1WAWA

Specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
365
structure length
365
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE 1
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wawA01
2ZXQA 4OKDA 4DM2A 2W92A 1NP0A 3POCA 3OLEA 3VU2A 2QLYA 3MV01 2EPMX 2MANA 4UQBA 1K9TA 5I77A 2VRQA 1HKKA 5DF0A 4GKLA 1LQ0A 2PWFA 3F5LA 5BCAA 1V3KA 1GHSA 1E6PA 2VC9A 2CYGA 3VD3A 4CU7A 3IAPA 5A2AA 3WF3A 2JIEA 2DT0A 5FOOA 1H11A 1W9XA 2BY1A 4HZ8A 4QLKA 2XIIA 3OA5A 4RE3A 1KXTA 2VO5A 3GH5A 4HTYA 1VENA 3WQWA 4M80A 2WKGA 1E6QM 2VRKA 4U3AA 1M04A 4W7VA 1CECA 4MNLA 2EPNA 2J8GA 4WKHA 1WE5A 1NOFA 2WHKA 3WH6A 1B3WA 1QNOA 5JIWA 1U2YA 4AWEA 1NM9A 1HJUA 4D72A 4AMCA 3M6DA 3WEZA 1B0IA 1Z32X 3VIKA 3PHAA 2GK1B 2ZUNA 3WUBA 3DYMA 1CEOA 3GBEA 4D6EA 1E6SM 2ZX7A 3PN8A 1CDGA 2DT2A 1MFUA 3PZQA 3DHUA 1X6LA 3AXXA 2E9BA 3WNNA 2ZUWA 5I5RA 6CGTA 1DWIM 1QHZA 1A47A 2Y8KA 4PEEA 3CHEA 3A3HA 3KEHA 1TUXA 4E8DA 1VF8A 1GONA 4CD5A 2GFTA 1UKQA 4W85A 4H8VA 4M24A 4MAVA 3L2MA 1JGIA 2WHMA 4KGLA 3IJ9A 3VGDA 4ZENA 3ZT5A 2VCBA 2JEQA 4PTMA 2NSXA 2VL4A 3KL5A 3MMWA 2X1IA 2UY3A 2V3EA 3CBWA 1JXKA 3RJXA 4HPGA 4NSBA 2UWFA 1GQJA 1R87A 3K46A 2O9RA 4CVUA 2ZUTA 3WNPA 1E0XA 2WVSA 3MKKA 1KFWA 4ML4A 4AEFA 1CGWA 1CIUA 3FHAA 3ZSSA 1OT1A 1SMAA 4Q22A 5FCZA 4MNMA 1QPKA 1E71M 1US3A 1BFNA 4X9YA 2VT0A 4JHZA 1W3HA 4JL2A 3QHOA 2YBTA 1WDQA 5IHRA 3NDZA 3CIVA 3ZJ6A 5I78A 3FNDA 1E9LA 1V3IA 1MXDA 1UWIA 4PMUA 4JKLA 2VZOA 4UQEA 1CENA 3ZT6A 1B31A 2XFFA 1BG9A 1JIBA 4D6IA 2J7CA 2ZX9A 2GJXB 2RGMA 1E6RA 3WDIA 3EYPA 3KZSA 4JFSA 1E4IA 2D0GA 2YOCA 3QR3A 5E09A 1LWHA 1MWOA 2D0HA 1ZB5A 3B9EA 1OGGA 3MUAA 1FHLA 3J7HA 3UG5A 3KWXA 2ZXDA 4V2XA 3UR7A 3PZVA 5BROA 3UEQA 3VX0A 2X05A 3CUHA 2VCAA 1C8YA 2JF6A 3ARSA 2C0HA 2E3ZA 4P7LA 4D71A 4CCEA 4B9ZA 2WSKA 4UCFA 1GJWA 2DSWA 4F9DA 1KCLA 1VEOA 1D2KA 3CMJA 3PZ9A 1OBAA 1GOOA 1LWJA 1JXJA 3WD3A 1JZ8A 3QOKA 1VFMA 4MB4A 3AHXA 2J25A 3CZEA 2EQDA 5FKYA 1QVBA 1QW8A 4QCFA 1BSIA 4EK7A 2DSZA 4S3KA 4UZUA 1V3MA 2D24A 1M53A 4J7RA 4XZWA 1V3JA 2J8FA 5GNXA 1TFVA 2UY2A 7CGTA 1UKPA 1K9DA 3VIGA 4TX6A 2G3JA 1J0YA 2D1ZA 2BY0A 1KB3A 1GPFA 5IDIA 5CPTA 1VEMA 2ZWZA 2OLHA 4UFMA 5FIPA 4JFVA 5AYIA 2EBNA 1TMQA 4WKAA 1CXKA 1QNRA 1I1WA 4JZ5A 1ZJAA 4HOWA 3BH4A 1QHOA 4ATWA 4UFLA 3AMCA 2D0FA 1E15A 5GPRA 1E55A 4W8BA 4D6HA 3VGEA 1E1EA 5HOSA 4FLOA 1H49A 2RGLA 1WPCA 4J3TA 4BQ5A 3AJ7A 3RJYA 1CXHA 1B3VA 2OWWA 4D6FA 4FMVA 1NWRA 4GZIA 4H8HA 3VUPA 1V0LA 1CYGA 5DT7A 5A69A 2PWHA 2QMKA 1QBBA 3RMEA 5ABFA 3ECQA 2CEQA 4PCTA 3OBAA 3EDKA 2DIEA 1JL8A 2W91A 5D9OA 3VIJA 2J7HA 3VMOA 1V6UA 2PWDA 3VDHA 4F8XA 2VX4A 2WMGA 1DWFM 1GOQA 1UQYA 2G3IA 4D6JA 4W93A 1ZL1A 2QHAA 1B90A 3L4VA 3LMYA 3WH5A 3ARRA 3MUZ1 3AHYA 1UA3A 1XD1A 3AS2A 3F4VA 2E9LA 1KQZA 3GYCA 4WKFA 3ARZA 2XGIA 1QI5A 1OSEA 3BC9A 3N17A 1OIMA 3AXHA 4XUYA 2J75A 5E9AA 4MDOA 3F5KA 2DT3A 3MUIA 1UH3A 1SMDA 2FHFA 2WVUA 3AIWA 4AD5A 4P8XA 4LPCA 5ABHA 1TZ7A 4X0NA 5HNNA 4NI3A 4QCEA 2XGBA 5BXSA 1GCYA 1G01A 1C8XA 2Y4SA 3VIFA 1EIBA 2CKSA 4CD7A 3AYRA 3ZIZA 4PRWA 1UWUA 2VR4A 3GBDA 3FAXA 4DWSA 1ZS2A 2WC4A 4HZ6A 2YL9A 4HOZA 4W5UA 1B30A 1OCQA 3WMCA 4J27A 2XYLA 4ZE5A 3SCPA 2XWEA 4A3HA 2WVVB 2WCGA 4U2ZA 3K8LA 2C7FA 1V02A 2F8QA 5I0DA 2WMIB 1CTNA 3EDDA 4RE2A 2QPSA 4BQ4A 1WDPA 2CXGA 1V3HA 1MQPA 8CGTA 4MB1A 1J0ZA 5JBDA 1LG1A 3W37A 2WW5A 1H3GA 4DUWA 1V0MA 3B9DA 1Q6CA 1V6YA 2VURA 5A3HA 3ARPA 4W5ZA 1JAKA 2DSVA 4TXEA 3GH4A 3A4AA 5EBAA 3VMNA 1WNOA 1HF6A 1W1TA 3WUFA 1G5AA 2J47A 5DT5A 5GNZA 1AQHA 1I1XA 1G1YA 3EDJA 4GZJA 1WZAA 4UTFA 2WXDM 1J12A 2NT0A 2VRJA 2WC3A 3RM9A 3CHDA 4DWSD 4JAWA 1DEDA 3BSHA 4IISA 2C8NA 1Q6FA 4CUCA 1GOKA 5IHSA 2J7BA 1U33A 4KGJA 1L8NA 2WMJA 3ALGA 4HMEA 4UQ9A 3S2CA 1D7FA 3CGTA 4GQRA 2EPOA 3RIKA 3QOMA 2JF7A 1C7SA 4CU6A 2FHCA 2WMHA 4XX6A 2BHZA 2W63A 1VEPA 2YDRA 3OGVA 5BWFA 1R7AA 2D23A 5IFPA 1JI1A 3IK2A 5D9NA 5A6JA 1O7AA 1MFVA 1TR1A 3BCDA 4PMXA 1CXLA 1CXIA 1HX0A 2JALA 2XPKA 3HJEA 3VPLA 1ZBVA 1TVPA 4CVWA 3FXYA 4H8UA 3WL0A 1ISZA 1BYCA 2CIPA 4GIAA 3WDPP 3W81A 1KR1A 3MANA 3ZQ9A 3N04A 3TOPA 3OLIA 4F66A 1PX3A 1E6NA 2VVSA 1VJZA 1EO7A 1NWSA 2XVNA 1BHGA 2WMFA 3WD0A 1XHGA 5IXEA 1DWAM 3CTTA 4MNKA 2VJXA 3L4ZA 3II1A 3MSDA 1J10A 1W9VA 4GO9A 1E0VA 2A3CA 3N12A 4OBSA 3TP4A 1HL8A 3SCTA 2G8ZA 4CN1A 4R5EA 4MADA 1V08A 3NSXA 2V3DA 3AROA 2ZX5A 5D9MA 4GO8A 3BAXA 2YLLA 4MJ2A 1H5VA 1GOWA 1UD4A 2J7GA 3O9NA 3WQ5A 1KGUA 1QI0A 2J7DA 2ZOXA 3EMZA 3L4TA 4KMQA 4AZCA 1QHPA 3RILA 3MUY1 2E4TA 4L4OA 3AIQA 1JNDA 3SUVA 1JD9A 4X0VA 1Q6EA 1BTCA 5D4YA 2QMJA 1Q4NX 2VCCA 4AIOA 1GUVA 5BXTA 4PMRA 2VMFA 2E40A 5DFAA 4NRRA 3FW6A 2XHYA 2FH8A 2XVGA 1JDDA 5JBEA 3QHNA 3PTKA 2X0YA 2Y24A 4FK9A 4NF7A 1DTUA 2YA2A 2CPUA 1XH1A 2BVTA 1HP4A 5DO8A 1BQCA 1WAWA 1KCKA 3KL3A 1KQYA 3E1F1 4EE9A 1FH8A 1R7OA 3WQ6A 3VIPA 2XTKA 1ODUA 1Q6DA 2BHYA 5LA2A 3UESA 1JF6A 2O9PA 4HA3A 3AMDA 5EMYA 1MQRA 2VI0A 2W62A 2YKKA 2WB5A 1UWRA 2WMKA 1K6AA 2DT1A 2IUZA 2X2YA 3WKZA 1WZMA 5E70A 3NUKA 3WELA 5M3WA 3N13A 1WKYA 1JZ7A 2Y5EA 2G41A 2XM2A 2BV9A 1ISXA 4W86A 4P8WA 5AC4A 1HKJA 3WMBA 3L4YA 2XUCA 1E5JA 3VD5A 4PTVA 1V0KA 2UY4A 3M7SA 5CGMA 2W5FA 3W26A 4F79A 4UFIA 1VAHA 3UG4A 1JF5A 1UD8A 5TD4A 2GDUA 3T2QA 2ZUVA 2XG9A 3VX1A 1XCXA 2OSWA 2PBOA 2VTFA 3CZ8A 3AYSA 1KGWA 2VNCA 1LL7A 1KWKA 3TTQA 4W8LA 2DEPA 2WNWA 3WFLA 1NOWA 3WNOA 1UZ4A 1W3KA 2DH3A 2CERA 3L2LA 2YDSA 2DQXA 4WK9A 2OYMA 2VZUA 2WPGA 3WF1A 3W0KA 3MV11 4JKMA 3WDJA 4D6DA 1XYZA 4OOUA 4QAWA 5A2BA 2HVMA 2E8YA 1ITCA 1E3ZA 2W4XA 3ZT7A 1OINA 1NQ6A 1IT0A 1QI4A 2GK1A 3K1DA 4GI6A 4GZEA 4N42A 3AHZA 1TCMA 2G4FA 2BXYA 3AZTA 3BAIA 5GQBA 1JG9A 1HL9A 1PX4A 3AMKA 3AIEA 1PJ9A 3ZJ8A 3SEPA 3APGA 3W53A 1LL6A 4LX4A 1DHKA 4DUVA 1KBBA 4U5IA 3O2LA 3ZO9A 5A6MA 3PZMA 2V3FA 4LYPA 1YHTA 4U31A 5JBFA 3I3BA 3RPMA 1G94A 3VGBA 2WM0A 2PI6A 1CGYA 3TA9A 5CLTA 1J11A 3KE0A 2YL5A 4OJYA 3SCVA 2PWEA 2W66A 1QNSA 3B9AA 1UR8A 3AMGA 3W6MA 3WFZA 1W9UA 2VZTA 4CCCA 1UH4A 1JYXA 2J7FA 1EA9C 3MS8A 3WDQA 1VBRA 4MJ4A 2QV4A 1UR9A 1EO5A 2ZUUA 3T08A 1V0NA 4PSRA 1CLXA 2J62A 4AZHA 5A2CA 2WZIA 5E0CA 1R86A 3THCA 2XM1A 5C71A 3EDEA 1M01A 3FHQA 4BCEA 5HPCA 1E6XM 4OBRA 4AISA 3BAYA 1B1YA 4LXFA 1ESWA 1E4LA 1YQ2A 2GJPA 4RE4A 1JAEA 3M07A 3SCRA 5A8OA 1OD8A 1E4MM 1HVXA 5A8NA 3MU7A 1UUQA 1GNXA 7TAAA 1FHDA 3S6TA 2GJXA 1UD5A 5CPSA 1MW1A 3GXIA 1J18A 3ZMRA 2YLAA 3TTYA 3PZOA 1JYNA 5M5DA 2BS9A 1HT6A 1UR0A 2O9TA 2WHJA 3VIOA 4BS0A 4E8CA 1E6ZA 3T0BA 1HJWA 1PIFA 1TA3B 1JZ6A 1J01A 4LGXA 1EGZA 3NJ3A 1HNYA 2HISA 3SUSA 1MYRA 1VFFA 1SFSA 1KBKA 3O6AA 1HIZA 4A3YA 4MAZA 1LF1A 4C7DA 2X8RA 1OWQA 3UR8A 1BVNP 1EQPA 2CESA 1CXEA 1EOMA 4UQAA 3GNPA 2WLYA 1XV8A 1UG6A 2YDQA 2OYKA 1ISWA 1BVZA 3WEMA 3ARQA 1OT2A 4FLSA 4P7RA 4YHEA 4HOXA 4Q7NA 4DUXA 5A6AA 4LYQA 2A3BA 3GXFA 1FOBA 4WIWA 4Z2GA 3FAWA 3U7BA 2W67A 4QLJA 4KH2A 2TAAA 3SCWA 1GQLA 3I3DA 4JL1A 1LL4A 1J9YA 3PZTA 3CLWA 3AXIA 3CUFA 4Z2KA 1C93A 4M1RA 3OGRA 4BZYA 2WVTA 1B3ZA 2AAAA 2CNCA 3L4UA 2V3GA 2B31A 1S46A 2XWDA 3LPPA 3QGVA 3VNZA 3CUIA 3BLKA 1ZU8A 5FD0A 1W1VA 4AD0A 3CH9A 4J3SA 3DC0A 2Z1KA 3W38A 3WUEA 4AIEA 1V3LA 2WBGA 2ZUMA 3AZSA 3WNLA 2YA0A 3ZJ7A 1C3FA 1C7TA 1OM0A 2EJ1A 5CQ1A 3UERA 4CN4A 2WANA 3VDAA 2AMGA 8A3HA 4U2YA 1KR0A 4LYRA 1PZ3A 3AIVA 2VX7A 2QPUA 1V6WA 3VD9A 1MW3A 2V5CA 1GJUA 5I24A 3LPFA 4PUDA 4QDMA 2YA1A 1M03A 1WDRA 2J77A 5DEZA 4U5KA 1E0WA 2BFGA 3I3EA 5AYBA 4TVDA 4QFUA 1UWQA 4BF7A 4UQDA 1W9BM 3W82A 4P8UA 3ZR6A 3AIRA 3HU7A 3N15A 4PMNA 1GQIA 5FL1A 2BVDA 1P6WA 3RO8A 3OZPA 1JI2A 3VD4A 1EH9A 2DSKA 4ATDA 1W1YA 3BAWA 4ACZB 1HKIA 3OB8A 1JFXA 1LJYA 4AYSA 3RDKA 4PCSA 1J0KA 4A4AA 3DECA 3GNOA 4NRSA 3SCUA 5HBFA 3W29A 1IV8A 1HJQA 1HJXA 3NSNA 5BRPA 2AOSA 3LPGA 2Y2WA 4N0RA 2V5DA 3W28A 2FGZA 3WH7A 1XSKA 4CD4A 1R85A 1EDTA 1MQQA 3EDFA 4L4PA 3PZGA 2WZHA 1XYFA 1G0CA 4UFJA 4V28A 1W3JA 3ARUA 2YBUA 3W25A 5A8QA 4HU0A 3EMCA 1WP6A 1ZBWA 3CPUA 4OZOA 4MB3A 4HMCA 4Z2IA 1CLVA 2WC7A 2ZICA 3A4XA 4FF5A 1PBGA 4DWSC 3WMSA 1VFOA 1KWGA 1DWJM 4W88A 5C70A 1UH2A 2VQTA 1AQ0A 6A3HA 1BGGA 2ZE0A 3BLPX 4M81A 1UR1A 4ZEPA 1ZBKA 2A3HA 1JZ5A 3CMGA 4JCMA 3CZJA 5E0FA 3AFBA 3OG2A 5CXPA 1UR2A 1FP8A 2BY2A 4B16A 3W6LA 3TONA 1SR0A 1CBGA 1NOUA 1HKMA 1HP5A 2D22A 3OLGA 5CLWA 3PZIA 1XRVA 2J79A 1GW1A 4JFUA 1WB0A 2YJQA 1HXJA 1QI3A 2VZSA 1KXQA 2WVVA 3A4WA 2ESCA 4TUFA 4PBGA 4AD2A 5ECUA 4UOJA 2WMIA 5I79A 1PIGA 1FFRA 1AQMA 1ITXA 4AZBA 3CHFA 2G3MA 4W8AA 1JFHA 3MSGA 3ARWA 1PPIA 4H04A 5EFDA 2BVYA 4RL3A 4LQ1A 3SCOA 2WSPA 2EPKX 3VM5A 3GDBA 4D1JA 3ZM8A 2G3NA 2DSUA 2CBUA 4R27A 2YIHA 4M8UA 2WWDA 4OOZA 4C7GA 3GM8A 2VR5A 4UNIA 3U7VA 1UA7A 1ECEA 3VINA 1H0IA 1DWGM 2WWCA 3UCQA 3ARTA 1D3CA 3WD4A 1VFUA 2E0PA 3CUGA 4FLQA 1FP9A 2XFYA 3T09A 1VBUA 4UOZA 3ZR5A 3DHPA 1BG4A 3DYPA 1XC6A 5A8MA 1XSJA 2JIWA 3ARYA 1MW0A 3WN6A 1PEZA 2XIBA 3AHTA 5ABEA 4J28A 3SURA 1HVQA 2WKLA 2WLZA 1RD6A 3VOCA 4AC1X 1I75A 3WH9A 2PF0A 4YHGA 5AY7A 1EXPA 3LPOA 4PUEA 4AZ6A 4ATLA 4JCLA 1XSIA 3WQVA 3AMLA 4P7NA 4Z2LA 3F5JA 2OYLA 1MXGA 3TTOA 2CCRA 1V6XA 4S3JA 4P8VA 5A6BA 1IZJA 1CZ1A 4W7WA 2EPLX 1AMYA 4M29A 5I6SA 5CSYA 1V03A 4ZXOA 1WZLA 1W2VA 1UWSA 2GDVA 4AZ5A 1J0JA 1PX8A 5I3DA 4JKKA 1JZ4A 3OZOA 3VDBA 1ZJBA 1BYAA 3G6MA 1E3XA 2DPEA 1Y7VA 3ZOAA 3WDRA 1ZBCA 3WD1A 5A6SA 3GTNA 4CN6A 2FGLA 5CGTA 3AS0A 4CU8A 4JIEA 1JZ2A 1W1PA 1F4AA 1E43A 1GOMA 2ZX6A 2IXUA 1JYVA 2BY3A 5HPOA 3WF0A 1X1NA 2ZXAA 3U5YA 5D8ZA 3VDCA 4TTUA 4PMDA 5KEZA 4H7VA 5D9PA 4MPKA 1M7XA 4H2CA 2A3AA 4DM1A 1A3HA 5A6KA 3RM4A 1UZ1A 4PTXA 2CBJA 2GVYA 1NARA 5A6BD 2FHBA 1MVYA 4YN5A 3WENA 2WBKA 2E9MA 2WAGA 4AIUA 5BYWA 4EKJA 5A95A 3D5HA 3ALFA 3AQUA 4AZIA 3BAJA 4XB3A 3W24A 3WUGA 3SCNA 1H0GA 3IAQA 2V38A 4B3KA 3TTSA 3RM8A 1ODZA 5I23A 4AEEA 4V27A 1QI2A 4GQQA 1OD0A 4PMZA 1RH9A 2DDXA 3N9KA 4WF7A 1OGSA 2A3EA 1H4PA 4HZ7A 3WF4A 5CZKA 1E5NA 4PMYA 2CETA 3SUWA 3D3AA 3AIBA 2CHNA 1FH7A 1HN1A 1N82A 1LLOA 4M82A 3WNMA 4ZE4A 4JFTA 1WCGA 1UKTA 4GPNA 2J74A 2DIJA 4PN2A 2XVKA 3A47A 5AC5A 3JUGA 4TX8A 2XFRA 3T0AA 2VQUA 3VGFA 1GORA 1HJSA 1NWTA 4HA1A 1UKOA 5I2UA 2YL6A 4GXPA 4CD6A 3GXDA 3MO4A 4PYSA 3AOFA 2D20A 3WSUA 4AZ7A 5JH8A 1CXFA 2WYSA 1HJVA 4UOQA 1E56A 1BPLB 1V6VA 3AS3A 1UWTA 1XH2A 2EXOA 3WL1A 2XVLA 4MTVA 1J0IA 3AS1A 3VO0A 1CGVA 2WCAA 3PZNA 1QNPA 4HPHA 3N11A 5HDRA 2F2HA 1X6NA 4IPNB 4KRTA 4U3CA 4CGTA 4U33A 4PTWA 2JE8A 4P7QA 5JUVA 3CZKA 4ZFMA 1JZ3A 1H41A 4BA0A 4BQ2A 3WF2A 1QOXA 4HMDA 1B9ZA 3VKKA 1CWYA 4ACYA 4JHOA 1AVAA 3W4RA 2BHUA 4AXNA 2OSXA 3CO4A 5EB8A 4WLCA 3UG3A 1ISVA 3WY1A 1E1FA 3N1AA 3OLDA 3A6OA 3BSGA 3VD7A 1UD2A 4W7UA 5E6ZA 1VJSA 3GZAA 4TVCA 4IM4A 4PMVA 3AHVA 4GI9A 1E73M 1XD0A 1GVYA 2XSAA 3L4XA 3VNYA 2CBVA 1H2JA 3EBVA 1CPUA 2XSBA 3VM7A 2OWXA 4TVUA 2GSJA 4MNJA 3IANA 5ABGA 7A3HA 2VUYA 1R8LA 5ABFB 4AD1A 1KGXA 4XZBA 3NYDA 3OGSA 4KRUA 5LYRA 3MMDA 1XH0A 4UFKA 2W61A 3T2OA 2OWCA 3VGGA 5C8BB 3AICA 1TE1A 1US2A 1ISYA 4EANA 1L0PA 1CGXA 1WDSA 3NCOA 2X09A 4B9YA 3WDHA 1NP2A 1V02E 3ZSTA 1VB9A 6TAAA 1JNEA 4B15A 2PWGA 2BNJA 1SYTA 1OB0A 1C90A 3U57A 2J4GA 3IJ8A 1EOKA 5E6YA 5LA1A 2EO7A 1JYWA 4J3WA 4HP5A 2CBIA 4MDPA 1IZKA 1PZ2A 1OIFA 2VX6A 4WJXA 1EQCA 1H09A 4IPLA 3K8MA 2NT1A 2WHLA 3WEOA 1WZKA 1UHVA 1E4NA 4AZGA 4C7FA 3WIJA 3WBEA 4HU8A 4E2OA 4D6GA 3SUUA 4AD4A 3FY1A 1B2YA 4MB5A 3BMWA 4DWSB 1FH9A 2IXVA 2O92A 2D2OA 1FA2A 4XV0A 5A94A 1BYDA 1J0HA 2WZEA 4BQ3A 2Y8VA 1H1NA 4W89A 4Z2HA 2QF8A 1BGAA 1E70M 4GINA 1KXHA 3AI0A 2VZVA 1TVNA 5A8PA 3WBAA 1UQZA 5LA0A 4F9JA 4UFHA 2ZIDA 1RPKA 4JFWA 1GHRA 3THDA 2ZWYA 2YL8A 1CGTA 2OSYA 3CUJA 3DYOA 2PBGA 3ARXA 4PSPA 1F4HA 1C8QA 4K68A 5EFFA 3K4AA 1Q6GA 1UD3A 1BLIA 1GVIA 4CKQA 1W91A 1GQKA 4M56A 3VVGA 5M03A 4FLRA 1C91A 1K9FA 2Z1SA 2EEXA 1B3YA 1U30A 1QW9A 2BXZA 4H41A 2ZUSA 4D6CA 3WD2A 3VIIA 3GH7A 3VMPA 1TA3A 4QP0A 4QLLA 3AIUA 1VIWA 1UOKA 2GJRA 2X0HA 1XCWA 3SCQA 4YPJA 5BRQA 3MMUA 3ARVA 4AD3A 1FFQA 2CITA 4OUEA 2ZX8A 1UYQA 4TTGA 3T2PA 4Z2JA 5DMYA 1OGBA 2PB1A 3NIYA 3VTRA 1UD6A 5CG0A 1JDAA 5FL0A 1QBAA 1BF2A 5HXMA 2JFEX 4IUGA 3PBGA 5M17A 4HA4A 5JIPA 3BCFA 2JEPA 2D3NA 2PC8A 1O6IA 2Q8XA 3BMVA 3SCSA 2J78A 5GNYA 3WH8A 1BAGA 1DP0A 1KXVA 3PTQA 3CZGA 5CJ5A 1K9EA 1LG2A 1PAMA 1MW2A 3PZUA 4AW7A 3VIHA 2WK2A 3VIMA 3POHA 2D3LA 1CGUA 4CD8A 2XVPA 4W87A 3NDYA 2WCSA 5CPQA 3M46A 5KZ6A 3NSMA 2CKRA 1B3XA 1CNVA 4W84A 2CHOA 2DH2A 3CZLA 3U5UA 2FDMA 3FN9A 1WO2A 1EDGA 3PTMA 3WQ4A 1UR4A 4GI8A 1RP9A 5A6LA 3UETA 1E40A 2ZXBA 1NWUA 5BXPA 3QHMA 2F61A 1BYBA 3K4DA 4J3XA 2XJ7A 2VOTA 1E72M 4PMOA 4NZCA 3G6LA 3BGAA 4UR9A 3AISA 4E4PA 1GZJA 5A1AA 4B3LA 3RCNA 4PMQA 1EHNA 1C92A 3N18A 4TOQA 4EAMA 2J7EA 4J3VA 4AZCB 1W9PA 1UKSA 3W27A 4CCDA 1JDCA 2UY5A 3WQ8A 1TG7A 5CSUA 4ZXLA 3EMQA 4AY1A 3SUTA 1NH6A 5D8WA 3KL0A 3BAKA 3HMCA 1W2PA 1W9DM 4UQCA 1DWHM 2GUYA 4ACZA 1VRXA 3ZJKA 3VGHA 3OIHA 2NW0A 3SIMA 4UZSA 3HN3A 3L4WA 1W3LA 3BXWA 4Y7EA 4J3UA 1EDQA 3GNRA 3IJ7A 1W32A 3K8KA 4OIFA 3CHCA 3B8SA 4KWUA 9CGTA 2E8ZA 3WNKA 1XGZA 5BXRA 1EHAA 1QNQA 5F7UA 3AZRA 2DGAA 3GXMA 4D1IA 1RP8A 4WSJA 4URIA 2VX5A 1JD7A 4WSKA 3T0DA 1GOIA 5IFTA 2FH6A 2O9OA 3VILA 1G9HA 2VVNA 4P7OA
chains in the Genus database with same CATH superfamily
4G7EB 4DWDA 2AL2B 5LIYX 2W92A 1UP3A 3W1LA 1QPRA 2EF9A 3MV01 1K9TA 1EEPA 3A9IA 5AVHA 1KBLA 4QGCA 4V1YA 1FKGA 3E96A 3H26A 1V3KA 1BKHA 3HPXA 3WJXA 3VD3A 3KCJA 2JIEA 3AXMA 1QPFA 3CAQA 1HO1A 4JTUA 2DT0A 5FOOA 1WBJA 3T40A 1W9XA 2BY1A 3OEXA 3NTPA 4HZ8A 2OGJA 4QLKA 2XIIA 4IGSA 2I56A 3OA5A 2VO5A 4GY1A 4HTYA 4Y2WA 5K4ZA 1R9XA 1T96A 4ZO6A 1DORA 3LCIA 1M04A 3UW6A 3F2DA 4GX9A 1KM4A 1B3WA 1EUAA 3TV8A 4ODLA 4ODQA 1U2YA 4ZQPA 2V63A 3BLDA 4D72A 3M6DA 3WEZA 2CZ5A 1B0IA 5B7YA 4LCSA 3QY7A 2E25A 1KM1A 2VYOA 3WMLA 4IPJA 4D6EA 3PN8A 3A24A 1TCDA 2DT2A 4H9UA 1L6SA 1X6LA 3AXXA 2DFAA 2E6DA 5I5RA 2IPFA 1TR9A 4B4FA 1TX0A 1QHZA 1GYMA 3BG3A 1P1XA 1DXIA 2QUTA 3O1NA 4DRPA 1YNQA 5B80A 3LSCA 3LYEA 1E44A 3WYZA 3KEHA 1TUXA 1A5MC 5LHEA 2D73A 1T5AA 4IUOA 3R8RA 2OFJA 2ACSA 3F03K 5HTGA 4MAVA 3L2MA 1JGIA 4KGLA 3LI1A 4EIVA 1XUZA 3SN0A 3ZT5A 2DVUA 3MMWA 2X1IA 4LAMA 2V3EA 3U2ZA 1JXKA 3V16A 3V35A 1GQJA 1R87A 3K46A 4ZOEA 1HG3A 2XZ9A 3E9AA 1LT7A 4DELA 2ZUTA 3THQA 1E0XA 1EFZA 1IEVA 2X42A 3GHRA 3MKKA 1C9WA 2OOGA 4IQCA 4JN6A 3FHAA 3ZSSA 2ZRUA 4U28A 2LLEA 4O17A 4PRRA 3KHJA 1KTBA 1XLCA 4IJBA 2GSHA 8XIMA 1FXQA 5LNRA 3QHOA 2HTMA 3ZJ6A 3P3BA 3GKFA 3IK8A 5LGXA 2VZOA 4BEQA 1S2TA 2EG7A 3B9NA 4W9QA 3PUOA 1BG9A 1JIBA 3CIWA 3TWAA 1G4PA 4DPQA 2GJXB 3MI3A 1E6RA 1U83A 1ZCOA 2W27A 1OFPA 3GNXA 4MLRA 1MWOA 3N6QA 1ZAJA 1ZB5A 4GVGA 3B9EA 4GIEA 1FHLA 4M51A 3UG5A 1EP1A 2NV1A 2X30A 2PPGA 4XO6A 3I6CA 4C1NA 2X05A 2ZZ5A 1H7RA 3FK4A 2V2CA 1E9YB 1DE6A 2C0HA 3C3NA 1A5CA 2R1KA 2OZTA 2DSWA 3PUGA 4F9DA 1KCLA 4L1XA 5H8UA 3UJRA 1A5BA 3TYBA 1ZTVA 5DIVA 1GOOA 3CAKA 1LWJA 1T0OA 2IQ0A 1JZ8A 4Q4QA 4MB4A 2ZVIA 2RH9A 2J25A 3QH2A 4MKNA 3CZEA 5HMFA 1PCKA 4RDWA 4E2VA 1V3MA 2D24A 1IIHA 1JCMP 1M53A 4XZWA 5HQEA 2X16A 3UZZA 1VPYA 1AMKA 5FEXA 3VIGA 3VFCA 3EX1A 3IIZA 1NSGA 3UVAA 2NZLA 3QZAA 2PWVA 4UFMA 3DENA 1VP5A 1AJZA 5AYIA 2OFNA 4WKAA 3GS6A 4I9TA 3TC6A 4X61A 1QNRA 1I1WA 3ITXA 4N02A 1QHOA 1SW0A 5F2IA 4ATWA 3AMCA 2J88A 1DHPA 1E1EA 4I6VA 4FLOA 2RGLA 5FAJA 3RJYA 1YBQA 1VC4A 2FMNA 4D6FA 2TPSA 3GKAA 3EKGA 3VUPA 3G0SA 3GW0A 3RK8A 1WKDA 2P50A 1KV5A 1T41A 4C65A 3DG3A 3G77A 2PWHA 1QBBA 5ABFA 3ECQA 1B4KA 3WLNA 4IGMA 4DBUA 4HB7A 1I2PA 3PSWA 3DFHA 5CAKA 4KWWA 3IVSA 1YE4A 1MDRA 4S3FA 3EX4A 4QNEA 5CPLA 4IG2B 2XZ7A 1UA3A 1RY0A 1XLHA 3F4VA 1N8FA 1NY1A 1L6FA 4JFJA 4UTMA 3GYCA 3N25A 1XLAA 2XGIA 3TLLA 3BC9A 2J75A 3ZS4A 3N6HA 4L4MA 1IZCA 1DVJA 3ORWA 4X60A 2JGYA 2NV2A 3QSRA 2FHFA 4E2BA 3RX4A 2WVUA 3N29A 1N1AA 4P8XA 4JIHA 4LPCA 6PTDA 1H7NA 1TZ7A 3R0DA 5DQPA 3GX9A 3IVUA 1W56A 4QJ4B 5BXSA 3SN4A 4BHYA 3IACA 9RUBA 5HR7A 3ZIZA 4RKAA 2P53A 1Q8JA 4HZ6A 4O1AA 1B30A 5JXQA 4XSLA 1K3UA 3G2GA 4R3UA 4ZE5A 2KZHA 5JU6A 3FFSA 3WK3A 2PZNA 1H62A 1X8FA 3O0KA 1ZHAA 5I0DA 4Q8WA 3KLKA 2AQWA 4BQ4A 2Y63A 2C1HA 4B2DA 2CXGA 1V3HA 3PULA 1Q7MA 2FLIA 1MQPA 2AMXA 3NZ1A 3RGTA 1G4SA 1J0ZA 3TK7A 1LG1A 3JU2A 5C6MA 2FTPA 4IJCA 3B9DA 1Q6CA 3MUCA 2VURA 1SFTA 4E3VA 2ISSA 3GVWA 4TXEA 4GBUA 3V5OA 3O8AA 3NL3A 4PB4A 2PRMA 1W1TA 3M5YA 3TE9A 2BGQA 2YPIA 4C90A 1J12A 2VRJA 3K13A 3RM9A 4QIBA 4ZPTR 2PMQA 3WLHA 1DEDA 4IISA 1IT7A 5IHSA 2J7BA 4KGJA 3W2NA 4YCPA 1XYMA 1VHCA 4UQ9A 1WOBA 4JYEA 4Y9PA 3CGTA 1K7XA 1DIDA 3CL8A 3DU0A 3RIKA 2F2KA 1PXGA 2PDYA 1P5QA 1C7SA 2JF7A 2BWGA 2BHZA 2W63A 2NQ9A 4IT4A 4PEKA 1VEPA 3KCLA 4LAUA 1G4EA 1R7AA 1F61A 4DJEA 3M0MA 3VCCA 1JI1A 1O7AA 3OQ8A 3TKFA 1TR1A 4JOMA 3GFYA 4PMXA 4G8TA 4YWIA 3C4UA 4C6MA 3UWUA 3E0FA 1YE6A 5CKSA 1SSDA 5BOFA 1FWHC 4GQGA 3RCMA 1TVPA 1DV7A 3TFXA 4CEXC 5T9CE 3P60A 3LV5A 2D9FA 2X41A 1IWAA 3DESA 2HNHA 4O0ZA 5AVNA 4HBEA 1KA9F 2UV8G 1XLBA 1GTEA 4XIAA 1VJZA 1OZQA 4GJJA 3G22A 3IUDA 2OZ0A 1F7BA 4XUGA 3EPMA 3ZXWA 4H19A 1XHGA 1C8VA 4DPPA 1A5NC 3CTTA 3IUIA 1LROA 3VA8A 4O14A 2VJXA 4CNNA 3DCPA 3L4ZA 1O60A 1AA1B 3CYJA 2KI3A 1J10A 4AG0A 3CV6A 4OBSA 1HL8A 4LBSA 4MADA 4S3DA 3NSXA 3OPSA 3R1ZA 5D9MA 4GO8A 1MEHA 2R14A 3OHMB 1GOWA 4TIMA 1QI0A 2PTWA 3ZFHA 5D2TA 2FKEA 3LHVA 3YPIA 1QZ2A 3DGRA 5G2IA 3HFTA 4UMBA 3AIQA 4Q6XA 3SJ3A 2HE8A 2JK2A 3OODA 1JD9A 1IR1A 3KAOA 1R30A 1Q6EA 1BTCA 5D4YA 2RSEA 4HSNA 1Q4NX 4MWAD 4C02B 3IIPA 3BQ5A 3WG6A 1QNVA 4PMRA 2PLMA 4LAXA 1SSGA 3FW6A 2P3ZA 2XHYA 1E51A 2Y24A 1W37A 3DGBA 4NF7A 2YA2A 4ZTYA 4U86A 2M08A 3PBWA 3MUXA 3DC8A 3UZJA 4IH3A 3C0LA 1BQCA 4QTGA 2AL1A 3ITTA 1R7OA 1Z48A 3VIPA 3SSZA 3O5KA 3SI9A 1ODUA 1Q6DA 2ALDA 3WLPA 3UESA 1IT8A 4KEMA 3EIPA 4HA3A 3KBVA 4AF0A 4LT9A 2W62A 4E38A 2DT1A 2IUZA 1W1ZA 1YPXA 2B81A 1WKYA 1YEYA 2XM2A 2XPAA 2BV9A 4RV8A 5CC6A 4P8WA 3MYPA 5AC4A 3THUA 2PTXA 3BE7A 4ICMA 4PTVA 4IHCA 1J4EA 3CXOA 3BOLA 1IHIA 5CGMA 2W5FA 3W26A 4JN8A 5CZJA 1VAHA 4U84A 2OEJA 1UD8A 1H5YA 2Z7GA 2XG9A 1IR2A 2ZDSA 3HM7A 3GB6A 4WEVX 3BLIA 3ENLA 3CZ8A 5RUBA 3AYSA 1G7UA 1KBJA 3DH7A 3N9SA 3QFWA 1TPDA 4W8LA 2DEPA 1NOWA 3EXTA 5G2WA 3WNOA 2RUQA 3AUJA 2VZUA 2WPGA 3MMTA 4QAWA 5A2BA 1EJSC 4DH0A 1DJXA 4NJGA 5J5RA 3VOGA 4MKSA 3W7GA 1YPIA 1NQ6A 4N19A 1EJUC 3K1DA 1SW3A 4ZA0A 3AHZA 3HFYA 3L68A 4LEFA 1J2WA 3ZJ8A 3VNMA 3B9OA 4U5IA 3REQB 3O2LA 1OG6A 3PZMA 2V3FA 4LYPA 3AYTA 2Y85A 1SQ7A 2M2AA 5JBFA 3IGUA 3VGBA 2HV5A 2ZA1A 3KX6A 5FI8A 4K1WA 1CGYA 3TA9A 4DJDD 1QNSA 3AMGA 2VEGA 1ZUAX 4UC5A 2VZTA 1MDLA 3U4AA 3UR2A 4ZO9A 2CZFA 5D38A 3ZVHA 3P2VA 2NX3A 3DKJA 2BTMA 3WDQA 1TV2A 3WQOA 5MHBA 2ZUUA 1A0DA 3T08A 2ZRZA 5DY3A 3BV4A 4PSRA 1O5RA 3DBNA 4CQAA 5G5IA 4LYKA 4ERGA 4KKXA 1V77A 3MHGA 2E77A 3NPUA 1XLLA 5K3VA 3ONCA 2XM1A 3IJ6A 1J8VA 3PWGA 3BDKA 2PDWA 2VEIA 4GUFA 4ZZ9A 1YW1A 4AX6A 3W7HA 2Y8UA 1ESWA 4OGZA 2GJPA 1JAEA 2R6OA 5TAOA 5A8OA 1RCOB 1LDCA 1HVXA 5A8NA 4POCA 1XIDA 3F7JA 4AAJA 1TIMA 1RBOB 2V30A 1J18A 4UR8A 3TTYA 4LV4A 4E4FA 3Q94A 5HWMA 3NPXA 4E8CA 5HUPA 2ASHA 1EJ7L 1TA3B 1R5YA 1J01A 2JQXA 4FZIA 3NJ3A 2HISA 3SUSA 3TN4A 5FEWA 1GK8A 5G4EA 4FI4A 2Y1HA 1HIZA 4MAZA 3GU2A 4AY8A 4IFOA 2CESA 1XV8A 4E6MA 1UG6A 5H8MA 2YDQA 4LW7A 3FIGA 2OYKA 3ARQA 1OT2A 4YHEA 1NSJA 3SAZA 3O3RA 5LHFA 2A3BA 3GXFA 3PNZA 4QLJA 4KH2A 2TAAA 3I3DA 2J9XA 3BOFA 4L6OA 2P0IA 4I8DA 2CWXA 3R5EA 2A7NA 1W3TA 3CUFA 3GIQA 4Z2KA 1C93A 4O54A 2FB3A 4BZYA 1JQXA 2QUUA 3S47A 1Z8AA 3BLEA 3KRSA 3UI5A 4MHBA 2CNCA 2V3GA 4L61A 2B31A 3BLKA 3S5SA 5DRCA 5FD0A 4HBKA 1SO4A 3DC0A 4XZMX 1XPYA 2WBGA 2ZUMA 1J4IA 3E2SA 1TPWA 3ZJ7A 1C3FA 5I7GA 1OM0A 2EJ1A 3N34A 3T05A 2WANA 3UA4A 2AMGA 3NGFA 1V8EA 4UCGA 2ZKMX 2W0UA 5LIXX 2QPUA 2QJGA 3ONBA 2B5UB 1LOQA 2V5CA 3CASA 3EWXA 4PUDA 4FX7A 4X9SA 4ZPVR 3T6CA 2UZ9A 4HJWA 4ZO8A 1B57A 5CC5A 4MFDA 3TAKA 3TQPA 4BF7A 1W9BM 3W82A 4YTSA 3AIRA 3HU7A 1RD5A 4KIEA 3W7KA 1AG1O 3OZPA 1JI2A 4WVXA 1UJPA 3NURA 3VD4A 4PH6A 3ZYZA 1LJYA 4AYSA 1XIJA 3GNOA 3UJSA 4GQ0A 4NRSA 3SCUA 1E9ZB 1QT1A 2QJNA 1TPVA 1DJIA 3RR1A 2YW3A 3V0TA 4PB3A 4RZBA 4L4PA 1TREA 3PZGA 2PDKA 4V28A 2YBUA 3W25A 5A8QA 2CLEA 1ZBWA 3CPUA 5HWJA 4Z2IA 1CLVA 5B8IC 4DWSC 3MVTA 3RUBL 4DZ5A 4NAFA 5C70A 3PAOA 4M81A 4ZEPA 3NQGA 1JZ5A 4KETA 1FP8A 2BY2A 3W6LA 1SR0A 1UZHA 2VFEA 1NOUA 1TWSA 2H9AB 1HKMA 3C2YA 2HK1A 1XP3A 2D22A 4F0KA 1LBFA 3PZIA 4HBOA 2J79A 1UOZA 5D04C 2YJQA 1QI3A 2WVVA 4UTIA 3D46A 1XF0A 1ZALA 1KFBA 4LB4A 3UF9A 1U22A 4PBGA 4F4RA 1FY6A 4UOJA 3JZUA 1PIGA 1FFRA 5CBJA 5MF5A 3S1WA 2YCEA 2G3MA 4W8AA 4J4OA 3MSGA 2YR1A 3L65A 4LCQA 2PDLA 2J24A 3GDMA 1PPIA 2GYIA 4LQ1A 4B5TA 3MYOA 4HN4A 2DSUA 2CBUA 5CGQA 2YIHA 4ZFCA 3HURA 3ANYA 5XINA 5ECVA 4PCNA 4BF8A 4AH7A 3U7VA 1ECEA 4KCWA 1TJRA 3ITCA 2QULA 3ARTA 1D3CA 2QEZA 4E8GA 4LF1A 3EWWA 4C6OA 1FP9A 2XFYA 4NP7A 3CM4A 1VBUA 4UBPC 3ZR5A 5HJYA 4PBFA 5A8MA 3PNUA 3QGKC 4QZVB 4LUTA 3CPGA 2RURA 2RUCA 4KS0A 3ARYA 3KBWA 4L1WA 3I6EA 4QITA 3V0SA 3SW6A 3V7PA 3UCCA 4GY0A 4AC1X 6XIAA 5HW8A 1I75A 2QR6A 1JUKA 1CB7B 5AY7A 1EXPA 4DZ2A 1TZ9A 4JCLA 3WQVA 1H51A 3W1UA 1V6TA 1SGJA 5F4WA 1ZNNA 3VOHA 4P7NA 3F5JA 3FA3A 3TTOA 4Z0JA 4P8VA 3LNPA 2NUYA 1XBZA 1QU4A 5BXJA 5I6SA 1TPC1 3SDOA 2PODA 3M16A 2P8CA 1PO9A 1BYAA 4DYEA 4W9TA 1E3XA 5HKGA 2PTDA 1Y7VA 4A8IA 9XIMA 2MPHA 1FWNA 3H4WA 3HPAA 4GXMA 3WDRA 1ZBCA 1P1MA 2REQA 3UP8A 3WD1A 3NM3A 3GTNA 4CN6A 3M47A 4K39A 4LEQA 1GQNA 3JVAA 3EWDA 2VFGA 1MI3A 2G4JA 2QPXA 1R9YA 2E7FA 4CU8A 1FWDC 4JIEA 1LOSA 2QCLA 2V68A 1F4AA 4S1FA 2VXNA 1LBLA 4H6RA 4KR0B 2RDWA 5E9XA 3EAUA 1AW1A 2VDGA 1RAKA 5LSMA 3TSMA 4TTUA 2Y61A 3C2EA 3LQGA 3LRLA 3R8GA 5D9PA 4HYWA 4NJIA 4QAIA 1P0KA 4DM1A 2AQOA 2Z7KA 5A6KA 3EOOA 1EX5A 2ZQTA 2WBKA 1FRBA 5E0KA 2FIQA 4EKJA 3GU1A 1PTGA 4ORIA 3S6DA 2V38A 4IQJA 3GC4A 1ODZA 3LY0A 2JKAA 2Z25A 3VC6A 1H4PA 3GUWA 4QG6A 5HULA 1A5AA 1E5NA 4PMYA 4HGXA 2CETA 1TJ2A 3AIBA 4H7CA 3LBCA 1N82A 4XD4A 1DQUA 1QOPA 4EF9A 3N73A 5EA9A 2DIJA 4TX8A 3ME3A 3F4DA 1GORA 4BJHA 2JKPA 2YL6A 5D2WA 1TRIA 3GXDA 4BF9A 2D20A 1VFSA 3KTSA 3F4WA 2IKJA 5JH8A 5K9DA 2BOEX 1BPLB 1MXSA 3W7EA 3WL1A 3BW3A 3B8TA 3HO8A 1CGVA 4RX0A 2WCAA 1QNPA 3N11A 5HDRA 4C91A 4IPNB 4U33A 1TUFA 4P7QA 3CV7A 5JUVA 3CZKA 1S2CA 3PR9A 3MP3A 1QOXA 2C6QA 3VKKA 1CWYA 4G2DA 1AVAA 4GC4A 4AXNA 5MKGB 2YYUA 3P81A 5EB8A 1ISVA 4K7VA 3OLDA 3A6OA 4AHOA 4RW5A 3BSGA 1UD2A 4FEZA 1YPFA 4EVZA 4O4VA 4PMVA 3MO7A 5HMEA 3L4XA 2R1PA 3VNYA 3S0CA 4W4QA 4BWLC 3TN6A 4IL0A 7ODCA 3UYIA 3CYVA 1AFSA 3EBVA 3S5YA 3VM7A 7XIMA 2OWXA 3GDRA 4TVUA 1WXYA 3IANA 2VUYA 9XIAA 1R8LA 3TJXA 3NYDA 3OGSA 5AYZA 1M1BA 5LYRA 4J2MA 2X40A 1WUEA 3E49A 4CCZA 3MHUA 2W61A 4GFIA 3AICA 1TE1A 1XFCA 4EANA 1L0PA 4DYKA 4IMCA 4JX5A 1A5KC 1GVSA 1NP2A 5FF7A 3ZSTA 1VB9A 2Z28A 4XAFA 4Q8TA 3GVRA 2X1SA 1U1JA 3KAGA 2PWGA 2BNJA 1SYTA 5I02A 2ACQA 3B8UA 3FDGA 3QSTA 4GY7A 3CQHA 5E6YA 5AHIA 3ABZA 3UXAA 2FZ8A 4HP5A 2HQAA 3LHTA 1F5ZA 4G1KA 4DRJA 1IZKA 3HQPA 3VUSA 4Q6JA 3MWCA 3QF0A 4NYYA 2NX1A 2F6KA 5C0QA 4GVFA 2HROA 1M41A 4JGDA 4DF1A 4FNUA 1WZKA 4AZGA 4HCLA 5LZLA 2V69A 1XJBA 5M2FX 2OT0A 3OU8A 3R10A 4DWSB 2HVNA 4JQ1A 1EJXC 1KO0A 2R1MA 4N4PA 4ALDA 4XV0A 1UROA 3C0JA 3UPBA 4EF8A 1BYDA 2Y8VA 4Z2HA 3RITA 4GINA 1D8CA 2G5WA 1A53A 2VZVA 1LBMA 2MLXA 1KRMA 1RXOB 5G2HA 3TMLA 4TR9A 4F9JA 4FXSA 4WXYA 1J5SA 4H00A 5BOEA 2ZWYA 3I7RA 1CGTA 2OSYA 4A2RA 4ODKA 4PSPA 3M5VA 1UD3A 2FTYA 1BLIA 3S1UA 1YXYA 1W91A 1GQKA 3TDFA 4CKQA 4XZHA 3PUEA 3NRKA 1C91A 2Z1SA 4DRQA 2HXTA 2ZRVA 2BXZA 2J13A 3OJGA 3UU0A 1TSIA 4C5ZA 2ZUSA 4UDMA 1AW2A 3S2LA 3VMPA 3IGHX 5AHNA 1BD0A 2GL5A 1SZFA 3KOXA 3AIUA 2QF7A 3GTFA 2AKZA 1UOKA 4LANA 3UGRA 3RXZA 1TPEA 1FFQA 3KOYA 1BQGA 4OUEA 3MBFA 1FHUA 3H9RB 2ZX8A 4O0QA 3T2PA 4Z2JA 2CLIA 1V4YA 3UYCA 5DMYA 1TPFA 4LY4A 3HGSA 4HN8A 1NDZA 1TTQA 2R24A 1RALA 3N9RA 4IUGA 1M5WA 2Y7GA 3PBGA 5JIPA 2JEPA 4F0LA 4GYPA 2OODA 2J78A 3K30A 4HNTA 8TIMA 1BAGA 3CQIA 1VBHA 4HNOA 3PBUA 4XAZA 3CZGA 2OXNA 1K9EA 4ODNA 1VQTA 2Q3RA 2KR7A 4BKNA 3WLSA 3PZUA 1MW2A 5HJXA 3POHA 2XVPA 1G6CA 4I7UA 4ONVA 3M46A 3MJMA 5SWUA 3M0JA 5F2MA 3UCDA 1CNVA 2DH2A 3I10A 3STGA 4QQUA 3LUOA 3USZA 3FN9A 1WO2A 5LNWA 3LEPA 2NWSA 4P2VA 1YLVA 1NWUA 2P8BA 3QHMA 2F61A 2DZVA 2VOTA 4UTHA 4IL2A 2ZZ4A 2XN0A 5HNUA 3G6LA 1OADA 3RCNA 4DAFA 4PMQA 1EHNA 1LUCB 1C92A 3BLLA 1SFJA 2QDDA 3GVVA 4EAMA 1Z42A 2VD9A 2FQIA 5DCBA 4J3VA 4FXJA 2XIJA 3W27A 4CCDA 1WDDA 1W1A1 3MTWA 1AJ2A 1NH6A 1XDMA 3KL0A 3FJ6A 1W2PA 4B2DD 4ZB2A 3ZJKA 3W1AA 3OIHA 1XG4A 1A5OC 3RF9A 2NW0A 3G3MA 3SIMA 4FOUA 4UZSA 2XP8A 4Y7EA 1D7HA 4C1KA 3GNRA 3E12A 3K8KA 2P1FA 4GNVA 4MZ1A 1BWLA 3B8SA 4MJZA 3O63A 9CGTA 1T11A 4IFRA 3WNKA 1TTJA 1TV5A 1QNQA 3GVQA 2DGAA 5TQLA 4D1IA 3MI6A 1RP8A 4WSJA 4UMCA 2PBCA 3NFUA 1Q6IA 3GTIA 2TSYA 1XISA 1S2VA 2VGIA 3EOSA 4DO6A 3JXVA 3POCA 3OLEA 2OLSA 2QLYA 3B8IA 2EPMX 4Y96A 5I77A 4QJ5B 5DF0A 4GKLA 4IXHA 4AX7A 2PWFA 1EPVA 5BCAA 3QGAC 3EY6A 1GHSA 2VGFA 3L0NA 1E6PA 2CYGA 3LA4A 2RKXA 3IAPA 4JNMA 2XGZA 1EC9A 3TQ0A 4ZPWR 4DJFC 2Q5AA 2Y7FA 1Q8AA 4H1ZA 4RE3A 1KXTA 1TJ1A 1EX1A 4GGBA 3WQWA 3GYEA 1E6QM 2Z6IA 1RA5A 1CECA 4Q8QA 4MNLA 4DYJA 2EPNA 4IMEA 4WKHA 3O5EA 1WE5A 1NOFA 2PCEA 4A6GA 1QRQA 1QNOA 1ZJIA 5I3JA 2POTA 1T8XA 4O4WA 1TYGA 5JQ9A 5JIWA 4AWEA 4RPPA 4WQ6A 1HJUA 4AHPA 4AMCA 1EBHA 3CWOX 5F1UA 3QV6A 3VIKA 2GK1B 2XSXA 2BODX 4GUHA 1NEYA 3O6DA 2IPJA 1OFDA 2ZZ1A 3VC5A 3RLGA 4K8EA 2RQSA 1UR3M 3DOPA 1FKJA 1I9CB 4Z1AA 2GQAA 2FKPA 3SN1A 4O8AA 2DY3A 4REQA 1QMLA 3FVMA 1PKYA 4DRNA 5EKYA 2R1NA 4Q8VA 4JTTA 2P4VA 5KZMA 1H1ZA 3GXTA 1GONA 4CD5A 1UKQA 2G96A 2ZADA 3FJ4A 1LQ2A 1UZDA 2M1IA 4M24A 3LCLA 4H9XA 3DKLA 3VGDA 1UPPA 5K2ZA 4KBXA 2JEQA 4PTMA 1O5XA 4AUBA 2UY3A 3W23A 4UTWC 1FKBA 4HPGA 4NSBA 2AGKA 1KT0A 4LVGA 2O9RA 2JKEA 3I4EA 4CVUA 3UFYA 5G4HC 4Z0SA 4AEFA 3WLOA 1CIUA 3DFPA 1H63A 4EXQA 1X97A 1JCYA 4H9VA 5FCZA 4GGQA 4JHZA 2VWTA 4JL2A 2O55A 3B40A 4XK2A 4WDUA 3MP4A 3BWWA 3PPGA 4G56A 5I78A 4XD5A 2CWNA 4ZOAA 1ZENA 3LRKA 2O4MA 3GAYA 5DCDA 2WV8A 4NILA 4UQEA 3QN3A 1B5TA 2YXOA 1B31A 4JTGA 3QTPA 2F84A 2WPBA 3ZR4A 4Y90A 2ZX9A 4GACA 2RGMA 3V5FA 1IQ8A 4JFSA 3FV9A 1E4IA 2D0GA 2YOCA 3QR3A 3U0HA 2DIKA 3KS6A 1YTDA 1OGGA 2DG9A 4GJ1A 5I98A 3ZLFA 1UMYA 3QJAA 4GD0A 1OK6A 3LLXA 3KCOA 3HPFA 3AU2A 3NEHA 4NNBA 4N7QA 4DEFA 2MUCA 4OVXA 1SO5A 2V2HA 1XLMA 1RPXA 3IJDA 3ARSA 4HPNA 2E3ZA 4MZ8A 1XLKA 3G1XA 1GJWA 1QPOA 4LAVA 1VLWA 1RV8A 4TV6A 1VEOA 3ZLHA 1D2KA 3CMJA 1KNWA 3BVJA 4NI8A 4RDYA 2BZNA 3P67A 4S3BA 3WD3A 3LBMA 3QOKA 1VFMA 4QG8A 2O4QA 5FKYA 4H4IA 3UZXA 1QW8A 5TNVA 1OFEA 4YLWA 4IIBA 4EPKA 3BZJA 3QR0A 2OGYA 1V3JA 3R25A 1ZP4A 4R7JA 1YDNA 7CGTA 1UKPA 1V79A 1K9DA 4TX6A 4ZBCA 2G3JA 2D1ZA 2BY0A 3C2OA 3KVLA 1GPFA 1VEMA 2OLHA 4UNKA 5FIPA 4JFVA 1ONRA 3UVIA 1PUDA 4JR5A 4N2YA 4KQZA 3DUGA 4JZ5A 3B8WA 3R0UA 1ZJAA 3JYMA 2XU2A 2WSQA 3RLHA 4L4LA 4UFLA 3XINA 3LTYA 3DERA 1E55A 4W8BA 4D6HA 4HU3A 5FF0A 1P7TA 3RN6A 1NIUA 1P0DA 3G1RA 4LUJA 1PCWA 3AJ7A 3F2BA 1CXHA 1B3VA 2Z1BA 1Q6HA 2OWWA 2BG5A 1XBXA 4H8HA 1O5QA 4I6KA 2NSOA 2HS6A 1H60A 3G1AA 1CYGA 3M64A 3FSUA 3MC5A 4DX3A 3VNKA 2QMKA 1IXNA 2GDQA 3E38A 2CEQA 1EL3A 4LRSA 3UXIA 3OBAA 4DO4A 3PJUA 5D9OA 2NXIA 5DBTA 3VMOA 1CCWB 4GRSA 2WMGA 1DBTA 4XAPA 1BKSA 3QMSA 4W93A 3OO2A 1B90A 3L4VA 4O1CA 1EKOA 1AZ2A 3ARRA 3WH5A 2E9LA 5BNKA 2B7NA 3H7RA 1KQZA 3E02A 3C6CA 4WKFA 1GVEA 2PU1A 3ARZA 4H6KA 1F3TA 3GNNA 4CQ8A 1QI5A 1OSEA 1OQFA 1P0EA 4H83A 1OIMA 3AXHA 3QMTA 5E9AA 3TSDA 2DT3A 4O11A 5M1TA 4LAZA 4M0XA 2EGZA 5HNNA 2ZTKA 1D3HA 4HHMA 4NI3A 3DFQA 1OX4B 1G01A 1R3VA 1WOAA 4XKYB 3R13A 4Q4SA 3VIFA 1FUYA 1RZMA 4CD7A 1BSLA 1ZJHA 1N8WA 1UWUA 1JUEA 4GG9A 4XD3A 4Q4RA 2WC4A 1O1ZA 4WZHA 2OJPA 4Z1DA 2FPVA 3WMCA 4J27A 1YDYA 1TPB1 3L66A 2XYLA 4TO8A 3SCPA 2XWEA 2WCGA 4U2ZA 3K8LA 3LZ5A 1UC5A 3P14A 3V18A 2ZZ3A 2WMIB 1CTNA 5BOOA 3EDDA 3VAWA 4QT2A 1HZYA 4X22A 1WDPA 3IGSA 3BJFA 6XIMA 2HRWA 2C1GA 4MB1A 2VEPA 3EKZA 1R0MA 4NL1A 2ZRYA 3U2OA 1I2RA 4JNYA 4NHVA 4O50A 2OX1A 4W5ZA 3TYZA 3N2MA 3A13A 3UR5A 5FA5A 2ZE3A 4AB4A 4WJ8A 1WNOA 3PUDA 1HF6A 2QCDB 3WUFA 5DBUA 1E1CA 2J47A 1AQHA 1G1YA 4UTFA 5C9XA 1WZAA 2WXDM 2FZ9A 3W1NA 5BMXA 4K3ZA 4IMGA 1X1ZA 1Q6FA 4HNVA 4KWSA 3H21A 3SJNA 3MDYB 1Q7QA 1B6CA 1L8NA 3ALGA 4GQRA 2ZR5A 3KOWA 1X7FA 4NZFA 1SFLA 1PVNA 4CU6A 2RUSA 3OYZA 3K1GA 5GJPA 2FHCA 2WMHA 1WX0A 4MGVA 3KP0A 5AECA 3B0PA 4PGLA 2D23A 2FZDA 1NFBA 5LNVA 1I0DA 4W9OA 1MFVA 5LIWX 1CXLA 7REQB 1CXIA 2VP8A 3HJEA 1PHQA 1QWGA 3VNLA 3EB2A 3N2CA 2LKNA 5LXXA 1ZBVA 1DPMA 3BK0A 4Z1CA 3VZZA 3A4JA 2CIPA 2GUUA 4MWAA 3HQNA 4A05A 3GHTA 1KR1A 4IXXA 4ADSA 3ZQ9A 1WKEA 3B03A 1YRRA 3OLIA 1TV4A 1OVDA 4YU1A 2FFIA 1EO7A 1F40A 4ODMA 3ITOA 2WMFA 4MIMA 4PE8A 2Z24A 3A64A 3MPGA 1DWAM 1FKIA 2B7OA 3TYEA 1THFD 3WBWA 5FF3A 3RCYA 1E0VA 1EGMA 2A3CA 3N12A 4LSBA 2G8ZA 1GKPA 1SPQA 4R5EA 1NDVA 3W1RA 3AROA 3TR9A 1S39A 3GY1A 5CC7A 3BAXA 5AZ1A 3S5NA 2J7GA 3O9NA 4K37A 3CQKA 4V33A 1X96A 2Z1VA 4PTDA 4A29A 3EMZA 5A8GA 3L4TA 1V7YA 3CS2A 2WNNA 1GYLA 1WA3A 3ELFA 1RQEA 4OQVA 3ERPA 3O0FA 6REQA 3OTRA 2VCCA 1REQB 4TMCA 4NXSA 4Z08A 1W31A 2ZZ2A 4AIOA 1GUVA 3BL3A 4LNYA 5DIUA 4TV5A 2YW4A 4NRRA 4LUIA 4PA8A 4IFKB 4FK9A 4GISA 3VKAA 1XH1A 3E2RA 3FYPA 2ZBTA 1HP4A 1AL7A 1KCKA 4OHQA 4WRHA 3E1F1 2EULA 4CNTA 2FVKA 3U8GA 3WQ6A 4US5D 1QCWA 3BURA 3EWUA 2DVTA 3TROA 1RQBA 1XC4A 4R7OA 2BHYA 5LA2A 4HMNA 3LD5A 3R6IA 3AMDA 5EMYA 1NMVA 2YKKA 1UWRA 3K2GA 4Q33A 1K6AA 3B0XA 4MVAA 1WZMA 2RAGA 3WQDA 3NUKA 3N13A 4FF7A 3PBMA 3M0XA 2H6RA 2DORA 3QKEA 3HB9A 3WMBA 1TELA 2OPJA 3LBOA 1E5JA 3VD5A 1QPNA 1ICQA 2PD5A 3W2UA 3M7SA 2QAFA 2XH0A 4UTKA 4GUJA 4JIIX 4UUIA 2GDUA 3LOTA 3T2QA 2ZUVA 5FEZA 3UQNA 4FOKA 3UWEA 3N14A 3VX1A 1XCXA 4J5NA 2ZRWA 3USBA 2QVHA 4DF0A 2WJDA 1LL7A 3P0WA 3W83A 1KWKA 2PV2A 3L9CA 2WNWA 4LBRA 1A4MA 2G0WA 3L2LA 2YDSA 2Y7DA 1LZOA 4RZ6A 3WDJA 3DFSA 3VZXA 3VCRA 1IEIA 3DBPA 3P61A 3LHUA 1E3ZA 1XIFA 1V5XA 2GJLA 4QNWA 1FKRA 2G4FA 3S6OA 5EMUA 5GQBA 4DZHA 1D3GA 1GPWA 4S3EA 1HL9A 1QDSA 3AMKA 3AIEA 1PJ9A 3LG3A 3W53A 3SM0A 4KEUA 4G5DA 1JJKA 5DY2A 3ZO9A 1KRAC 1MRQA 5D05A 3UG8A 3I3BA 4MGGA 3UI4A 3N3MA 5DXYA 2CLLA 4LAKA 2PS2A 4RV3A 1J11A 4JYSA 1QFEA 3KE0A 4DBSA 4OJYA 2UZ5A 3C8NA 3B9AA 3DFNA 3W6MA 1W9UA 3TVAA 1RQHA 3LU2A 2QW5A 2F21A 2Q8LA 1WKFA 2GZXA 3OW1A 4MJ4A 1T99A 3WLRA 1YNYA 1UR9A 3HIJA 3QYQA 3RLVA 1Q5MA 1V0NA 4K2SA 4LAOA 4AZHA 5A2CA 5GVJA 3U4FA 3GQYA 3R43A 5AYXA 5C71A 4ES4A 3NQ6A 3FHQA 1M01A 4WY0A 1BTMA 1E6XM 4OBRA 4AISA 3BAYA 1B1YA 1TPUA 3STEA 1QWKA 4RNHA 5EMLA 4RE4A 1OD8A 2RDUA 3BZGA 3MU7A 4LCRA 4B90A 2YX0A 5TBOA 1AJ0A 2TODA 1OEPA 3DAQA 3DHFA 3PRAA 2SFPA 5CPSA 4NAEB 3GXIA 4XBKA 2KX9A 4KQNA 2Y62A 1JYNA 2BS9A 3PVFA 1HT6A 3WQCA 4JN7A 4KCUA 3E5PA 1LLZA 2RJHA 1HJWA 1ZAIA 3M6YA 2AWGA 3QLDA 1PIFA 1OCBA 4DBEA 1EGZA 4PZVA 4Q7BA 3TU9A 2VCDA 3H7VA 3QFEA 1JPDX 3N4AA 3NVTA 4C6BA 2PDQA 1ZCCA 3LV6A 1GT8A 2YCIX 3NWRA 4PB5A 1LF1A 4C7DA 1OWQA 3ANUA 4QS5A 3T44A 4UQAA 1EJRC 2XH2A 4GIRA 1A49A 3GTXA 2WKJA 1BVZA 4LAWA 3WEMA 4FLSA 4P7RA 3N6JA 3CAVA 4HOXA 3RYSA 3TAOA 3QPEA 3NGJA 4DUXA 3OA3A 4LYQA 3GG1A 1FOBA 4Z2GA 2J8TA 3FAWA 3U7BA 3T81A 1GQLA 4JL1A 5DMMA 1J9YA 3PZTA 3K5XA 3UJEA 4R88A 1Q2RA 2XP6A 3ODKA 2C15A 4ML9A 3C56A 3M5XA 3GSMA 3V36A 3L4UA 1EXBA 1S46A 2XWDA 4L9YA 3QGVA 3EWZA 2OELA 3IVTA 4NYUA 1W1VA 4AD0A 1ADSA 4HSHA 2WJEA 5AOUA 2R91A 3WUEA 3AZSA 1I45A 4TQTA 1P0NA 3F4NA 4CN4A 3AUOA 4KW2A 2XP7A 2OU4A 5ENLA 3EWBX 5G1YA 1EYMA 1AH4A 4FSAA 2GPTA 3L23A 4E5TA 3AIVA 2VX7A 1LTDA 2I14A 4Q7IA 2YFNA 2ZZ6A 3VD9A 1MUCA 1MW3A 4OU1A 5I24A 3UNTA 1M03A 1WDRA 5L6UA 2ZA2A 4OUIA 5DEZA 1XLGA 4U5KA 2DQWA 1E0WA 3I3EA 3UWYA 4JTFA 3TX9A 4AXKA 4QFUA 4A8RA 4JD4A 1X7IA 4LY8A 2VFIA 3W7RA 3ZR6A 2NXGA 1W5OA 2YZRA 1K03A 2BVDA 3IIVA 1P6WA 1KTNA 1N55A 1QO2A 2EG6A 2DSKA 4ACZB 2HK0A 3MZ2A 5C2GA 1VYRA 3TCZA 4PCSA 3GFZA 4YTTA 3H23A 4CLMA 1HJQA 1HJXA 3NSNA 1XKJA 1OYAA 4N0RA 3CPRA 3CB3A 3W28A 3WLKX 2FGZA 2OO6A 1R85A 3EDFA 1Y0EA 1QPLA 3HQOA 4S39A 4UFJA 4D8AA 2FB2A 3ARUA 4MB3A 1E0TA 4HMCA 2C1IA 2WNQA 3EWYA 3O5IA 3NQ8A 2ABAA 1DJGA 1PBGA 3LCFA 4QSHA 2DZBA 1VFOA 3U2CA 1KWGA 3GWQA 4NT0A 3RRAA 1DWJM 2Z27A 2Y5SA 1UH2A 2VQTA 3S9ZA 1UR1A 2I5IA 3CQ0A 5HQMA 3CMGA 5KETA 3OG2A 1D6OA 2C19A 5EY5A 2PU0A 2BX7A 2FDSA 4BY3A 3W70A 3EOLA 3NQVA 1KRCC 4GCXA 4O1BA 4I3GA 4JFUA 1WB0A 4C6EA 1KXQA 3KDNA 3A4WA 2ESCA 4TUFA 4Z1BA 4FO4A 3LGEA 3CL7A 4BI5A 1F05A 1FX6A 1Y0OA 1AQMA 3CHFA 3NNTA 3CUZA 1TQXA 2CZDA 4GJIA 2QQ6A 3NL2A 1W8SA 4JTIA 4IQEA 4IPIA 1GZ1A 1TX2A 3KBNA 1R2TA 4MZYA 3Q58A 4IMAA 3GDBA 4D1JA 5J6EA 4LVBA 1PTAA 4M8UA 4C6IA 2V5JA 4OOZA 5PTDA 4ODPA 4C7GA 1PIIA 4X63A 4UNIA 3VINA 5XIAA 1H0IA 3V3WA 4JTSA 3WD4A 1VFUA 2E0PA 3W3OA 3LTPA 3NQ2A 4DJEC 4GIVA 1RK6A 3APYA 5GJMA 1XC6A 4IT6A 3MCMA 4BI7A 4FOJA 4FAPA 3R12A 1B9BA 1I2QA 3QBUA 3AAMA 4E2DA 2OQHA 3AHTA 4RLIA 1AD4A 3NPVA 4LC8A 2WLZA 4NJHA 3STFA 3VOCA 1BL4A 3WH9A 2PF0A 4YHGA 1A7XA 4MFEA 2VUNA 3CAWA 3LPOA 4LALA 4ATLA 1Q13A 3AMLA 4GC3A 4LVAA 4G50A 2L5HA 1MXGA 2QCGA 3PPHA 1V6XA 3SFKA 1CZ1A 3WQGA 4H9YA 5I00A 2JGQA 3W84A 1M65A 1QXLA 2H3BA 4C1LA 1V03A 4ZXOA 2GDVA 2A4AA 3VAVA 2I16A 4J2PA 4JKKA 4NXKA 2CHRA 1Z9AA 1OG0A 4AEOA 1ZJBA 4R7WA 4XKMA 5CBIA 3PC0A 1SUXA 1ADDA 2DPEA 1WYIA 2OO0A 3U9IA 5LNSA 1D7JA 1ADOA 1FWSA 1H7XA 4US6A 3SGZA 2XPBA 4L1GA 1T7LA 5CGTA 3AS0A 1KTCA 4YS1A 4FS9A 1E43A 1GOMA 2ZX6A 2IXUA 2BY3A 4AVOA 2XP9A 4GYFA 1RBLA 3U5YA 4JFLA 2HDJA 3VDCA 2QIWA 2X1TA 5HW6A 3NAVA 4PMDA 1O4UA 4MPKA 4UTLA 2A3AA 1RJPA 3RM4A 5D30A 4JDYA 2GVYA 1TZZA 4O57A 3WENA 4ZQOA 4LWWA 1UMLA 5A95A 3D5HA 2B0MA 3AQUA 4AZIA 3W24A 1RA0A 4D8LA 4TX9A 1NFGA 4XZLX 5ABTA 4H01A 2IQTA 2PP0A 1QI2A 1OD0A 2Z0IA 1RH9A 3GUGA 2MLYA 4C1NB 3PAJA 4Q8OA 3N9KA 3ATYA 3KHDA 4W9PA 4WF7A 3BMBA 2CFFA 4JFKA 4HZ7A 2DV0A 1NU5A 2Q3OA 3WF4A 2PURA 4XISA 3M0HA 2VR2A 4DZ3A 3UQAA 4M82A 3UJFA 4ZE4A 5D2VA 3PRBA 1WCGA 1UKTA 3CEPA 4GPNA 2J9YA 2XFRA 3T0AA 2CU0A 2VQUA 2V9DA 3TJLA 4QR6A 1UKOA 5I2UA 4GXPA 4CD6A 3O5JA 2ON3A 3AOFA 3OVRA 5T8GA 3WSUA 2IMRA 1ONWA 1K8ZA 1KCXA 1V6VA 2XVLA 3IJLA 2MLZA 3AS1A 5T9BG 4O13A 3VKCA 1QASA 3ITLA 3HV9A 4CGTA 1NDWA 4NZ1A 1JZ3A 4BQ2A 2PDXA 3QW3A 1B9ZA 1XYBA 3GG0A 3SRKA 4ACYA 3IWPA 2BGNE 2OSXA 1F8IA 1FWIC 4ZSUA 3CO4A 1F6PA 3KP1A 4GK8A 3UG3A 1E1FA 3HBLA 5C55A 4A3UA 4WJEA 3N2XA 4IM4A 3H70A 3KS5A 3G0XA 1YBQB 5FJTA 1RY8A 2F38A 5HMDA 3IGXA 4CNSA 1CPUA 4QEEA 2VKZG 1PB0A 4MNJA 3KVJA 5H1WA 4HU4A 3QQ1A 5ABFB 1UW9A 4QQ3A 4KRUA 3MMDA 4EWND 4UFKA 1XKYA 4HCDA 3VGGA 5C8BB 3MHFA 1VFTA 4RNIA 1R3QA 1XRFA 2WSRA 3BICA 1Z69A 2X09A 3MCNA 4KT2A 1XL9A 1BVWA 4B9YA 3P7YA 2HXUA 1HUVA 1UPMB 1LT8A 4XVDA 4G6CA 5C9ZA 1JNTA 1H7OA 1SW7A 1IF2A 1RSCA 1OB0A 1VRDA 2CZVA 1EOKA 1J79A 1IGSA 3W7DA 2I9UA 4RCXA 4YVVA 4XZ9A 4MDPA 4LFYA 1XQKA 1NAL1 1EQCA 4IPLA 2NT1A 2WHLA 3WEOA 2QJJA 3WBYA 1I0BA 3WBEA 6TIMA 2A6LA 4E2OA 2V0TA 3G1YA 4IGNA 3LXCA 2PSNA 3RFWA 3BMWA 4MB5A 1A3WA 4KESA 2O92A 4RPQA 1JCLA 1AODA 5CCZA 3HPZA 1OFOA 4J3ZA 1IIGA 4BQ3A 3WJZA 1H1NA 3DFYA 2OLAA 7ENLA 2QF8A 1E70M 4B92A 4L65A 4DY1A 3HV8A 1V7AA 3EGJA 5HW7A 5HINA 4DXKA 5TF0A 4JFWA 5J8LA 4C6JA 3THDA 1Z41A 2AAMA 2INZA 3CUJA 3DYOA 2PBGA 3ARXA 1F4HA 1C8QA 3K4AA 4IT1A 2NQLA 2C71A 2Z2BA 3L0GA 5C54A 2ISFA 2PDPA 2QAPA 1N7KA 3H4XA 1QW9A 4H41A 2XH4A 3WD2A 3QKZA 4Q3MA 3TEVA 3M4HA 4FR1A 2VEMA 4MJMA 3MKVA 3FCPA 3PK7A 3OG3A 3QV8A 3C3UA 2X0HA 4YPJA 5BRQA 2FTWA 3MMUA 4IQLA 4AD3A 4D8ZA 4FIQA 3KFTA 1J4RA 2DUXA 3PM6A 2VFDA 1OGBA 4L72B 3VTRA 1UD6A 1VD6A 1LQAA 4DAIA 2MNRA 3S2MA 4ERAA 3GHSA 2OKOA 1KFCA 2JFEX 3RU6A 4HA4A 3BCFA 2Q8XA 3BMVA 4M6VA 3SCSA 1E0UA 3CWHA 3PTQA 1QATA 3L5MA 1J93A 1PAMA 3VIMA 4QM1A 3O5DA 4CD8A 5CPOA 4RNFA 4M7TA 1OJXA 4WOQA 3TYUA 2J9ZA 5CPMA 1VGAA 3NSMA 1U5HA 3VNJA 1B3XA 2CHOA 4GNJA 5I3HA 3L12A 1KLYA 4QXIA 2W79A 1EDGA 2DVXA 1UR4A 2OQLA 2QUNA 1RP9A 3KBJA 1BYBA 3K4DA 3BLOA 4PMOA 3LX9A 4O16A 2FFCA 1EC7A 3WX7A 2CLPA 2PP1A 4ZQRA 3BTNA 3N18A 4Q32A 4GLEA 2OT1A 4M5PA 1FKFA 3FLUA 1K8CA 1UKSA 2OZ8A 3CLMA 3WQ8A 1DXFA 4ZXLA 5FF4A 2PLCA 1W54A 2ACRA 3SUTA 2BB0A 3VE7A 3B97A 3M1ZA 1DWHM 4P61A 1ZK6A 5IM51 4IX2A 1W3IA 1BRLA 1DKWA 1DXEA 3HN3A 1HKWA 3I65A 3QVQA 4JTCA 3O16A 4J3UA 1OC6A 1EDQA 4IWWA 3F1QA 3B04A 3KACA 4ZOBA 3GE7A 4DJFA 3CHCA 3TIMA 4KWUA 3MCOA 5C9WA 5F7UA 3ZWTA 2WOQA 4AIBA 3FEMA 2C13A 4UTTA 3S9YA 3WK1A 3GIPA 3LK6A 4KFNA 3TXZA 3WQEA 4K8HA 1GOIA 3T0DA 5CJMA 4AF0B 2FH6A 2O9OA 2Q01A 2VVNA 2TYSA 3W7IA 4LU0A 4DM2A 1NFPA 3VU2A 2AGTA 4TMBA 2ITKA 2MANA 3W74A 2VRQA 4HCHA 3LLDA 3MY9A 4LUYA 3TNOA 3M0LA 1OF6A 1QPQA 5HATA 2GJNA 2VC9A 5GPGA 4L56A 5I3IA 3CGMA 3KWSA 2ISWA 3QR1A 1H11A 1TIWA 3R7MA 2DG4A 2QGHA 4Q4OA 4M3PA 3H24A 1UIPA 1KKRA 3GH5A 2HSAA 1VENA 3UBPC 3G18A 1K8YA 1JQVA 2VRKA 4U3AA 4W7VA 4ZB5A 3W85A 4TNSA 3KBMA 1TWIA 1W26A 5I3GA 2PV3A 5IBXA 4BI6A 1DJQA 1MUMA 4QROA 4UTWA 3PHAA 2CLKA 3V75A 3WUBA 4RR4A 3GBEA 1E6SM 2ZX7A 5D2XA 2WQPA 4UB9A 3PA7A 1MFUA 3PZQA 1F07A 5HA7A 1TE6A 6ENLA 2E9BA 3M5ZA 2PV1A 1AH3A 1GJPA 4DRIA 2ZUWA 6CGTA 3AO0A 3PJXA 3W2LA 5HNTA 1DWIM 1OFRA 3THAA 1KV8A 4LUSA 1A47A 3P82A 2ATMA 2J6VA 2Z00A 4HHHA 4HNNA 3UPWA 3CHEA 1EEXA 1S2UA 4DN1A 1TJ0A 3HG2A 1MO0A 4ILSA 1XPGA 1VF8A 3EEZA 1KM5A 1R3YA 1UP2A 3KTCA 4IPPA 4H8VA 2ICSA 1YKWA 2DJLA 2HMCA 1OZMA 1U1HA 3KAFA 3PWIA 5FESA 3IJ9A 3MWAA 1R9ZA 4CNOA 1DQXA 3E6EA 2A2IA 2VL4A 2YZ5A 3ZVHB 4I5RA 4LVDA 1PHWA 3TOYA 3MA8A 4IX0A 2ZQUA 2UWFA 2XFWA 1UBSA 3ZLGA 3WNPA 1D7KA 1EQ3A 4Y9MA 4ML4A 1FWGC 2DZPA 4NQ1A 3NZGA 3MQTA 1OT1A 4PUMA 1AH0A 4YMZA 5HT1A 4Q22A 1QPKA 3UWVA 2PGEA 1E71M 2HE5A 1A5UA 1BFNA 2VT0A 4X9YA 2QIIA 1WDQA 5LKYA 5IHRA 1TB3A 3NDZA 2V67A 3CIVA 3G0UA 3FNDA 1V3IA 3T8LA 1O94A 4O18A 5C7HA 3LGDA 4LVFA 4JKLA 3H2NA 2PPNA 2ODOA 1CENA 3ZT6A 5F1VA 2XN1A 4JTLA 4QDPA 2G95A 2J7CA 1IWPA 4ZMGA 3W72A 3R0KA 3EA3A 3EYPA 1R47A 3B4YA 1TKKA 1LWHA 1XG3A 4KRZA 4FP1A 2R82A 4XTDA 2CZEA 3J7HA 3KWXA 4ZOCA 3B8DA 4MY9A 5IRPA 2ZXDA 4V2XA 3ITGA 3UR7A 3PZVA 3UEQA 4O53A 3CK5A 3CUHA 1Y5XA 2VCAA 1C8YA 2JF6A 1BWVA 1Q2SA 3RG6A 1AD1A 2HNEA 3PY2A 2AKMA 3T1GA 1RR2A 2WSKA 2H90A 4UCFA 3UA3A 4G7FA 3FEQA 4L9ZA 2FPYA 3PZ9A 1OBAA 3ANVA 1JXJA 4XZNX 4NX0A 3HTWA 3QY8A 1Q7ZA 2EQDA 2Z2UA 1QVBA 2GGGA 4L6HA 4S3KA 4UZUA 2E6YA 2YFOA 2OZ3A 4MYAA 3HQ1A 1Y65A 1L2UA 3FGCA 2UY2A 4WD0A 5EYWA 1XYCA 4A35A 5F2GA 2X0SA 3LM7A 1KB3A 5IDIA 5CPTA 2XIQA 2FMOA 2PGRA 3S83A 1XLDA 4R53A 2EBNA 2HBXA 2DW7A 3A12A 1FTXA 3H53A 3B05A 4GVHA 5CSSA 1XI3A 5EBUA 2A6NA 2EHHA 3BH4A 1LM1A 3O5GA 3FAPA 1EZWA 4I8YA 4S3AA 4FR6A 1E15A 4AU0A 3U6WA 3A5VA 4H3DA 4OFCA 5HOSA 1H49A 1J6PA 4IP7A 1J6YA 1NWRA 1W8GA 2ZQSA 3R11A 2PDBA 1V0LA 1DJYA 4S3GA 5A69A 4JX6A 3RMEA 3H54A 4PCTA 3O5OA 2W3ZA 2DIEA 1JL8A 2W91A 3VIJA 2J7HA 1V6UA 3VDHA 4F8XA 1DWFM 1GOQA 2XN2A 4DIAA 1XIIA 2QHAA 2VC5A 4IQDA 4OV4A 1FWJC 1OF8A 3LMYA 1FKWA 3MUZ1 1Q66A 3AHYA 3AS2A 4BF5A 1WDWA 3TCSA 4PBEA 2P5NA 1ROTA 3N17A 4NNAA 4XUYA 4WX2A 1XINA 1FCVA 1TVLA 3I68A 4F0SA 3O15A 4MDOA 3TJ4A 1UH3A 3LERA 1SR9A 4AD5A 4X0NA 3URQA 2J66A 4NAFB 1M7JA 4QCEA 5HWBA 3MP5A 2NQHA 2Y4SA 4GZ7A 1EIBA 1R3WA 4PRWA 3GBDA 2VR4A 3FAXA 1ZS2A 5CG7A 5CAHA 3WJSA 1EWEA 3IRSA 2OB3A 3WO8A 2YL9A 4W5UA 2QT3A 1IYXA 1A3XA 1N8IA 5JVLA 3OZMA 5AZ0A 4A8LA 2WVVB 2CLFA 2C7FA 4KERA 4YTUA 3VE9A 7TIMA 5CZSA 4EXAA 1SJCA 3GXPA 2E5BA 4RE2A 2QPSA 3MKCA 1GG1A 1CX9A 1AL8A 2VC6A 3W01A 2H8XA 8CGTA 4RJEA 1OX6A 2C91A 3OP2A 4IICA 5TIMA 3UWZA 1H7PA 4F2UA 3EZ4A 2WW5A 3W37A 1V6YA 1CT5A 4GUIA 2Z26A 3SY5A 5J5DA 4O1DA 1YTKA 4GUGA 3BSMA 3GH4A 4HYVA 3A4AA 4CQ9A 4JY9A 1G5AA 3TQVA 3W1PA 3EDJA 4GZJA 3O5RA 4CNPA 3CHDA 4DWSD 1H7WA 1LRQA 2C8NA 1GGOA 1FJDA 1GOKA 4CUCA 5AC6A 1Q85A 3W6YA 1KM6A 2A7RA 2WMJA 3S2CA 1D7FA 4GYPC 2EPOA 3QOMA 4V1XA 4XSMA 3VXGA 4LUTB 1FXPA 1AUSL 3TN3A 4F0RA 3ABXA 3OGVA 5BWFA 4ORMA 4NZJA 3LLFA 3LCXA 3H12A 5D9NA 5C2CA 1Y5WA 3W76A 1VS1A 1A4LA 1PYFA 4HPJA 1HX0A 3OQEA 2JALA 4CVWA 3FXYA 1TWDA 4H8UA 3WL0A 2J27A 1ISZA 1BYCA 1RCQA 1PKMA 2PDCA 5HQLA 3MANA 2HPIA 5REQA 3N04A 3TOPA 1PX3A 5FJIA 3OVQA 1E6NA 2DZUA 4KFOA 3UWWA 4HT3A 4BFAA 5AC7A 3EX3A 1D7IA 1BHGA 1S2WA 3DX5A 3WD0A 5IXEA 4AWSA 3LXAA 3LMZA 4MNKA 1NDYA 3WZ0E 1NF7A 2REQB 5HAOA 1KM2A 3II1A 2C14A 3IPWA 3MSDA 2FPTA 4GO9A 5C9UA 3TP4A 1YXCA 4PMJA 3SCTA 2PC4A 1V08A 1EUNA 2ZX5A 4US5A 3EOEA 2A7PA 5H8PA 1TO3A 1KGUA 1Q65A 2YCLA 2J7DA 2ZOXA 4KMQA 3OZYA 5DLCA 1XBVA 4AZCA 1QHPA 2CLHA 3MUY1 2E4TA 1VZWA 4LOCA 4QX4A 4J35A 1JNDA 2Q8ZA 1Q6RA 3SUVA 1PYMA 4X0VA 3UZWA 4Q8PA 1YTEA 3C2VA 3NA8A 4MOZA 4RDZA 3VYLA 5BXTA 2HZGA 4M6UA 2EJAA 5DFAA 5E1QA 3N2TA 3IIOA 1UCWA 2FH8A 2XVGA 1JDDA 1HQTA 2A21A 3V1PA 3RLUA 1SVDA 2X0YA 3PTKA 1DTUA 2EKCA 2CPUA 1XIEA 2BVTA 1ME8A 3UNDA 4RW3A 5DO8A 2A79A 3S8HA 1WAWA 2OMAA 2RDTA 2WM1A 1KQYA 4HK5A 4EE9A 1FH8A 4CQDA 1S5MA 2ZR6A 2ZDRA 2XTKA 3HF3A 4ZQMA 2O7QA 4MKVA 2R1LA 1JF6A 4XO7A 2VI0A 2IKIA 2WB5A 2WMKA 3MBDA 1BF6A 4G7EA 2AL2A 2QYGA 5E70A 5M3WA 1D9EA 2Y5EA 4IMDA 2G41A 5H6HA 3VKBA 1ISXA 1IWBA 5FJRA 2E1WA 4GE8A 1K4GA 4O10A 1Q1CA 5GJNA 4WR3A 2GQ8A 1H61A 3W7PA 4RXFA 1V0KA 4DB7A 1M3UA 3HMJG 3O6YX 2UY4A 3C8FA 4F79A 1A80A 3B4UA 4IOTA 1JF5A 5TD4A 5BWAA 3KM8A 5HWNA 1XBYA 1ML1A 2BVWA 2DJXA 4HK7A 1MNZA 2VTFA 3WJYA 3TH6A 3N2OA 2VNCA 3VOIA 2OG9A 2IKGA 3TTQA 1K8XA 3WFLA 4TYOA 3B7XA 2CERA 2OYMA 4ICCX 3PPCA 1POKA 1S1RA 2X1RA 2OEKA 3MV11 2F9RA 4L80A 1SO6A 4HTBA 2HVMA 3M0VA 4H2HA 3ZT7A 1IXOA 3W7NA 1OINA 3RHGA 4ITZA 1OK4A 4PUJA 1QI4A 2YB1A 3GTYX 1PBKA 5F2LA 4GZEA 4Q4KA 2GGIA 1RK5A 2Z4GA 4JTDA 5EL1A 1SJDA 2BXYA 3AZTA 3BAIA 3TC7A<