1WAWA

Specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE 1
publication title Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1wawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1wawA01
1G0CA 4PYSA 2XVKA 1QNPA 3W6LA 2Z1SA 1ISZA 1W9XA 2V5DA 8CGTA 1M03A 5A2AA 1JAEA 2E9LA 2F2HA 4OOZA 1TCMA 1OM0A 1LWHA 2WCGA 4D6CA 5CG0A 4PMZA 2GDUA 1FP9A 4C7GA 5JIPA 4JCLA 4LQ1A 4GINA 1G94A 2VCAA 5LYRA 3AQUA 1MWOA 3VIKA 4UQCA 2EPKX 1E9LA 4OBRA 1WAWA 4PEEA 2E0PA 5CQ1A 3WD2A 1NOWA 3U5UA 5BXRA 4W8AA 3WEZA 5IFTA 1ZBCA 1PX8A 2YA2A 1W1PA 3SCVA 1K9DA 1G01A 3KEHA 2IXVA 4V2XA 4TVCA 2CESA 3TTSA 5E6YA 4BF7A 1CGUA 5GNZA 1AMYA 1V6WA 3EBVA 3HN3A 1W9UA 4HPHA 2BY1A 3PZVA 4W8LA 4AD0A 4A4AA 2XSAA 5AYBA 1CENA 3BAKA 1EGZA 4Q7NA 5I6SA 1W1TA 4PUDA 1W3HA 2XJ7A 4AIUA 1E5NA 1BHGA 3W81A 2EPLX 1G9HA 3D5HA 1PX4A 1QI2A 2GK1B 2ZXQA 3ARUA 3D3AA 3EDFA 4AXNA 3K1DA 5E70A 1JNEA 2PB1A 4JFUA 2WXDM 2YL8A 4W89A 2NT1A 1JYWA 1ESWA 5D9MA 3EDJA 3QHMA 3SCTA 3WELA 2O92A 4XV0A 4MTVA 4PMXA 1Q6CA 1U2YA 1GJUA 3GZAA 1UH2A 3THCA 1QBBA 3GBEA 3SURA 2QMKA 2B31A 3VM5A 2G41A 1Q6DA 3E1F1 2J8FA 1E0VA 3W26A 1VIWA 3AHYA 4V28A 3VGFA 1XD0A 2Y8KA 5D8ZA 4EANA 4W85A 1UA7A 3K46A 4BS0A 4J3SA 2BVTA 4PMNA 2VZSA 1JG9A 3VKKA 2JF6A 1ZU8A 3AIUA 1CXEA 3WH8A 4OJYA 3GXMA 1A47A 2E8YA 2WNWA 1ODUA 4NSBA 1JD7A 3VMPA 1KBBA 3VO0A 4Z2KA 2WK2A 1HKIA 3NUKA 3VMOA 2J74A 3BLKA 1GOMA 1SMAA 1MFUA 4L4OA 1EXPA 2D23A 4GO9A 4HA1A 1TUXA 2E40A 1DWAM 4D6HA 2J7EA 3G6MA 4LYQA 1WNOA 1TE1A 1VB9A 3RM4A 3MV01 6TAAA 4J3XA 3NIYA 2RGLA 1UYQA 1V6VA 5HNNA 1P6WA 5M5DA 3BAIA 1E72M 4QP0A 1B9ZA 3VPLA 1FH7A 3WL0A 3AMLA 2BV9A 4P8VA 1CGXA 2BXYA 3AJ7A 5FL0A 1NQ6A 1B3ZA 1R85A 3AHXA 5EB8A 3WH9A 4HOZA 3K8KA 1NWRA 2PC8A 1BSIA 2XVPA 2VQUA 3UG5A 3L4WA 1TR1A 5ABEA 4NI3A 2WC7A 4GKLA 3WQ6A 4Z2LA 4X0VA 1E1EA 3OA5A 3MUAA 1HF6A 3WENA 2PBOA 2JIEA 5FD0A 3FW6A 3RCNA 2W61A 5A6LA 3L4VA 3NDZA 1E0WA 2W92A 2WVVA 3CHEA 1QVBA 2OWCA 4TXEA 3JUGA 3BC9A 3PHAA 1SYTA 2JEQA 4HP5A 1WDQA 2XUCA 4P7QA 5A6BD 3WD3A 3ARVA 5DT7A 3NCOA 1TFVA 3CH9A 1XV8A 4CCDA 5A1AA 2PWHA 1Y7VA 3N04A 4S3KA 3UG3A 2ZWYA 2WHKA 5FIPA 4L4PA 2C8NA 4FMVA 2BHUA 1UOKA 3MV11 3EDKA 3ZR6A 2GJXB 1BGAA 3J7HA 2XVNA 3GNRA 1BYDA 3T2PA 1EA9C 5BYWA 4Y7EA 1HP5A 1OD8A 3WEMA 1VEPA 3SIMA 3B9DA 3SCUA 1ITXA 2DH3A 1OT1A 5HDRA 1JZ7A 2WC4A 3WN6A 2E4TA 2BS9A 1BVZA 2X09A 1XCXA 1HIZA 2VZVA 4M29A 5FKYA 2E9MA 1E6RA 2F8QA 1DWJM 1UD8A 2VO5A 3A4WA 1G5AA 2VURA 3PZUA 1WB0A 2J62A 1QI0A 4DWSA 2X0YA 3ZT6A 1RP8A 1E6ZA 3HMCA 3A6OA 1H4PA 3WD4A 1UZ1A 1PIGA 4JL1A 5A2BA 1E15A 3ZR5A 5I5RA 2WWDA 3UEQA 3L4UA 2YL5A 2PF0A 2G8ZA 2ZUNA 2XYLA 5ABHA 1FP8A 3VIOA 4BZYA 3VIMA 4M56A 3BCFA 5JIWA 3RMEA 2A3EA 1W1VA 4UFKA 3AS3A 3VNZA 1CBGA 3CGTA 4HMEA 3B8SA 3AIRA 3APGA 1XYFA 2RGMA 2V3EA 5E0FA 2FH6A 4RE3A 2GDVA 1E6QM 3WNLA 4UFJA 3WDPP 4JHZA 2ZUTA 1VJSA 2XIIA 2WZEA 1M53A 1DTUA 2DH2A 3CMGA 2X8RA 3PZ9A 4CKQA 2JIWA 3CHFA 1B3XA 3W28A 2ESCA 1FA2A 1R7OA 4DUXA 4J27A 2FHFA 1UKQA 2GJRA 2WMGA 2ZWZA 3T2OA 5ABFA 3M6DA 7CGTA 1KXTA 1BQCA 3OLDA 3T08A 1DHKA 2GFTA 4RE2A 1D7FA 1GHRA 2F61A 1UA3A 2J47A 5BRPA 1NH6A 1JDAA 2W62A 4ATLA 1B0IA 1BAGA 5C8BB 2YLLA 1VBUA 2XVGA 2DEPA 3N13A 2NSXA 4AZ5A 1VEMA 5CJ5A 1KQZA 3BSHA 4M82A 3WNMA 4H8VA 1LLOA 5F7UA 1C3FA 1GOWA 2ZUMA 2UWFA 5EBAA 4D6FA 3OZOA 3U7VA 1MW3A 4PMRA 4D6DA 4AMCA 1PX3A 2OSXA 4LX4A 3CLWA 2QPSA 2W63A 4AWEA 3THDA 4W84A 1JZ5A 5BROA 3AFBA 4B16A 3VDBA 1JZ8A 3ZJ6A 2J4GA 1CZ1A 1D3CA 2CHNA 3GH4A 3PZGA 4UQDA 3ZSSA 1H5VA 1MVYA 4MADA 4PMYA 2DGAA 4YPJA 4MDOA 4BA0A 3B9EA 3SCOA 3FAWA 5A8OA 3WNOA 3BH4A 1GZJA 3WUBA 4HOWA 2FHCA 5JBDA 4R27A 2VX7A 4URIA 2YL6A 2VX5A 2ZXAA 3HU7A 3FHAA 4XZWA 4UOJA 4D6JA 1B31A 1H0IA 3FY1A 2PWEA 3ARSA 3KL3A 3IK2A 4B9ZA 3CZGA 1XRVA 3AOFA 2DT3A 3SCSA 2VRQA 3MSDA 5BXSA 2WMFA 3U5YA 1GQLA 4P8UA 3IAQA 1WDSA 2ZE0A 1FH8A 3L4YA 4JFWA 1LL7A 1MQQA 1UWQA 2C7FA 2NW0A 4LYPA 1OB0A 1X6NA 5A6BA 3OLEA 2E8ZA 4H04A 4XZBA 3GYCA 4FLOA 1FHLA 3LMYA 1UUQA 5I78A 3T0DA 4TVDA 4DUWA 1KR1A 1B3YA 5IHSA 4DM2A 3ARQA 4UZUA 3WNPA 3VD4A 1NP2A 1AQ0A 3L4TA 5JBFA 4PTWA 4MDPA 5AC4A 2BVDA 3WBAA 1PBGA 4AEEA 4XX6A 5A8MA 1RH9A 3MO4A 3WF1A 1Q6FA 1EIBA 2WMHA 2WANA 5D9NA 4J3TA 1IT0A 3SEPA 4ACYA 4LXFA 1UKPA 1M01A 4AZHA 3CHDA 2D1ZA 3MMUA 3TP4A 1MYRA 3WQ8A 1WZAA 2CHOA 3G6LA 5E09A 1UWRA 3VMNA 1E70M 5M17A 2XPKA 2PBGA 3QGVA 1W1YA 1J12A 5A94A 2J7CA 5AC5A 3NJ3A 3ZT5A 4CU8A 1NOFA 2VZUA 2OLHA 1F4AA 4B9YA 4AZCB 4S3JA 4AZ6A 1NWTA 3UETA 5IFPA 2UY3A 1OCQA 2BXZA 1JZ2A 2OWXA 4QCFA 2UY5A 1MQRA 5A69A 3KZSA 4M24A 3T09A 2VZTA 5DT5A 5GNXA 4HMDA 1O7AA 4E4PA 1H0GA 4U31A 5I77A 4LGXA 1E3ZA 1V0MA 2QPUA 4PMDA 1WO2A 3W6MA 1EDQA 5EMYA 2CBVA 1PAMA 4GI8A 2XM1A 1UWTA 3MKKA 2YL9A 4W5ZA 3VIPA 4E8DA 3QHNA 1U30A 3AIWA 3SCWA 3WF3A 1UR8A 3PZIA 4P8WA 3VGHA 4U3AA 1MQPA 4A3YA 1LL4A 3WEOA 1NP0A 4UFHA 9CGTA 4DWSD 4MPKA 1VENA 1H41A 3N11A 1HXJA 1DWFM 5A2CA 1JYXA 4W93A 4B3KA 5A6MA 1W32A 1LWJA 3TTQA 3PN8A 1HJQA 2ZUVA 4UFIA 1CDGA 3RO8A 3AMCA 2WCSA 1VBRA 4RL3A 1OIMA 1XCWA 1PZ3A 1OD0A 1E4MM 4QLKA 1V6UA 1XGZA 3POCA 3AROA 5KEZA 4ATDA 5EFDA 4JIEA 1B3WA 1UR4A 5JUVA 3AS0A 1KGXA 3CUIA 1W2VA 2XHYA 4BQ3A 3ZJKA 1ITCA 3WL1A 2A3AA 3VX0A 4JFSA 3AXHA 4XB3A 2J7BA 1UH3A 2WMIB 2QMJA 2BFGA 2WHLA 3W37A 2W4XA 4H7VA 1VJZA 5CGTA 1W91A 2WBKA 3BAXA 4ACZB 3ALGA 1PPIA 1BVNP 5A8NA 2Y5EA 4DM1A 3CZKA 3M46A 1KB3A 4GI9A 2V38A 1GOOA 2WKGA 4BQ4A 3TOPA 8A3HA 1H49A 3AZRA 3NSMA 4AYSA 1W3JA 2GK1A 1WP6A 3FN9A 2Y24A 3PZMA 3SUUA 3K8MA 3T0BA 1V0KA 3O6AA 4AIEA 1X1NA 2J77A 3PZQA 2FDMA 3WMSA 5GNYA 2FHBA 3SUWA 2CEQA 5ECUA 2ZUUA 4P7LA 5I0DA 1HVQA 4JAWA 1PEZA 3II1A 4PRWA 3RJYA 4OKDA 4TTUA 1C8QA 4QLJA 2BHYA 1CIUA 3WUEA 3PTKA 4MB5A 3GXIA 3CUFA 1KFWA 1GNXA 1WE5A 3PZTA 2W5FA 4BQ2A 2XG9A 4J7RA 5GPRA 3DC0A 1J0KA 4B15A 2CBIA 1UQYA 3WF4A 1C91A 2CCRA 3ARYA 3LPGA 2OYMA 3O2LA 2G3NA 4FK9A 1LQ0A 1NWSA 1US2A 3NSNA 2VZOA 4U2ZA 4P7NA 1GJWA 2JEPA 3AHVA 3VIHA 1E4LA 3N17A 1WDPA 1ECEA 3VD5A 4C7DA 2VCCA 2WVTA 4J3VA 3WDQA 4CN1A 4E8CA 3EDEA 1KCLA 1L0PA 1CTNA 4FLRA 1J10A 1JDDA 2AMGA 5HOSA 3K4DA 1JZ3A 1LL6A 4PMOA 2YA1A 3AIQA 1FFRA 3AZSA 4PMUA 1E6NA 2WZIA 4EKJA 3SCPA 5LA2A 1OGBA 3BSGA 3OB8A 3ARZA 4MB3A 1OIFA 1EQPA 3WH7A 3KL5A 3ALFA 4QLLA 1JYVA 3VGBA 4ML4A 3WQ5A 4AD1A 3RM9A 4NF7A 3WMCA 4FLSA 3GH5A 1HKJA 1WZMA 2UY2A 4GQQA 3WUFA 1E6PA 3GXDA 4MNLA 1ZJBA 2G3JA 3BMWA 3FAXA 4JCMA 5E0CA 5JBEA 3VM7A 3GBDA 1NOUA 1JAKA 2YA0A 3ARWA 1GVYA 3AMKA 3MS8A 2V3FA 4PTXA 2ZOXA 1EQCA 4M80A 1HJUA 3WY1A 2WCAA 1UR9A 3HJEA 1JGIA 4WKHA 3CUJA 2XTKA 3TA9A 2EEXA 2WLZA 1EOMA 3ZJ7A 3ARTA 2DT2A 2CNCA 1J0ZA 1OBAA 3RILA 1DWHM 2XFRA 1QHPA 4AISA 5KZ6A 4YHEA 4H8UA 4GPNA 5E6ZA 3BXWA 2E9BA 2GJXA 1XSJA 1MW1A 2IUZA 2FH8A 3W82A 2D2OA 1GOIA 4M81A 4ATWA 3AHZA 4KRTA 2OYLA 4V27A 1I1XA 1A3HA 3N1AA 4LPCA 2WSPA 4JL2A 3WH5A 4D1IA 5D4YA 2PI6A 4PN2A 3VIFA 2WVUA 3AYRA 1V3MA 3SCNA 1EDTA 2DSUA 2A3HA 1OGGA 4WSJA 5TD4A 4MB4A 1HKMA 1XSIA 1ZBKA 1VAHA 1ZS2A 3ZO9A 3EMCA 4CD8A 1WPCA 4AZGA 4MAVA 5A6KA 5I24A 2WYSA 2YOCA 2ZX5A 3AMGA 1LG2A 2VR4A 3IJ7A 2J7DA 1F4HA 1KWKA 1BYBA 4W7WA 2WB5A 3S6TA 4H2CA 4BCEA 3I3DA 2EBNA 3PTMA 2X2YA 4F9JA 5M3WA 1B1YA 4U3CA 1E6XM 2W67A 1FHDA 2DQXA 5D9OA 2JFEX 3T0AA 1KWGA 4MNMA 1W3LA 4GQRA 4F66A 1VEOA 1B3VA 3MUZ1 1GUVA 3I3BA 2X1IA 5ABFB 3CZEA 2XIBA 4F9DA 2VCBA 1H2JA 4PTVA 3MSGA 4CN6A 1QNSA 4D1JA 2YBUA 4X9YA 1B2YA 1JL8A 2ZXBA 5CSYA 1ZBWA 5A3HA 4W87A 3L4ZA 3N18A 4U5KA 3WSUA 3GNPA 5CLTA 1GQIA 3SCQA 3N9KA 1ISWA 4J3UA 1KBKA 2WBGA 3OG2A 4PSPA 2HVMA 3UESA 1V6XA 4D71A 1W9DM 3WF2A 1GOKA 4GZJA 3UR7A 3WD0A 5D8WA 3VUPA 2ZUSA 4UZSA 4MNJA 2XVLA 2WVSA 2X05A 1HJXA 1X6LA 1OSEA 4M8UA 1V3LA 5DMYA 4WSKA 1CLXA 2OWWA 1AQHA 1S46A 3BAJA 4GXPA 4P7OA 5AY7A 3AXXA 5GQBA 1UD5A 2XFYA 4CCCA 5LA0A 2G3MA 2XFFA 4EE9A 2WKLA 4U2YA 4Z2GA 4D6IA 2V3GA 4UCFA 4AZ7A 4TX6A 1JF5A 4AD5A 4JHOA 1IZKA 2AOSA 2D0HA 3ZIZA 4F79A 3GXFA 2J7FA 1B90A 2WMJA 3EMZA 2GJPA 2VR5A 2V5CA 3A4AA 3W38A 4OBSA 2CKRA 3UG4A 1W2PA 1MFVA 2YIHA 5A6JA 3WDHA 3WFLA 5ABGA 1E55A 3PTQA 2Q8XA 1O6IA 4F8XA 1UKSA 2XSBA 2BHZA 4WK9A 3W0KA 2EJ1A 1NM9A 2YBTA 2EO7A 4PBGA 2PWGA 1TA3B 2PWDA 2YDSA 4H41A 1V03A 3VD3A 1QNOA 4KH2A 3ARPA 2YDQA 4WJXA 3RM8A 4IISA 3UCQA 2D3NA 3ECQA 3GTNA 1WCGA 5DF0A 1CGVA 4RE4A 5CPTA 1J01A 1QPKA 1C8YA 4X0NA 3WH6A 3F5LA 1KXHA 3A3HA 4KGJA 4HA4A 3FHQA 4GZIA 3O9NA 3W24A 1HKKA 1GOQA 4AD4A 2A3BA 1OGSA 2V3DA 2WHMA 4TOQA 1BFNA 3CZJA 5CPSA 1V02E 2XWDA 3WQWA 4QFUA 4PTMA 1E3XA 4D6GA 4UQBA 4TTGA 1Z32X 5BWFA 4UFMA 1JI2A 5A6SA 4Z2HA 1JXJA 4CD6A 5DEZA 4R5EA 3OGVA 1FFQA 2DT0A 1CYGA 2WM0A 3I3EA 3QR3A 3WQVA 4PCTA 1V3HA 5E9AA 1EH9A 2J78A 4HA3A 4UNIA 4ZXLA 1R7AA 1UR2A 3VINA 3W29A 4CCEA 3GM8A 4HMCA 5I79A 1PIFA 1BG4A 4IUGA 4PMVA 4QCEA 5BXPA 1W3KA 1OWQA 5HPCA 4JFVA 1QOXA 1UWSA 3WDIA 5C70A 1DWIM 3T2QA 1FH9A 2DSZA 4MJ2A 2DIJA 2WPGA 2DT1A 2ZX8A 1D2KA 4QAWA 2XM2A 1PZ2A 2DDXA 1HX0A 2J7GA 1K9EA 2VOTA 4AZCA 1JI1A 1BTCA 1C90A 4AC1X 3DYPA 1W9PA 2MANA 4XUYA 5CXPA 2CETA 2VJXA 3AZTA 4MJ4A 2Y2WA 3VOCA 1H3GA 5CLWA 2VVNA 2ZIDA 4ZFMA 2CITA 5C71A 4D72A 3EDDA 1CXLA 2Y4SA 1HN1A 3SCRA 4JKLA 1JZ6A 2O9TA 1XC6A 3CZLA 2WSKA 2VT0A 1H11A 4HU0A 4U33A 1JD9A 3BGAA 4MB1A 3OBAA 2QF8A 2C0HA 2O9RA 3AISA 2ZXDA 3L2MA 1NWUA 2DPEA 3U7BA 2VRKA 3A47A 4JFTA 1DWGM 1C7SA 1QI5A 4TUFA 3WNKA 1UQZA 2OYKA 3OGSA 1V3JA 3RIKA 1J0YA 1MXGA 1HJWA 4OOUA 2A3CA 2IXUA 1CGYA 2CERA 1NARA 1ISVA 3BAYA 4FLQA 3OLIA 4PMQA 3DYMA 4IM4A 4Q22A 3BLPX 1DEDA 3NDYA 2YJQA 1RD6A 3PZOA 4QDMA 1VRXA 2J79A 1UD4A 4NRRA 4W5UA 2VI0A 3TONA 2EQDA 3VIGA 3FNDA 4NZCA 1XH1A 4UOQA 5M03A 1CWYA 1TZ7A 1XH2A 2VX4A 2ZX9A 4ZENA 2WMIA 4HPGA 1MW2A 3AIVA 1V6YA 1HVXA 2NT0A 4M1RA 1WZLA 5HXMA 4ACZA 5I23A 1H1NA 3W25A 1J11A 3GH7A 2WWCA 3RJXA 3A4XA 3QHOA 1W9BM 1LJYA 1ISXA 1XD1A 1UG6A 1KQYA 1TMQA 4AIOA 1KXQA 2CXGA 4IPLA 1VF8A 3ZM8A 3M7SA 2ZICA 1HT6A 2D0FA 1QW9A 2WAGA 3QOMA 3CIVA 3FXYA 1AVAA 1J0IA 1QNRA 2QHAA 2BY2A 1RP9A 1CXKA 4WKFA 3L2LA 1RPKA 2YKKA 5CPQA 3CO4A 3AXIA 3UERA 1LG1A 5AYIA 3BCDA 4UFLA 3GDBA 1QBAA 4JKKA 1R86A 2QV4A 4GIAA 1VFMA 3W53A 6CGTA 2J7HA 1C93A 2EXOA 1R87A 2BY3A 4OUEA 1TVPA 2O9OA 1WKYA 5A6AA 2VC9A 4OZOA 5EFFA 3SUSA 1E4NA 2FGZA 1QHOA 3OIHA 3TTOA 3CUGA 1BG9A 2WVVB 4PSRA 4DWSC 2WW5A 4P7RA 2W66A 3SUTA 3PZNA 4EAMA 4CD4A 2EPOA 1J9YA 1PJ9A 2JALA 7A3HA 3RDKA 1UD6A 4AZBA 2VVSA 4AW7A 3LPOA 1VFFA 1UR1A 1GQKA 1OINA 1QHZA 3VTRA 1M7XA 2XWEA 3F5KA 1Q6GA 2PWFA 3F5JA 4WKAA 1JDCA 1US3A 2CPUA 4CVWA 1JYNA 1V0LA 4U5IA 1ZB5A 1CXIA 2WHJA 1BF2A 3N12A 3MUY1 1UZ4A 5A8QA 4N42A 1CXHA 1E1FA 1UR0A 1UKOA 4H8HA 3CZ8A 2XGBA 3GNOA 1CGWA 4HTYA 1BYCA 2JE8A 2XGIA 4HZ7A 4UR9A 7TAAA 1V02A 3QOKA 3VD9A 3WFZA 1W9VA 1I75A 3POHA 2DSVA 3WKZA 3VDCA 4DWSB 1UKTA 3MMDA 4BQ5A 4CN4A 3CTTA 3UR8A 3B9AA 1QW8A 4OIFA 5JH8A 1N82A 4CUCA 5LA1A 2GUYA 3ZOAA 4Z2IA 4CD7A 5I3DA 1Q4NX 1V08A 1CXFA 3IANA 4A3HA 2ZX7A 1E5JA 5IXEA 2CIPA 1CEOA 1E43A 4HU8A 1CGTA 1C7TA 3WMBA 2W91A 3IJ8A 4PCSA 4JKMA 1B30A 4LYRA 2DSWA 3W27A 1KGWA 1HNYA 1KCKA 1R8LA 4UOZA 3VX1A 3ZJ8A 1V3KA 1L8NA 1JNDA 4EK7A 1DP0A 1SFSA 4KGLA 3WIJA 4UQ9A 4AZIA 1ODZA 3DYOA 2CBUA 1QNQA 3CHCA 2VL4A 3K8LA 4Z2JA 1V3IA 1VFUA 1SMDA 3OLGA 4AD3A 2VTFA 1IV8A 4K68A 1GW1A 2VX6A 4AY1A 1GONA 3F4VA 2OSYA 3DHUA 3WDJA 1TVNA 4ZXOA 1XH0A 2CBJA 2YLAA 4ZE4A 1IZJA 1ZJAA 1LF1A 1QI4A 3S2CA 3EYPA 3VVGA 3CPUA 3RPMA 2D22A 2YDRA 1I1WA 4J3WA 1C92A 3VGGA 1EHNA 5IHRA 1H09A 3ARXA 1GVIA 3ZMRA 5A8PA 1EO5A 1Q6EA 3WD1A 1UWUA 2J8GA 3EMQA 4WLCA 3MUIA 2DSKA 1E56A 4MNKA 2G4FA 4ZEPA 3VIIA 5BRQA 3DECA 1E40A 1EO7A 1GORA 3VDAA 3AS1A 1UD2A 2VMFA 1K9FA 1KXVA 3MANA 5DFAA 3VGDA 1JFXA 2G3IA 2UY4A 2Y8VA 4JZ5A 3ZT7A 3ARRA 2J75A 3MU7A 1E4IA 1E73M 1JF6A 4J28A 2HISA 1EHAA 1K9TA 2VUYA 5FL1A 4NRSA 6A3HA 3CUHA 2D0GA 5BCAA 1G1YA 1BLIA 4CU7A 1GHSA 3AIBA 5HBFA 5FOOA 1WZKA 2D20A 1KR0A 4TX8A 1TG7A 2BY0A 3AIEA 4HZ6A 4KWUA 2FGLA 1BGGA 3NSXA 1C8XA 3DHPA 2TAAA 3WF0A 3NYDA 1EDGA 4GZEA 4UQEA 4KRUA 2JF7A 3VU2A 2BVYA 3VIJA 4MAZA 1J18A 1OT2A 3KL0A 1GPFA 3AI0A 3CMJA 5HPOA 1VFOA 1JXKA 1E0XA 3AICA 3TTYA 3OGRA 1FOBA 3BMVA 4YHGA 4GI6A 1CLVA 3AMDA 3WNNA 3BAWA 2X0HA 3U57A 1KGUA 3WUGA 3PBGA 1K6AA 1YQ2A 2BNJA 4W8BA 1EOKA 3ZSTA 1AQMA 1XSKA 1HP4A 1CECA 1JIBA 2WC3A 5CGMA 1HJSA 2D3LA 2CYGA 5CSUA 4WIWA 2ZX6A 4W88A 4UQAA 4DUVA 1U33A 1GQJA 2CKSA 2EPMX 4WF7A 1JZ4A 4UTFA 1J0JA 4CGTA 5I2UA 3AS2A 5CZKA 5BXTA 1GCYA 3WQ4A 1CPUA 3KWXA 2EPNA 1E71M 3OZPA 4YN5A 1ISYA 3VGEA 1XYZA 2ZUWA 1TA3A 4W7VA 1UHVA 3AHTA 4W7UA 5DO8A 3KE0A 1BYAA 2Z1KA 2GSJA 2D24A 4D6EA 1HJVA 4E2OA 5D9PA 2J25A 4CD5A 1HL8A 2DIEA 4CU6A 2OSWA 2WZHA 1M04A 3MMWA 4KMQA 1JFHA 1UWIA 1MW0A 1ZBVA 4ZE5A 3VILA 4FF5A 2GVYA 4PUEA 4HZ8A 3VD7A 3SUVA 1J0HA 4IPNB 5A95A 1HL9A 4CVUA 2WMKA 1MXDA 1WDRA 4HOXA 4GO8A 2VNCA 2AAAA 3N15A 1ZL1A 3K4AA 3IJ9A 2VRJA 1SR0A 3AYSA 3WBEA 3WDRA 3LPPA 3W4RA 3VNYA 3IAPA 2QLYA 1QI3A 3LPFA 1UD3A 1XHGA 3VDHA 4W86A 4AEFA 4N0RA 2WLYA 1CNVA 2VQTA 3CBWA 2O9PA 4P8XA 3M07A 1V0NA 5FCZA 4B3LA 3L4XA 4TVUA 1YHTA 1BPLB 1UH4A 3ZQ9A 4C7FA 2E3ZA 4AD2A 1E6SM 5IDIA
chains in the Genus database with same CATH superfamily
4PYSA 4DRJA 3W6LA 1RY8A 2Z1SA 1A5CA 3UI5A 3RR4A 8CGTA 3S42A 4GVHA 1FKDA 1JAEA 2E9LA 2QCDB 4MF4A 1JPMA 4LUTA 1UMLA 3GSMA 4PMZA 4MM1A 5JIPA 1WX0A 4RPPA 1MWOA 1SVDA 1E9LA 3WJZA 1JPIA 3TU9A 5CQ1A 3WD2A 1I2QA 3MCNA 2CLPA 1PWLA 3DBPA 2PCQA 1PX8A 1JDFA 3GVVA 3CEPA 5D33A 1JQXA 2ZA3A 4N9BA 1YBQB 4IHCA 2VFDA 1JCNA 2PDHA 3G1DA 4ZL1A 4PCFA 1AJ2A 4KRZA 5E6YA 1P0DA 1GVFA 4RKAA 3UZ5A 4S23A 3UQIA 4BHYA 3ODKA 3PNZA 1JCXA 1PE1A 3ITTA 1D7JA 3VI2A 1W9UA 1Z8AA 4AF0B 4HPHA 4DAFA 1XX1A 3T0CA 5FJUA 1D6OA 5AYBA 5A6TC 1VPQA 4FOJA 1EGZA 4QRNA 2I5GA 4JTJA 2C1HA 1JUKA 4FB7A 3HG2A 4PUDA 1W3HA 4GZ7A 1QPNA 1QPRA 2Q71A 1H7NA 4DRIA 3D5HA 1X39A 2QUUA 1U5JA 1O66A 2Z6IA 3K30A 4AXNA 1TPFA 3NVDA 2YL8A 4W89A 4ZZ9A 1ESWA 5D9MA 4PE8A 3LCLA 2REQB 1TWIA 3IPWA 1LBLA 3JYMA 4J40A 1VZWA 1U2YA 1GJUA 4AU0A 1QBBA 4OV4A 4Q8PA 3PVFA 4DBWA 1E0VA 3AHYA 4EANA 1UA7A 3K46A 4BS0A 3VCRA 3GTXA 2JF6A 4NU7A 3AIUA 3MW7A 2QUNA 1DIOA 3P3BA 3GXMA 4OJYA 4KPLA 3B3DA 3BSMA 1EWDA 3DENA 1RQBA 3CL7A 4LCRA 1CX9A 4H9VA 3VO0A 5M1TA 5AHEA 2ZRYA 2WK2A 1SMAA 4FF7A 2G4JA 3G1HA 4RZ5A 4GO9A 1N8IA 2E40A 4AIBA 1DWAM 2J7EA 4ZO8A 1TE1A 3PPCA 1IEXA 6TAAA 1P48A 3VCCA 2RGLA 1V6VA 4HHPA 2EULA 3BW3A 2XIOA 4QP0A 4ML9A 3PUEA 3C2VA 3VPLA 1EUAA 1FHVA 3WL0A 2ZR4A 1A0CA 2BXYA 3AJ7A 2IPFA 4B5NA 3MY9A 2RHGA 4LAVA 1SZRA 2Q09A 3TH6A 1HZYA 3UG5A 1HGWA 3F2CA 2WPBA 2DFAA 3NL6A 4AWUA 2R9RA 4PRTA 1SO6A 3A64A 1R9ZA 4E2BA 5FD0A 5DBUA 1EJVC 2JK2A 2Y88A 3FW6A 5A6LA 4G50A 1WKFA 3NPWA 4TXEA 3BC9A 3W22A 3PRAA 2JEQA 3LGGA 4P7QA 1S1PA 5A6BD 3WD3A 4CCDA 3UQBA 5A1AA 3H4GA 3LCHA 1ADSA 1TV2A 3UG3A 3CQ0A 5FIPA 1W31A 3FKKA 1UOKA 3HPSA 5AHLA 2QVNA 3MCOA 5DRIA 3LD5A 1HP5A 1OD8A 3WEMA 3KUMA 1EQ3A 1VEPA 3SIMA 3SCUA 2V5BA 2GWGA 2DH3A 1AK5A 5E93A 3SZ8A 3BMBA 4NAEA 5HDRA 3LUOA 4XBJA 4RNFA 4TR9A 2L5HA 1XPYA 1AQFA 1I9CB 1XCXA 4M29A 2E9MA 2F8QA 2PUZA 1DWJM 2E28A 2KR7A 2ZZ6A 3E49A 3LENA 1PVNA 3TNOA 2YCLA 3ZT6A 1XR2A 5H8MA 3HMCA 3A6OA 1UZ1A 2H8XA 1F8IA 5DANA 2WWDA 3UEQA 4ZA0A 3O5DA 2G8ZA 1W54A 3M16A 4BZYA 1IQ8A 3MA8A 1FKJA 3VIMA 4M56A 2YXOA 5JIWA 1KBIA 3RMEA 3MYOA 2A3EA 1W1ZA 3CGTA 3QW3A 4UMBA 4AH7A 4LH8A 2V3EA 5BWAA 4C6OA 1PKYA 5EMUA 5LSMA 1E6QM 1A4MA 3BPWA 4JHZA 2ZUTA 2OR2A 4HSNA 4A8NA 1VPXA 1PHWA 1KRMA 3IKDA 3OTRA 2DH2A 3CMGA 4UNLA 3EWUA 1QASA 4ZVJA 3O3RA 2J6XA 4L1WA 3RYSA 3BLIA 4CKQA 4HNUA 2Z7GA 1FA2A 1EF3A 4HNLA 4MSSA 4UNKA 1QPFA 1UKQA 2CWXA 1FWHC 4A8LA 3B8UA 2GJRA 3O6CA 4Q8NA 1A3XA 4XKMA 1R9YA 3OLDA 4DH0A 3NQMA 4GYPC 3P93A 3L5MA 3P0XA 1J4HA 1NH6A 1JDAA 2OEKA 1V93A 3IGUA 3N13A 1QAPA 3BSHA 3GIYA 3EAUA 3WNMA 4GVFA 1JRCA 5F7UA 4Z1AA 4X9SA 4D6FA 3AYTA 1EWEA 1T0OA 1MW3A 4PMRA 3M7WA 4AMCA 3RLVA 5CZSA 4AWEA 3O06A 3T44A 3W3OA 1JZ5A 2PP3A 2PTXA 3VDBA 1SW0A 3K13A 1EC9A 1T41A 1VHNA 3TUUA 2WV8A 3HZ3A 3GH4A 4UQDA 2XISA 4DHGA 1H5VA 1XC4A 2WJEA 3UZZA 4PMYA 1FBAA 2OGYA 3OO2A 3CUXA 3HG5A 4MDOA 1T5AA 1C29A 3WUBA 2P8CA 2FHCA 4R85A 1EA0A 2YX0A 5HINA 4RZ6A 5JBDA 3NURA 5FESA 2YL6A 4ADTA 4A6GA 4XZWA 4UCGA 3HJZA 3HV9A 1VYSX 1K03A 2I17A 1SFJA 3UXAA 4DRNA 2V8ZA 1ZFJA 5CC7A 3WJXA 4DZ5A 3SCSA 2AAMA 1FKGA 2WMFA 4JTEA 4ICMA 3FYYA 3IAQA 2GGIA 3L4YA 5TAOA 5FEWA 1UWQA 2C7FA 2Z29A 4LYPA 3KTSA 2B5UB 1X6NA 1AW5A 3E2VA 3REQB 3E0VA 5FF0A 4FLOA 1FHLA 3HA1A 2V82A 4KWOA 5FEZA 3LMYA 3GTFA 5I78A 2NUYA 3G8RA 2QAFA 3QFWA 4TVDA 4IG2A 1B3YA 3UA3A 4DM2A 4UZUA 3WNPA 2C3ZA 5HJYA 5HMSA 4MLJA 2TODA 1BWLA 4IIFA 3UVIA 1Q6FA 3ONCA 1H1YA 1H50A 3GNDA 3K2GA 1PBKA 3SEPA 1M01A 3MZNA 1VHCA 5G2HA 3WQ8A 1EEXA 2JBMA 4GY7A 3G6LA 5E09A 1UWRA 3VMNA 1E70M 2Y85A 5M17A 3EPOA 4V15A 4TMCA 4C6IA 2R94A 2YZRA 3QGVA 3EKZA 2J7CA 3N9SA 1FKSA 4CU8A 1XXXA 4J4NA 4HBEA 1TV8A 2OLHA 1F4AA 3WLSA 3CMFA 1EL3A 4AUBA 2OOGA 3E0LA 3CWOX 3P5ZA 3V7PA 4XTDA 3N9RA 3GTIA 2OWXA 4QCFA 5RUBA 3KZSA 5LNWA 3TDBA 3MI3A 3UWVA 3DESA 3B03A 2ZZ4A 5GNXA 4LF1A 1ZGDA 5I77A 1F9CA 4DEFA 1WO2A 3QR0A 5G5IA 1PAMA 2VHLA 2V5LA 2NV1A 3MKKA 4CEXC 1U1JA 3TE9A 3OHMB 3QHNA 5DXYA 5XINA 3H12A 1DKWA 4MOZA 2V2CA 3TLQA 3TC3A 1MQPA 4HIBA 3WBYA 2RJHA 4UFHA 9CGTA 3WQGA 1SM9A 3Q67A 3P60A 3ERPA 4MPKA 1VENA 3B4UA 1HXJA 1XIEA 4W93A 3HO8A 4B3KA 1LWJA 3TTQA 1FCUA 4Y9PA 2E5CA 1RA5A 3AMCA 2O7SA 5C6MA 5HW6A 4RL3A 3G1YA 1V6UA 3HFYA 5KEZA 1LBFA 1F76A 4JIEA 1XGDA 2B7NA 3LU2A 4C6NA 4S39A 1W2VA 5CBIA 3ZLFA 3VE7A 3R79A 1TPVA 3GVRA 1Y5WA 2OEMA 2NXIA 4DAIA 2A3AA 1XLCA 4XB3A 2MLZA 4M5PA 1TZZA 4TW7A 2QMJA 3UF9A 2P1FA 4F0RA 1W91A 3OODA 4BF8A 2WBKA 3VNDA 8XIMA 3CWNA 1VR6A 1TPC1 4ACZB 3IIXA 3DIPA 1KB3A 3TN3A 4J2MA 2V38A 2QVHA 4X2PA 2WKGA 1U83A 1H49A 4KQZA 2GK1A 1WP6A 4GH3A 4PODA 3O1NA 1T8XA 1ZNNA 3W83A 3E12A 4IP4A 4JY9A 4R7JA 4BY3A 1R2RA 5C2CA 3V1PA 4EXBA 3GZ3A 3T4CA 3P81A 4WY0B 5AC8A 1OC5A 3AU6A 4ZTXA 4JAWA 4K7YA 4WXZA 1PEZA 3NQBA 1IWBA 5HNUA 4Q8QA 3O5IA 2GL5A 3I6RA 3T9PA 4GA8A 3LGDA 5DRCA 4ZPVR 4EOUA 3L23A 3R0UA 4W9PA 5GPRA 1J0KA 4DF1A 3SN4A 4RCXA 1C91A 2CCRA 5KITA 1D7IA 4FK9A 2G3NA 1LROA 2R1KA 3AUOA 3LTPA 3FGCA 3DEQA 4AHQA 1GJWA 4UTMA 4O12A 2A5HA 1ECEA 2M08A 1QJWA 2VCCA 2WVTA 3A9BA 3DUGA 1EBHA 4CN1A 5F4SA 3O5KA 1UASA 2PMQA 3TYDA 1CTNA 1Q2RA 3K4DA 4FNTA 1LL6A 4MJMA 4PMOA 3SSJA 4JTQA 3UA4A 2F38A 1FFRA 1I0DA 4JDBA 4US5A 3ZR4A 3EXRA 1E6NA 1BXCA 3DHDA 3IRDA 4K8GA 4IMEA 4E5TA 4RXGA 3ARZA 4HBKA 4MB3A 3UXIA 3NFUA 3WH7A 1I0BA 4S3AA 1RD5A 4MUZA 1JYVA 4J3ZA 3CIXA 2BGNE 2HCVA 5GVJA 4LAXA 1PCWA 4EAYA 3WMCA 1FCVA 4CNOA 5AVHA 1ZCNA 3N2MA 3PB0A 3EWBX 1D8WA 1E6PA 2DY3A 3G3MA 4O53A 3UZJA 3BMWA 5E0CA 3H4XA 2ZDSA 3ZZ1A 5C7HA 4KEVA 4IP7A 4F2BA 3EWYA 1GVYA 2V3FA 1Q6RA 4DO4A 3FDKA 4ZQCA 2EEXA 2I16A 1Q5MA 1H7WA 3ZJ7A 4KCTA 4HK6A 3ARTA 3KS5A 1J0ZA 3RXZA 2EKCA 1QHPA 4UTJA 4H8UA 3NA8A 3UNDA 5CBBA 3BXWA 1XSJA 1IHIA 2IUZA 4LS1A 3PPGA 1BRLA 3SN0A 3W82A 1Q6UA 3M5XA 4LS2A 2YCJA 1GJPA 1AL8A 4GYJA 4LJ3A 2EAWA 3HM7A 4K3ZA 5D38A 1V77A 1A3HA 1W17A 1JNSA 1Q6QA 5D4YA 2WVUA 3WLHA 1EDTA 4XIMA 4WDUA 2QV5A 4G56A 2X7VA 4AWSA 1OGGA 2QCMA 1HKMA 2VEKA 1XSIA 4F2TA 3PFMA 4JFKA 3W01A 1BKSA 1VAHA 1ZS2A 1FWFC 1WPCA 3CASA 2TYSA 1BSLA 1SJDA 5HAOA 1KWKA 1BYBA 2WB5A 4H2CA 5XIAA 4YVPA 1YE4A 5HWBA 4N2YA 2W67A 2DQXA 4QBXA 1NSJA 3SGZA 3TTEA 3L7RA 4MNMA 3EB3A 1B3VA 3UWUA 1ZCCA 4RE0A 4Y6GA 1DORA 2PDPA 3SY1A 4PTVA 2G96A 3C3NA 4YYCA 3VKDA 2YBUA 3KHJA 2X2GA 4PB4A 1ZBWA 4B5SA 4W87A 3KRUA 3L4ZA 3N18A 2WNZA 4J5NA 5D2TA 1KBKA 2WBGA 4D71A 1BXBA 2PDMA 4NYYA 3VNMA 2ZTJA 3G3DA 3UR7A 3WD0A 3URNA 2IPJA 3KHDA 1EJSC 2WVSA 1UOZA 1HJXA 1OSEA 4S3CA 4L1XA 4K7VA 5E0KA 3RF9A 4KWWA 5HJLA 4M8UA 2PGEA 4UTLA 4MY8A 2GLKA 4XAKA 1WKDA 2X30A 1GVSA 4GXPA 4P7OA 5AY7A 1UD5A 3TC5A 4CCCA 3EY6A 4P2VA 1B57A 2V30A 3UZWA 3UFYA 1B5TA 2CZ5A 4AD5A 2VGGA 3UJRA 3R12A 3URAA 2WMJA 3T42A 3EMZA 2HE8A 2V5CA 3QYSA 3CLMA 4OBSA 3KRBA 3PJTA 2CKRA 5TF0A 3ZYZA 5K3VA 2XN1A 2QDHA 3GG7A 2XN0A 4QE1A 3WDHA 3MQTA 2YXGA 1KNWA 3PTQA 1OX4A 1O6IA 3MVIA 3LXAA 1TMHA 3PUOA 3TFCA 3MCMA 2EO7A 4PBGA 2PWGA 2ZR5A 4Y8EA 2DZBA 5CPOA 2Y61A 5B8IC 2YDQA 3UP8A 5AN7A 3O5PA 4V1YA 4I7VA 4IISA 2D3NA 3DI1A 3KCJA 3R5EA 5I3JA 1AH0A 2EF9A 1GKRA 4A05A 1C9HA 3ISIX 3MWAA 3OVQA 4A8RA 1RA0A 3L5AA 3E38A 4KGJA 3IUHA 3O9NA 5F1VA 4R33A 5AECA 4GH1A 4IZGA 4QEEA 2V3DA 2WHMA 5CPSA 2B0MA 4LU0A 4QFUA 3SIZA 1V79A 4DYKA 1LRQA 1Z32X 3CQHA 4PCPA 3USZA 2DUXA 3GQYA 2IKJA 5BOOA 4IGSA 4B5TA 4US5D 3OGVA 2IW0A 1CYGA 1R6WA 2WM0A 4K1GA 1OY0A 2E5BA 1V3HA 1W6TA 3YPIA 1R7AA 3VINA 1NJJA 3O5OA 3RCMA 1BG4A 1UPPA 5C5YA 4B5WA 4HNOA 4PFHA 4PMVA 2EJAA 1OWQA 5HPCA 4JFVA 2ZZ2A 3THUA 1Q13A 3HG3A 2PZNA 4ASTA 4B90A 1FH9A 2MPHA 2MLXA 1L6YA 2Z6JA 1HTIA 4MJ2A 2WPGA 3ID7A 4QAWA 1XW8A 3VC5A 4FAMA 1RZMA 2J7GA 2BSLA 2QYGA 3E5PA 2A0NA 1JI1A 4AC1X 5CJNA 4O0KA 2RQSA 2PGWA 1Q2SA 1JJKA 3H22A 4LRTA 3AZTA 2PURA 3VOCA 2ALRA 3GK0A 3UI6A 2P5NA 4D8LA 5HWNA 3B8VA 4ZFMA 2OELA 4DRKA 4KCUA 1P7TB 2OZ0A 1A50A 2Y5SA 4QJ1A 2GQ8A 3CZLA 3GR7A 1TWDA 4KF1A 3E0FA 5CZJA 1H11A 3BGAA 3ITOA 2O9RA 3VABA 5F4XA 1O94A 2POTA 2VELA 2OPJA 4JFTA 1DWGM 1DOSA 1W1B1 2OYKA 1UZHA 3DI0A 3ES8A 3CGNA 2PSNA 3GHTA 3W7RA 1MXGA 4OOUA 2A3CA 4QITA 4ODPA 1AW1A 3PWAA 3GDMA 4NZ1A 3CQIA 4ZODA 1LDCA 3CYJA 4QJ4B 3DYMA 2F9RA 3HV8A 2J79A 1UD4A 3INPA 1L1PA 1SPQA 3SJ3A 5LIXX 3FNDA 1A3WA 4NZCA 3O0KA 5DCBA 4UOQA 2ZA2A 3NDOA 2VFGA 5BRBA 4ZENA 1J4RA 2WMIA 4EX4A 1QATA 3AIVA 4M1RA 5BMXA 4JTIA 2FTWA 3U3HA 4IJCA 3TSMA 3GH7A 2PP0A 4FZIA 3DC8A 1UG6A 5BW6A 1TMQA 2YDAA 2OT1A 1EB3A 4IPLA 1T96A 4UTUA 5LIYX 4I90A 2ZZ1A 2A7NA 2F4EA 2B7OA 1DHPA 4FI4A 2WNNA 4EACA 3QOMA 3FXYA 2YPIA 5TIMA 1J0IA 2BLEA 2BY2A 4GUIA 5IOBA 4WKFA 1RPKA 5CPQA 2RDUA 4UFLA 1K4GA 3GDBA 1AW2A 3EWXA 4DO5A 1L2UA 2BMBA 5I06A 3SECA 1G4EA 3QV9A 4H6QA 2J7HA 4LBRA 4IGHA 1R87A 2BY3A 3P8IA 3SUSA 1E4NA 3WYZA 1YX1A 4L1GA 3CUGA 4WD0A 3O05A 3SUTA 4QG8A 1R47A 7A3HA 3DFOA 4AZBA 3WQDA 3T81A 3CB8A 2Z1BA 1EF2A 2TSYA 1OZMA 3VTRA 1M7XA 3AYVA 3F5KA 1JYNA 3NEVA 4QS5A 1I2NA 1P0BA 1R3RA 3MUY1 3RRXA 4H8HA 1G6CA 2PV2A 2VD8A 1CGWA 5HNTA 1LOQA 2JE8A 2XGIA 1ENUA 1ZZMA 3WFZA 4QDPA 4LRSA 2BOFX 3WG6A 4L7ZA 2FMNA 4TW8A 2PP1A 4HU4A 2BGSA 2BBFA 3FIGA 4XK2A 4YCPA 3UR8A 3C6CA 3S8HA 1N82A 2C15A 4OU1A 2ATSA 3MUXA 4R7OA 3B04A 5KTLA 1Q4NX 1R3VA 2G37A 3NZQA 4MZ1A 4C60A 5IXEA 2LGOA 3KBMA 4JYEA 1CEOA 3NR0A 4A3UA 1CGTA 1IEVA 2W91A 1B30A 1AMKA 4ZOAA 1TE6A 5LNSA 5FJIA 3URQA 4JICA 2ACRA 2RAGA 4KFOA 1V3KA 1L8NA 1DP0A 4KGLA 3WIJA 1AFSA 4ZTYA 3VDGA 1RK6A 1X7IA 3F2DA 1LCOA 3GU0A 5AHFA 3STCA 5F1UA 1VFUA 1SMDA 2PDQA 1MUMA 1WV2A 1ZCOA 2KX9A 5HMEA 2TPSA 4WDTA 3ES7A 3UY8A 2ACUA 1TQJA 2VX6A 1GONA 2VP8A 3TCZA 3GR4A 3NM3A 2V81A 3WDJA 4ZXOA 3M44A 1GEQA 4IGNA 4OT7A 4ZB2A 4DBUA 1VYRA 4UTIA 1IZJA 4M7TA 2ZRVA 3RGCA 1LF1A 1QI4A 3VVGA 3RPMA 2O0TA 2YDRA 1I1WA 2PV1A 1H09A 3UJSA 1PB0A 3THAA 4ZSTA 1KT0A 3ARXA 3MDYB 3ZMRA 1UJPA 5A8PA 4B4HA 2J8GA 1F6PA 2ISVA 1FWCC 3VNJA 5K9CA 3G1VA 4H9MA 1E56A 4AEOA 4ZEPA 4Q33A 5BRQA 3DECA 4CNNA 2Z25A 1FX6A 2VOMA 3LQGA 4QR6A 1KXVA 1TMLA 1DXFA 1HQTA 1YTEA 2Y8VA 2ZRXA 2CC0A 3SRHA 1PYMA 1E4IA 4UIOA 1O4UA 2D2JA 3S6OA 2ODOA 5FL1A 2ZFAA 6A3HA 2D0GA 5BCAA 1VIZA 4DXVA 1G1YA 1BLIA 3B0PA 3AIBA 5JH1A 3CGMA 5FOOA 1WZKA 4F40A 1KR0A 1TG7A 4HZ6A 2FGLA 3QMTA 4KERA 1IGWA 3DHPA 4FN2A 3SRKA 1TTIA 4MY1A 4KRUA 2YZ5A 4M1BA 1FWJC 3W7MA 1U1UA 1LTDA 4MZ8A 1J18A 5HPOA 4WOQA 3B0XA 2A2IA 1UUMA 1I60A 2GDQA 1J6YA 3NQDA 3OGRA 2NQ9A 1LT7A 3ZWTA 1TPEA 4YHGA 1CLVA 1FXQA 1OF6A 3PRDA 4HA0A 3WUGA 1WQ5A 2RSEA 1XSKA 1HP4A 3CQJA 3OQ8A 5CGMA 3GLCA 2QCLA 4W88A 3TZFA 5HW8A 1MDLA 4YMZA 3FJ6A 3H2EA 4WF7A 3SGUA 5LNUA 2ZADA 2OO0A 1XLEA 3KWXA 3OZPA 1ISYA 2E67A 4FNPA 1TA3A 4O0QA 2PDJA 1UHVA 2BDQA 4FX8A 4L65A 5DO8A 2DZAA 4N4QA 3U48A 3FSTA 2CXEA 2XZ7A 4ZBCA 3LEPA 3GTYX 1OADA 3HMJG 5H91A 3M4HA 3PUGA 2OX4A 4DRQA 3JW7A 2P53A 3AXMA 1ZAJA 1M04A 1GKQA 1A5MC 2HXUA 1JFHA 4KMQA 4I9MA 3H8AA 2BX7A 4Q6XA 1VCVA 4ZE5A 4N9CA 1O95A 1F61A 2GVYA 4PUEA 2ZDRA 4HZ8A 5D04C 1NELA 3LYEA 2QGYA 4NQ1A 1LOLA 3CV1A 3RLGA 2PDNA 4GO8A 2OZ8A 1BXNA 1JPDX 3K4AA 2VRJA 1SR0A 3EB2A 1ME7A 3KRSA 5TBOA 3GWQA 4AEFA 3AAMA 4N0RA 4EPEC 4CCZA 3O8AA 2O9PA 4QSFA 1CB7B 4P8XA 3M07A 3IJQA 1FDZA 1S5MA 4XBSA 3PBMA 4GKTA 4C7FA 4AD2A 1VQTA 3RGTA 1G0CA 3NQCA 2XVKA 3TSBA 4DZHA 4XISA 1F5ZA 3S1XA 3ZS4A 3BO9A 1VFLA 4JTUA 2V5DA 4DQWA 2WZTA 2XN2A 4OOZA 1OM0A 1LWHA 2WCGA 4D6CA 5CG0A 1D9EA 3M0KA 4C7GA 3A5VA 1W3NA 2XH4A 4LQ1A 3G18A 4PC8A 4X22A 5LYRA 3M0VA 3VIKA 1MNSA 3KVKA 4KT2A 1PCKA 4W8AA 1JR1A 5IFTA 3GU9A 1VRDA 1XM3A 3SCVA 2IKIA 2NWSA 1G01A 3E5BA 1TPH1 4R9OA 3QN3A 5C2GA 2QCEA 4Q4MA 4BF7A 4A2RA 3KLLA 3CTLA 3O07A 4R9XA 3CYVA 2Y7FA 2HS8A 4XSMA 1V51A 3HN3A 1TQXA 3UD6A 3QY7A 2FIQA 3CC1A 3PZVA 4A4AA 2ONEA 4RV3A 3LI0A 1M5YA 3G0UA 1R3TA 4Q7NA 2W3ZA 1XL9A 4S1FA 3C0SA 2Y1HA 4DJFA 1KM6A 4HNVA 1BHGA 6TIMA 4B2DA 1ZY9A 1PX4A 1QI2A 1UPMB 1W3IA 4GVIA 3PB2A 4JTSA 4LC6A 1JNEA 2QEZA 2C6QA 2PB1A 3H4WA 2NT1A 3QHMA 4QNWA 4LNYA 3C8NA 3WELA 1R3QA 3GG1A 3BGJA 4XV0A 4MTVA 1Q6CA 2HVNA 3OIXA 3GZAA 3L65A 3THCA 3TSDA 3SURA 2QMKA 1WOAA 6ALDA 3WQFA 4UDMA 1G7UA 1V7AA 4G1NA 2VWSA 3LZ3A 4RV8A 4ENLA 1LQAA 3W26A 5LIWX 1TO3A 1VIWA 3EZ4A 3R11A 1V8EA 1O68A 1XD0A 2Y8KA 5D8ZA 1EYMA 3DKJA 4J3SA 3KBNA 2BVTA 1SW7A 2VZSA 1JG9A 1I45A 5HMDA 1Q8JA 4MFDA 2VDIA 2R6OA 1VP5A 1ODUA 4NSBA 1P5QA 4LUIA 5CCZA 1S2AA 2INEA 5HUAA 4GMEA 4Z0JA 4Z2KA 2F2KA 1MSSA 1HKIA 1K8CA 3BLKA 4DELA 1MFUA 3LY0A 2PE4A 2G5WA 4HA1A 1TUXA 2POZA 4D6HA 3H7VA 3G6MA 2D69A 4WSHA 4DB7A 1WNOA 4A21A 4OBTA 3RM4A 3SR7A 4TV6A 3MV01 4TV5A 4J3XA 3TMLA 3NIYA 1JCHB 3W1AA 2V63A 1UYQA 5F2GA 3NO5A 5M5DA 3FYOA 1E72M 4JX6A 2P3EA 1V7YA 7REQB 3NZRA 1SJCA 1EPVA 3AMLA 3KW3A 1RBAA 1CGXA 3QY8A 4YYFA 3TIMA 4EPBC 5EB8A 1XYBA 1FY6A 3MJMA 3K8KA 3TOYA 1BSIA 5ABEA 2DG4A 4NI3A 5MKGB 4QQ3A 2XIQA 2QUMA 4C6FA 4GCXA 4X0VA 4FR6A 3OA5A 1EXBA 2XPBA 4OQVA 1OFRA 3P61A 4LUJA 1E0WA 1TRIA 2WVVA 3VOFA 2XPAA 1KTNA 3P80A 4JNMA 2ZA1A 2GVGA 1SYTA 4HP5A 5CJMA 4REQA 3CH9A 3GNXA 1LZOA 2ZWYA 3MV11 4IUOA 2ISSA 1F40A 1QR7A 2GJXB 1BGAA 3J7HA 1EA9C 4Y7EA 3TJLA 3GW0A 1JQVA 1ZAIA 2X7WA 1YPXA 2VUNA 5K4ZA 3U0HA 3RAOA 3KM8A 3NOYA 2WC4A 4C6BA 3T07A 5HTGA 2CLHA 1KA9F 3VA8A 1HIZA 2VZVA 5AZ0A 5PTDA 1UD8A 1VFHA 4EXQA 3KS6A 1ZALA 2QCNA 2VURA 3VKAA 2W6RA 4DWSA 2V9DA 3N4FA 1RP8A 1E6ZA 1G4SA 3WD4A 2FPYA 3S9IA 4JFJA 1IIHA 4JL1A 5A2BA 1E15A 2QUVA 2VXNA 1GVEA 4FS9A 2AQOA 2OKTA 2BODX 1FAPA 2XYLA 3BG9A 3VIOA 2HRWA 3F7JA 1LUCA 3BCFA 1A5NC 1HXVA 5A5WA 1FCQA 4FXFA 3AS3A 3VNZA 1CBGA 3F2BA 5E9XA 2QS8A 2GSEA 4FOUA 1XYFA 3W87A 4A2SA 2RGMA 3G8EA 7XIMA 1AH4A 4RE3A 4YTUA 3V0TA 3IVUA 3OVGA 3WDPP 1QMLA 1N2VA 2XIIA 5FJJA 1DTUA 4JQ2A 1KM3A 4JQAA 3G5EA 2X8RA 3IIPA 3PZ9A 4KR0B 1GG0A 2J9XA 2JIWA 1NU5A 3W28A 4HKPA 3FX4A 3PNUA 1VBHA 4L9YA 5HWCA 4N19A 2GPTA 1IR2A 3CXOA 3C8FA 4JN6A 4RNHA 3ZVHA 1P1MA 2R91A 2GFTA 4RE2A 1D7FA 2Y63A 1UA3A 2W62A 4ATLA 3NQFA 5C8BB 4NT0A 1VBUA 2XVGA 1W56A 4HU3A 2XU2A 1SJBA 2NSXA 2Y7EA 4E4FA 4GOAA 4C6MA 2OOFA 3OZOA 1OJXA 1H62A 2ASHA 1PX3A 2RUDA 3TK7A 3CLWA 4DJFD 2W63A 1K70A 3THDA 1WOBA 4W84A 4UMCA 4B2DD 4L61A 1WUFA 4B16A 5ECVA 3B0VC 3G1RA 1CZ1A 1A0DA 5BNKA 4JQ4A 5DIUA 2CHNA 3L67A 3PZGA 3R4IA 3ZSSA 1MVYA 1XLDA 2TMDA 1NDWA 1BF6A 3B7XA 1OC6A 4YPJA 2HPMA 4R3UA 2YCKX 4G7EB 3SCOA 2DZWA 3E6EA 3WNOA 3BH4A 4HOWA 5I02A 2HSAA 3RFAA 2VX7A 4URIA 2VX5A 2ZXAA 1FWIC 2NUWA 3FHAA 4D6JA 4UOJA 4CNUA 4JTAA 1M6JA 4D9PA 1R9HA 2J13A 1XRVA 3A22A 3W85A 3AOFA 4GISA 2E6YA 2DT3A 3MSDA 2XIJA 3GU2A 1M3UA 3U5YA 4XBKA 3VKCA 4XO7A 2Y78A 5L9FA 3ZVIA 3LM3A 1YDYA 1FH8A 3E2SA 3HPXA 5AZ1A 1S2CA 4HJWA 4JFWA 1LL7A 5K4XA 2NW0A 4IIEA 1VBGA 2E8ZA 2PZ0A 3GG0A 2G3FA 3KBWA 3BW4A 3L68A 1T40A 6REQA 1PZ1A 4HSHA 1UUQA 2QCCA 1KKOA 1JULA 4Z17A 3N73A 2Q3RA 3NL5A 4MZYA 5AYYA 3MBDA 5JQ9A 4GGQA 1QPQA 3ARQA 4DJEA 1NP2A 1AQ0A 3L4TA 3IIVA 2PWVA 4WJEA 4FIQA 5AC4A 4XX6A 3IRSA 1YATA 3WF1A 5C9WA 1EIBA 1EPXA 2YSWA 2NQ5A 2WMHA 4ACYA 3I4EA 4AZHA 3CHDA 2D1ZA 3MMUA 4HBOA 1HW6A 4JDYA 4QJ3B 2CHOA 3NAVA 4XO6A 3IGXA 2Z7KA 3FSUA 4NJHA 1ONRA 5FA5A 3LBOA 1W1YA 1J12A 2CZVA 2I1OA 4JFMA 5CC6A 2C14A 3MHFA 2VFIA 2H9AB 3T1GA 4AVFA 1DIKA 4AZCB 4AZ6A 3UETA 4RXFA 4BR1A 4AFYA 4JTKA 1L6GA 3NGFA 1QWGA 5BOEA 5A69A 1UWAA 1XYAA 3BLFA 1FKFA 3CT2A 2V2HA 2VZTA 3QQWA 4PUMA 5DT5A 2INZA 3N6HA 3A4JA 4O19A 1SZGA 1SU5A 1E3ZA 3PAJA 2DW6A 2G0WA 5I3KA 3LA4A 3W6MA 3TA6A 1RALA 2XM1A 1UWTA 2YL9A 1GG1A 3O5GA 4KBXA 4E8DA 4HPJA 3W2MA 3AIWA 5HA7A 4KEMA 3O5RA 2AKMA 3VGHA 4XIAA 2QCDA 1RQHA 5DITA 4S2BA 1W5NA 4A3YA 1LL4A 4DWSD 2NLIA 1L9WA 1S3TC 5DELA 1H41A 3N11A 3MKCA 1DWFM 5A2CA 1JYXA 4HMNA 2OGJA 5BMWA 8TIMA 1H7RA 3PN8A 2VGFA 4XD6A 4UFIA 1OG6A 4IIGA 2WCSA 3IV3A 3EX6A 4G2PA 4U10A 3FV9A 1EEPA 5JH2A 1OIMA 2OLAA 2XP4A 4ECLA 4L64A 1PZ3A 4S2CA 5I3HA 3MBFA 3BQ6A 1UP2A 5D2WA 1YBQA 2XDFA 3T78A 5JUVA 3QVQA 6ENLA 3AS0A 1US0A 3CUIA 4H00A 3W7JA 4DPPA 1YDVA 4JYSA 3LCFA 2HROA 4GHRA 3VX0A 2QF7A 4AF0A 3AXHA 4Z0SA 1UH3A 3W7HA 4LSBA 4L4LA 2WHLA 4DYJA 2W4XA 3M47A 4L72B 3H2FA 1P0EA 4F4RA 2VCDA 3W7CA 5C54A 4AG0A 1DJWA 1X1ZA 5A8NA 4XVDA 5F2IA 2BOGX 3M46A 1BVWA 2DJXA 5T26A 2R1PA 2WQPA 3MB9A 3CK5A 3AZRA 4AYSA 4QHRA 3I4KA 4YWSA 3VE9A 2Y24A 2VKZG 3TYBA 4IPJA 1V0KA 2WSYA 1KLYA 3C0LA 3IVTA 1GPWA 3NPUA 5BU9A 2REQA 3TYAA 2FHBA 1R38A 4PL2A 2ZUUA 5I0DA 1HVQA 1F6KA 4ORIA 3R6IA 4OKDA 4TTUA 1CIUA 3PTKA 1P0KA 4MB5A 4JFLA 2W5FA 4RW3A 4BQ2A 4J7RA 1UQYA 3ARYA 3LPGA 2OYMA 3P2VA 2E1DA 3ABZA 5I3GA 1NWSA 2PU1A 1A53A 4ZB5A 3IS4A 1IX5A 2C91A 3N17A 3H26A 1AD4A 3IGSA 3RRAA 1ITQA 1GZGA 4ROQA 4A22A 3GVGA 5DY2A 2PGRA 3EDEA 1KCLA 3RU8X 3LOTA 1L0PA 4U86A 4FLRA 1J10A 1JDDA 4O17A 3DFYA 3M5YA 7PTDA 1ZENA 1JZ3A 2ZQ0A 3KTXA 3AIQA 3QLDA 4C6EA 3AZSA 3ZXWA 1JGMA 4DF0A 3LRMA 2OTDA 4EKJA 3N3MA 4NAFB 1Q6LA 1EQPA 1QUMA 3C86A 3SY5A 4QLLA 1J4EA 4ML4A 3RM9A 2RURA 1VD6A 4GWEA 4IMDA 4HCDA 1XBVA 1YXDA 2G3JA 1ZJBA 4GY0A 5HR7A 1J6PA 1FKWA 4NJKA 3FAXA 5JBEA 3ATYA 1TREA 5KZEA 3LV5A 3SO7A 1NOUA 4DJED 2Y70A 2IQDA 1DTNA 5DN1A 1LORA 2ZOXA 4M80A 4XVEA 1HJUA 2WCAA 2XTKA 5G1TA 1OCNA 1YNYA 4HCLA 3UY7A 3EPNA 3RILA 4AISA 5KZ6A 2BG5A 3JYJA 2D73A 4UUIA 3W1TA 2HE5A 4QE4A 2D2OA 5U4NA 3TQ0A 1YRRA 1NDZA 3GRIA 3GFXA 3NQ6A 4M81A 5LXXA 1V6TA 1PINA 3AHZA 1A5LC 2OYLA 3FXGA 1I1XA 3SBFA 2WSPA 3WH5A 3MO7A 3OQEA 3W1LA 3NXLA 2ABBA 4PN2A 3QYQA 2PBCA 2A85A 2PDBA 3M0YA 3R94A 2A3HA 4F0KA 1KRAC 1EC7A 4MB4A 4L6DA 1POKA 2J66A 3OZMA 3ZO9A 3K5XA 4XKYB 2NVDA 3WBWA 4AZGA 1V4YA 2WYSA 2ZX5A 3BV7A 1TWZA 3S9ZA 3IJ7A 1TB3A 2HV5A 4ZO6A 3S6TA 1M41A 3GIPA 3N14A 4HGXA 4UTWA 1N55A 3I3DA 2X16A 4F9JA 4N4PA 3ATZA 4J4OA 1B1YA 1ICPA 2ZQUA 1LP6A 3T0AA 1KFCA 1XLBA 3BW2A 5DX7A 1VEOA 2GSHA 1X98A 4B92A 3ZVHB 4DXKA 1SR9A 3PG9A 4O4WA 3ITYA 5G2WA 3BUVA 4I8DA 1B2YA 2ZXBA 5CSYA 3TDFA 5A3HA 1GQIA 4KQNA 3JRKA 4PSPA 3UESA 1V6XA 4GZJA 5HT1A 2C16A 1BTMA 2ITKA 4LBSA 3W7GA 3HPFA 2QJHA 2FVLA 4MNJA 3WLPA 2PRMA 4I8YA 3PP7A 4GQ0A 1X6LA 2C1GA 4HYWA 4C1LA 3THQA 1S2VA 2XP3A 1J93A 5DMYA 3G1AA 3EA2A 3CV2A 1RVKA 3ZFHA 4FEZA 3IK8A 3LS9A 3AXXA 4Q32A 4YIWA 4LUSB 2NV2A 4X61A 5FJOA 5LA0A 3QW4B 2CHRA 3SADA 2XFFA 2NV9A 4EE9A 4U2YA 4RX0A 1DBTA 1MO0A 4Z2GA 4ZS6A 3NTYA 1GTHA 3CT7A 3R25A 3TYEA 4KWVA 3TVAA 2D0HA 4O10A 2JKPA 2PTZA 1POJA 1OCJA 3DFNA 4AAJA 4JTGA 3O5FA 2BVWA 1PKMA 2XSBA 1GWJA 3BGGA 1SZFA 2W0UA 3VNKA 2EJ1A 2YBTA 3HF3A 4HT3A 3WQPA 3KP0A 3GC5A 4C6CA 4JPGA 3VD3A 5C9ZA 3O6DA 4KH2A 3ARPA 3FJ4A 4PUNA 4S38A 3RM8A 3B8TA 3G1XA 1IIGA 2XP8A 3L0GA 1WCGA 5DF0A 4RE4A 4QT2A 2J8TA 4MWAC 2VC6A 5CPTA 1J01A 4DPQA 1KXHA 4Q8MA 1XIIA 1P1XA 5H2ZA 5MF5A 3LZ5A 3PPFA 3U2EA 3TC7A 1H1ZA 3KBVA 3HQOA 1GOQA 5T9BG 2BGQA 4TOQA 1BFNA 3LK6A 3GD6A 3REQA 1E3XA 2X42A 3SGGA 1TWSA 5T91A 4DZAA 4ODOA 5A6SA 4Z2HA 1O1ZA 4R5EA 1FFQA 1O12A 5D2VA 4EPKA 2WSQA 3I3EA 2Z0IA 1ZQ5A 2VGBA 4PCTA 2PPNA 2XH0A 5FAJA 3RK8A 4ZXLA 4LTSA 4CCEA 3IEBA 2V5KA 1FWNA 4NASA 5I79A 2ZTKA 4QCEA 1W3KA 4MY9A 1PKNA 3SQSA 5G4WA 3DFSA 2EGZA 1SFLA 4HN4A 3T2QA 1T7LA 4LEQA 2DIJA 1JUBA 4DJFC 2XM2A 3M43A 4Q8WA 1K9EA 2VOTA 1XG4A 1YKWA 3W7DA 1C90A 1W9PA 2MANA 5REQB 1HUVA 1MRAA 2DVXA 3UXLA 3TQKA 1OX6A 1MEIA 4PR4A 4I6VA 3LLXA 3H7UA 1IEWA 4O1BA 3GYEA 5CLWA 4F48A 1JPHA 4HD5A 1XIHA 3EDDA 2Q8LA 2Y4SA 3A23A 1MEWA 2DZXA 3QZAA 1TJ1A 3OA3A 1GVOA 3FDGA 3PY2A 1Q85A 1XC6A 2VFHA 4FNSA 5K2ZA 2WSKA 4HU0A 3VNLA 4MB1A 2C0HA 3TYZA 3QR1A 1Q63A 3AISA 2ZXDA 2DPEA 1NSGA 2ZRZA 4ZFCA 3A47A 5I07A 4LV4A 1QI5A 4DF2A 1PKLA 3MP5A 3P74A 4UTTA 4U28A 3EXTA 4NX0A 1DJGA 3I10A 5EMMA 3MP3A 1XDJA 2R14A 3MJYA 1NFBA 3OGSA 4TMBA 2HS6A 1J0YA 1ZTVA 2NVAA 3DH7A 1N7KA 2CERA 3RN6A 1NARA 3W7OA 4FLQA 4PMQA 1O5RA 4PGLA 4IM4A 4Q22A 3BLPX 1FRBA 1DEDA 2BZNA 3NDYA 2DP3A 1VRXA 2P0OA 1SZNA 6XIMA 5TQLA 4NXSA 3SSZA 6PTDA 3TONA 3CM4A 3VIGA 3U4FA 5M03A 3W00A 3U8GA 2V6AA 2DZSA 2VX4A 2ZX9A 1VFTA 2DORA 1Z9AA 4ACZA 4CEUC 1K7EA 1KFKA 4XZMX 1DJZA 3RJXA 3QHOA 4H7ZA 3TXZA 1SUXA 3GKFA 4GNVA 1KXQA 3UR2A 3BJFA 2CXGA 4BEUA 3ZM8A 1HT6A 4JTFA 3EOLA 3M0MA 3H9RB 1KFBA 1QW9A 5C9UA 4WY0A 2AGTA 1PTGA 4IL0A 3UJ2A 3FYPA 1RP9A 3W7IA 4JIQA 2XP5A 3L2LA 4FSAA 2YKKA 3MPGA 3C3UA 1FKIA 3CO4A 4IWWA 4G2DA 4O1DA 3S6DA 1R86A 2QV4A 4IL2A 3DFTA 3PF3A 1XIDA 2GQ9A 3P7YA 4C6QA 2FGBA 2ZVRA 3S0CA 2GJNA 2RDWA 4P61A 3UYCA 4OUEA 3BL3A 4A29A 2O9OA 4H9XA 5A6AA 2VC9A 3L66A 3KDOA 3TTOA 4PSRA 4DWSC 3UWEA 2W66A 3PZNA 4EAMA 2NQJA 3RX2A 1DPMA 4NZ5A 1J9YA 2PN0A 2QUTA 3RDKA 2C0AA 2BASA 1UD6A 3QKZA 3QPYA 2VVSA 4XD5A 3LPOA 1UR1A 1GQKA 1OINA 2WSRA 5FACA 4TX9A 3F5JA 4WKAA 2CPUA 1US3A 4C5ZA 1XLFA 1R5YA 1ZB5A 3W1QA 5C9RA 4HK7A 4ODRA 3LX9A 1SO5A 1UR0A 3D46A 1UKOA 1GW9A 2XGBA 2PD9A 4QDWA 4YNGA 4PBEA 4HTYA 3TLLA 2C1IA 2YW4A 4FNRA 3JR2A 2F6KA 1QK2A 4IJBA 4Q7BA 4HZ7A 1KC7A 3VD9A 1W1IE 3TX9A 3EEZA 3POHA 5BXJA 4ZPTR 4IFKB 4E2DA 3M5VA 1ZUAX 5LZLA 3LXBA 4TX0A 3BVJA 4CNPA 3MMDA 4BQ5A 4CN4A 2AQVA 1HKWA 3UGRA 4LY4A 3B40A 3ABRA 4NZ4A 1QW8A 1OCBA 5JH8A 4GFSA 2H3DA 4DI9A 5LA1A 1Q7QA 4CD7A 5I3DA 2YGYA 4RZ4A 5FF3A 2ZX7A 3E0WA 1E5JA 1ZLPA 1DJQA 1J5SA 1E43A 3QH2A 3S1GA 3IJIA 3IJ8A 3F4CA 4JKMA 3PANA 4AY7A 3S2NA 2P3ZA 3ZJ8A 3ORWA 3IVSA 3A13A 5KZMA 1OABA 3W2KA 4FXSA 2OU4A 3A24A 4ERIA 3SFKA 4TIMA 2VL4A 5C7VA 3WJWA 4Z2JA 1V3IA 2AL2B 2VTFA 3V18A 5LXEA 4K68A 3FJNA 4HARA 3ITCA 3B8DA 3F4VA 2OSYA 2A6LA 3DHUA 1TVNA 4N6FA 1XH0A 1FHUA 4QM1A 1UP3A 1Y8BA 5G4HC 4ZE4A 3VZZA 4PULA 3NWRA 1ZJAA 4XTIA 4LCQA 3LSCA 3S2CA 3D3FA 3EYPA 3CPUA 4XUGA 4J3WA 3QRHA 1C92A 3VGGA 1EHNA 1A5KC 1DJYA 3SI9A 4IQCA 1GVIA 1EO5A 3WD1A 3K1GA 2PDYA 1R9XA 3CL6A 4RNIA 5D03A 2ZC1A 4YU1A 4E6MA 4J4KA 2C71A 3VIIA 4I3GA 3N2CA 2FTYA 1EO7A 5F2LA 1GORA 4B5VA 3GFZA 3GPKA 1PUDA 1K9FA 4Y8FA 3ZT7A 2VEMA 1Z7AA 3ARRA 4FIRA 1O1HA 3M0JA 3OYZA 1Z44A 1E73M 2HISA 4KCWA 4XZIA 1KRCC 3FA5A 3WLJA 2OEJA 2PODA 3DAQA 5HBFA 2E6DA 5HUPA 1ROTA 5K9XA 1KBJA 3EIPA 1BGGA 3NSXA 3NYDA 2NXGA 4GZEA 1L8PA 1EJTC 1E1CB 1AUSL 1TX2A 3VU2A 1TYGA 2QDGA 3H24A 3W2JA 2IKGA 3PAOA 3AO0A 5DO2A 4GQBA 4WY0F 4FXRA 4AXKA 1FOBA 3FK4A 1TJ0A 4GI6A 1DXIA 3IJDA 1WKEA 3U57A 4H3DA 4GYPA 2KZHA 1KBLA 2LJ4A 2BNJA 4W8BA 3ZSTA 1AQMA 2IQTA 3ZLHA 1QWKA 2WC3A 1JNTA 1HJSA 4Z08A 5CSUA 4WIWA 4HHMA 3B8IA 4DUVA 1C9WA 4CGTA 1DIEA 5BXTA 4M6VA 4IOTA 2EPNA 3FJLA 3HFTA 3M0ZA 1KCXA 2QGHA 3VGEA 1XYZA 1KV8A 4KWSA 4W7UA 4ZQRA 3NI6A 1GYLA 4LT9A 2Z1KA 4XAGA 4MHBA 4E2OA 2NUXA 2PLKA 2P0IA 2Q6ZA 5D9PA 1FWGC 3S1VA 3RR1A 4D8ZA 5IRPA 3B0UX 3MSRA 4CD5A 1YEYA 2FVKA 2OSWA 2R24A 3QGAC 3XISA 4MKNA 1WBHA 2HDJA 1A5OC 1ZJIA 3M41A 5C9XA 3VILA 4L9ZA 2AKZA 3SUVA 4MYXA 3EA3A 4A3RA 5A95A 8RUCA 3GKAA 4RDZA 4CVUA 4OTKA 2WMKA 1LYXA 4IQ2A 4Q4QA 1MXDA 1ITUA 5HQLA 3UGVA 4HVXA 4HOXA 4MYAA 1UBSA 1ZL1A 4DRHA 2OLSA 2NX3A 4MWAB 1OEPA 3AYSA 3WDRA 1I6NA 3W4RA 2GUBA 4QGCA 2QLYA 3LPFA 4I6KA 5HR6A 1CNVA 2VQTA 3O0FA 4O1EA 4GUJA 3VC6A 3MI6A 1V0NA 2BWGA 4DBEA 4Z42C 3L4XA 3CV7A 3SY8A 1J5TA 1BPLB 3CAQA 2EKGA 1SSGA 3GDLA 4FOKA 4I9AA 1QPOA 2A21A 2E3ZA 3SFWA 1E6SM 1HGYA 4ZO7A 2FTPA 1W9XA 3HPAA 4JN7A 4N9DA 5A2AA 1TRDA 3LUTA 4RW5A 1FWWA 1PDYA 2R1LA 2PDXA 4BEQA 2GDUA 2GOKA 4JCLA 1G94A 2AL1A 4C02B 4NNAA 1IXPA 5I98A 2VCAA 1DIDA 3QKEA 3ANVA 2CU0A 3PR2A 2EPKX 4OBRA 1K6WA 5LGZA 3DCPA 7TIMA 3WLNA 2G97A 1NOWA 2PU0A 3U5UA 1C8VA 3QGKC 3DFQA 1ZBCA 2YA2A 1AJ0A 1NEYA 1K9DA 2WOQA 3KEHA 2G95A 2HBVA 2CESA 3TTSA 1CGUA 4MSPA 3EA1A 1P7TA 2KAUC 1YPIA 1WXYA 1V6WA 3EBVA 4JIPA 4R0XA 3NG3A 1HFBA 1DXEA 2BY1A 4AD0A 2IS7A 4GIYA 1LBMA 4PUUA 2XSAA 1CENA 2C19A 5I6SA 2Z24A 5BZAA 2E09A 2XJ7A 1RJQA 3W81A 2EPLX 3PWIA 2QIWA 1G9HA 1XLGA 3PG8A 2ZXQA 3ARUA 3D3AA 4LVBA 9XIMA 2IPWA 3KVLA 4PB5A 4EF9A 2ABAA 4JFUA 1JYWA 1FKKA 2H8ZA 4R7WA 2FVMA 4U4MA 1WXJA 3SCTA 4PMXA 2H6RA 3NGJA 4F3HA 1UH2A 4G8TA 4O15A 2B31A 3VM5A 5GPGA 5D30A 3E1F1 1J96A 2J8FA 1FJDA 4WQ6A 3NL3A 4V28A 4HCHA 3UWZA 4W85A 3PPHA 2WM1A 1TTQA 3LM7A 3VKKA 5AYXA 1ZU8A 1XUZA 2QJMA 1CXEA 3RO6A 3T8LA 5LKYA 1A47A 4AX7A 1K8XA 2AGKA 3WQCA 1JD7A 3VMPA 1KBBA 3WFAA 2NVCA 2J74A 3R1ZA 1GOMA 4M19A 4L4OA 1EXPA 2VEGA 4LYQA 1VB9A 4QIBA 4HN8A 3QQ0A 4NHVA 3T4WA 2ADAA 3MKVA 5HNNA 1P6WA 3BAIA 3UCCA 1SW3A 4HK5A 2P88A 4PUKA 3ELFA 1FH7A 5D02A 3OJGA 2QDDA 1UIPA 3DDMA 1SGJA 3UBPC 2VYOA 5HQEA 1TV4A 3AHXA 2DG3A 4HOZA 2OVLA 1KTCA 2PC8A 2VQUA 4DY1A 3L4WA 1TR1A 1B4EA 2WC7A 4GKLA 4K39A 3WQ6A 4E38A 1AZ1A 1E1EA 3PFRA 3CU2A 3TWAA 5KMYA 2PBOA 1KM1A 2HZGA 3RCNA 3APYA 2W92A 3CHEA 1QVBA 4PFMA 3E74A 3JUGA 5FF7A 5HUOA 3PHAA 4GBUA 1WDQA 2XUCA 5JXQA 2PTDA 4ROPA 1GYMA 3GDKA 5FSEC 3NCOA 1XV8A 1CCWB 1AG1O 5FF4A 3C2EA 1BKHA 4UTWC 2VC7A 2FPVA 4FMVA 1RLCL 4YCOA 3KBJA 4O57A 4G7FA 2XVNA 1BYDA 4O11A 5L6UA 3HIJA 4Q8UA 1XDLA 2MNTA 1ADDA 1TKKA 1ITXA 2FZ9A 1P6CA 3EX3A 3W75A 4IJRA 1OT1A 5BOFA 1B6CA 1ZAHA 1JZ7A 4XQ6A 5IM51 3OBKA 2YXXA 3WN6A 1T11A 2W79A 1VPYA 1EX1A 3Q45A 1BVZA 1K4HA 1RV8A 3RX3A 4AB4A 2X09A 3NM1A 5FKYA 1E6RA 1GVQA 3VK5A 3GXNA 2D2HA 2PDGA 3PZUA 4JTDA 3W1RA 2P50A 1QI0A 5J8LA 4S3EA 1XIJA 3LHYA 1H4PA 2EHHA 4IFRA 3ZR5A 5I5RA 2PRHA 3IHZA 2YL5A 3KAHA 2KGJA 2NXHA 1MMFA 2PF0A 5ABHA 1XICA 1TSIA 2XIMA 3DHFA 4DWDA 4IX2A 5KETA 1GT8A 3BK0A 1W1VA 3M0IA 4UFKA 4HMEA 4MKVA 4DT4A 3AIRA 3DERA 3APGA 3M0XA 2VFFA 3R43A 5E0FA 3WLQA 2FH6A 1XGEA 2GDVA 1GOXA 3AALA 3WNLA 3VOJA 4EF8A 4GYFA 3ITVA 4GC4A 3V75A 3C2FA 1VJSA 3S4TA 4CQDA 3JZUA 4E0CA 4JIHA 2ZE3A 1GQNA 5HWMA 3CHFA 1B3XA 5EL1A 1OK6A 1H60A 4JXCA 2YR1A 1ADOA 4KIRA 3N2OA 4DUXA 4HHHA 2ZQTA 2ZWZA 1S5TA 3L2IA 5CH9A 4BFAA 5ABFA 7CGTA 1BQCA 2PTWA 1DHKA 4HYVA 4JQ3A 2QW5A 2Z2UA 3T0TA 5CAKA 3WK2A 4N6EA 4LAZA 5BRPA 1VCGA 4TQTA 1P4CA 3KZPA 2YLLA 3DKLA 1KLZA 1W8SA 3O7UA 2I7GA 2DEPA 4AZ5A 2QDEA 3CV6A 1KQZA 1OFQA 4M6PA 4M82A 3KABA 4DNHA 5DY3A 3N4EA 2ZUMA 2UWFA 3TN4A 2IPGA 3U7VA 2WJFA 4D6DA 3XINA 3BZJA 3GHSA 3R8GA 3B9OA 5BROA 2Y7GA 3AFBA 1OK4A 3W02A 3R0DA 4UWMA 1EIXA 4EPDC 2CLIA 1E44A 3H21A 3OZYA 3PTDA 1Q66A 4IIDA 3C2OA 2IF4A 2B7QA 3WZ0E 3CAKA 3QTGA 3H54A 1VKFA 4MADA 3RUBL 5EGRA 3B9EA 3FAWA 5A8OA 1X6UA 1GZJA 1SZEA 1GVRA 2VN1A 1X97A 4O8AA 1Q6HA 4R27A 1B9BA 2J27A 4H9TA 4DIAA 2X1TA 3KL3A 3IK2A 4PRRA 1BD0A 3AU2A 5G2IA 2F6XA 3PBVA 3A21A 3GXTA 4LAKA 1E9IA 2CZFA 4HYRA 4IQLA 3KWSA 3P82A 3T8QA 5FJRA 4JTHA 1H7OA 1OX5A 1W5OA 1YMYA 3H2MA 4Y96A 5A6BA 4H04A 3GYCA 1A80A 2ATMA 3NQAA 5I00A 5BU6A 2V68A 4IXXA 3GTHA 3T0DA 4F0LA 4BF5A 2WKJA 5IHSA 4QZVB 3VD4A 4ZQMA 5JBFA 4DVOA 4MDPA 3OEXA 1T99A 3WBAA 1PBGA 1QPLA 3UZYA 3WLTA 5A8MA 1QOQA 3MO4A 4FPSA 4WJ8A 2WANA 2WJZA 4E2VA 2QZRA 4LXFA 1WDDA 4GD0A 3I7SA 4IGMA 3DX5A 4LEFA 1MYRA 1PZ0A 2C79A 2XFWA 4C1NB 4Q7IA 1UJQA 3ITLA 3P6LA 2QCGA 4G6CA 4IXHA 3PC0A 5AYZA 4C6KA 1Z41A 3QQ1A 3EOOA 4DNMA 3UWWA 5A94A 3LNPA 2FPTA 3ZT5A 2PD5A 3KXQA 1NOFA 4EP8C 2RH9A 4PB3A 4XD4A 1KTBA 3ITXA 2PWUA 3GO2A 5EMKA 2ISFA 4Y9AA 4B3ZA 1Q7MA 1J79A 3T09A 1A5SA 5TNVA 1TWWA 4JOMA 1O7AA 4E4PA 5AHIA 1M7JA 4U31A 1V0MA 3DG7A 3NRKA 4PMDA 1EDQA 4GI8A 3KBSA 2I5IA 4W5ZA 3VIPA 3NVTA 3S47A 3C52A 1U30A 4GX8A 4J9JA 3SCWA 3WF3A 2QT3A 1MRQA 4FAPA 4CLMA 1X8FA 4QTGA 3WEOA 4W9QA 1XISA 1ONXA 1QDSA 2F2DA 1DE6A 1ZRQA 5CPMA 5ENLA 4QAIA 4LC8A 1FKXA 5A6MA 1O60A 1VYPX 1XIGA 3CH0A 3U9IA 3LHWA 3STPA 3LLDA 1OQFA 4ITZA 3I6CA 1WAUA 1VBRA 1AZ2A 4DZ3A 2OX1A 1XCWA 1VGAA 1E4MM 3IKGA 1J2BA 1D3GA 1QRQA 4HB7A 5EFDA 4GJIA 2MUCA 4LANA 1UR4A 2LKNA 1KGXA 2XHYA 4C6JA 3AJXA 1ITCA 3ZJKA 3IWPA 1NFGA 1OFPA 4OHQA 3W70A 2BFGA 1XLJA 5CGTA 3LDVA 3MWCA 1XYMA 5EYWA 3ALGA 1P0NA 1PPIA 1BVNP 4M6QA 1D7HA 2RUSA 2Y5EA 4DM1A 1A5UA 4OFCA 2GVEA 4GI9A 1EC8A 3GVQA 1NDYA 3P5YA 2Z2BA 3TOPA 8A3HA 4O1CA 4NJIA 3NSMA 2Y89A 3VFLA 1W3JA 1RCOB 4NYUA 3NZPA 3HTWA 3FN9A 2Z1WA 3PZMA 1FWAC 3SUUA 3IIOA 3BICA 5H1WA 4AIEA 3I7QA 3PSWA 4AWTA 4S3GA 1X1NA 2J77A 3H53A 3LGEA 3PZQA 1OFAA 2FDMA 5GNYA 4GGHA 4YTQA 3SUWA 2CEQA 5ECUA 3OU8A 3O5MA 3LSBA 3UT0A 3II1A 4RJEA 1C8QA 4QLJA 2BHYA 3KCEA 3WUEA 1IEQA 3GXIA 3CUFA 2XP9A 4JTRA 2XG9A 3WJSA 2CFFA 4IIBA 3DC0A 1DQUA 1FKRA 2X0SA 1TV3A 1J8VA 3O2LA 1W37A 2OB3A 3G77A 2FB2A 3E02A 3NSNA 2QR6A 2VZOA 4U2ZA 4P7NA 4ZSUA 3S5YA 2JEPA 3AHVA 1TPUA 1WDPA 3VD5A 4C7DA 4RLIA 4J3VA 1BL4A 4LALA 3WDQA 4US6A 3W1PA 3GG8A 4FNUA 5HOSA 1OYAA 3W86A 1I2OA 3CWHA 1FQ0A 4X2RA 1LLZA 4PMUA 4YS1A 3NEHA 2WZIA 3O5LA 1UBPC 4Q3MA 3Q4DA 1WYIA 4Y9OA 4G1KA 2YCEA 3BOFA 2I9UA