1WAWA

Specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHITOTRIOSIDASE 1
total genus 130
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wawA01
4P7NA 3VDCA 5BXTA 2PC8A 2WC4A 1H09A 1XSKA 1QI4A 1VAHA 3FNDA 3W24A 1E4LA 1QI2A 3N04A 5DMYA 1E0WA 2WBGA 3VGDA 4AXNA 5JUVA 2O9RA 2VT0A 5D9PA 2UY5A 1MXDA 2VOTA 1HKKA 4ATDA 3WFLA 1CXFA 3VINA 4DWSD 1ISXA 3L4XA 1QNQA 4B15A 1FH7A 3VTRA 4M24A 3HU7A 1JXKA 2D23A 2ZWZA 1JI2A 1PPIA 1J18A 1BYDA 3OLEA 2XVKA 3VX1A 4V27A 4JL1A 1UR8A 1M03A 1C91A 1QOXA 4X0NA 4AIUA 2DT0A 2J74A 4X0VA 1B3ZA 3AICA 2WK2A 4PSPA 1MFUA 2VCBA 3IAPA 1BQCA 1KQZA 1E4NA 4HZ6A 1B3YA 3ARTA 2WWCA 3K1DA 1SR0A 1C8XA 1GJWA 4OUEA 4Y7EA 3OIHA 4F8XA 1JAEA 1V3HA 1FH9A 2PBGA 4UOQA 3AS0A 4P8XA 3GH5A 2DSUA 3ALGA 1DWAM 1UHVA 3AHZA 1JYWA 4OOUA 3U7BA 2CKSA 1UKSA 4XV0A 4DUVA 5BRQA 3TONA 4M81A 1ISWA 4W87A 4HMEA 1CXEA 4PMQA 1CXHA 2J7GA 2PB1A 4XZWA 2BY3A 4J3SA 1UQZA 1JZ8A 4TX6A 2ZUTA 1C90A 3TA9A 1UOKA 1TCMA 4D6CA 3RM8A 1TE1A 5IFPA 3WH6A 3BLPX 2NSXA 3SCWA 1XV8A 2FDMA 2DH2A 1UYQA 1F4HA 4AZ6A 3D5HA 2VURA 4E4PA 2JIEA 3ARUA 3NSMA 2DT2A 2W61A 2V3GA 6A3HA 1C8YA 4HU0A 2YJQA 2G41A 4OBRA 2VR4A 3ARZA 2W62A 5IXEA 4W86A 2OYKA 2XHYA 4H8HA 3OLDA 5A6BD 1V08A 3ZSSA 4AZIA 3MU7A 2VX4A 4U5KA 5I24A 4WJXA 1UWQA 4XUYA 3OGSA 3KL5A 2VMFA 1UD6A 1MW2A 3WEMA 4RE3A 3ZR5A 2RGMA 3WFZA 1OD8A 1XH0A 2WCSA 3K8KA 3FW6A 4U3AA 3WF1A 1JD9A 3RDKA 4CCCA 3ARRA 5CLWA 1H11A 1R86A 3BC9A 3WF0A 3W28A 1RPKA 3GXDA 3GXFA 1XRVA 5BXRA 4D6EA 2QHAA 5FOOA 1CLXA 2OSXA 3A4XA 1MFVA 5GNZA 3VVGA 1V3JA 2WZHA 4BZYA 3POHA 3WL1A 2D1ZA 1JF6A 3PZTA 4QLLA 2CXGA 2X05A 4BS0A 4AYSA 2WHMA 4CD5A 4MB3A 4GQQA 4KMQA 1ODUA 3T2PA 1ECEA 1VFUA 3QGVA 4JCMA 4EAMA 3VGEA 2W4XA 2C0HA 3ARXA 1I1WA 2WMIA 1G9HA 1XGZA 2J77A 5A6AA 3BLKA 4JIEA 3N9KA 4AD3A 1HVXA 3W37A 3B9EA 1E1FA 3T0DA 1V02E 4MNLA 2GJXB 2HISA 1PJ9A 1EXPA 4S3KA 1E9LA 3CHEA 4IM4A 1VIWA 3W38A 1V6YA 1ZB5A 3CZEA 4GO8A 4QCEA 3VDHA 1UD2A 1E6PA 3THDA 4CD7A 3CMGA 1LLOA 1TVPA 5I3DA 2Y4SA 4W8BA 3GNRA 4UOZA 2BY0A 4GO9A 3GNOA 3RMEA 3SUSA 5ABGA 5A8PA 3CUGA 5AC4A 1E4MM 1ESWA 1V6VA 2XSAA 4J27A 1ODZA 4AD4A 4GZEA 3F5LA 3NUKA 5DT7A 2VCCA 3U7VA 3ZT6A 1U33A 1ZBVA 1MVYA 2VVSA 1XSIA 3AHTA 3BMVA 3FHQA 2BY2A 4MDOA 5M3WA 3N13A 1EO5A 1CGUA 1E6ZA 2BNJA 2BVYA 1B31A 1OINA 2WBKA 4PBGA 1WP6A 3OZOA 1Q6EA 3MSGA 1HJUA 4PTVA 2VRJA 1C93A 4YHGA 1U2YA 4U2YA 3GH7A 3BGAA 4UNIA 2A3HA 2E9BA 4HOZA 2DDXA 1HJVA 3AIBA 4LGXA 1W91A 2FHBA 4P7QA 3AXXA 1E4IA 4UQ9A 3RPMA 4AC1X 1UR2A 2EPMX 3CHFA 5CSUA 2A3CA 1K9TA 1JZ6A 1QI3A 4UQBA 1FP8A 2VX7A 1V6UA 4NRSA 1K9DA 2OYMA 1E55A 3O2LA 4ATWA 3DYMA 1XH1A 5A94A 2CERA 2GVYA 1KGUA 1JZ3A 2EBNA 4EKJA 1CYGA 3E1F1 1UR4A 4W7UA 5ABFA 4PYSA 4MPKA 2X1IA 3UCQA 2EXOA 2WZIA 4P8UA 4AD0A 3EYPA 3FXYA 3VDAA 3AFBA 2J79A 2D0HA 1OSEA 1E3XA 3PTMA 3II1A 2WSPA 3EMCA 1JIBA 3AOFA 4M82A 1K9EA 1OBAA 3FAWA 2NW0A 2BFGA 5A69A 5A8QA 2UY4A 2YKKA 3GBEA 5A6MA 1VRXA 5D9MA 3AROA 2FHFA 1HP4A 2DT3A 1JAKA 4AW7A 3MANA 2ZXBA 4UZUA 1HX0A 2UY2A 2J7CA 3SURA 4AD1A 2JEPA 5JBFA 3BAXA 1BTCA 3AZTA 5HPOA 1W2PA 3CZKA 2CBJA 2IXVA 1UH2A 3RCNA 4QP0A 1RH9A 4YHEA 1UKPA 3MUIA 1MWOA 1PAMA 2D20A 1XCWA 1MW1A 4KWUA 5DT5A 1CLVA 3UERA 2CETA 3W6LA 2ZIDA 4OZOA 1B9ZA 1XSJA 3T2QA 3MV01 2YL9A 1XD1A 2GK1A 1TA3B 3WUEA 1BGGA 1JDCA 1PBGA 1AQHA 4W8LA 3F4VA 1DWGM 1UD5A 1VJSA 3WF4A 2Y8VA 2XJ7A 2Q8XA 5JIWA 1E3ZA 3MV11 2WVSA 3EBVA 2G3IA 1ISZA 3AYSA 5A8NA 1E56A 4F66A 4HZ7A 3EDDA 3SCUA 1Q6FA 3W26A 4A3HA 5E9AA 5A8OA 3AMKA 1R7OA 3VMNA 3POCA 1GVIA 2GK1B 1KWKA 4NRRA 2DEPA 2D24A 1J10A 1HL9A 2YL6A 4BQ4A 3IAQA 3HJEA 4U2ZA 2RGLA 1KGXA 1GOOA 2OLHA 4Z2HA 4HU8A 5FCZA 1NP0A 1J0HA 2WCGA 5IHRA 1JZ4A 1KGWA 2X2YA 3AIEA 4D1IA 8CGTA 1JGIA 2BVDA 3EDFA 2JIWA 3IANA 4M56A 1E40A 2PWEA 1NP2A 4CVWA 1W9XA 2WHJA 1MW3A 1D3CA 2VQTA 1LG1A 3OA5A 1HP5A 3AHYA 4C7FA 1BFNA 3CO4A 1BG9A 1UZ1A 4L4PA 3AISA 5E0CA 5IFTA 2GJPA 4PMXA 5I79A 2JF7A 1US2A 1GOQA 2XFRA 3AS1A 3VO0A 3CLWA 1VBUA 3GBDA 1TZ7A 3THCA 4CD4A 3RIKA 3TOPA 1CGWA 4LYPA 2FH6A 5EFFA 2OSYA 5A95A 3AIVA 2ZXAA 3BCFA 4AIOA 1C92A 2B31A 4ZFMA 3AMLA 1FOBA 1M01A 1UWSA 2CYGA 2CBUA 3PBGA 1DTUA 3CUIA 3ZQ9A 4TTUA 4AZ7A 2EEXA 3OBAA 2WVTA 3WMBA 5DFAA 4IUGA 3ALFA 4BQ2A 2WKGA 5A6BA 3D3AA 3WQ8A 1X6NA 1B30A 5LYRA 3ARWA 4XB3A 3M7SA 5CXPA 4ZEPA 4MNKA 1CECA 5A6JA 1BPLB 2F61A 2OSWA 4GXPA 2O9PA 3WD1A 1ISYA 4Q22A 1E73M 3SUUA 3VM7A 3KL3A 4AZHA 2G3JA 3VD4A 4HMDA 1HT6A 3IJ7A 2XPKA 4FF5A 2QMKA 1VFMA 3BH4A 3QR3A 3TTYA 5CQ1A 3W0KA 1GHSA 2YL8A 4D71A 1WO2A 2V5DA 1W3LA 1C8QA 2VZTA 7CGTA 2F8QA 2XFYA 4AY1A 4DM1A 1V3MA 4UCFA 1GQLA 1Q6DA 2WLZA 2V3FA 1W9VA 3LPGA 5AY7A 1B90A 2DQXA 4JFSA 1F4AA 3VILA 1V3KA 1CZ1A 1H49A 4MTVA 3PHAA 2VC9A 3BAJA 1V3LA 5CPTA 1JNDA 4E8CA 1GW1A 4GKLA 4U31A 5I77A 4CU8A 1ZJAA 4W89A 4MDPA 5LA0A 4HOXA 3WBEA 1EHAA 4TVUA 1EDQA 5D4YA 1L0PA 2W92A 3UG3A 4AZ5A 4UR9A 4H8VA 3WL0A 1VEOA 2WC3A 4H7VA 3BXWA 1HVQA 5F7UA 4FLSA 3A4AA 1FH8A 3CHCA 4QDMA 1EOMA 1XH2A 4PUDA 2J7FA 1WZKA 4TOQA 1TMQA 1GOWA 1Y7VA 2ZUSA 1PZ3A 4QLJA 4WK9A 3WDPP 2JF6A 3WEOA 1ISVA 2CIPA 2VZOA 1W1TA 4P7RA 1GVYA 1JZ2A 1KXQA 4R5EA 4ZXOA 2J47A 1BYCA 3HN3A 3A3HA 3CTTA 2DIEA 2W63A 2CESA 2CNCA 4PN2A 1UR1A 4KGJA 4NZCA 2QV4A 1SFSA 1W32A 2CKRA 1ZBCA 2Z1SA 4JFWA 2X0HA 1NWSA 2XIIA 4K68A 2EO7A 4U3CA 5TD4A 4UFLA 2WMGA 3WF3A 4CCDA 4BCEA 2GSJA 3WBAA 2BVTA 2XG9A 2AMGA 2WZEA 1W3JA 2CBIA 3ZSTA 4A3YA 1JL8A 1OD0A 4MB1A 3DYOA 1ITXA 1CTNA 2WVVA 1IZKA 1GNXA 4UFMA 5D8WA 1E6RA 3L4YA 3NDYA 5GNYA 1V6XA 3CMJA 1EDGA 1EDTA 2YOCA 3VM5A 1I75A 1WNOA 3VD9A 5IHSA 3VOCA 1K9FA 4LX4A 3WNLA 2X09A 1W9UA 3W53A 4MB4A 3OGVA 1OM0A 4B16A 1Q6GA 4W85A 3WD3A 4MNJA 4UQEA 3QHOA 3VIIA 3GM8A 3QOKA 4UQDA 4JKKA 1LQ0A 2JALA 1EH9A 4GZJA 5E6YA 1KCLA 1MYRA 4B3LA 1UKOA 4E2OA 2D3NA 5I78A 3KEHA 3VD5A 1UH4A 1GQKA 5CZKA 2AAAA 3EDEA 5KEZA 1UUQA 3CGTA 3B8SA 3L4WA 5A2CA 3RM9A 1QI5A 3GH4A 1I1XA 3RO8A 2CCRA 1QBAA 1U30A 2BXZA 1YQ2A 3N18A 4LYRA 4AZCB 1K6AA 2MANA 3F5KA 2PBOA 1D2KA 3PZNA 4JL2A 5M17A 4QCFA 4UQCA 3VGBA 3AHXA 1E71M 3VIJA 1LL6A 4RL3A 3BAYA 2NT1A 3K8MA 2YA2A 5HBFA 5D8ZA 2D22A 4EK7A 4XX6A 2DIJA 3O9NA 5CGMA 2JEQA 2VRKA 2VO5A 1W9BM 3DHPA 1H2JA 3NSXA 1WDQA 2WYSA 1FA2A 3CPUA 1IT0A 4HA1A 2VUYA 2X0YA 4UQAA 1C7TA 2XYLA 3WQ6A 1P6WA 3A4WA 2XGBA 4C7DA 1WDSA 2E8ZA 2VI0A 4BF7A 4URIA 4GI6A 1HL8A 4P7OA 2G3NA 2OYLA 4YPJA 3APGA 4UZSA 3B9DA 2VVNA 4WSKA 3T2OA 3EDJA 1HXJA 5CPQA 3ZM8A 4AIEA 3AYRA 3VU2A 2EQDA 3CH9A 2OWXA 4HPGA 1DWIM 5CPSA 1MQQA 1WCGA 3CUJA 1BLIA 5GNXA 4ZE5A 4F9JA 3K4DA 4UOJA 1G5AA 2ZXQA 4ATLA 3QHMA 3WH5A 5HDRA 2C8NA 1OT2A 1CXIA 5FIPA 3L4ZA 4CUCA 1TVNA 1NOWA 1CENA 3VUPA 4KGLA 4W93A 5A2BA 1CDGA 3VIOA 4HZ8A 3L2MA 2WMKA 4V28A 2DH3A 2O92A 4IPNB 3VPLA 3MUY1 1XCXA 1ZJBA 4V2XA 3MS8A 3WY1A 4BA0A 1EQPA 3BSHA 4TUFA 5ABFB 1E0VA 1YHTA 4W7VA 3N17A 1JXJA 4U5IA 5A6LA 2XVGA 3MO4A 1BHGA 3WN6A 2YL5A 4JFVA 3AMGA 4PSRA 3N15A 2J7EA 4PMOA 2W91A 3VNYA 1QPKA 4TXEA 1JZ5A 1H0IA 1V0KA 2DSKA 3B9AA 1VF8A 4OOZA 2PF0A 1WZLA 3ECQA 3RJYA 5EMYA 2V38A 1UD8A 3WDIA 3PZ9A 2OWWA 2E0PA 3NSNA 5E6ZA 2XUCA 3G6LA 4DUWA 2WW5A 3WH9A 1R87A 4J3XA 5BXSA 1ITCA 2CHNA 1H5VA 4AD5A 3N12A 3WNMA 1UD4A 3SUTA 1FHDA 1WPCA 1MXGA 3CZGA 3AS2A 4J3TA 1OCQA 1E43A 2FGLA 3IJ8A 4BQ3A 4W5ZA 1V0LA 3AIRA 1GONA 3WELA 3WQ4A 3OG2A 1ZS2A 2XM2A 4X9YA 3WENA 1KBKA 2W67A 1PIFA 1LL7A 1CIUA 1TA3A 3AZSA 4UFKA 1GQJA 2E8YA 3SCQA 1UQYA 3T0BA 3CZJA 3UG4A 1W3HA 1HJQA 1W1VA 4R27A 3PZUA 4FLRA 3WH7A 4CU7A 4FLQA 3DECA 1GCYA 1CGVA 3DYPA 4J3VA 4MNMA 2WMFA 2XFFA 1J0ZA 3VD3A 3NCOA 3EDKA 3BSGA 3GTNA 3ARPA 5E09A 5GQBA 3MSDA 4WLCA 1J9YA 1HIZA 5EFDA 2Y8KA 2VR5A 2WKLA 2VTFA 1M7XA 3WEZA 4ACYA 4HA4A 4CD6A 4KRUA 1RD6A 1VFOA 3ZJ7A 4B9YA 4F79A 2VZSA 2E9LA 4D6DA 1PX8A 3T09A 3AXIA 1TR1A 3M6DA 4AEFA 4B9ZA 1E6SM 2FH8A 1JYXA 2O9OA 3NIYA 3KWXA 4CCEA 3BAKA 1GJUA 1J0IA 1ZBWA 1E5NA 3W81A 3SCSA 2YDQA 5BCAA 1LWJA 2WMIB 5HNNA 2G3MA 3VMPA 2VZUA 1UWTA 1QBBA 3VGFA 4H8UA 2VZVA 2GDVA 4MJ4A 4KRTA 4GINA 2FHCA 4H41A 1ZL1A 2WNWA 1H1NA 1UWRA 1FHLA 2QPSA 5FKYA 1X1NA 1KCKA 5CG0A 1WAWA 1PZ2A 3LPOA 3RM4A 4QAWA 5LA1A 4UFIA 2BHUA 1JD7A 5I6SA 4JZ5A 1QVBA 4J28A 3VGGA 1G1YA 1JYNA 2W5FA 5LA2A 1H41A 1JG9A 2NT0A 3PTQA 4B3KA 3K8LA 1V02A 1XD0A 1UZ4A 3TTOA 2OWCA 3AZRA 1EQCA 5FD0A 4DWSA 4WKHA 1UWUA 4AZBA 2VX6A 2YIHA 2V3EA 3L4VA 3LPPA 1UD3A 4CVUA 4TTGA 1W3KA 4EE9A 3ZT5A 1EA9C 5DEZA 4JCLA 4Z2GA 1D7FA 2BS9A 2ZWYA 4LYQA 1S46A 3WD4A 5BROA 3CZLA 1EHNA 3AHVA 4HTYA 2TAAA 2PWHA 2E40A 1E70M 1US3A 3DHUA 4PTXA 3W4RA 2QLYA 1RP9A 1KXTA 7TAAA 3ZJ6A 1FFQA 4IPLA 4JFUA 4AWEA 2WXDM 3OZPA 5C71A 3ZO9A 3K46A 1QW9A 3SCNA 2BHYA 2GDUA 1HKMA 3WUBA 2XVPA 4PCTA 2J62A 9CGTA 1CNVA 3VDBA 2PI6A 1HJWA 4ZENA 1ZBKA 4MAVA 1V0NA 2V3DA 3L4TA 5JBDA 4D6IA 4W88A 2XIBA 2XSBA 1XC6A 4PMNA 1GOKA 2EPLX 5I23A 1B0IA 1CGXA 2YDSA 1QNSA 1E5JA 4WIWA 1VBRA 2W66A 3AS3A 1O6IA 1WB0A 3WDQA 3FAXA 2IXUA 4WKFA 5M5DA 3S2CA 4A4AA 1KWGA 3CZ8A 1LL4A 1AQMA 1OB0A 3PZGA 4AD2A 1UA3A 4L4OA 1BVNP 1QNPA 1BVZA 3W27A 4JKMA 1X6LA 1A3HA 4PTWA 2XM1A 4AZGA 2G8ZA 2ZX6A 2WMHA 1CBGA 3GYCA 1HF6A 3PTKA 1UWIA 4PRWA 2E9MA 1C3FA 4HP5A 3RJXA 3EMQA 3GZAA 4OJYA 4W8AA 5CJ5A 3F5JA 4OKDA 2WANA 4D6GA 1E72M 3WDHA 1OGGA 3WSUA 4PMUA 4ACZB 4PMYA 2XTKA 5EBAA 3WQ5A 2D2OA 3I3BA 3CHDA 4RE4A 1R85A 1QHZA 1J11A 3AJ7A 3OLGA 4W7WA 1N82A 3MMWA 3IK2A 1JDDA 5CSYA 1DWJM 3O6AA 4YN5A 1CXKA 2GUYA 4LXFA 1VB9A 1QNRA 1TUXA 2VCAA 2YDRA 4P8VA 1TFVA 3WH8A 4BQ5A 2ZUMA 2CHOA 3PZIA 4ACZA 3KE0A 3PZVA 2DSVA 4UFJA 1B3XA 1FP9A 1E6XM 3KZSA 4NSBA 3VKKA 1WZMA 1NH6A 4IISA 2WLYA 3PZMA 1KR0A 1JYVA 1GUVA 2WSKA 1E0XA 3J7HA 2CBVA 4HOWA 4CD8A 4PCSA 1NM9A 3NJ3A 4F9DA 3ZT7A 1UR0A 1GOIA 4PMDA 3WNNA 3M46A 1PX4A 4H2CA 3WIJA 2EPOA 3WUGA 1XHGA 1J0YA 3M07A 1TG7A 2DT1A 2WWDA 1E15A 4N42A 1JDAA 2VRQA 1BF2A 2VJXA 2GFTA 4LQ1A 5BWFA 1G01A 3MUZ1 1BAGA 1HN1A 3VIKA 4GQRA 2WHLA 2Y24A 1W1PA 2IUZA 2A3BA 4CKQA 4W5UA 4J3UA 3ZOAA 1UKQA 5CGTA 1OIMA 2O9TA 1IZJA 3W6MA 3CBWA 4QLKA 8A3HA 5A6SA 3CIVA 1EGZA 1V0MA 1WKYA 3OLIA 1BYBA 1PIGA 3AIQA 4OBSA 5FL0A 5CLTA 1B1YA 1BYAA 5DO8A 4AISA 3VIHA 3VX0A 5A1AA 1VFFA 5GPRA 1LG2A 2PWFA 5HXMA 5A3HA 2JE8A 2UWFA 1V03A 2WPGA 1DWHM 2YBTA 3TTSA 5A8MA 3WQVA 4MAZA 1H0GA 4Z2LA 4WF7A 3SCOA 4M80A 2ZX5A 3RILA 1RP8A 4DWSC 3EMZA 3SIMA 4PMZA 3MUAA 2ZUVA 3WNKA 3VIPA 4XZBA 1WE5A 1BG4A 4D1JA 1JI1A 1BSIA 1NWRA 3ZMRA 1H4PA 3TTQA 1B3VA 3WMCA 4C7GA 4J7RA 3TP4A 1CGYA 4PTMA 4QFUA 2E3ZA 4Z2KA 2WHKA 3SCTA 2HVMA 1NOUA 4GI9A 3SCPA 4FLOA 3WUFA 5A6KA 3FY1A 3WDRA 1UR9A 4U33A 2XGIA 5I0DA 2CITA 1CEOA 2ZUWA 1OGBA 1KQYA 2VNCA 3SEPA 1WZAA 4OIFA 5E0FA 4FMVA 1IV8A 2ZXDA 3AIWA 2BHZA 1NOFA 3VIMA 4GZIA 3T0AA 1HKIA 5FL1A 3U5UA 3SCVA 2ZX8A 1QNOA 3A47A 3VIGA 4ZE4A 5JBEA 4Z2IA 1KFWA 3UR8A 1XYFA 4WSJA 3L2LA 3VNZA 1JF5A 1E1EA 2ZX9A 1J0JA 1NQ6A 4Z2JA 2J8FA 2D0GA 1M04A 3ZR6A 3MKKA 5AYBA 1HJSA 4KH2A 3SUWA 5ABHA 5HPCA 1PEZA 1W9PA 4DM2A 1OGSA 4AEEA 5HOSA 3OB8A 1BGAA 3FN9A 1JZ7A 1O7AA 5I2UA 4MJ2A 3NYDA 3LPFA 3MMUA 5DF0A 1DHKA 1Q6CA 2J7DA 2YBUA 1UG6A 2ZICA 7A3HA 3I3DA 3T08A 3ARVA 1GZJA 3AXHA 1LF1A 4Q7NA 3GNPA 1JFHA 2YA0A 4W84A 3GXIA 4RE2A 3GDBA 4N0RA 3ZJ8A 6CGTA 2ZUUA 3BAWA 3UR7A 1QHPA 4H04A 1GOMA 5M03A 3BAIA 1KB3A 2WM0A 2XVNA 3WQWA 2DSZA 4D72A 3ARSA 3ZIZA 3HMCA 2E4TA 1SMAA 3I3EA 3UESA 1MQPA 4CN4A 1B2YA 3UEQA 2YLAA 1KR1A 3A6OA 1M53A 1VEPA 2D0FA 2J78A 4GIAA 4PUEA 2WVVB 2UY3A 3VD7A 1EIBA 3WKZA 5C70A 4PEEA 4M29A 4D6JA 1KXVA 1VJZA 4LPCA 4CU6A 5EB8A 1GQIA 2PWDA 3ARYA 4M1RA 1W9DM 4UTFA 3BCDA 4EANA 5BXPA 3OGRA 3U5YA 1G0CA 2XWDA 3UG5A 5JIPA 1V3IA 1UKTA 3U57A 1CXLA 2FGZA 4JAWA 3WD2A 2J7BA 4E8DA 4M8UA 2V5CA 3K4AA 1J01A 3BMWA 1OT1A 4JFTA 4PMRA 1AMYA 3LMYA 2Z1KA 1V6WA 6TAAA 2CEQA 1HNYA 1KXHA 1A47A 3JUGA 3S6TA 2ZX7A 2A3AA 4P8WA 4ZXLA 2QMJA 3SCRA 3PZQA 1LJYA 3NDZA 3W25A 1R8LA 1EO7A 5E70A 1AVAA 3G6MA 2C7FA 1JNEA 1EOKA 2WCAA 4GPNA 2DGAA 4D6HA 3AQUA 1L8NA 2X8RA 1CGTA 4AZCA 1SMDA 4CN1A 3ARQA 4HPHA 2QF8A 1HJXA 3CUFA 3WMSA 2DSWA 2F2HA 3WF2A 4PMVA 2ESCA 2J75A 2G4FA 5ECUA 4UFHA 3ZJKA 3VIFA 1ZU8A 1VENA 2J4GA 2EPNA 3UETA 3CUHA 1QHOA 4CN6A 2BXYA 2JFEX 1Q4NX 1GHRA 5A2AA 4NI3A 3QHNA 2WVUA 4DUXA 2AOSA 2VL4A 1HKJA 1J12A 5KZ6A 1OIFA 1UH3A 2Y2WA 1R7AA 3MMDA 5ABEA 3IJ9A 4S3JA 4NF7A 2WAGA 2EPKX 3PZOA 3L4UA 2J7HA 2WMJA 2VQUA 4MB5A 1MQRA 1SYTA 2GJXA 1CWYA 4DWSB 3QOMA 4WKAA 3WNPA 4MADA 4HA3A 1NWUA 1Z32X 5I5RA 3AMDA 2DPEA 4FK9A 3VMOA 3PN8A 1KBBA 1UA7A 2D3LA 4J3WA 4TX8A 1PX3A 1OWQA 5JH8A 3SUVA 3N1AA 1DEDA 2EJ1A 3AMCA 2YA1A 1G94A 2QPUA 1CPUA 2ZUNA 2XVLA 1WDRA 2BY1A 2ZOXA 1GPFA 2GJRA 4D6FA 5IDIA 1QW8A 1W2VA 4TVDA 4CGTA 2VX5A 4TVCA 2ZE0A 2J8GA 3KL0A 1JFXA 1J0KA 1AQ0A 1WDPA 1XYZA 2J25A 1FFRA 4HMCA 1GORA 3AI0A 4P7LA 3AIUA 1NARA 2A3EA 4JHZA 1NWTA 1E6NA 4JKLA 3W29A 1E6QM 1DP0A 5C8BB 2Y5EA 2WB5A 3WDJA 2CPUA 3WNOA 3WD0A 1MW0A 3N11A 4JHOA 3FHAA 1C7SA 5BYWA 1W1YA 3GXMA 5AYIA 1DWFM 1VEMA 1B3WA 2WC7A 2YLLA 1QI0A 1H3GA 5D9OA 3W82A 4AMCA 2XWEA 5AC5A 3VGHA 4ML4A 3DC0A 5D9NA 1LWHA 5BRPA 2PWGA 4GI8A 2BV9A
chains in the Genus database with same CATH superfamily
3VDCA 4GCAA 2ISSA 3ONBA 4XSMA 4E5TA 2WC4A 1XSKA 1VAHA 4Q6JA 3VOHA 1QI2A 3N04A 3CM4A 4HU4A 4B15A 4GY7A 3LRLA 3VTRA 3KM8A 4J4NA 1PPIA 1ZP4A 1L2QA 4US5D 2XVKA 3VX1A 1H7RA 3SQMA 4V27A 3PWIA 4GYFA 2C79A 3S4TA 3CQIA 1FKKA 1QOXA 4ODRA 2DT0A 2PGRA 2CLFA 2DORA 2NQJA 3V3WA 4DZIA 4J9JA 1MUWA 2NSOA 3IAPA 1FWWA 4HZ6A 1KM2A 3ARTA 2NV2A 2WWCA 3BV7A 3REQA 1SR0A 4Y7EA 4HNOA 5FF3A 5M1TA 3UD6A 3TQKA 4MMWA 1XW8A 4NNRA 4ZO8A 1FXPA 2Q8LA 2NUXA 2N87A 3CT2A 3UR5A 3AS0A 2VEPA 3ALGA 1UHVA 4PC8A 3AHZA 2F2KA 1UKSA 2HTMA 3JS3A 2QIWA 1OCBA 4AWSA 2LLEA 5HW6A 4ZR8A 2AL2A 3NQ6A 2J7GA 4XZWA 2BY3A 1JZ8A 3UQIA 1BRLA 2FZNA 3VFLA 3H7RA 1UOKA 2VFFA 1TCMA 3QMTA 1SQ7A 3I6CA 5IFPA 4H9VA 3SCWA 1A49A 1F4HA 4AZ6A 3NSMA 4GA8A 4IL0A 2FVKA 1GVSA 8XIAA 2M08A 5HULA 1KFLA 3T44A 4JTFA 4AZIA 3ME3A 4U5KA 4UTTC 3K13A 3NGJA 4XUYA 1R38A 2VMFA 1FBAA 1QAPA 3BLEA 4HNUA 3IACA 2QUVA 3E2RA 3QC3A 3CWHA 4U3AA 4AWUA 3WF1A 4FNUA 3AWOA 2DVXA 3L68A 5CLWA 1R86A 3BC9A 5DRIA 3NRKA 1RPKA 1XRVA 3QR0A 2AKZA 4D6EA 4RNIA 4PULA 4UMAA 1LCOA 5IM51 1XLLA 3A4XA 1OFDA 3H24A 3QQWA 1DV7A 4BZYA 3POHA 3QR1A 2D1ZA 2BDQA 4B2DA 1XQLA 1XIBA 3VE7A 2X05A 1TMHA 5FJOA 1IXPA 4KMQA 1AH4A 1I2RA 1ODUA 3T2PA 1ECEA 4Q8NA 4C6QA 2Y70A 4JCMA 1A5OC 1MDLA 3H4WA 3QF0A 1NY1A 2W4XA 2TPSA 4IPPA 3MA8A 4X60A 4KKXA 2WMIA 1G67A 2J77A 3B9EA 2YR1A 4R3UA 1JRBA 1V02E 4E2DA 4MNLA 1PJ9A 3CGNA 5EGRA 4GC3A 4S3KA 4YNGA 3L7RA 3C56A 1Q3NA 2R8WA 3PNUA 3THDA 4MLJA 4MY9A 4MWAB 3WLOA 1E1CB 1HG3A 2RKXA 3OTRA 1J8VA 4W8BA 2Z0IA 3CT7A 4B4FA 4GO9A 2V5BA 2ODOA 2Y6ZA 3NYZA 1ESWA 3KAHA 2F9RA 2Z00A 2XSAA 4J27A 1ODZA 3PAOA 4GZEA 5BU9A 3MSYA 4JICA 1CI1A 3ZT6A 1ZBVA 2QUMA 2VVSA 3BMVA 2BY2A 5M3WA 3N13A 4L5ZA 4ICNA 1E6ZA 2BNJA 4M5PA 2XN2A 1V79A 2WBKA 1WP6A 2Y0FA 2P5NA 3R8GA 3TXVA 4PTVA 2VRJA 1OFOA 1Q6HA 1FCVA 4I5RA 3S1UA 4UNIA 3ITGA 5ECVA 4Q7BA 1GJPA 4DX3A 1W91A 3UVAA 2KR7A 3AXXA 1E4IA 5CSUA 3GHSA 2ZC1A 4MLRA 3W85A 3I7RA 3ZXWA 2DZBA 3W1AA 1S2AA 1BKHA 4RNFA 2OYMA 1E55A 3O2LA 3W02A 3HGRA 3N14A 3EX4A 4HHMA 3CYJA 3UBPC 1J6YA 1UR4A 5DBUA 4KT2A 3WLLA 4MPKA 3ID7A 2ZR6A 4NAFB 2Z4GA 2E1DA 3AFBA 3CAVA 1EP1A 4IX2A 3R4IA 3EOSA 4LF2A 2X7WA 2YXOA 4LV4A 3TIMA 3I6TA 2XH2A 3EMCA 3A12A 5HQMA 3FGCB 4M82A 2BFGA 5A8QA 4UNLA 4C6OA 4DELA 3KDOA 2HRWA 5D9MA 4FX8A 1P5QA 3AROA 2FHFA 2QJMA 1MDRA 5G1TA 5I3JA 2DT3A 2Y63A 4FI4A 4ES4A 2PWUA 4AW7A 3KACA 3RCYA 3IIVA 4JN7A 3MANA 2ZXBA 2YCLB 1THFD 3GD6A 3CQ0A 3IRDA 4NASA 4AD1A 1BTCA 2DG3A 3CZKA 3K2GA 1UH2A 3MVIA 4QP0A 3MUIA 3IVSA 1KCXA 4E6MA 1WV2A 1MW1A 4TW7A 4KWUA 3UERA 3L12A 4KQZA 4PMJA 4N9DA 2WSQA 3MV01 2I57A 4JIPA 1PBGA 1AQHA 1H50A 1DWGM 1QDSA 3MSRA 5D2YA 2XPBA 3QFWA 3WF4A 1JPHA 2Y8VA 2ASHA 2EHHA 2NWRA 3KUMA 4PB3A 2PPGA 2Q8XA 1IT7A 4JTCA 2VEKA 2F38A 4JTHA 1KM6A 5A8NA 1FCUA 2X1RA 3GIQA 3EDDA 1TWIA 1XLGA 3W26A 2FVLA 5A8OA 1ZJIA 3AMKA 4O53A 3POCA 4Z17A 3ABOA 3S46A 1KWKA 4NRRA 4AAJA 1DHPA 4N9CA 1B9BA 4WHBA 2YL6A 2H90A 1A5MC 4K8EA 3OPSA 2RGLA 5EMKA 1KGXA 2PGEA 1GOOA 3BZJA 1AD4A 4H3DA 1J0HA 5F2IA 3ABQA 2YBVA 4QE5A 1ZLPA 8CGTA 1JGIA 3U2EA 2FTWA 1XKYA 3EDFA 4M56A 3W1PA 1VCGA 3HV8A 1QTWA 3G1RA 2WO5A 3VAWA 3EIPA 1D3CA 3W72A 1WA3A 4C7FA 3CO4A 1LTDA 1V93A 3LNPA 4L4MA 3OIXA 2QV5A 2WNZA 1JPKA 3V5OA 4DXKA 4GX8A 4PMXA 3BVJA 6PTDA 5AYXA 4Z42C 5I79A 4ZVJA 4RUBA 1GOQA 4BKNA 1H61A 3RCMA 2D2JA 1W5QA 3QSTA 5HQEA 3APYA 5AC6A 4CD4A 5I07A 5LXEA 4GYPC 3TQPA 2FH6A 4XVDA 1TJ0A 1C92A 5MF5A 1RVKA 1T99A 4ZFMA 3L2IA 1M01A 3G1SA 1SO3A 4GXMA 2CBUA 3OBAA 4U10A 1MZHA 2BMBA 2I5QA 2L5HA 3BURA 2WKGA 3EPMA 3WQ8A 1X6NA 2OLAA 1JRCA 4HYRA 4XB3A 3M7SA 3Q45A 3KW3A 1E1CA 4ZEPA 4D8AA 1CECA 1Q6RA 1ISYA 3MKVA 3SUUA 4LAMA 3KL3A 2HROA 3VD4A 4IQJA 1HGYA 3C0SA 5E93A 3WLRA 2XPKA 3BH4A 4C02B 3P6LA 3TTYA 3W0KA 2P53A 1OZQA 1CX9A 4D71A 3Q58A 2C14A 1W3LA 3TV8A 3S9YA 4DRJA 4RV3A 2F8QA 3B97A 4HVXA 4LT9A 2YSWA 3OODA 1KCZA 1KLZA 3TN3A 2WLZA 1W9VA 1DPMA 4JFSA 3KHDA 1F4AA 3DXIA 1X8FA 4MTVA 3AYTA 2VC9A 3GLCA 5CPTA 2BXVA 1GW1A 5I77A 3EWWA 1NTHA 1RQHA 1S2WA 3RLUA 5D33A 4IIEA 3LCGA 1VEOA 2WC3A 4UTMA 4ZO6A 3BXWA 3MWCA 4MFEA 2C71A 5F7UA 3A4AA 1NAL1 4QDMA 4C60A 3HPSA 3C0LA 4Q8MA 3H9RB 5TIMA 3FS2A 1PZ3A 4WK9A 3WDPP 2JF6A 3PWGA 3WEOA 3IGXA 1ISVA 3UWVA 1GEQA 2VZOA 4LC6A 2QCEA 1BXCA 1Z44A 1W5PA 2BLEA 3E0WA 3CV6A 5C5YA 2HE5A 3IVUA 3VC5A 4PN2A 2E1WA 1UR1A 2NUYA 4NZCA 1X98A 5DANA 1ML1A 1SFSA 3IUDA 7TIMA 3G8RA 3PS7A 4QE1A 2CKRA 4HK7A 1TCOC 4JFWA 1NWSA 1IQ8A 4IP4A 5JMUA 2F21A 4ZPWR 3WF3A 4C1NB 3WBAA 3WJWA 4FNPA 2QDHA 4GFSA 5BOOA 1K4GA 1W3JA 3CC1A 5BU6A 4RDVA 4A3YA 4G6CA 1MI3A 3GVWA 3DYOA 3MYOA 5BNKA 4UR8A 4B3ZA 1VYRA 4UFMA 3NDYA 2IKIA 3GX9A 4WD0A 4A8RA 1EDGA 4JTJA 3ITYA 4ROQA 3E3HA 1EDTA 1UP3A 4C6LA 4FOUA 4YVXA 1PTGA 2ZR4A 2DFAA 4B16A 5J04A 4JTLA 2UV8G 3TMLA 3S2NA 3BQ5A 3WQGA 5FF0A 2FMOA 1YNYA 1ME7A 2CWXA 3VNLA 3K5XA 5C9RA 4UQDA 4JKKA 3LBMA 1LQ0A 3WCZA 2Z2UA 1MYRA 4B3LA 4BF5A 1GQKA 1WUFA 2PV1A 5JH1A 5KETA 2PV2A 3B8SA 4L72B 1TV8A 3GR4A 1EWEA 1QBAA 1VYSX 2PODA 1U30A 3BWWA 2X0SA 1LLZA 2BXZA 3ICJA 1YQ2A 4LYRA 3TYAA 2H8ZA 4IQ2A 4ZMGA 3NXLA 4JL2A 1EJRC 3AHXA 4QEEA 2JZVA 4AMAA 4BI7A 5HBFA 1YX1A 4EK7A 3SM0A 1M6JA 3O9NA 2JEQA 2QVHA 2A7NA 2VO5A 3DHPA 1H2JA 2PP1A 2OG9A 3CL7A 4DROA 1TPEA 3G1DA 3MI2A 1EJUC 3M4HA 4HA1A 4PUNA 2XYLA 1C29A 4LRTA 3SAZA 3WK3A 3NEVA 4URIA 4B92A 1HL8A 2CLEA 4Z1AA 4QG6A 1G7VA 1R3QA 3PC0A 4YPJA 4WXZA 2VVNA 1WXYA 5AVNA 3M0MA 3EDJA 5CPQA 4AIEA 1XCFA 3STGA 4HPGA 1VFSA 2BBFA 4L56A 3QC0A 4GJIA 2OEKA 3LQLA 1BLIA 4F9JA 3T7VA 2YYUA 3RHGA 2YW4A 5C55A 3WH5A 2FAPA 2HPMA 4QG8A 1EJTC 3VUPA 3IK8A 1CDGA 4O28A 2BWGA 1K6WA 3E49A 1PSCA 1OYCA 1GKPA 3VPLA 4RX0A 5HWNA 4A3RA 1F6KA 1EQPA 3BSHA 1MSSA 3W7KA 4YS1A 4LUSA 2PE4A 1GG1A 4W7VA 2D73A 2EULA 1JXJA 4HSHA 2NV1A 2XVGA 3H54A 3MCOA 3DZ1A 3ZZ1A 2VP8A 4PSRA 4IH3A 1MRQA 4DRHA 4IHCA 1OYAA 5C7VA 3TDFA 2DSKA 5JXQA 4KWVA 5DCBA 4KEZA 3WZ0E 1WZLA 5FEWA 4UTLA 3DU0A 1JR1A 5F4XA 2FVMA 3WDIA 4DZAA 3ORWA 4NNBA 2E0PA 4V1XA 2PRMA 2ZKMX 2XUCA 4GHRA 4DUWA 4WGXA 4JDYA 1H5VA 3D46A 2ABBA 3WNMA 3F4DA 3SUTA 1WPCA 5E9XA 4EXBA 4NYUA 2Y62A 1VCFA 2FGLA 3NQMA 3EEGA 1TV3A 1L6GA 2DVTA 5KZDA 2HDJA 5C0QA 2PDHA 4PCNA 2XM2A 4H9MA 2OOFA 4X9YA 2OFNA 2BGNE 1KTNA 1ME9A 4LV9A 4U28A 1TA3A 1GQJA 2E8YA 3SCQA 3QMRA 3GNXA 3CZJA 2DG9A 2PDCA 2V82A 3CASA 1A3WA 4WY0F 4XAGA 2CC0A 4FLQA 4QSHA 3STCA 5LGXA 1Q7QA 4DYEA 4RNJA 3HG2A 3LTYA 2JQXA 1KV8A 3VD3A 3NCOA 3M0IA 1D3HA 1NDVA 4W9PA 5E09A 1SZRA 4NXKA 3C2YA 2PD9A 2Y8KA 2WQDA 3NZGA 2P8CA 1K8XA 4LUTB 3WEZA 3MZNA 2QCMA 3ZJ7A 4YTTA 4G2PA 3T09A 5CSSA 4AEFA 2FLIA 3LLDA 4V1YA 4HD5A 5ENLA 1EUAA 1UC5A 4GRSA 4IF2A 4S3DA 3KWXA 3EPNA 5DRCA 3TLQA 1SZNA 1C8VA 2INEA 3PRDA 3WH0A 1GJUA 1ZBWA 4A3UA 1U1UA 1E5NA 3CPRA 4I8DA 5CAHA 1R6WA 1IHIA 2VZUA 3RMJA 1LT7A 3QM3A 3PULA 4H8UA 4ZPVR 3GNDA 3UWYA 1O94A 1VBGA 4DAFA 3EXTA 5CSRA 5HT1A 4JNYA 1H1NA 1EKOA 1R2TA 5CG0A 4FN2A 4ICMA 5T91A 4HSOA 4JYFA 4QAWA 5LA1A 5I6SA 3U6WA 2OPJA 1QPOA 1G1YA 5LA2A 1H41A 2Y1HA 2NT0A 1EP2A 2DZAA 3EKLA 1V02A 4LFYA 3IJ6A 4JTEA 1BKSA 3ITCA 1F05A 3DCPA 3H55A 3HG3A 4Q8VA 3WBYA 3LPPA 2PS2A 4TTGA 3G0XA 1M7PA 2Z7GA 1QPNA 3TDBA 2G95A 2BS9A 4EPDC 3WD4A 3CZLA 2H6RA 4O0QA 1R3TA 3NA8A 4N7QA 1E70M 3DHUA 5F2MA 1PKNA 4PTXA 2OQHA 2XSXA 1DJQA 3TC7A 2DZVA 2QLYA 3XISA 1P1XA 7TAAA 3HGOA 2WPBA 2R1MA 3CYVA 4IPLA 4HJWA 4AWEA 2XDFA 1XIDA 4AF0B 3ZO9A 3W7PA 1QW9A 3SCNA 4EXAA 2BHYA 1HKMA 5H6HA 3WUBA 2XVPA 2QGHA 4OTKA 4RW5A 3HMJG 4PCTA 1G69A 2VDHA 3BGJA 3S3GA 3U8GA 9CGTA 3M5ZA 4IMGA 3VDBA 3GDRA 3O7UA 4ZENA 2Q3RA 3KBSA 4J4OA 5IOBA 5KINA 3C0JA 4D6IA 1XL9A 3B9NA 3VK5A 1XC6A 1IYXA 2Z24A 2EPLX 2PDIA 3K1GA 3W83A 1SJAA 2QT3A 1VBRA 4F0RA 3AS3A 1PKYA 4X61A 1WB0A 4AEOA 1LOSA 1SU5A 2BP1A 4JPGA 3UPBA 1ADDA 3INPA 3S2CA 1RLCL 2QYGA 3FKKA 1B4KA 1LL4A 1OB0A 4AD2A 4H4IA 1SFJA 1FQ0A 2PP3A 1QASA 4O2TA 1G4PA 3AXMA 4FB7A 4XSLA 3C2RA 2G8ZA 4JY8A 5XIAA 3UJ2A 1KW1A 4JTGA 1UWIA 4OV4A 2BOGX 4PRWA 2HCVA 5F2LA 5CJ5A 3F5JA 1D6OA 2IS7A 3V75A 1LOLA 1E72M 3PTDA 1OCNA 3WDHA 4PMYA 3ABSA 3RRAA 3R79A 1RPXA 3I3BA 1TSIA 3TZFA 1R85A 3LG3A 3KS5A 1XGEA 1N82A 3W9ZA 1DWJM 1F8IA 1VH7A 4GH1A 4YN5A 3UXKA 3GU9A 3ANYA 1QNVA 1QNRA 5DIUA 2VUNA 3UJEA 1A4LA 3FX4A 3WH8A 4EF8A 2ZUMA 2CHOA 1EEPA 4ZB2A 5BMWA 3OQEA 2E28A 4CQAA 3LGGA 4XZNX 1B3XA 1E6XM 1K70A 3VKKA 2CLLA 3PZMA 1KR0A 4H6QA 4D8LA 4GACA 3NJ3A 4F9DA 3RPDA 4GOAA 2LKNA 1E51A 2ZC8A 4G1NA 4LNCA 1YPFA 5B80A 3S9IA 4LS2A 5CPOA 1S5TA 3P84A 3T40A 3AXKA 3WIJA 2PDNA 2NQHA 3WUGA 1XHGA 1I60A 4C90A 4G1KA 1S2VA 4WR3A 4H83A 3CAWA 4E4UA 4Z0SA 4UTTA 2KGJA 1JDAA 2C13A 1UUOA 1BF2A 4RDYA 2PDXA 4LUTA 2YCIX 3EZ4A 4OQVA 1XDMA 2MUCA 2V2HA 2A3BA 2GLKA 4CKQA 4W5UA 3S5NA 1OC5A 1UKQA 2GOUA 3MB9A 3NL5A 1XDJA 1F74A 4QLKA 5A6SA 3CIVA 1JVWA 1EGZA 1V0MA 3OLIA 1PIGA 3OA3A 3PA7A 6REQA 1PE1A 4XTIA 4IPIA 3GTXA 4IWWA 4RZ5A 1SUXA 2HVOA 1YTEA 2Y7GA 5HXMA 5A3HA 2JE8A 4LYKA 3W70A 3K30A 4JDBA 3IJQA 3ITVA 2VEMA 3WK1A 3EPOA 1ZGDA 2P10A 3I68A 2ZX5A 1F7BA 2VC7A 3SIMA 3CLMA 4QT2A 1W56A 4BWLA 4DB7A 4D2JA 5T9CE 2NXIA 4O15A 1R3WA 3UT0A 3N4EA 4DO6A 1QMLA 1JI1A 3M5VA 1NWRA 1DXFA 1R3VA 3ZMRA 4J7RA 1VFHA 3HM7A 2R24A 2I7GA 1I2NA 3C8NA 2E3ZA 3STEA 3SSZA 4JYEA 3SCPA 3W2KA 4FLOA 4ADTA 3WDRA 4A05A 1CEOA 1OGBA 3UQAA 1DE5A 1QWKA 3BJTA 1RK6A 1TVLA 2BHZA 4A29A 1TV4A 3O5FA 3DN5A 4GZIA 1HKIA 1P43A 3BLIA 3U5UA 3CPGA 3SCVA 2ZX8A 4IJBA 2VN1A 1W17A 1XS2A 4FX6M 4Z2IA 3MZ2A 3VNIA 3E0VA 4JFKA 1KFWA 2PP0A 3KTCA 4LBRA 3L2LA 5SWUA 4ODOA 1IEQA 2HEJA 5HINA 1NQ6A 4L7ZA 1M1BA 4Z2JA 3GTIA 5LNVA 4KH2A 4B5VA 5ABHA 3UPMA 1EBGA 4RZ6A 4DYJA 4NP7A 1W9PA 1OABA 4G9PA 1YE6A 4DM2A 4XG1A 5AOUA 3FN9A 1Q85A 1JZ7A 2E67A 3UJSA 3M7WA 3LPFA 4M7SA 3W7CA 7A3HA 1OJXA 1S3TC 4DIPA 3ARVA 1GZJA 3FEQA 1TPFA 1R46A 3LX9A 4O14A 3GNPA 1JFHA 3GXIA 1S5MA 3MCNA 3GDBA 3R10A 4JX4A 4N0RA 1TPUA 4G8TA 3BL3A 3ZJ8A 3OHIA 2YCKX 3BAIA 3PAJA 2WM0A 3AAMA 2XVNA 3RN6A 4D72A 2E4TA 2PLMA 2PAJA 2BASA 4TW6A 1T8XA 4W9OA 2MLYA 4PUEA 2PDMA 4IFOA 2CZVA 3WKZA 5C70A 4O8AA 4RLIA 4O57A 4CU6A 1VLWA 3H7VA 3VNMA 1F3XA 3A5FA 4A8IA 1WKDA 3QLLA 1G0CA 5LKYA 1L9WA 3UG5A 4JTUA 1FUYA 4JAWA 4DLMA 4DXXA 2J7BA 3CU2A 1OT1A 3PSWA 1UP0A 3MWAA 4L1XA 2C1IA 4B91A 2CEQA 4EPEC 3W7QA 4KFNA 3DESA 2ZX7A 3M0KA 1FWNA 1IXOA 4IIHA 1EO7A 4O52A 3MBFA 4RW3A 1AVAA 1ME8A 1UP2A 1FWAC 3NQFA 1YMYA 2DGAA 1L6SA 4D6HA 4WDXA 3AQUA 3B8VA 1U1HA 1KTCA 5FEPA 2HMCA 2CWNA 1KT0A 4HPHA 2QF8A 1US0A 2J75A 2AGKA 3AALA 3M16A 5I00A 3VIFA 1T0OA 1VENA 3U0HA 3CUHA 1QHOA 4MVAA 4QR6A 2FB3A 4NI3A 2PDBA 1J12A 1XJBA 5KZ6A 2PLJA 2G3FA 1OIFA 1UH3A 3WJXA 2G5WA 4FHAA 1YDOA 5ABEA 5LXXA 4CQBA 3CEUA 3IGHX 3T8LA 4S3JA 3NTYA 3RU6A 4NF7A 4Q32A 1T41A 1QATA 1ONRA 1SYTA 1CWYA 4DWSB 1VZWA 3CV2A 3QOMA 3WNPA 4MADA 3NQ7A 2ZZ7A 2QCCA 2CZDA 2PTYA 1OWQA 3TCEA 3UWEA 3G2GA 2EJ1A 2YA1A 2QPUA 1CPUA 1GZGA 1KA9F 3MT1A 2GQ3A 1QW8A 2PDKA 3DENA 2ZE0A 5FJUA 1JFXA 3NPXA 1J0KA 2WNNA 1FFRA 3VAVA 3WBWA 2WNQA 4ZA0A 4N02A 5J5RA 1PHWA 1NARA 4JHZA 2FZBA 4PUUA 1DP0A 4IIFA 1PKMA 3BOXA 2Y5EA 5C7HA 2WB5A 4XVEA 3WD0A 1GVQA 5CH9A 2HK0A 1F5ZA 4KR0B 1C7SA 5BYWA 1W1YA 3NNTA 1DWFM 2PTZA 2WC7A 2ZDSA 1ZENA 1KLYA 1RQEA 1NFBA 3IUIA 1REQB 1UROA 3R58A 1RK5A 3VGHA 5U7SA 4DPQA 1XLFA 4JNZA 1RCXB 1VKFA 4A22A 2E5BA 2PWGA 1I45A 2BV9A 3A22A 2YCJA 2H3BA 4O0ZA 1H09A 3FNDA 5JUVA 3VGDA 2OT0A 4K6AA 3ZWSA 1OX5A 2UY5A 3WFLA 1Y5VA 4OHQA 1ISXA 3L4XA 4JTKA 1QNQA 1FH7A 3PPFA 4FAPA 4L6OA 3EB3A 1R0MA 3OVGA 3REQB 2D23A 4OWGA 1BYDA 1UZHA 3OLEA 1A0EA 4HYWA 4HHLA 1RUSA 3VOJA 3TN4A 4GUIA 4YVPA 1PS9A 4X0VA 1Q13A 3APTA 3DBNA 1B3ZA 1BEUA 1CLKA 1TJPA 4HYVA 4QE4A 2VCBA 4JFMA 2FIQA 5K7JA 1E4NA 4JYSA 2F6UA 3B4UA 3HQOA 3WYZA 1C8XA 3OIHA 4H9ZA 2XGZA 3WQPA 2PBGA 2Q71A 3FYYA 1IEIA 4P8XA 2DSUA 1DWAM 2I9UA 1JYWA 1XG3A 4OOUA 3RGTA 3JZEA 4O4WA 3U7BA 3W7IA 3FSUA 2OKOA 3JRKA 2TMDA 5BRQA 1NDWA 4HMEA 4Q4PA 4IMFA 4RXFA 3V1PA 3FLUA 4ODNA 4ZB0A 2PB1A 4J3SA 3CQHA 1C90A 3E5BA 5CBBA 4IIBA 3VNKA 3WK0A 3BE7A 6XIAA 2Z2AA 3BLPX 2PDQA 2HV5A 3GAYA 1UYQA 1VQTA 1UUMA 3D5HA 2VURA 3TCSA 4E4PA 3ARUA 1Q66A 2PFHA 3I7QA 3H23A 2QAFA 4HU0A 4LAVA 2QJJA 1TR9A 4XBKA 2YJQA 4PB5A 3UY7A 4Y8FA 4XAPA 2REQA 1EPXA 5CAKA 2NQLA 2RUCA 2OYKA 4JQ1A 4H8HA 1XPYA 5A6BD 4JIRA 2W9MA 4IQEA 3O15A 4WJXA 4R33A 1PVNA 5H8UA 3M0YA 1UD6A 3V0SA 2QIIA 1M3UA 4K2SA 2LJ4A 3WEMA 1PIIA 4RE3A 3ZR5A 1E9YB 1OD8A 3DHFA 2WCSA 3FW6A 3SN1A 4PGLA 3KOXA 1K8CA 1WOAA 3QN3A 4QSFA 3BDKA 4CCCA 3DI1A 4J3ZA 2ZFAA 3WF0A 3GXDA 4MYXA 2QHAA 4NILA 3C4UA 2GGJA 2XP6A 2OSXA 1GK8A 1ZP3A 5DELA 1V3JA 2WZHA 4YVVA 3GKAA 2IKHA 4QLLA 2Z7KA 2WHMA 3P0WA 3QZ6A 5G5IA 5CC6A 4L64A 3QGVA 4EAMA 3ARXA 4GIYA 4IGSA 3DG7A 1G9HA 1XGZA 4JIEA 3N9KA 3MY9A 4AD3A 3EKGA 1EJWC 3T0DA 3P2VA 3WQOA 1F8AB 1B5TA 4N6EA 1XP3A 1GYLA 3W7GA 1VIWA 1AJ0A 3UF8A 4FA3A 1V6YA 4GO8A 1DJIA 1IX5A 3QGAC 1AA1B 4CD7A 4AY8A 1WYIA 1LLOA 4R7JA 4REQB 5DX7A 2GZXA 4FX7A 2BY0A 3GNOA 3RMEA 5AHLA 3CUGA 2Z27A 3HF3A 1FWEC 2BOFX 2DUAA 4AD4A 3S42A 4WDTA 1AW2A 3ITXA 4Z1BA 3BMXA 4QJ1A 3A5VA 1U33A 1MVYA 1XSIA 3DAQA 1B4EA 3JR2A 3O5PA 1J96A 2QR6A 4DJDC 2R1PA 1B31A 1OINA 1OFAA 4PBGA 3H2EA 1T11A 1GGOA 3MSGA 2J66A 3KRZA 2FDSA 2NLIA 3W1UA 3F4WA 3IV8A 4U2YA 4I7VA 3OU8A 2E9BA 5MKGB 2IQTA 3AIBA 4LGXA 1FAPA 4AG0A 3USBA 4X2PA 2AKMA 4P7QA 5IBXC 4UQ9A 4AC1X 3CHFA 1K9TA 4PTDA 2OZ8A 2G0WA 3UR2A 3N19B 2UZ5A 1QI3A 4AB4A 4UQBA 3S2MA 2VX7A 1V6UA 4ZOEA 4K1GA 1EZWA 1RCOB 3RX4A 4CLMA 4F0MA 3H12A 2QCDA 3LMZA 4PEKA 3M6YA 2EBNA 2RUDA 3E1F1 1R3YA 4MY1A 4PYSA 2WZIA 2YCLA 1LM1A 3EYPA 3WJZA 3FXYA 3P8IA 2D0HA 2HVNA 4MGGA 4WVXA 4I6KA 3II1A 4NJIA 3PR2A 1VHCA 2HS6A 1K9EA 2NW0A 1Q4WA 2UY4A 4FOKA 4I9AA 1KM4A 3LHUA 3VKAA 4LUJA 2FZMA 1HX0A 4YCOA 3KAGA 3SURA 2GUUA 1IEWA 1X1ZA 2IMRA 4BR1A 3G18A 4EVZA 1FD9A 3NAVA 3ZLGA 4KCVA 3GDTA 1BXNA 4EPKA 4Q4SA 2D20A 3RYSA 3URNA 5DT5A 4W4QA 3O5MA 4LAUA 4GD0A 4OZOA 3TQVA 2OQLA 1B9ZA 4PCPA 1XSJA 2YL9A 1N7KA 3TYDA 3WUEA 1ZNNA 1JDCA 2HXTA 1VJSA 4GY1A 2XIQA 3DFQA 2OMAA 4I90A 4IIGA 5JIWA 1JQXA 4PUKA 1TWWA 3MV11 4JIQA 4DF0A 4IG2A 3AYSA 3L65A 4HZ7A 1F3TA 3CTLA 1GTHA 5FAJA 1ZPTA 4RZBA 2RUQA 5HJXA 1F9CA 1FTXA 4NAEA 1I0BA 3F2BA 3W86A 4QZVB 1XLEA 4NT0A 3TA6A 3LM3A 3EXRA 3IIXA 4Z2HA 4S39A 4KF1A 1NP0A 5IHRA 2X2YA 4D1IA 2V5JA 2BVDA 5HNRA 3IANA 8TIMA 1JCNA 2PF8A 3W87A 3V0UA 1W9XA 4JTSA 2XP3A 4U4MA 5K9CA 1N1AA 2VQTA 4Q8UA 3B06A 1BG9A 2OOGA 1Q6QA 1TRIA 3AISA 4E0CA 4DRPA 4S3CA 5C2CA 5HUOA 2I5GA 5DN1A 4MIMA 3IKDA 1WUEA 1US2A 2J9ZA 2WZTA 3G0SA 4UTWC 2DP3A 2DJXA 1VBUA 2Y85A 4K8HA 4F0LA 3EXSA 1QT1A 3TOPA 1EYMA 1IIHA 3PUDA 4LYPA 5EFFA 2OSYA 1Z69A 2X1SA 3R0UA 1J4RA 4NJKA 4C6EA 2PV3A 2B31A 3U48A 4MPQA 3AMLA 3NM3A 5AZ0A 3WG6A 4GGHA 1P7TB 1R9XA 1OC6A 1P0NA 1TJ1A 4UMCA 4AU0A 1A50A 4ADSA 2EEXA 2WVTA 3WMBA 5DFAA 1E0TA 1DJWA 4BQ2A 3TTEA 4IGMA 4TR9A 4UC5A 4QJ5B 1V8EA 1X7IA 1XIIA 4FR1A 1IGSA 3G5EA 1K8ZA 3ARWA 1ZRQA 5CXPA 5KSWA 4JFLA 5A6JA 3NZQA 2OVLA 1RZMA 3LBOA 2R6OA 3VM7A 4MKNA 2PZNA 5BOEA 2EJAA 4HMDA 3HGJA 1HT6A 3IJ7A 4FF5A 2QMKA 4D8ZA 3QR3A 4GXWA 5CQ1A 1GHSA 4TV6A 4HHHA 3XIMA 1WO2A 2DIKA 5I03A 7CGTA 3GG7A 1FKLA 1NFGA 3TYBA 2PCEA 4B2DD 2PBCA 1FKBA 2NXHA 4AY1A 1W37A 4B5WA 4DM1A 1Q6DA 3W7OA 3VE9A 3KVKA 3LPGA 5AY7A 1H62A 2E25A 4R53A 2DQXA 1I4NA 3NI6A 2C0AA 1KKOA 1R2SA 4X22A 4MJMA 4CEXC 3H8AA 1F3WA 5HR7A 1DJXA 2ALDA 2XZ7A 4CU8A 1ZJAA 1YDYA 5D38A 3LS9A 4HOXA 3VCNA 2KZHA 2G50A 5D4YA 3RFWA 7XIMA 3B4YA 3GZ3A 4AZ5A 4UR9A 1EX1A 5FJTA 3R25A 4H7VA 2DY3A 1FWCC 4R9XA 1FH8A 4QS6A 2XP4A 3NZ1A 4QLJA 1DORA 2NVCA 4WY0A 1XLJA 2CIPA 1P0KA 1EJXC 4C1NA 4AYGA 1JZ2A 4R5EA 2X41A 5FEXA 3QH2A 2J47A 1BYCA 1FY6A 3SN0A 3H26A 3MDUA 3A3HA 3IKGA 3CTTA 2NLYA 2QXWA 4M1BA 3GSMA 5EY5A 2CNCA 3HURA 3TC5A 2QV4A 2VM8A 4K3ZA 4NU7A 2RDUA 4H9XA 2Z1SA 1OFEA 4FAMA 2X30A 2X0HA 2XIIA 2Z1WA 4K68A 4DEFA 3GO2A 4U3CA 3TSDA 3GXNA 2WMGA 4GQ0A 4BCEA 3QTPA 3M0XA 2BVTA 3E02A 4XIAA 4MKSA 4NVTA 3PJTA 2CBIA 1BL4A 1MMFA 2DZWA 3NQBA 1OD0A 3KCEA 3KX6A 5BRBA 2QCNA 1CTNA 5D8WA 3CAKA 5GNYA 1UBPC 1V6XA 1XLHA 3GTYX 4GUHA 4I3GA 2W27A 3VM5A 4N6FA 3AC0A 1I75A 1LP6A 4IG2B 4IQCA 5IHSA 3O5DA 1BXBA 4IX0A 3WNLA 3W53A 3OGVA 2VFGA 1OM0A 3A9BA 4W85A 2Z28A 3OW1A 5AHFA 2ON3A 4GWEA 3KCLA 3QJAA 2QJHA 4N4QA 3TXZA 1QK2A 3HA1A 3BW3A 1ZK6A 4L6DA 4NAEB 3DC8A 2JALA 3OVPA 2C16A 3KABA 4GZJA 1JCHB 3TE9A 3NQDA 2D3NA 2MF9A 3HQPA 5KEZA 2QCLA 1UUQA 2I5IA 1ENUA 3CGTA 4G2DA 3L4WA 4HN8A 1QI5A 1I1XA 3R2GA 5HW8A 2O7SA 5J6EA 2CLKA 3HG4A 4GUJA 2IKGA 3TR2A 3VOIA 4AZCB 2OT1A 3MMTA 1OHLA 1K6AA 2VD9A 4NG3A 5D2VA 4DO7A 2Z1BA 1K03A 3CNYA 2Q01A 3PZNA 2AQWA 5M17A 4GMEA 2ZZ4A 5D75A 5I02A 3SSJA 2RDWA 2NVDA 3UWUA 1XQKA 2ZQTA 5D8ZA 2BODX 2B7NA 3UI6A 2VRKA 4MWAA 3NSXA 3CPUA 3V1HA 1SFTA 1MZRA 3SW6A 1KFBA 1W31A 3N2TA 3NL6A 3WQ6A 4DBSA 2XGBA 3BOFA 1BTMA 5HANA 3TYUA 2VI0A 3L21A 4ZL1A 4P7OA 2YX0A 4DJFC 3S6DA 5CBIA 1XIFA 1QR7A 4UZSA 4Q4OA 4WSKA 1IWPA 1HXJA 3ZM8A 3UYIA 3VU2A 3SADA 2AMXA 1RY8A 2OWXA 4CNTA 1WBJA 3L9CA 1DWIM 4ZOCA 2EKCA 3FIGA 1U5HA 1WCGA 1NF0A 3Q65A 2QGYA 2F6KA 2PPOA 1L6WA 4TQTA 1G5AA 2ZXQA 2C1HA 3QHMA 4Y8EA 4ASTA 1K7EA 4CUCA 1I2QA 4W93A 1PDYA 5A2BA 5H1WA 4IFRA 4WUIA 4JTIA 4Y6GA 5FACA 4PFMA 4HZ8A 1XBXA 2GJLA 2I16A 3L2MA 2WMKA 2DH3A 2MNRA 4NNAA 4LVAA 1XCXA 3I4EA 3DGBA 1LQAA 4V2XA 2WV8A 3KOZA 3MS8A 2V9DA 3SRFA 4AUBA 3R5EA 3E6EA 4GQBA 4Z0JA 1E0VA 1YHTA 4G56A 1TB3A 4KFOA 3M43A 4LB4A 3N15A 2J7EA 4FALA 1GZ1A 4R34A 2W91A 1QPKA 4TXEA 1JZ5A 1LZOA 1VF8A 4OE7A 3RX2A 1G4SA 1UD8A 1EYEA 2OWWA 4YLWA 3NSNA 5E6ZA 5DY3A 4EPBC 3JVAA 3MUCA 5HR6A 4NJGA 3QMSA 1JVNA 2WW5A 2POTA 4YTUA 1W5OA 3WH9A 1ITCA 3N12A 3RR1A 1P1MA 3BICA 4H00A 1E43A 4DPPA 1UB3A 4DBDA 1A7XA 3WQ4A 4DBUA 1KBKA 2W67A 5EA9A 2E09A 2OU4A 1LL7A 3SGZA 1CIUA 2WSYA 3AZSA 3PANA 4IOTA 2J13A 4UFKA 4CCZA 4ZO7A 4IT6A 4CNNA 4ODQA 1W1VA 4LSBA 3PZUA 4DH0A 3IJIA 3WH7A 2DUZA 3VC6A 3P67A 1GCYA 1CGVA 1P48A 3KAOA 4LBUA 2XFFA 2AL2B 3BSGA 2GVLA 5GQBA 4L80A 4DZHA 3MSDA 3G3MA 2X42A 4GYPA 4KEVA 1HIZA 5GVJA 4IICA 2VKZG 5EFDA 3VKDA 1KRMA 2VR5A 1NIUA 2QJNA 1RD6A 4B9YA 2VZSA 9XIMA 5EMJA 4KEMA 3LCHA 1JYXA 1EJ7L 3P8JA 1P0BA 4INFA 4NL1A 3BAKA 2PPPA 1EZ2A 3WFAA 4CNOA 1OY0A 1LWJA 3VMPA 1S5WA 2G3MA 4I7WA 2VZVA 2HSAA 3GDMA 4KRTA 4GINA 3WLSA 4I9MA 1UR3M 2WNWA 4WX2A 2INZA 1UWRA 4XISA 1ROUA 3UGRA 3DDMA 3NO1A 3TWBA 4DNHA 3WLJA 3R8RA 3RM4A 4UFIA 1Q65A 2BHUA 1FKWA 4JZ5A 1QVBA 4J28A 3VGGA 1JYNA 4YTRA 1NVMA 5KTLA 3ZS4A 2I14A 3PTQA 1AUSL 5I98A 3OOQA 4UIOA 4YJ5A 1UZ4A 2NX9A 2OWCA 5FD0A 3P74A 1I8JA 1FWBC 2V3EA 1BKFA 3PM6A 4N4PA 1EA9C 4PBEA 4JCLA 2ZWYA 3LV6A 4HNNA 2ZRZA 1EX5A 1XBYA 2R91A 2ZYFA 3LA4A 2ZRXA 1X96A 3AHVA 3UQNA 2NUWA 4NZ5A 1US3A 3B0XA 3NURA 3N9RA 2P88A 1RP9A 1EXBA 3NTPA 1KXTA 4KWWA 4IMDA 2DU2A 4JFUA 2WXDM 4O54A 2VGFA 4ICCX 5LIUX 2PU0A 3LCIA 1TV7A 2AWGA 4FZIA 1R9HA 2WJDA 1CNVA 2BGSA 2PI6A 1HJWA 2NXGA 2V3DA 1SR9A 3KTSA 1GOKA 3D6NA 4U86A 5K9DA 5I23A 4Q8WA 1CGXA 2YB4A 4JTAA 3DKLA 2W66A 5BW6A 8RUCA 1O6IA 1KM0A 1QPQA 3O5OA 5M5DA 4WKFA 2HS8A 3USZA 3CZ8A 3PZGA 4KQNA 4L65A 4OUIA 1ITUA 1D8WA 3Q4DA 1BVNP 1W5NA 3E2SA 1QNPA 4IFKA 4ZZ9A 5EKYA 3W2LA 1DKWA 3FA5A 1O1ZA 2XIOA 1KD0A 2XM1A 1O5XA 1SVDA 2ZX6A 3NQGA 2WMHA 3GYCA 5F1VA 3NEHA 1HF6A 1GWJA 4UXDA 3LERA 1R2RA 4RR4A 4DRIA 1B54A 3UW6A 4C6FA 5REQB 3PUEA 1ICPA 2XN1A 2RQSA 3LXAA 1HO1A 1H60A 1XI3A 2M2AA 2JKPA 3LXBA 4S3FA 1QHZA 4GH3A 3VI2A 2ISWA 1J11A 3AJ7A 5KITA 2ZDRA 2ZADA 4W7WA 3MMWA 5FEZA 2P76A 5CSYA 4IGHA 4RZ4A 4LCQA 1BSLA 2SFPA 1MNSA 1IEVA 2EG6A 3CL8A 4LXFA 1S2UA 3FGCA 1RV8A 5AHIA 2J9XA 3MHFA 3UFYA 4QHRA 4ACZA 1FP9A 3KZSA 4NSBA 2NV9A 7REQA 1Y0OA 3H2NA 1JYVA 2FJUB 5C9WA 4CD8A 3SN4A 2VXNA 2NX1A 3ZT7A 2VDGA 3KRBA 3LXCA 1UWAA 1UR0A 4GI4A 4C6IA 6ALDA 3WNNA 3M46A 5DXYA 3ONCA 1NQKA 2Q3OA 3L0NA 3Q37A 1EGMA 3DEQA 5D05A 5H91A 2R9RA 3LENA 1F3EA 3M07A 1TG7A 2VEIA 4X2RA 2DT1A 1LT8A 1E15A 4N42A 4QISA 3GR8A 1FKXA 2VRQA 3W6YA 2DQWA 4LAXA 1AJ2A 4ZQNA 5M2FX 3DUGA 3VIKA 1MRAA 4GQRA 5A5WA 1YBQA 2J8TA 3EOUA 3RU8X 4LS0A 2IUZA 4M6PA 1FKJA 4J3UA 3G1FA 1IZJA 3LTSA 4DJED 3UQBA 1T96A 1UIPA 1BYBA 4Q4KA 4OBSA 3W1MA 3PRBA 4MGVA 1UPMB 2XH0A 1BYAA 5DO8A 1YTKA 4B5UA 1RY0A 5A1AA 3UP8A 4XD6A 4JQAA 1ZZMA 2WPGA 2QDEA 1V03A 1OF8A 2UZ9A 3V5CA 4IIDA 1FWRA 4E4FA 2FJKA 5A8MA 3W74A 4MAZA 1HW6A 4JR5A 4JTRA 4JX6A 3SCOA 4M80A 1RBOB 5HK4A 4DWSC 3KBJA 3ISIX 2A5HA 4PMZA 4H9UA 1LOQA 4K37A 1WX0A 2P8BA 4KERA 3C3UA 1FCBA 4LWWA 1PL9A 5CPMA 3EWYA 1BSIA 4Q4MA 5K4ZA 1H4PA 3L0GA 3TCZA 1B3VA 1X7FA 1ECQA 3LCLA 4WDUA 1OK4A 4WSHA 1CGYA 1DJYA 1ICQA 4QFUA 1XUUA 3T07A 3QLDA 2WHKA 1ZFJA 3GFYA 4D9PA 4XWUA 3L5LA 4ZB5A 3WUFA 1FX6A 4ZGYA 2ZUWA 1LDCA 2VHLA 1Q2SA 3DFSA 4J35A 1FVPA 4C6PA 1AFSA 3THUA 4HPNA 1XINA 3ENLA 2ZXDA 4AHOA 3VIMA 4GNJA 3W75A 2G4JA 3T0AA 3D47A 5DITA 5FL1A 1HKWA 4F2UA 2V5LA 2ZA2A 4S23A 3VIGA 3ATZA 3A3XA 5CCZA 1H7PA 3MP4A 1XYFA 3VNZA 4JTQA 3ODKA 1JF5A 2ZX9A 4ZPTR 4FXFA 1Q63A 5BZAA 2J8FA 1VHNA 1M04A 4Y9MA 3DFTA 3MKKA 4TV5A 3RO6A 1QPRA 1M7OA 5HPCA 4NI8A 2PURA 1KTBA 4JS3A 1OGSA 2YW3A 4AEEA 1GRJA 3TOYA 1L8PA 3STPA 2GWNA 4S3GA 1O7AA 3B0PA 5I2UA 4KETA 5AFDA 3KCOA 3PG8A 3T1GA 5HWCA 3MMUA 2CHRA 2Y7DA 1L6YA 3PG9A 3V5FA 5LHEA 1UG6A 2ZICA 2TRSA 4LVGA 3TLLA 1PKLA 5HMEA 3TJ4A 3WJSA 2EAWA 1XIMA 4Q7NA 3E2QA 1ICSA 3EEZA 1FWJC 2O4MA 3FSTA 2ZUUA 3BAWA 3GVVA 5M03A 4FIRA 5REQA 3WQWA 2DSZA 3ZIZA 4XUGA 2Z1VA 3KAIA 4IZGA 3UEQA 1KR1A 3A6OA 1M53A 3W22A 2WVVB 2UY3A 4ORIA 1AH0A 4PEEA 3KBMA 4M29A 1KXVA 1VJZA 1GQIA 1GYMA 3TX9A 1FKRA 1NDYA 1TE6A 3BCDA 4TO8A 3U5YA 3W73A 2C18A 3CQKA 4GABA 5JIPA 4HBKA 3U57A 2FGZA 3WD2A 1VFLA 4M8UA 4B4HA 4ZFCA 4PE8A 3FKRA 2J24A 2X16A 2NX3A 2Z1KA 1HNYA 3GC2A 1X97A 2HJPA 3UWZA 4KFPA 3CS2A 1MEIA 2A6LA 4P8WA 3SCRA 1EC7A 1LJYA 3NDZA 3TR9A 4H1ZA 3QY8A 3PBVA 4OECA 1JNEA 1YPXA 4OU1A 4GPNA 2WCAA 4I7UA 1OYBA 3S5OA 4AY7A 3W1QA 4XKMA 3HO8A 1V6TA 1CGTA 1SMDA 5D37A 3LU2A 3ARQA 1PCKA 3R1ZA 4CN1A 1ZUAX 5FI8A 2Y88A 2FTYA 2G4FA 1YBQB 1RCQA 3V35A 4GVFA 2EPNA 2O7QA 3GY1A 4AVNA 4CN6A 2JFEX 1Q4NX 1GHRA 3QHNA 2WVUA 1JCJA 4IUOA 1EP3A 4NKCA 3LQGA 3BO9A 3P5YA 3FEMA 4GJ1A 1GVEA 1DQUA 4X9SA 3KOWA 2WAGA 1SM9A 1DQXA 2EPKX 3PZOA 3NR0A 2GPTA 4LAWA 1EF2A 2WMJA 4MB5A 7ENLA 3NQCA 1MQRA 1H7OA 2C19A 2GJXA 4WKAA 3SZ8A 1NWUA 3M0LA 5I5RA 3AMDA 4POCA 1AJZA 3SJNA 3JYJA 2V2DA 1P0EA 1UA7A 4J3WA 4QDWA 4TX0A 2Q09A 1TPH1 3L66A 3SUVA 1GEHA 3N1AA 1DEDA 3B8IA 2ZUNA 2XVLA 2DZSA 2QDDA 2ZOXA 1GPFA 4B5TA 1W2VA 4TVDA 4DHGA 4TVCA 3S1GA 4KCUA 1FWSA 3ZWTA 2XISA 1XYZA 3NVDA 2AQOA 1GORA 3AI0A 1C9WA 3HPFA 4AF0A 1ROTA 3LBCA 2A3EA 4KCTA 1NWTA 5GJPA 1PWMA 3W29A 2O55A 4DI8A 4JY9A 5C8BB 2V5KA 3VYLA 3IGUA 1UW9A 5AYIA 2FGBA 1VYPX 1QI0A 1H3GA 4AMCA 2XWEA 3CAQA 5FA5A 5AC5A 1RJPA 4ML4A 1N55A 5D9NA 3LHTA 4DO5A 4N9BA 5I06A 3ZYZA 3FK4A 3MP5A 4P7NA 4YWIA 2H8XA 5BXTA 1D9EA 4UTKA 2PC8A 2HPIA 3S5ZA 3U4FA 1E4LA 5FAGA 3BARA 4DT4A 5DMYA 1E0WA 2WBGA 4AXNA 4H6KA 2O9RA 2VT0A 4HK6A 1P5BA 4F48A 1MXDA 2VOTA 1HKKA 2ZR5A 4ATDA 3BG9A 3VINA 3LUOA 1X6UA 3NQAA 4M24A 1XDLA 1JXKA 2ZWZA 3QKEA 2IPFA 1J18A 2C3ZA 3TUUA 1SO5A 5EPDA 4U84A 5L6UA 5I3KA 3EY6A 1UR8A 4ZCWA 4E3TA 1M03A 1C91A 4X0NA 4AIUA 2J74A 2DZPA 1F07A 5B7ZA 1YEYA 2WK2A 1MFUA 4NZ1A 3UVIA 1PV8A 1BQCA 3TJIA 2QJIA 4JIIX 4PR4A 3TW6A 1KQZA 2OEJA 4FEZA 4A8LA 3GR7A 1EJVC 4F0HA 1JAEA 2BZNA 1FH9A 3W76A 3NQEA 1F61A 2RAGA 4G5DA 4Z08A 3WLHA 4ZSTA 3LHZA 5HTGA 3VOFA 3P7YA 2O56A 3H2CA 5GPGA 3GG0A 3O16A 4DN1A 4XV0A 4DUVA 3S1XA 5HMSA 1ISWA 1CXEA 4GQGA 4X63A 3WLTA 3GFXA 4DRMA 4TX6A 2ZUTA 1JCYA 2J6VA 1OFQA 4D6CA 1J2BA 1EQ3A 3RM8A 4OV9A 1JCXA 2BB0A 1DIOA 4L3NA 1KRCC 3FDKA 2DH2A 4DBWA 3W7DA 3W7LA 2OTDA 4EOUA 2UBPC 3E0IA 2JIEA 2ZTJA 2DT2A 2W61A 6A3HA 1C8YA 3GHRA 2WOQA 3QZEA 4YIWA 1Z3NA 4OBRA 4M7TA 4L61A 3ARZA 2W62A 5IXEA 4W86A 3AYVA 3OLDA 1V08A 3QYQA 3TW9A 4MZYA 3QZAA 3ZSSA 3GIPA 3MU7A 1FKGA 2A79A 1UWQA 2ITKA 3MW7A 3OGSA 1RXOB 3WQCA 4C1LA 1Z9AA 4CQCA 3R13A 4ZOAA 3N3TA 2RGMA 2CLHA 3T55A 3WFZA 3KXQA 3K8KA 3VKCA 1W1ZA 4UCGA 1YXDA 3RDKA 1GTEA 3ARRA 1EPVA 3GXFA 1TWDA 4LALA 4Y96A 5FOOA 1G4EA 2QKFA 3FAPA 2OELA 1SGJA 3VVGA 2GYIA 4NX0A 2PRLA 1JF6A 1TPB1 3PZTA 2CXGA 2W79A 3O63A 3P61A 5DLCA 3RXZA 4GQQA 1SJCA 1EA0A 1VFUA 4OVXA 2ISFA 1YIXA 3UU0A 3GFZA 1HXVA 4Y2WA 3VGEA 3EWZA 4NNCA 2QCGA 1E0UA 1XLIA 2EKGA 1TPVA 4QBXA 5A6AA 3BLKA 1KRAC 1HVXA 3W37A 1IR1A 4HPJA 2GJXB 2HISA 3N6JA 4PTNA 5EU9A 3PPGA 4IMAA 1ZB5A 3VDHA 4QCEA 4BHYA 2DJLA 6TIMA 2OX1A 4DRNA 4FNTA 4TW8A 3UXAA 1KM1A 2P3EA 2Y4SA 1WQ5A 2GGIA 4UOZA 2TYSA 2Z2BA 3SUSA 5A8PA 2I1OA 2EG8A 5AC4A 3SY1A 1E4MM 3TU9A 3JU2A 1V6VA 4LS1A 1Q6OA 2CZ5A 3M9YA 3F5LA 4HNTA 3NUKA 5DT7A 2VCCA 2XIJA 3AHTA 2YPIA 3G24A 4MDOA 2NQ5A 4TMCA 1EO5A 3W7EA 1CGUA 4IP5A 5EL1A 4RXGA 3N25A 1Q6EA 2RDTA 3Q67A 3UZYA 1C93A 3IK4A 3G22A 4YHGA 4O8RA 3GH7A 3BMBA 2FPTA 4HOZA 2B7OA 2O0TA 5CZ0A 2A7RA 1UR2A 3NM1A 1XBVA 1FP8A 4NRSA 1K9DA 2PGWA 1ADSA 4Q8QA 1AD1A 2DUXA 1DYSA 5LIKX 4ATWA 3HJZA 4HJFA 4ODKA 3DYMA 1YW1A 1XH1A 3VOGA 2GVYA 2HXUA 5EMMA 1I2PA 2B7PA 4XAFA 2ZRVA 3GC5A 4EKJA 4W7UA 5ABFA 2X1IA 4AD0A 4LVDA 1OSEA 3ELFA 1E3XA 2GGGA 4MFDA 3A21A 2WSPA 1RQBA 3NQ2A 4HCDA 3TNOA 4ADUA 1N8IA 2V68A 3FAWA 5A69A 5AC7A 2YKKA 3GBEA 3LSCA 3WMLA 4R0XA 1P6CA 3S2JA 1HP4A 3LCXA 1JAKA 2VEGA 2PDJA 3PPCA 4UZUA 4RKAA 1IZCA 1YXCA 5KZEA 1XISA 3BAXA 1D7KA 3EOOA 5HPOA 3W00A 3HPZA 4MSSA 3F2CA 3TMQA 3S47A 2CBJA 2IXVA 1RH9A 1UKPA 4XK2A 4BF8A 3QXBA 4RPQA 5IBXA 3KOYA 1CLVA 3RGCA 1ZAIA 1X39A 2CETA 2ZIDA 4A35A 4UTJA 5EMLA 4KCWA 2QULA 1XD1A 3M1ZA 3O3RA 1BGGA 4HKPA 3E9AA 2Y7FA 1O5KA 4KBXA 5HQLA 3D0CA 1F40A 3QTGA 9XIAA 5LNRA 2XJ7A 3PUGA 4ZTYA 1E3ZA 4M6UA 4J5NA 1E9ZB 1Y0EA 2G3IA 1ISZA 3DH7A 1E56A 1E9IA 1WDDA 4KS0A 1MXSA 3VMNA 3PRAA 3PPHA 2GK1B 5G1MA 3R94A 2DEPA 1XC4A 1J10A 5C2XA 1TO3A 4JQ4A 3IAQA 3NZRA 2WJZA 4G7EA 1DTNA 2RURA 3MKCA 5FCZA 2FB2A 3NOEA 5HWJA 3MVTA 2WCGA 1KGWA 3AIEA 1ZAHA 2JIWA 3B9OA 4MKVA 5I3IA 3DERA 3KADA 2PWEA 2FZ8A 1NP2A 3VZYA 2WHJA 3CB8A 1MW3A 1QXLA 3U3HA 1HP5A 2PC4A 3AHYA 1YLVA 3H4GA 1Z42A 1QOPA 1RALA 1XFCA 4FNQA 5H8PA 4L4PA 5E0CA 2FKEA 1Q8JA 2E7FA 3EX3A 4Y9PA 4ZODA 3O05A 2JF7A 2XFRA 3AS1A 5HMDA 3VO0A 3CLWA 5KZMA 1FKIA 3THCA 1VLIA 4BFAA 1SW7A 2FPVA 2JBMA 3AIVA 2ZXAA 1DBTA 1M68A 3RG6A 4KRZA 3RR4A 1FOBA 1S1RA 6REQB 2GGEA 5J5DA 4KIEA 3P14A 1UWSA 1XBZA 2CYGA 4WXYA 4CNUA 3OOBA 3CUIA 3ZQ9A 5CKSA 1C9DA 1PBKA 1M9HA 3CHVA 5AZ1A 4IUGA 3P3BA 5A6BA 4KWSA 4XZLX 3D3AA 1D7JA 1Q6LA 1FDZA 1VPXA 1FKDA 5KMYA 3AWNA 5GJMA 1BPLB 2F61A 2OSWA 4GXPA 2O9PA 4HK5A 4JYDA 3GVGA 1X38A 3G0UA 4YMZA 1PCWA 3G1XA 5AKQA 3VABA 2QZRA 4A2SA 1BWLA 2Y5SA 1VFMA 1OC7A 4HSNA 1TX2A 1W5MA 2V5DA 2FYMA 3W7MA 4ZSUA 3W1NA 1W3NA 1RA0A 1A5KC 2XFYA 4ALDA 4NZFA 2G37A 2ATSA 4UCFA 1GQLA 4NXSA 2AGTA 2QF7A 2V3FA 1ZAJA 3ZR4A 3IIZA 3KWSA 3O8AA 3VILA 1CZ1A 2VDIA 3NO5A 1V3LA 4E8CA 1R9YA 4GKLA 4LNYA 3W2MA 5D2TA 5C9XA 2A85A 4W89A 4MDPA 2RFGA 5LA0A 4ODMA 4WY0B 1FKFA 3VXGA 4B5XA 4TVUA 4DIAA 1EC9A 3FYOA 4UTUA 3G3DA 3IEBA 4ZO9A 2W92A 3LYEA 1DIKA 2KX9A 1WBHA 1HVQA 5D2XA 4TX9A 4DJEC 4GIVA 1EFZA 1XYLA 4R88A 2MNTA 1XH2A 4PUDA 4TOQA 2Z25A 3HFTA 4OBTA 1TMQA 4F2BA 2Z1XA 4WQ6A 3GU2A 1J4EA 5CZSA 2OR2A 1QZ2A 4FXSA 1GVYA 1YATA 1KXQA 2W3ZA 1P6BA 1TV2A 3AU2A 2VFEA 2D2GA 3SIZA 4JX5A 2DIEA 2W63A 2Q02A 2ZA3A 1VGAA 1SW0A 4EWND 2ZZ2A 2TSYA 1KFCA 4KGJA 4N2YA 2CLIA 2M1IA 4G50A 1GVOA 1W32A 2J9YA 1ZBCA 1B57A 1D7HA 5TD4A 4UFLA 3R7MA 1JUBA 5GJNA 2AMGA 2OKTA 2REQB 4JGDA 2E5CA 5AC8A 3ZSTA 4RK8A 1JNTA 3PNZA 1Q7MA 1ITXA 5DMMA 1IZKA 2GVJA 4JNMA 3E5PA 3XINA 4GLEA 1E6RA 3L4YA 3ITOA 1FWHC 4GIEA 2VC6A 4AFYA 3FV9A 4LJ3A 3S1WA 3VD9A 3VOCA 2F4EA 3EWUA 3TQ0A 1B3OA 4S2CA 2X09A 1W9UA 3SGUA 1O95A 1SZEA 4UQEA 4RE0A 3RK8A 3UNTA 1TX0A 3VIIA 3GM8A 1C9HA 3QOKA 3VZZA 3SJ3A 1TKKA 2X1UA 3TSBA 4GVGA 3URBA 1PZ0A 3AUOA 4L4LA 5E6YA 1KCLA 4TU1A 4E8GA 4E2OA 1YDVA 2BG5A 1DE6A 3VD5A 1UH4A 5CZKA 2AAAA 2ABAA 2ONEA 2X40A 3RM9A 3VNDA 3CB3A 3L5MA 3RO8A 3NDOA 2CCRA 1VC4A 2PLKA 4QEHA 1HFBA 2PTDA 2ADAA 4QITA 2MANA 1D2KA 2YFOA 4WRHA 1OG0A 4QCFA 4UQCA 2A2IA 3VIJA 1LL6A 3FVDA 4K1WA 2NT1A 3K8MA 3O5QA 2YA2A 2IF4A 2D22A 3WQEA 4LOCA 3ZFHA 1W9BM 4K38A 1TRDA 4K36A 4O18A 1FCQA 1WDQA 2WYSA 5I09A