQV A;  4BJT A;  3I5Q A;  1I5N A;  2CYD A;  3NYL A;  3O39 A;  3RF3 A;  3NDB B;  3RH3 A;  4EBK A;  2JD3 A;  3G50 A;  3ZSU A;  3ABK C;  2PP4 A;  2Q9C A;  1MMD A;  2AWY A;  3MYI A;  3SXY A;  3ZDL A;  2EPK X;  1NFN A;  1LKX A;  4G7Z F;  2J9V A;  3B0U X;  5L0I A;  1XZQ A;  3VRC A;  4NQF A;  1ZU4 A;  3TJ6 A;  3O6X A;  2LP4 A;  2Q9B A;  3U8P A;  3IEE A;  4B6I A;  2P1A A;  4QI0 A;  3GOD A;  3HNL A;  1M2V B;  1V4A A;  2W9Y A;  1M2V A;  2XLH A;  3GEE A;  3FXH A;  1Z7Q c;  4CS9 A;  1YA7 O;  1PV3 A;  2HV7 A;  2ZPA A;  4HFK B;  3TUL A;  2A1D D;  4QI2 A;  5FZT A;  2IXM A;  2P61 A;  3C18 A;  1OKK A;  2NPU A;  3POV A;  1ZW2 A;  3CSK A;  3ATP A;  2PFD A;  4DBQ A;  1BR2 A;  2OKU A;  4PJM A;  1Z23 A;  4JEB A;  4N6H A;  3FHD A;  4XQ1 A;  4AK9 A;  4DBR A;  5F5F A;  4DXW A;  3AG3 C;  1LE2 A;  4MVO A;  1E86 A;  3S84 A;  3V7O A;  1ZHT A;  4JKV A;  1OW7 A;  1V74 B;  3FMS A;  4IB4 A;  2G3V A;  1JRA A;  1WAS A;  2J0X A;  1K05 A;  1ORJ A;  2L6H A;  4A4A A;  1JPJ A;  1LM3 B;  2IM8 A;  4PR9 A;  4E7Z A;  2J7P A;  1FNT c;  3L0I A;  3MYF A;  2H7O A;  1VYK A;  2XL8 A;  3DWW A;  2XLM A;  2R7W A;  2L6G A;  2Y3H A;  4H54 A;  1BBH A;  2FFH A;  2QUP A;  4MVU A;  2EPO A;  3HNJ A;  4CSA A;  4AX2 A;  4J7T A;  2B0H A;  4OD5 A;  2YEV A;  4O6Y A;  4L6R A;  1KNY A;  3S9O A;  4R32 A;  3TJ5 A;  2YZS A;  2HKV A;  5KYW B;  3K1I C;  4M63 A;  2WZF A;  4YN0 B;  4OIN F;  4O6M A;  5KYW A;  1E85 A;  1CPR A;  4CDY A;  3UGO A;  3FAJ A;  1J8M F;  3GEH A;  2R7X A;  1U0B B;  1A0B A;  3E9V A;  1HW1 A;  2D4U A;  4PAC A;  1OCO C;  2HMQ A;  2VH3 A;  3B0V C;  4Q4Z F;  2GDC A;  3MLG A;  3C8Z A;  4I44 A;  3R7C A;  4PJN A;  1Q0G A;  3UR3 C;  1CGO A;  1YAU O;  2I8B A;  2OG2 A;  3WAQ A;  3LAY A;  3U3B A;  1VYI A;  2XLD A;  4E18 A;  2OJE D;  3HNK A;  3QTH A;  1PD0 A;  2IXO A;  1LPE A;  3LNM B;  5L0F A;  2X51 A;  2Y3G A;  3UMH A;  4LER A;  3OEO A;  5EGY A;  4E0H A;  5HSW A;  3DM9 B;  3KYI A;  1MND A;  2Y39 A;  3DE9 A;  2ZXR A;  4U5B E;  2OU6 A;  3S28 A;  4O6N A;  3L8J A;  3N24 A;  3PCV A;  3BRJ A;  5DVW A;  4HFF B;  4CJO A;  2R7S A;  1BZ4 A;  4NCQ A;  1HMD A;  4NTB A;  5B1B C;  1HY5 A;  2HZ8 A;  1PCX A;  3GM1 A;  1TWH A;  5L0G A;  4XWJ A;  3DM5 A;  5L0C A;  1Q0K A;  5EHH A;  2M64 A;  4XEF A;  1CPQ A;  1NG1 A;  1RJ9 B;  1APC A;  1OXB A;  2A6E F;  2E87 A;  1RJ9 A;  2R05 A;  1LI7 A;  2XL6 A;  2ZXP A;  2C04 A;  1VK5 A;  5DS5 A;  1HE1 A;  2NSF A;  3PMR A;  3QZC A;  5E2Q A;  1YZC A;  3DD7 A;  2IXP A;  2QE9 A;  1WN0 A;  1Q0F A;  4KBL A;  5L0H A;  5AGF A;  2DGJ A;  3ABM C;  1T01 A;  2PF4 E;  2RD9 A;  5AC5 A;  3LS0 A;  2GA0 A;  3JYH A;  3QVZ A;  4CBE A;  4HEA J;  1E83 A;  1NSG B;  3NRH A;  4I3M A;  1OR3 A;  4IGG A;  3AG4 C;  5L3Q A;  1EQ1 A;  3SP1 A;  1RKE B;  5JSL A;  1RKE A;  2V3C C;  1K40 A;  2EPN A;  3OA1 A;  1TR2 A;  2XL4 A;  3Q7G A;  4LLC A;  3N0T A;  4ZLC A;  2YKZ A;  3ABL C;  1QPU A;  1GQA A;  2WL8 A;  1QSP A;  1QVX A;  2R03 A;  4O7G A;  2ETS A;  2XLV A;  3RQF A;  5JRA A;  3C63 A;  2YL7 A;  2I15 A;  3AOU A;  4JRZ A;  4C3E A;  1ZVZ A;  5KYX B;  3ZVR A;  5KYX A;  4E7S A;  4CIH A;  1ZHY A;  2R02 A;  2KK1 A;  3JT1 A;  3PHF 2;  1GS9 A;  2Q7R A;  2YLD A;  3JRM O;  3H2U A;  3RYL A;  5KYY B;  1Z63 A;  4U5D E;  5KYY A;  1C17 M;  2XM4 A;  2L6F A;  4QDL A;  3RVY A;  3SXZ A;  1YYJ A;  2XRH A;  1G5Z A;  2GAQ A;  2Q9A A;  2XLW A;  4KNV A;  3T6J A;  3UGP A;  2LIG A;  1H7I A;  4LLE A;  1JAF A;  3EGD B;  5AC4 A;  4Z9H A;  3EGD A;  2QNL A;  1MMN A;  2DB4 A;  1CGN A;  4YL0 A;  5EK0 A;  1MMA A;  2D5R B;  3F46 A;  4CDV A;  2AU5 A;  3ZTZ A;  2HMZ A;  2DYR C;  2QY9 A;  2R7Q A;  2ZD9 A;  5JS5 A;  3W8H A;  1KU2 A;  1WGW A;  4YJW A;  1E84 A;  3DAF A;  1MNE A;  1AUE A;  4YT5 A;  2HSQ A;  4E0I A;  4EHP A;  3MBG A;  3C7J A;  2EIJ C;  1NLX A;  2W4B A;  2EIL C;  1QQ3 A;  3E70 C;  1I4Y A;  2HUJ A;  4W8K A;  4MVQ A;  5IY5 C;  3X1O A;  1YVI A;  2TMV P;  2J9W A;  1TFO B;  3M4C A;  4JCZ A;  4U5H A;  1BR4 A;  2P0N A;  3H2V A;  1SZI A;  1DOV A;  1YA9 A;  4KNW A;  4DVZ A;  4YT2 A;  1YDI A;  3VM6 A;  2J45 A;  2XS8 A;  3KMI A;  4CS8 C;  2Q00 A;  1B68 A;  1FMW A;  3U5S A;  1FFH A;  3SZR A;  2VCA A;  5E33 A;  3DKA A;  2Y3D A;  2X0C A;  4YK5 A;  1H6G A;  2MWQ A;  3EG9 B;  3T4R A;  3ZIB A;  2JX0 A;  3EG9 A;  3IPM O;  1V54 C;  1IW7 F;  5COM A;  3TOM A;  5GPG B;  1Y6D A;  2MHR A;  4NTA A;  3NKD A;  4P6I C;  1ORS C;  2Z15 A;  5E3C A;  4EUK B;  1ZZP A;  4OIO F;  3WHN A;  2VCC A;  4PK4 A;  4IWB A;  3T9O A;  1LS4 A;  2J0W A;  3W2W A;  5T3W A;  5L3V A;  3H65 A;  4WGZ A;  3T6G B;  1KTM A;  2AVK A;  2G62 A;  3B71 A;  3WG7 C;  4JVS A;  4O79 A;  2DYS C;  5JUA A;  1A7E A;  1FFT C;  1QKR A;  4YT8 A;  2Q3T A;  1XWJ A;  1JPN A;  3K7D A;  1ZHX A;  2YHS A;  1W2W A;  2AWC A;  2ZXW C;  2M4E A;  1PD1 A;  5BQH A;  2LQG A;  3QMK A;  2WB7 A;  3W2V A;  4N4W A;  1Q0D A;  3GWN A;  3UMK A;  1T5O A;  3OWT A;  4H4K C;  4JJG A;  4K1O A;  4KC9 A;  4U9E A;  3CZ6 A;  3RFY A;  2R7T A;  1D0Z A;  2NSG A;  3A9C A;  3DMD A;  2XLO A;  4PJJ A;  1TWC A;  3B0P A;  2R7U A;  4GYT A;  4EBB A;  3EH1 A;  1D1A A;  3LNR A;  4MW8 A;  2YVK A;  1YAR O;  1HE9 A;  1AVO B;  1S05 A;  2PX3 A;  3AJM A;  5COF A;  1O3U A;  2P7V A;  2XSE A;  2XXA B;  1DOW A;  1FTS A;  4MVR A;  1YZA A;  3TOL A;  2XXA A;  4OIQ F;  2A0B A;  3VYW A;  2HV6 A;  1SF8 A;  3DXJ F;  1EI7 A;  2HJ3 A;  3LUT B;  2VB6 A;  4BJ6 C;  4LDR A;  3V5Y A;  2HFI A;  1RMV A;  1FMV A;  2XS1 A;  3K1I A;  2OQM A;  3JSZ A;  5KYN A;  2ZXO A;  2HJM A;  3EJN A;  4K0D A;  3JRT A;  5JVE A;  4G78 A;  1TWG A;  2NUP B;  1VLT A;  5DS4 A;  1OCR C;  2NUP A;  4DRJ B;  256B A;  4U5E E;  4ULV A;  2WZG A;  4AL0 A;  1T6U A;  2Y3B A;  2A0U A;  2A6H F;  3EH2 A;  3FOP A;  4D4X A;  3U8V A;  3U9J A;  4D4N A;  5DS6 A;  1T9K A;  3RKO F;  4KI2 A;  3IQ5 A;  1TKN A;  4OIP F;  3AGT A;  3ASN C;  3EQL F;  3LJB A;  4JTD B;  3L1M A;  1N1C A;  1U89 A;  4IAR A;  1U6H A;  2CDQ A;  5A6J A;  4BJ5 C;  1ZHZ A;  3JCU Q;  4Q5S F;  1G4U S;  4J32 B;  1L7C A;  4P9F A;  1OCZ C;  3ZQY A;  3K66 A;  1S7Z A;  3AG1 C;  3NYJ A;  3O10 A;  3HLZ A;  2BL2 A;  1E2X A;  1NBB A;  1XZP A;  3DE8 A;  5B3I A;  2XLE A;  4ZLD A;  1EKY A;  1O5H A;  4XPX A;  2BE5 F;  2F22 A;  2W4M A;  3Q6M A;  3VF0 A;  3GEI A;  3LLI A;  3S27 A;  1C02 A;  2YL1 A;  3B9Q A;  3RQG A;  2YL3 A;  3S29 A;  4BPM A;  2YLG A;  3AQB A;  3LEO A;  4JJF A;  2EPM X;  3EZI A;  3JZ0 A;  4AL1 A;  2XM0 A;  4JC7 A;  5L0D A;  4MTO A;  4YWQ A;  4LDK A;  4N6C A;  3AG2 C;  4ANJ A;  1QLE C;  3W4Y A;  3B29 A;  4BJ1 A;  2QLA A;  4CIP A;  4JCH A;  4JUR I;  3HNI A;  4LDQ A;  4U5C E;  2VAS A;  5TJ5 E;  1LI5 A;  2CNW A;  2EIN C;  4JW1 A;  3NMK A;  1M6T A;  1ZW3 A;  3HTK C;  4DOZ A;  2EPL X;  1G4W R;  4XEK A;  1ZYR F;  3IQ6 A;  4XLP F;  1OXK A;  4MVM A;  2VC9 A;  4IRU A;  2GWW A;  3U3F A;  5T1D B;  1D0Y A;  4XTK A;  2KC3 A;  4AE4 B;  1RKC A;  1RXQ A;  2OEX A;  2YRF A;  1SMY F;  3M1C B;  2J8W A;  3VAY A;  2OJQ A;  4AE4 A;  4K7B A;  4W8P A;  4XLN F;  1AEP A;  1NFO A;  2A69 F;  2WZL A;  3GWL A;  3HJC A;  2R25 A;  3KKB A;  4P9T A;  1R4T A;  2KNH A;  1M57 C;  2KQ9 A;  3M4B A;  4JTA B;  2WVO A;  5T3T A;  1SYQ A;  4YL3 A;  4Z9J A;  4C7O B;  3ZTM A;  4C7O A;  1QZX A;  2H8A A;  3LLK A;  2DI3 A;  1HMO A;  2H7B A;  3QVY A;  4MQ9 F;  1JOG A;  3N2Z B;  5D91 A;  3C62 A;  1F1M A;  4MTF A;  4J7Y A;  3SXK A;  5KYU B;  3NG1 A;  5KYU A;  2WVQ A;  4EBJ A;  2ASR A;  3DZA A;  4I1M A;  3TQO A;  1CGM E;  2LCH A;  2R7O A;  1FR0 A;  2PX0 A;  3C8G B;  3SXM A;  1I4Z A;  3C8G A;  3F47 A;  1WAT A;  3L34 A;  4WJ0 A;  5COG A;  4YL1 A;  4Z9I A;  5DQZ A;  4ER9 A;  1D1B A;  3ZG1 A;  1Z5Z A;  2KYH A;  3CEX A;  2KGO A;  1OW6 A;  4G0H A;  4CS9 C;  5B1A C;  4IAO A;  4I1O B;  4U9D A;  2WVN A;  3FOO A;  4FX5 A;  3I5P A;  3L8I A;  4JIO A;  3GM3 A;  3EPV A;  1T6Q A;  1Y4C A;  2JPU A;  3GOR A;  4XEV A;  3U0C A;  2RSE B;  2J46 A;  5JLI A;  1D0X A;  2HS5 A;  3MX3 A;  3A11 A;  4CX9 A;  2OCC C;  1VB5 A;  1GM5 A;  4JE9 A;  4CS8 A;  4N06 A;  2UUI A;  3RW0 A;  1L3P A;  1WOL A;  3DJN B;  3FVY A;  2H7V C;  1M56 C;  1YJG A;  2ICW G;  1UFB A;  4CJG A;  4G7H F;  2LD6 A;  1LVK A;  3ECS A;  3HKK A;  2LSE A;  4NTF A;  4NY3 A;  5CI9 A;  3TK0 A;  2R7R A;  1WWP A;  4J30 B;  3IQC A;  2GFH A;  3RQE A;  4MVS A;  4FES A;  2YWA A;  3ITF A;  3W8I A;  4DRH B;  5A69 A;  3DJU B;  1YLM A;  3R2P A;  2R7V A;  1R5I D;  3NYM A;  1JR8 A;  4MND A;  2EIM C;  4PJL A;  2KJG A;  1LE4 A;  1BR1 A;  3EHN A;  2YLI A;  3V5Z A;  4CSA C;  3FDQ A;  4CDA A;  2MYS A;  1VMA A;  1ZHW A;  3U2L A;  5JT4 A;  4EIY A;  3US6 A;  2KW3 C;  3Q7L A;  2CNW D;  1ST6 A;  2G3K A;  2J9U A;  1OQC A;  4BEM J;  1UG7 A;  4MVZ A;  4ULW A;  3BEH A;  3K6B A;  4XPW A;  3V5X A;  4RBN A;  3RIP A;  1J8Y F;  3NKE A;  4JTC B;  4RD9 A;  3LS1 A;  3LEV A;  4C3B A;  3TD7 A;  3CAX A;  3EGX B;  3RVZ A;  2IXN A;  3KL4 A;  2CGE A;  2W45 A;  3EGX A;  1TQG A;  3SYN A;  3KPH A;  1C03 A;  3X2Q C;  4E17 A;  1VTM P;  1LS1 A;  2YL0 A;  3QW0 A;  5A6B A;  5BQG A;  4C3D A;  3M79 A;  4LAC B;  4WAB A;  3UMI A;  4XPY A;  1K04 A;  2PNO A; 
#chains in the Genus database with same CATH homology
 4H54 A;  3T9O A;  1LIH A;  1VLT A;  4Z9J A;  2D4U A;  2LIG A;  1WAS A;  1WAT A;  1VLS A;  4Z9I A;  4Z9H A;  1JMW A;  3ATP A;  2ASR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...