1WB7A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title The Role of Tyr41 and His155 in the Functional Properties of Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb7A02
3C3TA 1I0HA 1GN2A 3AK1A 1Y67A 1WB8A 1EN5A 3MDSA 1PL4A 2P4KA 1AP5A 1I08A 1XILA 1B06A 1GN6A 4X9QA 1VARA 1GN3A 3TJTA 1KKCA 1ZSPA 1ZTEA 3CEIA 2ADQB 3DC5A 1JR9A 1MMMA 4JZ2A 3C3SA 1BT8A 2AW9A 2RCVA 4E4EA 2GDSA 1ZUQA 3EVKA 1MA1A 1EN6A 2CE4A 4GUNA 1XUQA 1EN4A 1WB7A 4FFKA 1AR4A 1IXBA 1JA8A 1IDSA 1IX9A 3DC6A 3OT7A 4F6EA 1BSMA 4JYYA 5AG2A 4BR6A 1N0NA 1VEWA 1EM1A 1AR5A 4JZGA 1GN4A 1D5NA 1XDCA 1ZLZA 3K9SA 1N0JA 4YIPA 3BFRA 4C7UA 3AK2A 1AVMA 3QVNA 1LUWA 1P7GA 3RN4A 1LUVA 1SZXA 5A9GA 1BS3A 2QKAA 1MSDA 3KKYA 3LSUA 3IC9A 1MNGA 1PM9A 1QNMA 2QKCA 1AP6A 2ADPA 3AK3A 2CDYA 4YIOA 1XREA
chains in the Genus database with same CATH superfamily
3JATB 3C3TA 4RO2A 4MTGA 5KA6A 3UM7A 5D5QA 4X89A 1QBZA 1E1RG 5IYZA 1Y67A 3A0BZ 1WB8A 1QR8A 1YZBA 4BAYA 3Q4HB 4DV2B 2YS8A 4IYIA 2M6YA 3F7VC 3OEHG 4DV0B 3E8BA 2ZE5A 2DN9A 2Z0AA 3CJHB 4LF9O 5J2TB 2R9IA 4DR4O 3L75H 2LW7A 2AZ2A 4F4LA 3TXQA 4DR1B 1BT8A 4GKKO 2AW9A 2ZD9A 3T1CA 3OTOB 4LC1A 1JX9A 1CP9A 2Q7HA 2ZDIC 3OR7C 4TOIA 4P9PA 4GUNA 1UFIA 1EN4A 4KFMA 2JEXA 3H9VA 4DV3B 4DUZB 1VQ6V 3FD9A 4JGSA 1R6NA 3RYFA 1J95A 2X7RB 4B3RO 1NH2D 3SJAC 1V55B 4F6EA 2Q67A 2PI5A 4JTDB 2ITCC 1KBHA 2HFEC 3GVMA 4R6ZA 4LFBO 3E35A 4U7OA 3Q4HA 1ZAUA 3A0RA 2H94A 3BCCH 4P2ZA 2F4VO 2OTJV 1J5EO 3CJHA 1RSOA 1OCRC 1V55C 4FLWA 2ZQMA 5DECA 4YXWG 2NNUA 1MSDA 3TXSA 2VQFO 4DRXA 2OCCB 4UUJC 3RWRD 2K1EA 1R6KA 3BHPA 1ZWIC 4QPKA 1F4MA 4TT3G 1DF5A 1FFXB 2ZE8A 4EKWA 1YDXA 2AXTZ 3FB6C 1ENVA 1X59A 3F5WC 3UT5B 2WLKA 1VQ8V 3K06A 1SQPH 1PL4A 3ZRXA 2GUZB 4RUEA 1S72V 1DK1A 1AJNA 4X8AA 2IBZH 4J80A 1M57B 4K3AA 2F66C 3JALA 1PKXA 4OX9O 3CEIA 4U3FH 3VQWA 3WG7B 3STLC 5L3DA 2O57A 3RFRA 3M7MX 3E2EA 3QNEA 1KP2A 2WAMA 1LNQA 4KL1A 1M57C 1D5AA 4PI2A 3UCSC 3S3XA 1WB7A 3CWBH 4LF8O 3TETA 3DC6A 1OV9A 4J7KA 3A8TA 3IFXA 5KMGA 5BR8O 1PNKA 2UU9B 3UT5A 3FB5C 3B40A 4UCRA 5KHHA 4DUYB 2NR5A 2KG7B 2R9AA 2YXYA 1ZLZA 4N23A 4WCEV 5IWAB 1GM9A 2GUZA 3S3WA 1K3EA 2XTAA 4JI8O 5BMVA 2PTMA 3KG2A 2QKSA 2HLDG 3E8GA 4QE9A 3N2KB 2YDEA 2QM8A 1CXZB 3UQ8A 1YIJV 5CB4B 3QVNA 1N34O 2WPDG 4UCUA 2PI4A 1YITV 5GTHZ 4FVMA 2EINC 1HNWB 1PM9A 2QTSA 2JIZG 3LNNA 4UVAA 2HJFC 4DV6O 5LBQA 1R6TA 1H8EG 2QWRB 5EIBC 2ZCEA 4UVBA 3TGUH 3LDCA 1M93A 2EIJB 2JGDB 2P22C 4LF5O 3AG3C 2IH3C 2QSAA 2VQEO 2BTOA 1OCCB 1IBMO 1KU9A 3FB8C 2Y0IA 1GTOA 1V9PA 5DEDA 2EULA 4BIUA 3JAMN 5EZYA 2XOKG 3HR0A 5CBFA 2C2AA 2Q4PA 5KHIA 4JAVA 1Y74A 2BE3A 3N2KA 4O4IB 4ABMA 5CB4A 1VQMV 1HWYA 3CRCA 3SYQA 4QNHB 3JD4A 4LF9B 3HKCA 4DR4B 1OCCC 4HZ3A 1H2NA 3QF7A 1NR7A 1XUQA 2LFSA 3H1HH 4JAAA 5IDJA 1AR4A 4Q6GA 4GKKB 5FPRA 4IT5A 3OAAG 3OT7A 5KHGA 1ORQC 4EEQA 1QR9A 3DGEA 4JI7O 2QR4A 2JK5C 1KP3A 2JGDA 4BIOA 4LBEC 3R66A 3CCQV 1K5QA 5E1AC 4Z1VA 4FM1A 1SETA 3JAWA 1XMQO 1RP3B 3T4DA 1R73A 3FYEB 1SQBH 3OGIB 4JI0O 1E1QG 2WLIB 1GMGA 3E86A 1MZFA 4CS4A 5IYDO 2IJIA 1FD9A 2JDIG 3IJ4A 4O4HA 5LP6B 4HAMA 3WB1A 2F4VB 4HNAA 4MVRA 2YI8A 1XNRO 1QU7A 4X62O 5D5PA 5JH7B 4O2AB 4NVPA 1KECA 1XL6A 2Y48A 1QQCA 2ATKC 2QWNB 4O2BA 5KAIZ 5IY5B 1WP7A 3RYIB 1TA8A 4PDMA 3EHBB 1AB3A 1A32A 2DOSA 2KKWA 1B6QA 3N27A 3ETEA 2EBOA 1TGOA 3B2EE 4DW0A 1MZEA 4P9OA 1ZTEA 2E75B 4L87A 4X64O 5FNVA 2W6IG 1I5YA 2GSMB 4OGQB 2WLIA 2OCHA 3CCVV 3F5TA 2Q7EA 5IY5C 1YHQV 4LF4B 2XAGA 3JCUZ 5LP6A 3ZCCA 4OX9B 4FPPA 4KHPB 4YJ2B 4H37A 3ZJZA 1BHBA 2A0LA 2CE4A 3SPIA 3IAYA 3ZHSA 4NTXA 4O2AA 4LH6A 2HR3A 2GTSA 3FB7C 3I55V 5AG2A 3RYHB 3K03A 5H2FZ 4PELA 4LF7B 3VBBA 3RYCB 5FL7G 3K9SA 3AG1B 5BR8B 1H2GA 1K5SA 2FYUH 4JTAB 1TUBB 1AI4A 1V54B 1VF6C 3SJCC 4X66O 1QVGU 1US6A 4DW1A 1FKAO 3CC2V 3RBZA 4JV5B 3G4SV 3LDDA 1VF7A 2N74A 4IHJB 3CCLV 2DMXA 4YJ2A 1WAZA 3AG1C 1K8AW 2WSSG 1W2BU 1CEZA 1WJZA 1N34B 3QO5A 1V54C 4W4LA 1IXMA 1NH2B 2AHZA 3P30A 2DYSB 1K4CC 2F95B 1PPJH 3JCZA 4FLVA 1IZ3A 1RM1C 3TK1A 3RYCA 2PY5A 3BEHA 4Z1MG 4MTFA 4YJ3A 2LW1A 2HHHO 4UCTA 4D7SA 5LMUB 4TUYB 1IBMB 4MSWC 4JZ2A 4J42A 3JAKA 2WLHA 4PDRA 1SQQH 4UXNA 1P7BA 1K92A 1FXKA 2AGAA 4IHJA 2DQ0A 2FL4A 1AI5A 3OM3B 3CSXA 1NVPD 4JI3B 5H9CA 4DXWA 4LF6B 1OCZB 1JA8A 1NTKH 3ZX6A 1IDSA 4F6RB 2LGQA 1FOUA 2V4DA 4K8XA 1B3QA 2V1DA 4PA6A 4PDLA 3CXCU 4JYYA 4UCOA 3SYOA 2RN9A 4FLYA 3CCRV 4WFFA 1Y4MA 5C8YA 4YY3O 1N0JA 4KXRA 3D3IA 3KDRA 4UV9A 3AG7A 5JJNB 1X4TA 3SPCA 3CD6V 4NB5A 3AG4B 5IYZB 4G28B 1L1FA 4TUYA 1XMQB 2FMLA 5H5NA 1XEQA 3WU2Z 1JFFB 1SZTA 2L6LA 2PGGA 2P5OA 3HPLC 2CGNA 4LP8A 5CA0A 4AQYO 2B1GA 3ZHRA 3AK3A 1NU1H 4JYAB 2P90A 3BY6A 2OT5A 3AG4C 2CAZC 4FMTA 1KYOF 3F7YC 1N33O 3CRQA 3H01A 5K1XA 4FLXA 4I9QA 2YUAA 2KSDA 1QLNA 3B4SA 3H1LH 3OGCC 3G71V 4UFZA 1I94O 2ZNIA 3DSQA 3JSLA 2QWOB 1YXBA 2GV9A 3RYFB 3ZHUA 3CC7V 3UKMA 2QDOA 4DV7O 4AI8A 2GHYA 4JI5O 1NBMG 2CTWA 4I4TB 3ZMSA 1JFFA 4I0XA 4E4EA 1N8RW 2XAJA 3OW2U 2XAFA 2V7QG 1RSOB 1SQVH 2WLNA 2E74B 3CHXA 2PUSA 1N0NA 1VEWA 2ZNJA 2RNBA 5HFMA 1M5IA 1SQXH 4DRXB 3PN1A 5LOVA 4FLTA 1H8HG 3A0HZ 1XDCA 1JCHA 4QE7A 4YIPA 3ASNB 2CTQA 2BSKA 1I5XA 1T5EA 3LSQA 2R9RB 3ZMZA 2YEVB 1WN7A 2YIBD 5IJ0A 1F51A 2RQ6A 1N4CA 1Y6XA 3G80A 1YSCA 4GT1A 4NR1A 3LSUA 5IYBO 1BHAA 4I4TA 2F43G 4DR7O 2Z3YA 3MHHC 4X66B 1BQZA 4QIWF 4MT8A 1VQKV 1TVKA 1P84F 3JALB 3B8MA 4X65O 4BW5A 2ADPA 4CBCA 3CRAA 1YJWV 4MS2A 1WPBA 4YIOA 1AI6A 1P4RA 2Q69A 1I0HA 2IM9A 1GM7A 4NKGB 3MD0A 5EBMC 4B3SO 3BA8A 3RW0A 4H33A 3ZMVA 3VQYA 4JI2O 3X2QB 4ZIBA 3APQA 3E8HA 2BOCC 2GBOA 2MW2B 1KKCA 1Q3EA 2YEVA 1QHTA 3DC5A 4NTYA 5KMGB 4GKJB 2R72A 4ICGA 1UPGA 3QO7A 5L3GA 3G67A 5J9PC 3K5MA 5LYJA 2CUGA 3HB3B 4UV8A 4H0LB 3SYPA 2OCCC 1K7DA 1EN6A 1HNXO 3C90A 3X2QC 1DLBA 5BMVB 2BOBC 3AEIA 3ZMUA 3W7XA 1N36B 2YXLA 4X88A 1E79G 4AILC 4GLXA 1KUQA 5CBHA 4JTCB 5CA3A 2ZR3A 1JQ0A 4JZGA 2B5UA 2KB1A 1OJHA 3FAVA 4NTWA 4GX1A 3BABA 4MVOA 1I7FA 3CMAV 2JJ2G 3OUSA 3JD3A 3WG7C 4WFBV 1IBKB 1B04A 4YY3B 1HW7A 1Z5VA 3ML0A 4LCUC 1LUVA 1S5LZ 2QKAA 3KKYA 1CPYA 2W6JG 1G4YB 3IC9A 4NXNO 2LGWA 5J2UA 2KQXA 1HNZO 5EZYB 4ZBMA 2XAHA 1XREA 3OMNB 2BTQA 2ZE7A 2YI9A 4PHZA 1Y74B 4X1KA 2DYRB 1GN2A 4ZKIA 4B7EA 2YC0A 1NTZH 2YXHA 4B7KA 3HKCB 1H5WA 2EIMB 1GO3F 3JD0A 2GTAA 2Q0OC 3CX5F 1W59A 3M8AA 3K5NA 1P49A 3GWKC 3PJSK 5LHIA 2MK3A 2ZR2A 2DYRC 3ZIAG 3BA9A 2PYJA 1I94B 2YICA 3CCUV 5LXTA 4TWKA 5JJEB 2IJHA 3EVKA 5F2VO 2EIMC 1YVWA 1XI1A 1VF5B 3ZHTA 1JPXA 1KD1W 4JYBA 4DV7B 3JAWB 4GYCB 2QM4A 3L70H 3SPGA 4DR3O 3K58A 4MVMA 4CH3A 2WWWA 1BZKA 4J7JA 2UUAO 5JCOA 4O4HB 2EIJC 1XNQO 1EM1A 4HNAB 3SPJA 3LDEA 1M90W 3IC7A 4PDVA 4JI1O 2UUBO 5E79Z 4ZOLB 4C7UA 3RT3C 3ZBHA 2A79B 3T4ZA 3HKBA 1Q6HA 4O2BB 3J7AU 4ZI7A 1VQ7V 4BIZA 2OWOA 4RQEA 4FM2A 3OD4A 5B1OA 4B3RB 1NVPB 2F23A 4O4JB 4GCZA 1NR1A 4CC5A 4I50A 5FNVB 2D3OW 4LFBB 1YJNV 5CMUA 4DR7B 2ZM6O 2K9PA 4J41A 3K3WA 4KP4A 2CTPA 4X65B 1EN5A 2X6BA 5KHJA 4EFBA 2DWDC 2UUCO 4LFAO 1SS3A 2HVKC 5IE9A 5JWPA 1J5EB 3U10A 3T1YO 1VMGA 1G1XB 3ZRSA 1I08A 1THZA 1W0JG 1XILA 1B06A 4X9QA 5LMNO 4ZOLA 1NI8A 5IJ9A 4GZRB 1XHXA 4DYLA 4B3SB 2VQFB 1GM8A 5H6RA 3LNMB 4B3MO 3VQVA 4JI2B 3ABTA 5LP6C 4CZZA 4Q20A 3JASA 4DR6O 3LSSA 4I55A 2Y69B 3JD1A 4EB6B 4O4JA 4UCSA 4DR2O 3OE7G 1YEWA 1Z2GA 4RAIA 4GX5A 3RVZA 5KA5A 3N2GA 4UCVA 3ZHQA 2Q73A 1O9GA 3HKDB 2Q0AA 4DV2O 1Q82W 3CRMA 3W7UA 2JJ1G 1GAXA 1IJGA 1JJOA 3VOUA 1MOFA 1R3LC 4BW9A 4H13B 2EZOA 2A7WA 4G27B 1SA0A 2YIDA 4X1IA 4WFAV 4LF8B 4LFCO 5EBLC 1WPXA 3K0GA 4DR1O 3LUTB 4B3TO 1AP6A 3W7SA 4X20B 2H3OA 4YJ3B 2CDYA 4EB6A 3CRRA 2ARHA 1S77D 3K04A 4NXNB 2ZKOA 4DV3O 1MABG 3AK1A 3JAKB 5L3FA 2E3CA 4DO2A 1HNZB 4JI8B 1Y66A 1WNSA 2LQTA 1FXKB 3CCEV 3SPHA 3KCXA 4WF9V 4OXSA 1M56B 1BQ0A 1KKDA 1GN6A 1VARA 2AHYA 3AG2B 4O4LB 3HKDA 2Q7GA 1BE3H 1R3IC 4DR5O 5KX5A 3FKSG 2ADQB 5HFLA 4YHHO 4HYOA 5EC1C 3ABLB 3ABUA 3D36A 4CS3A 4FZ0A 4DV6B 3IGAC 2JGUA 1FXKC 2EX3A 2GDSA 2WA3A 5C8YB 1S76D 4J10A 1MA1A 2XAQA 4J7ZA 5GONA 3CE2A 5L3CA 2LFRA 1M56C 3MHSC 1KQSU 3B09A 4LF5B 4X20A 3STZC 1ZX3A 4JI4O 2VQEB 2IH1C 2ZIOA 2DYSC 4XBFA 1L8DA 4OPAA 5KUMA 2LP7A 5CA0B 2UUAB 4QGPA 3BFRA 2OTLV 1YCIA 1XNQB 2CK3G 2ILMA 4O4LA 2P4VA 3L9DA 3P3PA 2YIBA 3ABKB 1AVMA 4JI1B 1VP7A 2OIEA 3CP1A 1P7GA 2X6CA 3RN4A 5EYPB 1SZXA 2ETNA 3I56V 3UO3A 4WFEA 4KUMA 1SRYA 1MNGA 1Y76B 1K33A 5LGTA 4K0KO 4JI7B 1BCCH 1OCZC 3M99B 1EZJA 3K59A 1PNMA 3ABKC 1W0KG 3K9AA 4AHCA 4DK1A 4JYCA 4MVUA 3ZN0A 4I9WA 1FPOA 3ZRWB 4I0XB 1UJWB 1VQ9V 1RFYA 3E22B 2A3QA 3SR2C 3BPZA 4JI0B 2UU9O 1F7YA 1AJPA 3CCMV 4OPHA 5A2QN 1LR1A 2UUCB 1L0NH 4TV8B 1G6UA 3ETDA 1FYJA 1KB9F 2EIKB 1XNRB 3EXAA 4X62B 3T1YB 2YSUB 1JR9A 1EZVH 3H1IH 2IU0A 2W0FC 5LMNB 4XDLA 3CS5A 4U3JA 5LHGA 1VQ4V 5EYPA 5B1BB 5LOVB 1ZUQA 3E89A 3T1HO 1M1KW 3NXSA 2Y0PA 4K8ZA 4B3MB 1Y76A 2BSKB 5IJ0B 4ZHQA 1HNWO 4DR6B 3K57A 1AILA 2IU3A 1Q90D 2D2CB 2VS0A 3T2MA 4BR6A 4HBNA 2QWPB 4IL6Z 5B1BC 3KZIZ 3ZRWA 3J80N 4X64B 1TVKB 4K35A 1OCOB 2ZINA 3E22A 1QVFU 2HJDA 1OHHG 5LGNA 3I5DA 3TCUA 5B1NA 4TV8A 5JVDA 4NXMO 3WB2A 1M9NA 1Q7YW 1GRJA 2WLLB 1BS3A 1JNBA 1Z5WA 1HDJA 1QNMA 3H1KH 3MAQA 1OCOC 2Q6AA 4MTXA 2Z5UA 1MG1A 1JOYA 1VIBA 3O9OA 4DV1O 4LFCB 5EK0A 3FX7A 2Q68A 1VQOV 1FXVA 4B3TB 4UB6Z 5LYJB 3K79A 4FFBA 4IYHA 4X1YA 4PA3A 2WLMA 1K34A 4FM0A 2VRZA 1ZL8A 3SYCA 3ASNC 1SC5B 4DV4O 1SF9A 2A06H 2QWQB 1OCRB 3JATA 3KCYA 4ASUG 3C3SA 4XDJA 3DXRB 2WLLA 1YTFD 1SERA 4FK5C 1QCEA 4DR5B 3FYIB 2P67A 2OIGA 2ZDIA 3EFFK 3FAVB 3OMAB 2IJJA 1DGSA 1F23A 4YHHB 2LO1A 2DE0X 1DF4A 2UXXA 5J2TA 2N04A 1H2LA 3OTFA 4DV5O 3DTUB 4UB8Z 3P32A 1HR0O 1Q81W 5EC2C 1EBOA 1NS1A 4MTOA 2UXCO 4R7CA 2AZ0A 1PV0A 1D5NA 1JVMA 2HHHB 4JI4B 5J2UB 1O9HA 1Q8IA 3A2FA 5B1AB 2BTQB 3W7WA 4X1KB 4I7ZB 4TQDA 3L74H 1K4DC 4FIPC 1NJIW 2QM7A 4MVQA 3DXRA 3G6BA 5LL6Y 1GK9A 5GW7A 1F4NA 3ZMTA 4LF4O 5TISZ 2QKCA 3OR6C 2X6AA 5B1AC 4KHPO 3GWOA 5DM6V 2P7TC 4JI6O 2QEXV 4MW8A 4MW3A 5C93A 2F93B 2IJKA 3CCJV 5LXTB 4K0KB 4TV9B 3ZRVA 1AP5A 2JRIA 3J81N 2NLJC 2QA4V 4I5SA 3BVOA 4IGGA 5BZBA 3ZEDA 2L35A 1FFXA 4LF7O 1IBLO 1ROPA 4UVCA 1AI7A 4RUFA 2FB5A 1SQGA 4AQYB 1K9MW 2UXBO 5KUKA 1NTMH 4PA9A 3L71H 2EINB 1FJGO 2E76B 1EFRG 5EBWC 4FZ1A 1R3KC 3P3NA 4JV5O 3HKBB 1IXBA 1VQLV 1N33B 4Z2WA 3ZS8C 1IX9A 2PZSA 1VQNV 1FFTB 5JCOC 3T1HB 2DJVA 4G2KA 4ZI7B 4FJCC 4PA4A 3AG3B 1JMKC 1U96A 4R8CA 2H8PC 1AJQA 2XUMA 4CH4A 2UXDO 1XMOO 3OEEG 2E5LO 4TV9A 1URFA 2W0XA 4JASA 2ZIMA 2XT9A 5LHHA 3ZN1A 1XOUA 4JI5B 1MSWD 5CN0A 4I50B 2EJ7A 1R3JC 1R1BA 1NT2B 4WFHA 4FLZA 4D7TA 1YI2V 5LMUO 2XHBA 2KG7A 1S3JA 2HVJC 4NXMB 3GB7C 2LJ2A 3HKEB 3NR7A 5IJ9B 1Q86W 1D2DA 4D6TH 1M4UA 2Q5ZA 3L72H 1SQFA 4JI3O 4LF6O 1NZ6A 1PD3A 3JASB 3L73H 3MDSA 4R50A 1XHZA 1N32O 2EZPA 1HP8A 1G8MA 3RVYA 4I55B 3SGIA 3K08A 4DV1B 3RGBA 3D8CA 2QTOA 4MVSA 1ZSPA 3QTCA 2QJ1A 1TAEA 4U7NA 4BWAA 1KMIZ 1BGYH 1VQ5V 1TUEB 4WBNB 4DV4B 3N2GB 2PF4E 3ABMB 2RJZA 3WB0A 3SJQC 2XNDG 1FXHA 1WLEA 4FFKA 4E2LA 3HKEA 3E83A 1AR1B 4PJ0Z 5KHKA 1BMFG 2EILB 1RPOA 1BSMA 2Y4TA 5KAFZ 2X0LA 2Q8VA 4O4IA 1SA0B 4JYAO 3K5OA 1AR5A 4X1IB 3BRCA 1L0LH 2JVDA 3ABMC 4DV5B 5BY1A 3U0ZA 2HP8A 3AK2A 1HR0B 5B3SB 1Q43A 2JEUA 1QLEB 3OMIB 2UXCB 3ETGA 2EILC 1HNXB 2ZT9B 4WBNA 1NQTA 5LGUA 1IVSA 1PP9H 2A9HA 3WFVA 2Y69C 3O65A 1YF2A 4NYKA 4B08A 1H2KA 4PV1B 5B3SC 3JD2A 5KX5B 1H2MA 1FS0G 1BL8A 1QLEC 5LA6B 5B5EZ 5H6QA 3K0DA 4J9YB 2Q9LA 4DV0O 3JARB 1FAFA 3G6EV 2B9ZA 4DK0A 5IT9N 2ZE6A 4JI6B 4QPJA 1Q6UA 5GONB 5B66Z 5JH7A 3CPWU 2VWJA 2FKXA 2YIAA 1WA8B 3JYCA 5L3BA 3TJTA 4A5UB 4CS2A 3OTOO 3CMEV 2Y4UA 5EIBD 5JQGB 4IIJB 1S5JA 4J11A 1MMMA 4WFGA 2DWEC 3D36C 4DUZO 2HEPA 2EJRA 4J9ZB 2NN4A 2VWKA 2RCVA 2F1MA 3RYIA 1IBLB 4L8JA 3D3QA 2ITDC 2UXBB 3K5LA 5CBGA 3B77A 1FJGB 5K1PA 2DQ3A 5LA6A 3SDLA 2CTRA 4FLUA 3JARA 1IURA 4GX2A 1GN4A 4JAUA 5KLVH 1RM1B 2M7WA 1NKDA 4JF3A 1XQ8A 3SYAA 1DTOA 2HKOA 4H44B 2P6JA 3QG5A 1H2SB 3AG2C 1JJ2U 1WA8A 4QJFB 2UXDB 1XMOB 1WP8A 2E5LB 2ZXWB 1VF6A 5JQGA 4IIJA 4RWUA 4RQFA 4JPRA 3RYHA 4DR3B 3ABLC 4CH5A 5A9GA 1YTFB 1KC8W 2FTKA 3CC4V 3CXHF 4GKJO 3CYOA 1Q5OA 4LH7A 1S0VA 2DW4A 2R70A 1TUBA 4EFEA 2QGNA 2IW5A 5DN6G 2OYQA 2ZXWC 3JSNA 4LR3A 4TQFA 4LNUB 2UUBB 3CCSV 4U3JB 1YJ9V 2CH7B 2JS3A 1GH6A 5ITZB 1Q6IA 2P4KA 1N36O 1XL4A 2BCCH 1VQPV 2PYLA 3VQXA 1GN3A 2QE7G 3APOA 4ZHQB 2WA4A 2ODMA 3OUFA 1N32B 4GX0A 1H38A 5GTIZ 1RPRA 4W4KA 3U11A 2RMKB 2RDCA 5CA1B 3ASOB 2G38A 2JS5A 1AROP 4LWSB 2UXNA 3UO2A 1IBKO 5BXZA 1OZ0A 4MVZA 3ICXA 5L3EA 1XBLA 3FFQA 2XASA 4CC6A 3ETQA 5IYCO 2ZM6B 1K97A 4PD4F 5JJJB 4DUYO 1SKVA 2CGOA 4LFAB 5JVDB 5IWAO 4TSFG 1U97A 2P06A 1PL0A 3ASOC 1COWG 4LNUA 3E8FA 2CH7A 5ITZA 2WLJA 3OFNG 5FLXN 4PI0A 4XDKA 1PNLA 3BAAA 1GKFA 4CH6A 2HG5C 4P30A 3ZHVA 3R65A 4F6RA 3SJBC 3B8NA 3W7TA 1K73W 1S5HC 3THOA 2EIKC 3CB2A 4N21A 1LUWA 4FFBB 5CA1A 2B1IA 4LWSA 4X1YB 4DR2B 1ZL8B 3QO8A 1SESA 2N05A 4PA7A 3H1JH 5FPOA
chains in the Genus database with same CATH topology
3C3TA 1I0HA 1GN2A 3AK1A 1Y67A 1WB8A 1EN5A 3MDSA 1PL4A 2P4KA 1AP5A 1I08A 1XILA 1B06A 1GN6A 4X9QA 1VARA 1GN3A 3TJTA 1KKCA 1ZSPA 1ZTEA 3CEIA 2ADQB 3DC5A 1JR9A 1MMMA 4JZ2A 3C3SA 1BT8A 2AW9A 2RCVA 4E4EA 2GDSA 1ZUQA 3EVKA 1MA1A 1EN6A 2CE4A 4GUNA 1XUQA 1EN4A 1WB7A 4FFKA 1AR4A 1IXBA 1JA8A 1IDSA 1IX9A 3DC6A 3OT7A 4F6EA 1BSMA 4JYYA 5AG2A 4BR6A 1N0NA 1VEWA 1EM1A 1AR5A 4JZGA 1GN4A 1D5NA 1XDCA 1ZLZA 3K9SA 1N0JA 4YIPA 3KDRA 3BFRA 4C7UA 3AK2A 1AVMA 3QVNA 1LUWA 1P7GA 3RN4A 1LUVA 1SZXA 5A9GA 1BS3A 2QKAA 1MSDA 3KKYA 3LSUA 3IC9A 1MNGA 1PM9A 1QNMA 2QKCA 1AP6A 2ADPA 3AK3A 2CDYA 4YIOA 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3T A;  1I0H A;  1GN2 A;  3AK1 A;  1Y67 A;  1WB8 A;  1EN5 A;  3MDS A;  1PL4 A;  2P4K A;  1AP5 A;  1I08 A;  1XIL A;  1B06 A;  1GN6 A;  4X9Q A;  1VAR A;  1GN3 A;  3TJT A;  1KKC A;  1ZSP A;  1ZTE A;  3CEI A;  2ADQ B;  3DC5 A;  1JR9 A;  1MMM A;  4JZ2 A;  3C3S A;  1BT8 A;  2AW9 A;  2RCV A;  4E4E A;  2GDS A;  1ZUQ A;  3EVK A;  1MA1 A;  1EN6 A;  2CE4 A;  4GUN A;  1XUQ A;  1EN4 A;  1WB7 A;  4FFK A;  1AR4 A;  1IXB A;  1JA8 A;  1IDS A;  1IX9 A;  3DC6 A;  3OT7 A;  4F6E A;  1BSM A;  4JYY A;  5AG2 A;  4BR6 A;  1N0N A;  1VEW A;  1EM1 A;  1AR5 A;  4JZG A;  1GN4 A;  1D5N A;  1XDC A;  1ZLZ A;  3K9S A;  1N0J A;  4YIP A;  3BFR A;  4C7U A;  3AK2 A;  1AVM A;  3QVN A;  1LUW A;  1P7G A;  3RN4 A;  1LUV A;  1SZX A;  5A9G A;  1BS3 A;  2QKA A;  1MSD A;  3KKY A;  3LSU A;  3IC9 A;  1MNG A;  1PM9 A;  1QNM A;  2QKC A;  1AP6 A;  2ADP A;  3AK3 A;  2CDY A;  4YIO A;  1XRE A; 
#chains in the Genus database with same CATH topology
 3JAT B;  3C3T A;  4RO2 A;  4MTG A;  5KA6 A;  3UM7 A;  5D5Q A;  4X89 A;  1QBZ A;  1E1R G;  5IYZ A;  1Y67 A;  3A0B Z;  1WB8 A;  1QR8 A;  1YZB A;  4BAY A;  3Q4H B;  4DV2 B;  2YS8 A;  4IYI A;  2M6Y A;  3F7V C;  3OEH G;  4DV0 B;  3E8B A;  2ZE5 A;  2DN9 A;  2Z0A A;  3CJH B;  4LF9 O;  5J2T B;  2R9I A;  4DR4 O;  3L75 H;  2LW7 A;  2AZ2 A;  4F4L A;  3TXQ A;  4DR1 B;  1BT8 A;  4GKK O;  2AW9 A;  2ZD9 A;  3T1C A;  3OTO B;  4LC1 A;  1JX9 A;  1CP9 A;  2Q7H A;  2ZDI C;  3OR7 C;  4TOI A;  4P9P A;  4GUN A;  1UFI A;  1EN4 A;  4KFM A;  2JEX A;  3H9V A;  4DV3 B;  4DUZ B;  1VQ6 V;  3FD9 A;  4JGS A;  1R6N A;  3RYF A;  1J95 A;  2X7R B;  4B3R O;  1NH2 D;  3SJA C;  1V55 B;  4F6E A;  2Q67 A;  2PI5 A;  4JTD B;  2ITC C;  1KBH A;  2HFE C;  3GVM A;  4R6Z A;  4LFB O;  3E35 A;  4U7O A;  3Q4H A;  1ZAU A;  3A0R A;  2H94 A;  3BCC H;  4P2Z A;  2F4V O;  2OTJ V;  1J5E O;  3CJH A;  1RSO A;  1OCR C;  1V55 C;  4FLW A;  2ZQM A;  5DEC A;  4YXW G;  2NNU A;  1MSD A;  3TXS A;  2VQF O;  4DRX A;  2OCC B;  4UUJ C;  3RWR D;  2K1E A;  1R6K A;  3BHP A;  1ZWI C;  4QPK A;  1F4M A;  4TT3 G;  1DF5 A;  1FFX B;  2ZE8 A;  4EKW A;  1YDX A;  2AXT Z;  3FB6 C;  1ENV A;  1X59 A;  3F5W C;  3UT5 B;  2WLK A;  1VQ8 V;  3K06 A;  1SQP H;  1PL4 A;  3ZRX A;  2GUZ B;  4RUE A;  1S72 V;  1DK1 A;  1AJN A;  4X8A A;  2IBZ H;  4J80 A;  1M57 B;  4K3A A;  2F66 C;  3JAL A;  1PKX A;  4OX9 O;  3CEI A;  4U3F H;  3VQW A;  3WG7 B;  3STL C;  5L3D A;  2O57 A;  3RFR A;  3M7M X;  3E2E A;  3QNE A;  1KP2 A;  2WAM A;  1LNQ A;  4KL1 A;  1M57 C;  1D5A A;  4PI2 A;  3UCS C;  3S3X A;  1WB7 A;  3CWB H;  4LF8 O;  3TET A;  3DC6 A;  1OV9 A;  4J7K A;  3A8T A;  3IFX A;  5KMG A;  5BR8 O;  1PNK A;  2UU9 B;  3UT5 A;  3FB5 C;  3B40 A;  4UCR A;  5KHH A;  4DUY B;  2NR5 A;  2KG7 B;  2R9A A;  2YXY A;  1ZLZ A;  4N23 A;  4WCE V;  5IWA B;  1GM9 A;  2GUZ A;  3S3W A;  1K3E A;  2XTA A;  4JI8 O;  5BMV A;  2PTM A;  3KG2 A;  2QKS A;  2HLD G;  3E8G A;  4QE9 A;  3N2K B;  2YDE A;  2QM8 A;  1CXZ B;  3UQ8 A;  1YIJ V;  5CB4 B;  3QVN A;  1N34 O;  2WPD G;  4UCU A;  2PI4 A;  1YIT V;  5GTH Z;  4FVM A;  2EIN C;  1HNW B;  1PM9 A;  2QTS A;  2JIZ G;  3LNN A;  4UVA A;  2HJF C;  4DV6 O;  5LBQ A;  1R6T A;  1H8E G;  2QWR B;  5EIB C;  2ZCE A;  4UVB A;  3TGU H;  3LDC A;  1M93 A;  2EIJ B;  2JGD B;  2P22 C;  4LF5 O;  3AG3 C;  2IH3 C;  2QSA A;  2VQE O;  2BTO A;  1OCC B;  1IBM O;  1KU9 A;  3FB8 C;  2Y0I A;  1GTO A;  1V9P A;  5DED A;  2EUL A;  4BIU A;  3JAM N;  5EZY A;  2XOK G;  3HR0 A;  5CBF A;  2C2A A;  2Q4P A;  5KHI A;  4JAV A;  1Y74 A;  2BE3 A;  3N2K A;  4O4I B;  4ABM A;  5CB4 A;  1VQM V;  1HWY A;  3CRC A;  3SYQ A;  4QNH B;  3JD4 A;  4LF9 B;  3HKC A;  4DR4 B;  1OCC C;  4HZ3 A;  1H2N A;  3QF7 A;  1NR7 A;  1XUQ A;  2LFS A;  3H1H H;  4JAA A;  5IDJ A;  1AR4 A;  4Q6G A;  4GKK B;  5FPR A;  4IT5 A;  3OAA G;  3OT7 A;  5KHG A;  1ORQ C;  4EEQ A;  1QR9 A;  3DGE A;  4JI7 O;  2QR4 A;  2JK5 C;  1KP3 A;  2JGD A;  4BIO A;  4LBE C;  3R66 A;  3CCQ V;  1K5Q A;  5E1A C;  4Z1V A;  4FM1 A;  1SET A;  3JAW A;  1XMQ O;  1RP3 B;  3T4D A;  1R73 A;  3FYE B;  1SQB H;  3OGI B;  4JI0 O;  1E1Q G;  2WLI B;  1GMG A;  3E86 A;  1MZF A;  4CS4 A;  5IYD O;  2IJI A;  1FD9 A;  2JDI G;  3IJ4 A;  4O4H A;  5LP6 B;  4HAM A;  3WB1 A;  2F4V B;  4HNA A;  4MVR A;  2YI8 A;  1XNR O;  1QU7 A;  4X62 O;  5D5P A;  5JH7 B;  4O2A B;  4NVP A;  1KEC A;  1XL6 A;  2Y48 A;  1QQC A;  2ATK C;  2QWN B;  4O2B A;  5KAI Z;  5IY5 B;  1WP7 A;  3RYI B;  1TA8 A;  4PDM A;  3EHB B;  1AB3 A;  1A32 A;  2DOS A;  2KKW A;  1B6Q A;  3N27 A;  3ETE A;  2EBO A;  1TGO A;  3B2E E;  4DW0 A;  1MZE A;  4P9O A;  1ZTE A;  2E75 B;  4L87 A;  4X64 O;  5FNV A;  2W6I G;  1I5Y A;  2GSM B;  4OGQ B;  2WLI A;  2OCH A;  3CCV V;  3F5T A;  2Q7E A;  5IY5 C;  1YHQ V;  4LF4 B;  2XAG A;  3JCU Z;  5LP6 A;  3ZCC A;  4OX9 B;  4FPP A;  4KHP B;  4YJ2 B;  4H37 A;  3ZJZ A;  1BHB A;  2A0L A;  2CE4 A;  3SPI A;  3IAY A;  3ZHS A;  4NTX A;  4O2A A;  4LH6 A;  2HR3 A;  2GTS A;  3FB7 C;  3I55 V;  5AG2 A;  3RYH B;  3K03 A;  5H2F Z;  4PEL A;  4LF7 B;  3VBB A;  3RYC B;  5FL7 G;  3K9S A;  3AG1 B;  5BR8 B;  1H2G A;  1K5S A;  2FYU H;  4JTA B;  1TUB B;  1AI4 A;  1V54 B;  1VF6 C;  3SJC C;  4X66 O;  1QVG U;  1US6 A;  4DW1 A;  1FKA O;  3CC2 V;  3RBZ A;  4JV5 B;  3G4S V;  3LDD A;  1VF7 A;  2N74 A;  4IHJ B;  3CCL V;  2DMX A;  4YJ2 A;  1WAZ A;  3AG1 C;  1K8A W;  2WSS G;  1W2B U;  1CEZ A;  1WJZ A;  1N34 B;  3QO5 A;  1V54 C;  4W4L A;  1IXM A;  1NH2 B;  2AHZ A;  3P30 A;  2DYS B;  1K4C C;  2F95 B;  1PPJ H;  3JCZ A;  4FLV A;  1IZ3 A;  1RM1 C;  3TK1 A;  3RYC A;  2PY5 A;  3BEH A;  4Z1M G;  4MTF A;  4YJ3 A;  2LW1 A;  2HHH O;  4UCT A;  4D7S A;  5LMU B;  4TUY B;  1IBM B;  4MSW C;  4JZ2 A;  4J42 A;  3JAK A;  2WLH A;  4PDR A;  1SQQ H;  4UXN A;  1P7B A;  1K92 A;  1FXK A;  2AGA A;  4IHJ A;  2DQ0 A;  2FL4 A;  1AI5 A;  3OM3 B;  3CSX A;  1NVP D;  4JI3 B;  5H9C A;  4DXW A;  4LF6 B;  1OCZ B;  1JA8 A;  1NTK H;  3ZX6 A;  1IDS A;  4F6R B;  2LGQ A;  1FOU A;  2V4D A;  4K8X A;  1B3Q A;  2V1D A;  4PA6 A;  4PDL A;  3CXC U;  4JYY A;  4UCO A;  3SYO A;  2RN9 A;  4FLY A;  3CCR V;  4WFF A;  1Y4M A;  5C8Y A;  4YY3 O;  1N0J A;  4KXR A;  3D3I A;  3KDR A;  4UV9 A;  3AG7 A;  5JJN B;  1X4T A;  3SPC A;  3CD6 V;  4NB5 A;  3AG4 B;  5IYZ B;  4G28 B;  1L1F A;  4TUY A;  1XMQ B;  2FML A;  5H5N A;  1XEQ A;  3WU2 Z;  1JFF B;  1SZT A;  2L6L A;  2PGG A;  2P5O A;  3HPL C;  2CGN A;  4LP8 A;  5CA0 A;  4AQY O;  2B1G A;  3ZHR A;  3AK3 A;  1NU1 H;  4JYA B;  2P90 A;  3BY6 A;  2OT5 A;  3AG4 C;  2CAZ C;  4FMT A;  1KYO F;  3F7Y C;  1N33 O;  3CRQ A;  3H01 A;  5K1X A;  4FLX A;  4I9Q A;  2YUA A;  2KSD A;  1QLN A;  3B4S A;  3H1L H;  3OGC C;  3G71 V;  4UFZ A;  1I94 O;  2ZNI A;  3DSQ A;  3JSL A;  2QWO B;  1YXB A;  2GV9 A;  3RYF B;  3ZHU A;  3CC7 V;  3UKM A;  2QDO A;  4DV7 O;  4AI8 A;  2GHY A;  4JI5 O;  1NBM G;  2CTW A;  4I4T B;  3ZMS A;  1JFF A;  4I0X A;  4E4E A;  1N8R W;  2XAJ A;  3OW2 U;  2XAF A;  2V7Q G;  1RSO B;  1SQV H;  2WLN A;  2E74 B;  3CHX A;  2PUS A;  1N0N A;  1VEW A;  2ZNJ A;  2RNB A;  5HFM A;  1M5I A;  1SQX H;  4DRX B;  3PN1 A;  5LOV A;  4FLT A;  1H8H G;  3A0H Z;  1XDC A;  1JCH A;  4QE7 A;  4YIP A;  3ASN B;  2CTQ A;  2BSK A;  1I5X A;  1T5E A;  3LSQ A;  2R9R B;  3ZMZ A;  2YEV B;  1WN7 A;  2YIB D;  5IJ0 A;  1F51 A;  2RQ6 A;  1N4C A;  1Y6X A;  3G80 A;  1YSC A;  4GT1 A;  4NR1 A;  3LSU A;  5IYB O;  1BHA A;  4I4T A;  2F43 G;  4DR7 O;  2Z3Y A;  3MHH C;  4X66 B;  1BQZ A;  4QIW F;  4MT8 A;  1VQK V;  1TVK A;  1P84 F;  3JAL B;  3B8M A;  4X65 O;  4BW5 A;  2ADP A;  4CBC A;  3CRA A;  1YJW V;  4MS2 A;  1WPB A;  4YIO A;  1AI6 A;  1P4R A;  2Q69 A;  1I0H A;  2IM9 A;  1GM7 A;  4NKG B;  3MD0 A;  5EBM C;  4B3S O;  3BA8 A;  3RW0 A;  4H33 A;  3ZMV A;  3VQY A;  4JI2 O;  3X2Q B;  4ZIB A;  3APQ A;  3E8H A;  2BOC C;  2GBO A;  2MW2 B;  1KKC A;  1Q3E A;  2YEV A;  1QHT A;  3DC5 A;  4NTY A;  5KMG B;  4GKJ B;  2R72 A;  4ICG A;  1UPG A;  3QO7 A;  5L3G A;  3G67 A;  5J9P C;  3K5M A;  5LYJ A;  2CUG A;  3HB3 B;  4UV8 A;  4H0L B;  3SYP A;  2OCC C;  1K7D A;  1EN6 A;  1HNX O;  3C90 A;  3X2Q C;  1DLB A;  5BMV B;  2BOB C;  3AEI A;  3ZMU A;  3W7X A;  1N36 B;  2YXL A;  4X88 A;  1E79 G;  4AIL C;  4GLX A;  1KUQ A;  5CBH A;  4JTC B;  5CA3 A;  2ZR3 A;  1JQ0 A;  4JZG A;  2B5U A;  2KB1 A;  1OJH A;  3FAV A;  4NTW A;  4GX1 A;  3BAB A;  4MVO A;  1I7F A;  3CMA V;  2JJ2 G;  3OUS A;  3JD3 A;  3WG7 C;  4WFB V;  1IBK B;  1B04 A;  4YY3 B;  1HW7 A;  1Z5V A;  3ML0 A;  4LCU C;  1LUV A;  1S5L Z;  2QKA A;  3KKY A;  1CPY A;  2W6J G;  1G4Y B;  3IC9 A;  4NXN O;  2LGW A;  5J2U A;  2KQX A;  1HNZ O;  5EZY B;  4ZBM A;  2XAH A;  1XRE A;  3OMN B;  2BTQ A;  2ZE7 A;  2YI9 A;  4PHZ A;  1Y74 B;  4X1K A;  2DYR B;  1GN2 A;  4ZKI A;  4B7E A;  2YC0 A;  1NTZ H;  2YXH A;  4B7K A;  3HKC B;  1H5W A;  2EIM B;  1GO3 F;  3JD0 A;  2GTA A;  2Q0O C;  3CX5 F;  1W59 A;  3M8A A;  3K5N A;  1P49 A;  3GWK C;  3PJS K;  5LHI A;  2MK3 A;  2ZR2 A;  2DYR C;  3ZIA G;  3BA9 A;  2PYJ A;  1I94 B;  2YIC A;  3CCU V;  5LXT A;  4TWK A;  5JJE B;  2IJH A;  3EVK A;  5F2V O;  2EIM C;  1YVW A;  1XI1 A;  1VF5 B;  3ZHT A;  1JPX A;  1KD1 W;  4JYB A;  4DV7 B;  3JAW B;  4GYC B;  2QM4 A;  3L70 H;  3SPG A;  4DR3 O;  3K58 A;  4MVM A;  4CH3 A;  2WWW A;  1BZK A;  4J7J A;  2UUA O;  5JCO A;  4O4H B;  2EIJ C;  1XNQ O;  1EM1 A;  4HNA B;  3SPJ A;  3LDE A;  1M90 W;  3IC7 A;  4PDV A;  4JI1 O;  2UUB O;  5E79 Z;  4ZOL B;  4C7U A;  3RT3 C;  3ZBH A;  2A79 B;  3T4Z A;  3HKB A;  1Q6H A;  4O2B B;  3J7A U;  4ZI7 A;  1VQ7 V;  4BIZ A;  2OWO A;  4RQE A;  4FM2 A;  3OD4 A;  5B1O A;  4B3R B;  1NVP B;  2F23 A;  4O4J B;  4GCZ A;  1NR1 A;  4CC5 A;  4I50 A;  5FNV B;  2D3O W;  4LFB B;  1YJN V;  5CMU A;  4DR7 B;  2ZM6 O;  2K9P A;  4J41 A;  3K3W A;  4KP4 A;  2CTP A;  4X65 B;  1EN5 A;  2X6B A;  5KHJ A;  4EFB A;  2DWD C;  2UUC O;  4LFA O;  1SS3 A;  2HVK C;  5IE9 A;  5JWP A;  1J5E B;  3U10 A;  3T1Y O;  1VMG A;  1G1X B;  3ZRS A;  1I08 A;  1THZ A;  1W0J G;  1XIL A;  1B06 A;  4X9Q A;  5LMN O;  4ZOL A;  1NI8 A;  5IJ9 A;  4GZR B;  1XHX A;  4DYL A;  4B3S B;  2VQF B;  1GM8 A;  5H6R A;  3LNM B;  4B3M O;  3VQV A;  4JI2 B;  3ABT A;  5LP6 C;  4CZZ A;  4Q20 A;  3JAS A;  4DR6 O;  3LSS A;  4I55 A;  2Y69 B;  3JD1 A;  4EB6 B;  4O4J A;  4UCS A;  4DR2 O;  3OE7 G;  1YEW A;  1Z2G A;  4RAI A;  4GX5 A;  3RVZ A;  5KA5 A;  3N2G A;  4UCV A;  3ZHQ A;  2Q73 A;  1O9G A;  3HKD B;  2Q0A A;  4DV2 O;  1Q82 W;  3CRM A;  3W7U A;  2JJ1 G;  1GAX A;  1IJG A;  1JJO A;  3VOU A;  1MOF A;  1R3L C;  4BW9 A;  4H13 B;  2EZO A;  2A7W A;  4G27 B;  1SA0 A;  2YID A;  4X1I A;  4WFA V;  4LF8 B;  4LFC O;  5EBL C;  1WPX A;  3K0G A;  4DR1 O;  3LUT B;  4B3T O;  1AP6 A;  3W7S A;  4X20 B;  2H3O A;  4YJ3 B;  2CDY A;  4EB6 A;  3CRR A;  2ARH A;  1S77 D;  3K04 A;  4NXN B;  2ZKO A;  4DV3 O;  1MAB G;  3AK1 A;  3JAK B;  5L3F A;  2E3C A;  4DO2 A;  1HNZ B;  4JI8 B;  1Y66 A;  1WNS A;  2LQT A;  1FXK B;  3CCE V;  3SPH A;  3KCX A;  4WF9 V;  4OXS A;  1M56 B;  1BQ0 A;  1KKD A;  1GN6 A;  1VAR A;  2AHY A;  3AG2 B;  4O4L B;  3HKD A;  2Q7G A;  1BE3 H;  1R3I C;  4DR5 O;  5KX5 A;  3FKS G;  2ADQ B;  5HFL A;  4YHH O;  4HYO A;  5EC1 C;  3ABL B;  3ABU A;  3D36 A;  4CS3 A;  4FZ0 A;  4DV6 B;  3IGA C;  2JGU A;  1FXK C;  2EX3 A;  2GDS A;  2WA3 A;  5C8Y B;  1S76 D;  4J10 A;  1MA1 A;  2XAQ A;  4J7Z A;  5GON A;  3CE2 A;  5L3C A;  2LFR A;  1M56 C;  3MHS C;  1KQS U;  3B09 A;  4LF5 B;  4X20 A;  3STZ C;  1ZX3 A;  4JI4 O;  2VQE B;  2IH1 C;  2ZIO A;  2DYS C;  4XBF A;  1L8D A;  4OPA A;  5KUM A;  2LP7 A;  5CA0 B;  2UUA B;  4QGP A;  3BFR A;  2OTL V;  1YCI A;  1XNQ B;  2CK3 G;  2ILM A;  4O4L A;  2P4V A;  3L9D A;  3P3P A;  2YIB A;  3ABK B;  1AVM A;  4JI1 B;  1VP7 A;  2OIE A;  3CP1 A;  1P7G A;  2X6C A;  3RN4 A;  5EYP B;  1SZX A;  2ETN A;  3I56 V;  3UO3 A;  4WFE A;  4KUM A;  1SRY A;  1MNG A;  1Y76 B;  1K33 A;  5LGT A;  4K0K O;  4JI7 B;  1BCC H;  1OCZ C;  3M99 B;  1EZJ A;  3K59 A;  1PNM A;  3ABK C;  1W0K G;  3K9A A;  4AHC A;  4DK1 A;  4JYC A;  4MVU A;  3ZN0 A;  4I9W A;  1FPO A;  3ZRW B;  4I0X B;  1UJW B;  1VQ9 V;  1RFY A;  3E22 B;  2A3Q A;  3SR2 C;  3BPZ A;  4JI0 B;  2UU9 O;  1F7Y A;  1AJP A;  3CCM V;  4OPH A;  5A2Q N;  1LR1 A;  2UUC B;  1L0N H;  4TV8 B;  1G6U A;  3ETD A;  1FYJ A;  1KB9 F;  2EIK B;  1XNR B;  3EXA A;  4X62 B;  3T1Y B;  2YSU B;  1JR9 A;  1EZV H;  3H1I H;  2IU0 A;  2W0F C;  5LMN B;  4XDL A;  3CS5 A;  4U3J A;  5LHG A;  1VQ4 V;  5EYP A;  5B1B B;  5LOV B;  1ZUQ A;  3E89 A;  3T1H O;  1M1K W;  3NXS A;  2Y0P A;  4K8Z A;  4B3M B;  1Y76 A;  2BSK B;  5IJ0 B;  4ZHQ A;  1HNW O;  4DR6 B;  3K57 A;  1AIL A;  2IU3 A;  1Q90 D;  2D2C B;  2VS0 A;  3T2M A;  4BR6 A;  4HBN A;  2QWP B;  4IL6 Z;  5B1B C;  3KZI Z;  3ZRW A;  3J80 N;  4X64 B;  1TVK B;  4K35 A;  1OCO B;  2ZIN A;  3E22 A;  1QVF U;  2HJD A;  1OHH G;  5LGN A;  3I5D A;  3TCU A;  5B1N A;  4TV8 A;  5JVD A;  4NXM O;  3WB2 A;  1M9N A;  1Q7Y W;  1GRJ A;  2WLL B;  1BS3 A;  1JNB A;  1Z5W A;  1HDJ A;  1QNM A;  3H1K H;  3MAQ A;  1OCO C;  2Q6A A;  4MTX A;  2Z5U A;  1MG1 A;  1JOY A;  1VIB A;  3O9O A;  4DV1 O;  4LFC B;  5EK0 A;  3FX7 A;  2Q68 A;  1VQO V;  1FXV A;  4B3T B;  4UB6 Z;  5LYJ B;  3K79 A;  4FFB A;  4IYH A;  4X1Y A;  4PA3 A;  2WLM A;  1K34 A;  4FM0 A;  2VRZ A;  1ZL8 A;  3SYC A;  3ASN C;  1SC5 B;  4DV4 O;  1SF9 A;  2A06 H;  2QWQ B;  1OCR B;  3JAT A;  3KCY A;  4ASU G;  3C3S A;  4XDJ A;  3DXR B;  2WLL A;  1YTF D;  1SER A;  4FK5 C;  1QCE A;  4DR5 B;  3FYI B;  2P67 A;  2OIG A;  2ZDI A;  3EFF K;  3FAV B;  3OMA B;  2IJJ A;  1DGS A;  1F23 A;  4YHH B;  2LO1 A;  2DE0 X;  1DF4 A;  2UXX A;  5J2T A;  2N04 A;  1H2L A;  3OTF A;  4DV5 O;  3DTU B;  4UB8 Z;  3P32 A;  1HR0 O;  1Q81 W;  5EC2 C;  1EBO A;  1NS1 A;  4MTO A;  2UXC O;  4R7C A;  2AZ0 A;  1PV0 A;  1D5N A;  1JVM A;  2HHH B;  4JI4 B;  5J2U B;  1O9H A;  1Q8I A;  3A2F A;  5B1A B;  2BTQ B;  3W7W A;  4X1K B;  4I7Z B;  4TQD A;  3L74 H;  1K4D C;  4FIP C;  1NJI W;  2QM7 A;  4MVQ A;  3DXR A;  3G6B A;  5LL6 Y;  1GK9 A;  5GW7 A;  1F4N A;  3ZMT A;  4LF4 O;  5TIS Z;  2QKC A;  3OR6 C;  2X6A A;  5B1A C;  4KHP O;  3GWO A;  5DM6 V;  2P7T C;  4JI6 O;  2QEX V;  4MW8 A;  4MW3 A;  5C93 A;  2F93 B;  2IJK A;  3CCJ V;  5LXT B;  4K0K B;  4TV9 B;  3ZRV A;  1AP5 A;  2JRI A;  3J81 N;  2NLJ C;  2QA4 V;  4I5S A;  3BVO A;  4IGG A;  5BZB A;  3ZED A;  2L35 A;  1FFX A;  4LF7 O;  1IBL O;  1ROP A;  4UVC A;  1AI7 A;  4RUF A;  2FB5 A;  1SQG A;  4AQY B;  1K9M W;  2UXB O;  5KUK A;  1NTM H;  4PA9 A;  3L71 H;  2EIN B;  1FJG O;  2E76 B;  1EFR G;  5EBW C;  4FZ1 A;  1R3K C;  3P3N A;  4JV5 O;  3HKB B;  1IXB A;  1VQL V;  1N33 B;  4Z2W A;  3ZS8 C;  1IX9 A;  2PZS A;  1VQN V;  1FFT B;  5JCO C;  3T1H B;  2DJV A;  4G2K A;  4ZI7 B;  4FJC C;  4PA4 A;  3AG3 B;  1JMK C;  1U96 A;  4R8C A;  2H8P C;  1AJQ A;  2XUM A;  4CH4 A;  2UXD O;  1XMO O;  3OEE G;  2E5L O;  4TV9 A;  1URF A;  2W0X A;  4JAS A;  2ZIM A;  2XT9 A;  5LHH A;  3ZN1 A;  1XOU A;  4JI5 B;  1MSW D;  5CN0 A;  4I50 B;  2EJ7 A;  1R3J C;  1R1B A;  1NT2 B;  4WFH A;  4FLZ A;  4D7T A;  1YI2 V;  5LMU O;  2XHB A;  2KG7 A;  1S3J A;  2HVJ C;  4NXM B;  3GB7 C;  2LJ2 A;  3HKE B;  3NR7 A;  5IJ9 B;  1Q86 W;  1D2D A;  4D6T H;  1M4U A;  2Q5Z A;  3L72 H;  1SQF A;  4JI3 O;  4LF6 O;  1NZ6 A;  1PD3 A;  3JAS B;  3L73 H;  3MDS A;  4R50 A;  1XHZ A;  1N32 O;  2EZP A;  1HP8 A;  1G8M A;  3RVY A;  4I55 B;  3SGI A;  3K08 A;  4DV1 B;  3RGB A;  3D8C A;  2QTO A;  4MVS A;  1ZSP A;  3QTC A;  2QJ1 A;  1TAE A;  4U7N A;  4BWA A;  1KMI Z;  1BGY H;  1VQ5 V;  1TUE B;  4WBN B;  4DV4 B;  3N2G B;  2PF4 E;  3ABM B;  2RJZ A;  3WB0 A;  3SJQ C;  2XND G;  1FXH A;  1WLE A;  4FFK A;  4E2L A;  3HKE A;  3E83 A;  1AR1 B;  4PJ0 Z;  5KHK A;  1BMF G;  2EIL B;  1RPO A;  1BSM A;  2Y4T A;  5KAF Z;  2X0L A;  2Q8V A;  4O4I A;  1SA0 B;  4JYA O;  3K5O A;  1AR5 A;  4X1I B;  3BRC A;  1L0L H;  2JVD A;  3ABM C;  4DV5 B;  5BY1 A;  3U0Z A;  2HP8 A;  3AK2 A;  1HR0 B;  5B3S B;  1Q43 A;  2JEU A;  1QLE B;  3OMI B;  2UXC B;  3ETG A;  2EIL C;  1HNX B;  2ZT9 B;  4WBN A;  1NQT A;  5LGU A;  1IVS A;  1PP9 H;  2A9H A;  3WFV A;  2Y69 C;  3O65 A;  1YF2 A;  4NYK A;  4B08 A;  1H2K A;  4PV1 B;  5B3S C;  3JD2 A;  5KX5 B;  1H2M A;  1FS0 G;  1BL8 A;  1QLE C;  5LA6 B;  5B5E Z;  5H6Q A;  3K0D A;  4J9Y B;  2Q9L A;  4DV0 O;  3JAR B;  1FAF A;  3G6E V;  2B9Z A;  4DK0 A;  5IT9 N;  2ZE6 A;  4JI6 B;  4QPJ A;  1Q6U A;  5GON B;  5B66 Z;  5JH7 A;  3CPW U;  2VWJ A;  2FKX A;  2YIA A;  1WA8 B;  3JYC A;  5L3B A;  3TJT A;  4A5U B;  4CS2 A;  3OTO O;  3CME V;  2Y4U A;  5EIB D;  5JQG B;  4IIJ B;  1S5J A;  4J11 A;  1MMM A;  4WFG A;  2DWE C;  3D36 C;  4DUZ O;  2HEP A;  2EJR A;  4J9Z B;  2NN4 A;  2VWK A;  2RCV A;  2F1M A;  3RYI A;  1IBL B;  4L8J A;  3D3Q A;  2ITD C;  2UXB B;  3K5L A;  5CBG A;  3B77 A;  1FJG B;  5K1P A;  2DQ3 A;  5LA6 A;  3SDL A;  2CTR A;  4FLU A;  3JAR A;  1IUR A;  4GX2 A;  1GN4 A;  4JAU A;  5KLV H;  1RM1 B;  2M7W A;  1NKD A;  4JF3 A;  1XQ8 A;  3SYA A;  1DTO A;  2HKO A;  4H44 B;  2P6J A;  3QG5 A;  1H2S B;  3AG2 C;  1JJ2 U;  1WA8 A;  4QJF B;  2UXD B;  1XMO B;  1WP8 A;  2E5L B;  2ZXW B;  1VF6 A;  5JQG A;  4IIJ A;  4RWU A;  4RQF A;  4JPR A;  3RYH A;  4DR3 B;  3ABL C;  4CH5 A;  5A9G A;  1YTF B;  1KC8 W;  2FTK A;  3CC4 V;  3CXH F;  4GKJ O;  3CYO A;  1Q5O A;  4LH7 A;  1S0V A;  2DW4 A;  2R70 A;  1TUB A;  4EFE A;  2QGN A;  2IW5 A;  5DN6 G;  2OYQ A;  2ZXW C;  3JSN A;  4LR3 A;  4TQF A;  4LNU B;  2UUB B;  3CCS V;  4U3J B;  1YJ9 V;  2CH7 B;  2JS3 A;  1GH6 A;  5ITZ B;  1Q6I A;  2P4K A;  1N36 O;  1XL4 A;  2BCC H;  1VQP V;  2PYL A;  3VQX A;  1GN3 A;  2QE7 G;  3APO A;  4ZHQ B;  2WA4 A;  2ODM A;  3OUF A;  1N32 B;  4GX0 A;  1H38 A;  5GTI Z;  1RPR A;  4W4K A;  3U11 A;  2RMK B;  2RDC A;  5CA1 B;  3ASO B;  2G38 A;  2JS5 A;  1ARO P;  4LWS B;  2UXN A;  3UO2 A;  1IBK O;  5BXZ A;  1OZ0 A;  4MVZ A;  3ICX A;  5L3E A;  1XBL A;  3FFQ A;  2XAS A;  4CC6 A;  3ETQ A;  5IYC O;  2ZM6 B;  1K97 A;  4PD4 F;  5JJJ B;  4DUY O;  1SKV A;  2CGO A;  4LFA B;  5JVD B;  5IWA O;  4TSF G;  1U97 A;  2P06 A;  1PL0 A;  3ASO C;  1COW G;  4LNU A;  3E8F A;  2CH7 A;  5ITZ A;  2WLJ A;  3OFN G;  5FLX N;  4PI0 A;  4XDK A;  1PNL A;  3BAA A;  1GKF A;  4CH6 A;  2HG5 C;  4P30 A;  3ZHV A;  3R65 A;  4F6R A;  3SJB C;  3B8N A;  3W7T A;  1K73 W;  1S5H C;  3THO A;  2EIK C;  3CB2 A;  4N21 A;  1LUW A;  4FFB B;  5CA1 A;  2B1I A;  4LWS A;  4X1Y B;  4DR2 B;  1ZL8 B;  3QO8 A;  1SES A;  2N05 A;  4PA7 A;  3H1J H;  5FPO A; 
#chains in the Genus database with same CATH homology
 3C3T A;  1I0H A;  1GN2 A;  3AK1 A;  1Y67 A;  1WB8 A;  1EN5 A;  3MDS A;  1PL4 A;  2P4K A;  1AP5 A;  1I08 A;  1XIL A;  1B06 A;  1GN6 A;  4X9Q A;  1VAR A;  1GN3 A;  3TJT A;  1KKC A;  1ZSP A;  1ZTE A;  3CEI A;  2ADQ B;  3DC5 A;  1JR9 A;  1MMM A;  4JZ2 A;  3C3S A;  1BT8 A;  2AW9 A;  2RCV A;  4E4E A;  2GDS A;  1ZUQ A;  3EVK A;  1MA1 A;  1EN6 A;  2CE4 A;  4GUN A;  1XUQ A;  1EN4 A;  1WB7 A;  4FFK A;  1AR4 A;  1IXB A;  1JA8 A;  1IDS A;  1IX9 A;  3DC6 A;  3OT7 A;  4F6E A;  1BSM A;  4JYY A;  5AG2 A;  4BR6 A;  1N0N A;  1VEW A;  1EM1 A;  1AR5 A;  4JZG A;  1GN4 A;  1D5N A;  1XDC A;  1ZLZ A;  3K9S A;  1N0J A;  4YIP A;  3KDR A;  3BFR A;  4C7U A;  3AK2 A;  1AVM A;  3QVN A;  1LUW A;  1P7G A;  3RN4 A;  1LUV A;  1SZX A;  5A9G A;  1BS3 A;  2QKA A;  1MSD A;  3KKY A;  3LSU A;  3IC9 A;  1MNG A;  1PM9 A;  1QNM A;  2QKC A;  1AP6 A;  2ADP A;  3AK3 A;  2CDY A;  4YIO A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...