1WB7A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
b'IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title The Role of Tyr41 and His155 in the Functional Properties of Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb7A02
1LUVA 3BFRA 2CDYA 3LSUA 1B06A 1VEWA 4YIPA 1PL4A 1IXBA 1IDSA 3K9SA 1AR4A 2GDSA 1EN5A 3C3TA 3DC5A 2QKAA 1I08A 1XUQA 1Y67A 3AK3A 1AP6A 1PM9A 1GN2A 1XDCA 5A9GA 1WB7A 4F6EA 1AP5A 1ZUQA 1MNGA 3KKYA 3IC9A 1ZTEA 3TJTA 3RN4A 2RCVA 2ADQB 4GUNA 4C7UA 1BS3A 1BSMA 2CE4A 3CEIA 3OT7A 1KKCA 1GN6A 3C3SA 1VARA 1WB8A 1AVMA 1I0HA 1QNMA 1BT8A 4FFKA 3DC6A 1XREA 2ADPA 3AK2A 1IX9A 1SZXA 1N0NA 5AG2A 1GN3A 1XILA 4JZ2A 1D5NA 3MDSA 1EM1A 2P4KA 1AR5A 4BR6A 1JA8A 1LUWA 1EN4A 4JZGA 1MA1A 2QKCA 2AW9A 4X9QA 3AK1A 1MMMA 3EVKA 4JYYA 4YIOA 4E4EA 1ZSPA 1N0JA 1P7GA 1ZLZA 1EN6A 1MSDA 1GN4A 3QVNA 1JR9A
chains in the Genus database with same CATH superfamily
1LUVA 4MVRA 1H2LA 4EFEA 3E22A 3JAWB 3BVOA 4JI0B 1S5HC 1IXBA 1YTFB 5CA1A 3ZS8C 4LF5O 1VIBA 1KQSU 3RYIB 4DV4B 5H6RA 3SYQA 4YJ3B 2CTQA 2EZOA 1YCIA 1JPXA 2EZPA 3EXAA 4D6TH 1Y67A 1OHHG 3E8HA 2P4VA 4LFCO 3P3PA 4J11A 2ZXWB 3ABMB 2Y48A 1SQVH 1CPYA 4J10A 1F4NA 4F6EA 4Q6GA 4B3RO 3Q4HA 5IY5C 2GSMB 3AG4C 1IJGA 2M7WA 2O57A 5BZBA 3KDRA 2HHHB 4MVMA 3JD3A 3DGEA 4JPRA 5CB4B 3LUTB 4WF9V 5EZYB 2Q0OC 4FLUA 4WFEA 4UB6Z 3CCSV 4DR5B 1D2DA 4JI5O 1ORQC 1IZ3A 2X6AA 1XREA 4GKKO 3AG1B 4NXNB 3WU2Z 3LDDA 3L9DA 3ETEA 1FJGB 3ZRVA 2EIMB 1VQ7V 2GUZA 2ZD9A 1SQXH 3THOA 5J2UA 3E22B 1S77D 3CCLV 2ETNA 2WLIA 5CA1B 4DV2O 5J2TA 2YDEA 3K04A 2ZR2A 1Q86W 2LW1A 1XNQO 2N04A 1I5YA 4JYYA 3OUFA 3VQWA 3T1YO 2Z3YA 1Q6HA 2ZM6B 5EIBC 3RYFA 3QVNA 4NXMO 4DR3B 5B1NA 4GLXA 2CDYA 3A2FA 5H9CA 3JCZA 4FPPA 1VQPV 1XMOO 2ZIMA 3K9AA 3OW2U 4P9OA 3RGBA 1VQ8V 1YDXA 1AILA 1PP9H 2OWOA 1V9PA 3UM7A 3H1HH 2XHBA 2ZIOA 1S5LZ 1HNXO 4PDRA 4KHPO 2EJRA 4P9PA 3N27A 4MVUA 5IJ0A 1GN2A 5LGNA 3OGCC 2X0LA 1TVKA 3BPZA 5JWPA 2OCCB 5KHGA 4L87A 3ZEDA 3W7XA 2AHZA 3HKCA 3MHHC 2YC0A 2EX3A 1XNRB 2ADQB 4GUNA 3ASNB 1O9GA 2GUZB 5LXTA 1R3JC 3LDCA 1NTKH 3FB7C 1OCCC 1K8AW 3CRCA 5IYDO 4AI8A 3N2GA 2WLIB 3X2QC 5J2TB 1XMQO 2W6IG 2ADPA 3SJBC 2A9HA 3U11A 1GN3A 4JYAO 2PUSA 4I4TA 4X89A 3RYFB 4NTWA 1GRJA 1Y4MA 4CBCA 2ZE8A 4DYLA 4I0XA 5IYBO 3DXRA 5KAFZ 3ZCCA 4LNUA 2UU9B 3K59A 3SJCC 1MMMA 1FFXA 4H13B 3UKMA 2QA4V 4NVPA 2H94A 3CWBH 4PELA 3OM3B 3LNMB 2QTSA 5IJ0B 1JR9A 2YEVA 2PYLA 1SQBH 1TVKB 1SERA 5K1XA 2YS8A 3E8FA 4FFBA 5KMGB 3BA8A 4PV1B 3HKCB 3ETDA 2QWQB 3JATA 1YHQV 2LJ2A 1BGYH 3CCUV 1OZ0A 1S76D 4DUYO 3BEHA 1NQTA 2UUCO 3FFQA 5LXTB 1R1BA 4X88A 2PI4A 3BRCA 1AI6A 3N2GB 2OYQA 1L1FA 3HKDA 4JV5B 3CMAV 1LR1A 4TOIA 4JI0O 3TJTA 4DV0B 4UCRA 2DYRB 3JASA 4B3TB 2A06H 1D5AA 4I4TB 1J5EO 4O4JA 3UQ8A 2F4VB 1SRYA 2CE4A 1FXKA 2C2AA 3CEIA 2P5OA 4I0XB 3DXRB 1EZJA 1JQ0A 2Y0IA 2OCHA 1NH2B 3AEIA 2QKSA 2PF4E 1FFXB 3ZRXA 4JZ2A 2HHHO 1EM1A 1PD3A 2YEVB 5LYJA 3QO8A 4DV3B 3G6EV 4DR4O 1Q6UA 1U97A 2WLKA 4FFBB 4JAVA 5JCOA 2Q73A 2RN9A 4B08A 1TUBA 3CRQA 2CUGA 4OX9B 4PDMA 4LC1A 4X66O 1UPGA 3B4SA 3ZX6A 3QG5A 1XOUA 4DR7O 1MSDA 4ZIBA 3D8CA 3A0RA 3ETGA 2IBZH 5B1OA 3VQVA 5JJJB 4YIPA 3GB7C 3HKDB 4A5UB 1PL4A 3MHSC 2B1IA 1MABG 2L6LA 1DF5A 1BQZA 3JASB 2JVDA 5BR8B 4O4JB 4NTXA 4UXNA 1THZA 2R70A 3ZN0A 3DC5A 4QPKA 2QKAA 1FXKB 1PNMA 4IYHA 4QNHB 4BW9A 2HJDA 1QR8A 1EFRG 3ZMVA 1FAFA 5L3EA 1DK1A 3CC2V 3QO5A 5CBHA 5KA5A 2DE0X 4FLTA 1W0KG 1OCRC 4U7NA 2F95B 4DK1A 5LYJB 1VARA 3WG7B 4JI2O 3JAKA 4LF8O 3D36C 2YXLA 2UXCO 1EBOA 2QSAA 4WFGA 2RNBA 3KCYA 4QIWF 1SZXA 2JJ1G 4J41A 2HVJC 4RUFA 1G1XB 4BIUA 2WLHA 3WB0A 1FYJA 4BW5A 1AI4A 4UVCA 4R6ZA 2EILC 1QQCA 4G28B 3JD0A 4LR3A 5CBGA 1LUWA 4PA4A 4GX5A 3OEEG 3T4DA 4LF6O 2CH7A 5IYZA 3VQYA 2Q69A 4MTXA 4BIZA 4LFBB 5LHGA 1N36O 3K5NA 4E4EA 4PHZA 2CTPA 2X7RB 2HVKC 1LNQA 5DECA 3T1CA 3CRAA 1MG1A 4TUYA 4CS2A 4PD4F 4X1YB 1NU1H 3U0ZA 4MVOA 1IVSA 4JTCB 4AQYB 1VQOV 2RQ6A 4JF3A 4NKGB 4DR1B 4HZ3A 1SC5B 2WLJA 4FJCC 1YEWA 4O4LB 2VQFB 3DTUB 4GX2A 2ZE6A 4FIPC 3JAKB 1IBLB 1S0VA 1NS1A 1K5SA 5A9GA 3HB3B 2Y4UA 1YJ9V 5CA3A 3FB6C 2KG7A 3IGAC 2H3OA 2LP7A 2QWOB 4LFAB 3G67A 4FZ0A 2PYJA 2BOBC 2EIKB 4Z1VA 3E83A 4WFFA 3CCEV 1L8DA 3P32A 2ZT9B 1AVMA 4JYBA 2NN4A 1ZWIC 2CH7B 4FFKA 5IYZB 2VS0A 4OGQB 1K97A 2P7TC 3F7YC 5GW7A 2UXDO 1IX9A 3A0BZ 2DWEC 1M56B 5GONA 4GZRB 3BY6A 2W0FC 1Q3EA 5IE9A 4XDLA 3FX7A 4TUYB 4P30A 4ZI7A 4PDLA 1QCEA 1WLEA 2GBOA 4DW0A 1Q82W 3ZHUA 4IGGA 3B09A 1URFA 1G4YB 1NVPB 4B3MO 2Q5ZA 1RPOA 3RVYA 3WB1A 1OCZC 2QGNA 5TISZ 2K9PA 1ZSPA 2AZ0A 4UCOA 4FLWA 2E5LO 1US6A 5LMUO 2YIBA 2YUAA 2BTOA 1VQLV 1R3KC 2KG7B 3P3NA 5BMVA 2UUAB 1YJWV 4J7ZA 2XAQA 1IBKB 1AR4A 1DTOA 4LF7O 3E86A 2PZSA 4TV9A 2DMXA 2IM9A 4MTOA 4LF9O 3CB2A 5IY5B 4LF4B 4DV7B 3AG4B 4K35A 4X65O 5B1BC 3UT5A 2DYSC 1F4MA 1PNLA 4E2LA 2WPDG 3CYOA 1P49A 4R7CA 1NT2B 2HG5C 3OTOO 3VQXA 4O4HA 1N33O 3OR6C 2RCVA 5GONB 5FPOA 4YJ2A 4YHHB 1Y66A 3WB2A 4JI7O 3LNNA 2WLLB 1RPRA 4ZI7B 3VOUA 4GKJB 3C3SA 1VQ6V 1Q43A 1WB8A 4I9QA 4WBNA 2VQEB 2UXBB 5EBMC 2HKOA 3VBBA 4MTGA 3DC6A 1N34B 1IBMB 3CCMV 2BOCC 1K73W 4X8AA 4W4LA 4FM2A 1AR5A 4LBEC 5B5EZ 3RBZA 1SESA 2OIEA 5ITZA 4DV5B 5J9PC 3ASOC 3P30A 5BMVB 5LMNB 2Q4PA 3CX5F 3SR2C 3NXSA 3CCQV 4FLXA 1FXVA 2AZ2A 4JI6B 5GTIZ 1GN4A 1QLEC 2JK5C 4FVMA 3K0GA 4HNAA 1E1RG 3W7UA 2XOKG 3RVZA 1YIJV 4DRXA 1WA8A 4JAAA 4O4HB 4PJ0Z 4YJ2B 2GDSA 3SJQC 2Y4TA 5EYPA 3CC4V 1L0LH 2A0LA 1R6NA 2E75B 5GTHZ 2HLDG 1NTMH 5LHIA 1R3LC 4UCSA 2Q9LA 3ABLC 1BL8A 4WBNB 3E35A 3RYCA 1ZX3A 1VF7A 4JI1B 1N32B 3Q4HB 4JI4O 2F1MA 3B40A 4IIJA 1HNWB 1K3EA 2HR3A 3STZC 5L3DA 1OCCB 4Z1MG 1VMGA 3IFXA 1X4TA 3X2QB 1HR0O 1Q90D 3ABTA 2L35A 2N74A 5ITZB 4RAIA 3GWOA 4DV6B 3ZHQA 1BZKA 1YJNV 2VRZA 3R65A 4K3AA 2Z0AA 4CS4A 4GX0A 1GM9A 4LP8A 1N0NA 5JVDA 2UUBB 4I55A 4R50A 1BHBA 4UCUA 2X6BA 3G6BA 3MDSA 3AG2C 1OV9A 4PA7A 4NYKA 2DQ0A 5J2UB 2BSKA 2CTWA 2JGDA 4MW3A 1SQPH 1YXBA 2XAGA 4DRXB 1ENVA 1WA8B 2DWDC 4NTYA 1L0NH 4JTAB 2YI8A 1TGOA 5EYPB 1AI5A 4H0LB 4OXSA 1ZAUA 2OT5A 4X64O 5B3SC 3UCSC 3SDLA 2MW2B 4DV1B 3G71V 4N21A 3JCUZ 3B77A 4XDJA 4IYIA 1CP9A 3CCRV 4AHCA 3RYCB 3ETQA 2WSSG 3R66A 5EC2C 1I94B 1K4DC 3T1HB 4B3SO 3JSNA 2LW7A 4ZBMA 4DUZO 4JI8O 2P22C 1PM9A 2JEXA 2LGWA 3AG7A 1SQGA 1XI1A 4J42A 1CEZA 5JVDB 3S3XA 2KKWA 1X59A 2DOSA 2ZDIC 1HNZB 4I55B 3H01A 2A79B 4YXWG 2B9ZA 1KP3A 3N2KA 3T4ZA 2LFRA 3LDEA 1M1KW 2BSKB 2W0XA 3BCCH 3D3IA 1YZBA 2XASA 4Z2WA 5B1AC 4UVBA 1WPXA 3K5MA 2JIZG 2D2CB 4UVAA 1XL4A 5CA0A 4CH4A 3K57A 3D36A 2A7WA 1F23A 4WFHA 1H38A 2G38A 1SA0A 2NNUA 4DV4O 2Q8VA 1S72V 1K5QA 1VQNV 5KAIZ 3CPWU 5FPRA 4X20A 3M7MX 4PDVA 1VP7A 4LNUB 1R73A 5IWAB 4GYCB 2EULA 2XUMA 5L3CA 2PY5A 4O2AA 4JI3B 3ABKC 4X1IA 1IURA 2YI9A 5HFMA 3U10A 1N0JA 1GH6A 4MT8A 4GT1A 1XEQA 4RWUA 4TV8A 1B6QA 1SQQH 2CK3G 4UFZA 4J7KA 3CD6V 1VQ9V 1W0JG 1KU9A 4DR5O 3JATB 2QDOA 3CRMA 3IC7A 3K03A 2KSDA 3N2KB 2Q67A 4K0KB 4NXNO 3APOA 1AP6A 4MVZA 1SKVA 2DYRC 5LP6C 1FJGO 3KG2A 1R6KA 4NB5A 1HW7A 1OCRB 1AP5A 3KKYA 2GTSA 5A2QN 4IHJA 4IT5A 5CA0B 3BHPA 4F4LA 1SA0B 3ZIAG 1H2GA 5FL7G 3LSQA 2IW5A 2ARHA 2WAMA 4KFMA 3WFVA 2AHYA 3HKEA 1WP7A 4X20B 4RUEA 4LF5B 1JJOA 1QR9A 2ZM6O 2ILMA 4DR3O 2BTQA 2DN9A 4O2AB 4X1IB 2EILB 4X1KA 1Y76A 4MS2A 5AG2A 4TQFA 1Q81W 5IDJA 3JALA 1SS3A 4LFCB 4DK0A 1K4CC 3GWKC 5CBFA 1N4CA 5K1PA 4TV8B 4B3RB 4FZ1A 2D3OW 2R9AA 1JA8A 3QO7A 2DQ3A 3OE7G 4DV6O 1G8MA 3FB5C 1TUBB 1FXHA 1RFYA 1GM8A 5EK0A 1XL6A 3ZN1A 3CE2A 1XNRO 3J7AU 5EC1C 4GKKB 3ICXA 3H1LH 1RM1C 1FFTB 4IHJB 1M90W 4B7EA 3CMEV 2YSUB 5FNVA 3FKSG 5DN6G 4ZOLA 2FMLA 1PL0A 3CP1A 5E79Z 1XHZA 1N8RW 1SETA 2ZE5A 1I08A 3HKEB 1W59A 2Y0PA 4WFAV 2EINC 5JQGA 4UCVA 1XNQB 4CH5A 3T1YB 5CMUA 4X1KB 1Y76B 2Q7HA 1I94O 1OCOC 2N05A 1A32A 2H8PC 4WFBV 2FKXA 2UU9O 3OR7C 3JALB 3T1HO 4EB6A 4NXMB 3K5LA 2ZR3A 4K8XA 3OT7A 2ITDC 5KHJA 3BABA 2P6JA 1XMOB 1S5JA 1Z2GA 5FLXN 2JGUA 4KL1A 2Z5UA 2CTRA 3JD4A 3S3WA 1M57C 3AK2A 3ZMUA 1V55B 4K8ZA 4N23A 1HNXB 1R6TA 4KHPB 1D5NA 3CHXA 1BQ0A 2XAFA 1OCZB 2BE3A 2JRIA 4H44B 4DR6B 3FD9A 1PKXA 1UFIA 1V54C 2LGQA 1VF6C 4YY3B 1I7FA 4TWKA 1MA1A 2CGNA 4HYOA 5FNVB 3MAQA 3OUSA 3G80A 3TXSA 5LA6A 4H37A 4ZOLB 4JV5O 5IT9N 4DV0O 4O2BA 1H2MA 4B3TO 1DF4A 1F7YA 2Y69C 1XMQB 3ZHTA 4MVSA 2F4VO 2P90A 1B06A 4JGSA 2K1EA 2OTJV 2GHYA 1GAXA 4JYAB 1W2BU 4FLVA 5B1BB 1AJPA 1WNSA 5EBWC 2DYSB 2QEXV 3RYIA 4Q20A 4EB6B 1NJIW 5LGTA 4QE7A 5BY1A 4DR2B 3AK3A 3OMNB 1NZ6A 4G27B 1YTFD 4RO2A 1MZEA 1K34A 4WCEV 3W7WA 2V4DA 3K08A 2QWNB 1AJQA 4DV3O 4JTDB 5BXZA 3RYHA 1B04A 5JH7A 2QR4A 3ZMSA 1G6UA 5EZYA 4OX9O 1KKCA 4K0KO 1WN7A 4DW1A 2MK3A 3H1JH 1TA8A 4DXWA 1E1QG 3E8GA 3F5TA 2GV9A 2FL4A 4CH6A 1ZL8A 2QM4A 5IYCO 4DUYB 5LA6B 2UUCB 1M4UA 3E8BA 2F43G 2YIBD 1XILA 3ASOB 3RFRA 1JFFA 4TT3G 3I5DA 2X6CA 4O2BB 2YXYA 1HWYA 2AGAA 5BR8O 5EIBD 2E3CA 5CN0A 2JJ2G 1QVGU 4EFBA 3TXQA 3ZBHA 1BCCH 4BWAA 3T2MA 1YITV 4MTFA 4XBFA 1J5EB 1QLEB 2EIJC 1VQMV 2WLMA 1XBLA 3AG3C 1RP3B 2LQTA 2AXTZ 1MZFA 1Y74A 3CC7V 3NR7A 5KUMA 2ZQMA 5L3GA 3ZHRA 2B5UA 2R72A 3RT3C 3B8MA 3OTFA 1KUQA 3ZRSA 4UV9A 3RYHB 4TQDA 3ABLB 1T5EA 3K79A 2LO1A 5JH7B 4TV9B 4EEQA 2ZNIA 4ZKIA 4J80A 3C3TA 4DR4B 1XUQA 3UT5B 4HAMA 3TCUA 1Q6IA 1WB7A 1JMKC 2V1DA 3H1IH 1ZL8B 2Q6AA 4X66B 4R8CA 1VQKV 3STLC 3IC9A 2Q7EA 5LBQA 1ZTEA 5DM6V 3ZHSA 4DR7B 1JFFB 1QU7A 2ZXWC 5LGUA 3ABMC 3ZHVA 1JOYA 4LFBO 3SJAC 4C7UA 3CS5A 1KMIZ 1BS3A 4FLZA 5C8YA 2CAZC 2ZKOA 5KHHA 2ZDIA 1E79G 3K0DA 4KUMA 3L73H 1J95A 3AG2B 1Q5OA 2LFSA 4AQYO 3K3WA 3SPJA 1WPBA 5D5PA 3SPHA 4DR1O 3OMIB 1Y74B 4LH7A 1VQ5V 2DW4A 2FYUH 3F5WC 3RWRD 1H2KA 5JJEB 1PV0A 3JARA 1WP8A 3E2EA 3AG1C 5B3SB 3O9OA 2VQFO 3B2EE 4J7JA 3FAVA 1IBLO 1SF9A 2IJHA 2EIMC 2ZE7A 2IU3A 2QTOA 3SPIA 1JJ2U 3BA9A 2QWPB 1AI7A 2UXNA 1AJNA 4JI2B 1JCHA 4LF8B 4LFAO 1JVMA 3KZIZ 3L75H 2UXCB 1EN6A 1HDJA 1Z5VA 4HNAB 3A8TA 1P84F 2XAJA 3FYEB 3M99B 1R3IC 2CGOA 3L74H 3W7TA 3EHBB 1P4RA 4F6RA 5KMGA 4DR6O 2RMKB 3APQA 1YI2V 4P2ZA 2NLJC 4D7TA 4YY3O 4CC5A 4L8JA 2ZNJA 3HKBA 4CC6A 4I5SA 4MSWC 1Z5WA 4JAUA 3SPCA 5C8YB 2XT9A 1GTOA 4CS3A 1P7BA 4LF6B 1OJHA 2YIDA 1NTZH 3SYCA 1FD9A 1N36B 1VQ4V 4H33A 2QM7A 1MSWD 1IXMA 4IIJB 4TSFG 5LP6A 5JJNB 3FB8C 5B1AB 2PI5A 1YSCA 2OCCC 1JNBA 3JARB 1GN6A 3JD1A 4PA6A 3OGIB 4DR2O 3FAVB 1K7DA 3G4SV 3ASNC 3PN1A 3OMAB 1COWG 4LWSA 2UUAO 1IBKO 2IU0A 3UO3A 1NH2D 3K58A 2P4KA 1KP2A 2QJ1A 4G2KA 3ABKB 2F93B 2JGDB 4BR6A 1XQ8A 4LF4O 4DV7O 1H2NA 4MW8A 4F6RB 4J9YB 1EN4A 3HPLC 2PTMA 1KECA 3ABUA 3HKBB 3CCJV 4YIOA 1HP8A 2WWWA 5KHIA 1P7GA 1ZLZA 4YHHO 2BCCH 4PA9A 2F66C 2ZCEA 1F51A 1AB3A 5LHHA 3B8NA 2GTAA 3CXHF 1WJZA 2P06A 2QM8A 4UV8A 3I55V 4GKJO 1GO3F 1VEWA 2UXDB 1B3QA 4DO2A 1TUEB 1IDSA 2VQEO 1O9HA 2UXBO 1EN5A 5LP6B 3ZJZA 1KB9F 1YF2A 1N34O 4B7KA 1H2SB 1IBMO 2R9IA 4BIOA 1XHXA 2VWJA 5L3FA 2B1GA 3JYCA 1KBHA 4QPJA 2KQXA 1SZTA 3MD0A 3LSSA 4KP4A 1NR1A 4B3MB 1XDCA 4ASUG 3QNEA 1QBZA 4FM1A 1QLNA 1GK9A 3CSXA 4DV5O 2EJ7A 4LWSB 2OTLV 4IL6Z 3L71H 2ITCC 2F23A 5LMNO 2E5LB 3TETA 2E74B 4OPAA 5LMUB 1NBMG 1TAEA 4OPHA 3SYPA 3UO2A 1FKAO 2HP8A 4BAYA 4JI6O 4X62B 3ZRWA 1GMGA 4LF7B 4GX1A 2DJVA 2QE7G 4GCZA 1M5IA 3M8AA 4LF9B 1KD1W 1K92A 1CXZB 4X65B 3A0HZ 4PI0A 2Q68A 4RQFA 1UJWB 2XTAA 3SYAA 3ZMTA 5KX5A 3QTCA 3OTOB 1NKDA 1BMFG 1YVWA 1N33B 4JZGA 2QKCA 4JI7B 2JS3A 3AK1A 4JI1O 1N32O 1NI8A 4EKWA 1HNWO 1KKDA 1RM1B 3RW0A 1VF6A 4U3JA 3PJSK 5KHKA 1PPJH 5LOVA 5D5QA 2WLNA 4X1YA 4UB8Z 3BFRA 3GVMA 1I5XA 3LSUA 1S3JA 5H2FZ 2ZINA 4ABMA 1SQFA 2RJZA 4KXRA 3J81N 2EINB 5LL6Y 4FMTA 2YIAA 4W4KA 4O4LA 1QHTA 3KCXA 1AROP 4JI5B 2UUBO 1FPOA 2R9RB 1PNKA 1OCOB 3QF7A 3ZRWB 4J9ZB 2HJFC 5KA6A 2IH3C 2M6YA 1MNGA 1FXKC 1M9NA 4UUJC 2A3QA 3CRRA 1RSOA 1K9MW 2QWRB 4JYCA 3E89A 1ROPA 1BSMA 1M57B 2E76B 5KX5B 4DV2B 4DV1O 5B66Z 2NR5A 4QGPA 3O65A 2BTQB 3C90A 3F7VC 3WG7C 3SPGA 4XDKA 5IJ9A 3JAMN 3BAAA 4AILC 1V54B 5H5NA 4U3JB 5L3BA 3DSQA 1DLBA 2IJJA 5JCOC 1FS0G 5LOVB 3CJHA 4QJFB 4JI4B 3FYIB 3OFNG 2JDIG 2VWKA 3JSLA 2AW9A 4QE9A 4CZZA 3L72H 4FLYA 2Y69B 5F2VO 1HR0B 4ZHQA 2IH1C 3EVKA 2W6JG 5KLVH 4I7ZB 2UXXA 2IJIA 1HNZO 4U3FH 1NVPD 1Q7YW 2WA3A 2RDCA 2XNDG 2JS5A 4UCTA 5EBLC 1BE3H 2HFEC 3K06A 3TK1A 3CCVV 1KYOF 1FOUA 2Q7GA 2YICA 4HBNA 1QVFU 4PI2A 3K9SA 2XAHA 5KUKA 2YXHA 1K33A 1RSOB 2HEPA 2FTKA 3IAYA 4I50A 3TGUH 2P67A 4O4IA 1NR7A 1GM7A 1WAZA 2Q0AA 3OEHG 1H5WA 4LCUC 3EFFK 3J80N 3H9VA 2FB5A 4FM0A 5JQGB 3SGIA 3SYOA 3OD4A 4MVQA 1ZUQA 3JAWA 3K5OA 3HR0A 4X64B 1H8HG 1M93A 1U96A 1VF5B 5IJ9B 1Q8IA 2ODMA 3RN4A 5DEDA 2OIGA 4U7OA 4CH3A 5IWAO 4ICGA 3L70H 1MOFA 4YJ3A 4JI3O 2WLLA 3JD2A 3IJ4A 2JEUA 3CJHB 1GKFA 5HFLA 1V55C 5E1AC 1H8EG 1I0HA 1QNMA 1AR1B 2EBOA 2EIKC 4RQEA 3OAAG 4B3SB 1BT8A 3ML0A 2V7QG 4DUZB 4ZHQB 4JI8B 4D7SA 3W7SA 2KB1A 4LH6A 1Y6XA 1DGSA 3D3QA 5CB4A 1KC8W 2ATKC 2EIJB 1EZVH 1BHAA 3AG3B 3ZMZA 1M56C 4PA3A 2PGGA 5C93A 4X62O 4JASA 4NR1A 2WA4A 2IJKA 4X9QA 1JX9A 4I50B 4FK5C 4O4IB 5H6QA 4I9WA 3I56V 3H1KH 3CXCU
chains in the Genus database with same CATH topology
1LUVA 3BFRA 2CDYA 3LSUA 1B06A 1VEWA 4YIPA 1PL4A 1IXBA 1IDSA 3K9SA 1AR4A 2GDSA 1EN5A 3C3TA 3DC5A 2QKAA 1I08A 1XUQA 1Y67A 3AK3A 1AP6A 1PM9A 1GN2A 1XDCA 5A9GA 1WB7A 4F6EA 1AP5A 1ZUQA 1MNGA 3KKYA 3IC9A 1ZTEA 3TJTA 3KDRA 3RN4A 2RCVA 2ADQB 4GUNA 4C7UA 1BS3A 1BSMA 2CE4A 3CEIA 3OT7A 1KKCA 1GN6A 3C3SA 1VARA 1WB8A 1AVMA 1I0HA 1QNMA 1BT8A 4FFKA 3DC6A 1XREA 2ADPA 3AK2A 1IX9A 1SZXA 1N0NA 5AG2A 1GN3A 1XILA 4JZ2A 1D5NA 3MDSA 1EM1A 2P4KA 1AR5A 4BR6A 1JA8A 1LUWA 1EN4A 4JZGA 1MA1A 2QKCA 2AW9A 4X9QA 3AK1A 1MMMA 3EVKA 4JYYA 4YIOA 4E4EA 1ZSPA 1N0JA 1P7GA 1ZLZA 1EN6A 1MSDA 1GN4A 3QVNA 1JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUV A;  3BFR A;  2CDY A;  3LSU A;  1B06 A;  1VEW A;  4YIP A;  1PL4 A;  1IXB A;  1IDS A;  3K9S A;  1AR4 A;  2GDS A;  1EN5 A;  3C3T A;  3DC5 A;  2QKA A;  1I08 A;  1XUQ A;  1Y67 A;  3AK3 A;  1AP6 A;  1PM9 A;  1GN2 A;  1XDC A;  5A9G A;  1WB7 A;  4F6E A;  1AP5 A;  1ZUQ A;  1MNG A;  3KKY A;  3IC9 A;  1ZTE A;  3TJT A;  3RN4 A;  2RCV A;  2ADQ B;  4GUN A;  4C7U A;  1BS3 A;  1BSM A;  2CE4 A;  3CEI A;  3OT7 A;  1KKC A;  1GN6 A;  3C3S A;  1VAR A;  1WB8 A;  1AVM A;  1I0H A;  1QNM A;  1BT8 A;  4FFK A;  3DC6 A;  1XRE A;  2ADP A;  3AK2 A;  1IX9 A;  1SZX A;  1N0N A;  5AG2 A;  1GN3 A;  1XIL A;  4JZ2 A;  1D5N A;  3MDS A;  1EM1 A;  2P4K A;  1AR5 A;  4BR6 A;  1JA8 A;  1LUW A;  1EN4 A;  4JZG A;  1MA1 A;  2QKC A;  2AW9 A;  4X9Q A;  3AK1 A;  1MMM A;  3EVK A;  4JYY A;  4YIO A;  4E4E A;  1ZSP A;  1N0J A;  1P7G A;  1ZLZ A;  1EN6 A;  1MSD A;  1GN4 A;  3QVN A;  1JR9 A; 
#chains in the Genus database with same CATH topology
 1LUV A;  4MVR A;  1H2L A;  4EFE A;  3E22 A;  3JAW B;  3BVO A;  4JI0 B;  1S5H C;  1IXB A;  1YTF B;  5CA1 A;  3ZS8 C;  4LF5 O;  1VIB A;  1KQS U;  3RYI B;  4DV4 B;  5H6R A;  3SYQ A;  4YJ3 B;  2CTQ A;  2EZO A;  1YCI A;  1JPX A;  2EZP A;  3EXA A;  4D6T H;  1Y67 A;  1OHH G;  3E8H A;  2P4V A;  4LFC O;  3P3P A;  4J11 A;  2ZXW B;  3ABM B;  2Y48 A;  1SQV H;  1CPY A;  4J10 A;  1F4N A;  4F6E A;  4Q6G A;  4B3R O;  3Q4H A;  5IY5 C;  2GSM B;  3AG4 C;  1IJG A;  2M7W A;  2O57 A;  5BZB A;  3KDR A;  2HHH B;  4MVM A;  3JD3 A;  3DGE A;  4JPR A;  5CB4 B;  3LUT B;  4WF9 V;  5EZY B;  2Q0O C;  4FLU A;  4WFE A;  4UB6 Z;  3CCS V;  4DR5 B;  1D2D A;  4JI5 O;  1ORQ C;  1IZ3 A;  2X6A A;  1XRE A;  4GKK O;  3AG1 B;  4NXN B;  3WU2 Z;  3LDD A;  3L9D A;  3ETE A;  1FJG B;  3ZRV A;  2EIM B;  1VQ7 V;  2GUZ A;  2ZD9 A;  1SQX H;  3THO A;  5J2U A;  3E22 B;  1S77 D;  3CCL V;  2ETN A;  2WLI A;  5CA1 B;  4DV2 O;  5J2T A;  2YDE A;  3K04 A;  2ZR2 A;  1Q86 W;  2LW1 A;  1XNQ O;  2N04 A;  1I5Y A;  4JYY A;  3OUF A;  3VQW A;  3T1Y O;  2Z3Y A;  1Q6H A;  2ZM6 B;  5EIB C;  3RYF A;  3QVN A;  4NXM O;  4DR3 B;  5B1N A;  4GLX A;  2CDY A;  3A2F A;  5H9C A;  3JCZ A;  4FPP A;  1VQP V;  1XMO O;  2ZIM A;  3K9A A;  3OW2 U;  4P9O A;  3RGB A;  1VQ8 V;  1YDX A;  1AIL A;  1PP9 H;  2OWO A;  1V9P A;  3UM7 A;  3H1H H;  2XHB A;  2ZIO A;  1S5L Z;  1HNX O;  4PDR A;  4KHP O;  2EJR A;  4P9P A;  3N27 A;  4MVU A;  5IJ0 A;  1GN2 A;  5LGN A;  3OGC C;  2X0L A;  1TVK A;  3BPZ A;  5JWP A;  2OCC B;  5KHG A;  4L87 A;  3ZED A;  3W7X A;  2AHZ A;  3HKC A;  3MHH C;  2YC0 A;  2EX3 A;  1XNR B;  2ADQ B;  4GUN A;  3ASN B;  1O9G A;  2GUZ B;  5LXT A;  1R3J C;  3LDC A;  1NTK H;  3FB7 C;  1OCC C;  1K8A W;  3CRC A;  5IYD O;  4AI8 A;  3N2G A;  2WLI B;  3X2Q C;  5J2T B;  1XMQ O;  2W6I G;  2ADP A;  3SJB C;  2A9H A;  3U11 A;  1GN3 A;  4JYA O;  2PUS A;  4I4T A;  4X89 A;  3RYF B;  4NTW A;  1GRJ A;  1Y4M A;  4CBC A;  2ZE8 A;  4DYL A;  4I0X A;  5IYB O;  3DXR A;  5KAF Z;  3ZCC A;  4LNU A;  2UU9 B;  3K59 A;  3SJC C;  1MMM A;  1FFX A;  4H13 B;  3UKM A;  2QA4 V;  4NVP A;  2H94 A;  3CWB H;  4PEL A;  3OM3 B;  3LNM B;  2QTS A;  5IJ0 B;  1JR9 A;  2YEV A;  2PYL A;  1SQB H;  1TVK B;  1SER A;  5K1X A;  2YS8 A;  3E8F A;  4FFB A;  5KMG B;  3BA8 A;  4PV1 B;  3HKC B;  3ETD A;  2QWQ B;  3JAT A;  1YHQ V;  2LJ2 A;  1BGY H;  3CCU V;  1OZ0 A;  1S76 D;  4DUY O;  3BEH A;  1NQT A;  2UUC O;  3FFQ A;  5LXT B;  1R1B A;  4X88 A;  2PI4 A;  3BRC A;  1AI6 A;  3N2G B;  2OYQ A;  1L1F A;  3HKD A;  4JV5 B;  3CMA V;  1LR1 A;  4TOI A;  4JI0 O;  3TJT A;  4DV0 B;  4UCR A;  2DYR B;  3JAS A;  4B3T B;  2A06 H;  1D5A A;  4I4T B;  1J5E O;  4O4J A;  3UQ8 A;  2F4V B;  1SRY A;  2CE4 A;  1FXK A;  2C2A A;  3CEI A;  2P5O A;  4I0X B;  3DXR B;  1EZJ A;  1JQ0 A;  2Y0I A;  2OCH A;  1NH2 B;  3AEI A;  2QKS A;  2PF4 E;  1FFX B;  3ZRX A;  4JZ2 A;  2HHH O;  1EM1 A;  1PD3 A;  2YEV B;  5LYJ A;  3QO8 A;  4DV3 B;  3G6E V;  4DR4 O;  1Q6U A;  1U97 A;  2WLK A;  4FFB B;  4JAV A;  5JCO A;  2Q73 A;  2RN9 A;  4B08 A;  1TUB A;  3CRQ A;  2CUG A;  4OX9 B;  4PDM A;  4LC1 A;  4X66 O;  1UPG A;  3B4S A;  3ZX6 A;  3QG5 A;  1XOU A;  4DR7 O;  1MSD A;  4ZIB A;  3D8C A;  3A0R A;  3ETG A;  2IBZ H;  5B1O A;  3VQV A;  5JJJ B;  4YIP A;  3GB7 C;  3HKD B;  4A5U B;  1PL4 A;  3MHS C;  2B1I A;  1MAB G;  2L6L A;  1DF5 A;  1BQZ A;  3JAS B;  2JVD A;  5BR8 B;  4O4J B;  4NTX A;  4UXN A;  1THZ A;  2R70 A;  3ZN0 A;  3DC5 A;  4QPK A;  2QKA A;  1FXK B;  1PNM A;  4IYH A;  4QNH B;  4BW9 A;  2HJD A;  1QR8 A;  1EFR G;  3ZMV A;  1FAF A;  5L3E A;  1DK1 A;  3CC2 V;  3QO5 A;  5CBH A;  5KA5 A;  2DE0 X;  4FLT A;  1W0K G;  1OCR C;  4U7N A;  2F95 B;  4DK1 A;  5LYJ B;  1VAR A;  3WG7 B;  4JI2 O;  3JAK A;  4LF8 O;  3D36 C;  2YXL A;  2UXC O;  1EBO A;  2QSA A;  4WFG A;  2RNB A;  3KCY A;  4QIW F;  1SZX A;  2JJ1 G;  4J41 A;  2HVJ C;  4RUF A;  1G1X B;  4BIU A;  2WLH A;  3WB0 A;  1FYJ A;  4BW5 A;  1AI4 A;  4UVC A;  4R6Z A;  2EIL C;  1QQC A;  4G28 B;  3JD0 A;  4LR3 A;  5CBG A;  1LUW A;  4PA4 A;  4GX5 A;  3OEE G;  3T4D A;  4LF6 O;  2CH7 A;  5IYZ A;  3VQY A;  2Q69 A;  4MTX A;  4BIZ A;  4LFB B;  5LHG A;  1N36 O;  3K5N A;  4E4E A;  4PHZ A;  2CTP A;  2X7R B;  2HVK C;  1LNQ A;  5DEC A;  3T1C A;  3CRA A;  1MG1 A;  4TUY A;  4CS2 A;  4PD4 F;  4X1Y B;  1NU1 H;  3U0Z A;  4MVO A;  1IVS A;  4JTC B;  4AQY B;  1VQO V;  2RQ6 A;  4JF3 A;  4NKG B;  4DR1 B;  4HZ3 A;  1SC5 B;  2WLJ A;  4FJC C;  1YEW A;  4O4L B;  2VQF B;  3DTU B;  4GX2 A;  2ZE6 A;  4FIP C;  3JAK B;  1IBL B;  1S0V A;  1NS1 A;  1K5S A;  5A9G A;  3HB3 B;  2Y4U A;  1YJ9 V;  5CA3 A;  3FB6 C;  2KG7 A;  3IGA C;  2H3O A;  2LP7 A;  2QWO B;  4LFA B;  3G67 A;  4FZ0 A;  2PYJ A;  2BOB C;  2EIK B;  4Z1V A;  3E83 A;  4WFF A;  3CCE V;  1L8D A;  3P32 A;  2ZT9 B;  1AVM A;  4JYB A;  2NN4 A;  1ZWI C;  2CH7 B;  4FFK A;  5IYZ B;  2VS0 A;  4OGQ B;  1K97 A;  2P7T C;  3F7Y C;  5GW7 A;  2UXD O;  1IX9 A;  3A0B Z;  2DWE C;  1M56 B;  5GON A;  4GZR B;  3BY6 A;  2W0F C;  1Q3E A;  5IE9 A;  4XDL A;  3FX7 A;  4TUY B;  4P30 A;  4ZI7 A;  4PDL A;  1QCE A;  1WLE A;  2GBO A;  4DW0 A;  1Q82 W;  3ZHU A;  4IGG A;  3B09 A;  1URF A;  1G4Y B;  1NVP B;  4B3M O;  2Q5Z A;  1RPO A;  3RVY A;  3WB1 A;  1OCZ C;  2QGN A;  5TIS Z;  2K9P A;  1ZSP A;  2AZ0 A;  4UCO A;  4FLW A;  2E5L O;  1US6 A;  5LMU O;  2YIB A;  2YUA A;  2BTO A;  1VQL V;  1R3K C;  2KG7 B;  3P3N A;  5BMV A;  2UUA B;  1YJW V;  4J7Z A;  2XAQ A;  1IBK B;  1AR4 A;  1DTO A;  4LF7 O;  3E86 A;  2PZS A;  4TV9 A;  2DMX A;  2IM9 A;  4MTO A;  4LF9 O;  3CB2 A;  5IY5 B;  4LF4 B;  4DV7 B;  3AG4 B;  4K35 A;  4X65 O;  5B1B C;  3UT5 A;  2DYS C;  1F4M A;  1PNL A;  4E2L A;  2WPD G;  3CYO A;  1P49 A;  4R7C A;  1NT2 B;  2HG5 C;  3OTO O;  3VQX A;  4O4H A;  1N33 O;  3OR6 C;  2RCV A;  5GON B;  5FPO A;  4YJ2 A;  4YHH B;  1Y66 A;  3WB2 A;  4JI7 O;  3LNN A;  2WLL B;  1RPR A;  4ZI7 B;  3VOU A;  4GKJ B;  3C3S A;  1VQ6 V;  1Q43 A;  1WB8 A;  4I9Q A;  4WBN A;  2VQE B;  2UXB B;  5EBM C;  2HKO A;  3VBB A;  4MTG A;  3DC6 A;  1N34 B;  1IBM B;  3CCM V;  2BOC C;  1K73 W;  4X8A A;  4W4L A;  4FM2 A;  1AR5 A;  4LBE C;  5B5E Z;  3RBZ A;  1SES A;  2OIE A;  5ITZ A;  4DV5 B;  5J9P C;  3ASO C;  3P30 A;  5BMV B;  5LMN B;  2Q4P A;  3CX5 F;  3SR2 C;  3NXS A;  3CCQ V;  4FLX A;  1FXV A;  2AZ2 A;  4JI6 B;  5GTI Z;  1GN4 A;  1QLE C;  2JK5 C;  4FVM A;  3K0G A;  4HNA A;  1E1R G;  3W7U A;  2XOK G;  3RVZ A;  1YIJ V;  4DRX A;  1WA8 A;  4JAA A;  4O4H B;  4PJ0 Z;  4YJ2 B;  2GDS A;  3SJQ C;  2Y4T A;  5EYP A;  3CC4 V;  1L0L H;  2A0L A;  1R6N A;  2E75 B;  5GTH Z;  2HLD G;  1NTM H;  5LHI A;  1R3L C;  4UCS A;  2Q9L A;  3ABL C;  1BL8 A;  4WBN B;  3E35 A;  3RYC A;  1ZX3 A;  1VF7 A;  4JI1 B;  1N32 B;  3Q4H B;  4JI4 O;  2F1M A;  3B40 A;  4IIJ A;  1HNW B;  1K3E A;  2HR3 A;  3STZ C;  5L3D A;  1OCC B;  4Z1M G;  1VMG A;  3IFX A;  1X4T A;  3X2Q B;  1HR0 O;  1Q90 D;  3ABT A;  2L35 A;  2N74 A;  5ITZ B;  4RAI A;  3GWO A;  4DV6 B;  3ZHQ A;  1BZK A;  1YJN V;  2VRZ A;  3R65 A;  4K3A A;  2Z0A A;  4CS4 A;  4GX0 A;  1GM9 A;  4LP8 A;  1N0N A;  5JVD A;  2UUB B;  4I55 A;  4R50 A;  1BHB A;  4UCU A;  2X6B A;  3G6B A;  3MDS A;  3AG2 C;  1OV9 A;  4PA7 A;  4NYK A;  2DQ0 A;  5J2U B;  2BSK A;  2CTW A;  2JGD A;  4MW3 A;  1SQP H;  1YXB A;  2XAG A;  4DRX B;  1ENV A;  1WA8 B;  2DWD C;  4NTY A;  1L0N H;  4JTA B;  2YI8 A;  1TGO A;  5EYP B;  1AI5 A;  4H0L B;  4OXS A;  1ZAU A;  2OT5 A;  4X64 O;  5B3S C;  3UCS C;  3SDL A;  2MW2 B;  4DV1 B;  3G71 V;  4N21 A;  3JCU Z;  3B77 A;  4XDJ A;  4IYI A;  1CP9 A;  3CCR V;  4AHC A;  3RYC B;  3ETQ A;  2WSS G;  3R66 A;  5EC2 C;  1I94 B;  1K4D C;  3T1H B;  4B3S O;  3JSN A;  2LW7 A;  4ZBM A;  4DUZ O;  4JI8 O;  2P22 C;  1PM9 A;  2JEX A;  2LGW A;  3AG7 A;  1SQG A;  1XI1 A;  4J42 A;  1CEZ A;  5JVD B;  3S3X A;  2KKW A;  1X59 A;  2DOS A;  2ZDI C;  1HNZ B;  4I55 B;  3H01 A;  2A79 B;  4YXW G;  2B9Z A;  1KP3 A;  3N2K A;  3T4Z A;  2LFR A;  3LDE A;  1M1K W;  2BSK B;  2W0X A;  3BCC H;  3D3I A;  1YZB A;  2XAS A;  4Z2W A;  5B1A C;  4UVB A;  1WPX A;  3K5M A;  2JIZ G;  2D2C B;  4UVA A;  1XL4 A;  5CA0 A;  4CH4 A;  3K57 A;  3D36 A;  2A7W A;  1F23 A;  4WFH A;  1H38 A;  2G38 A;  1SA0 A;  2NNU A;  4DV4 O;  2Q8V A;  1S72 V;  1K5Q A;  1VQN V;  5KAI Z;  3CPW U;  5FPR A;  4X20 A;  3M7M X;  4PDV A;  1VP7 A;  4LNU B;  1R73 A;  5IWA B;  4GYC B;  2EUL A;  2XUM A;  5L3C A;  2PY5 A;  4O2A A;  4JI3 B;  3ABK C;  4X1I A;  1IUR A;  2YI9 A;  5HFM A;  3U10 A;  1N0J A;  1GH6 A;  4MT8 A;  4GT1 A;  1XEQ A;  4RWU A;  4TV8 A;  1B6Q A;  1SQQ H;  2CK3 G;  4UFZ A;  4J7K A;  3CD6 V;  1VQ9 V;  1W0J G;  1KU9 A;  4DR5 O;  3JAT B;  2QDO A;  3CRM A;  3IC7 A;  3K03 A;  2KSD A;  3N2K B;  2Q67 A;  4K0K B;  4NXN O;  3APO A;  1AP6 A;  4MVZ A;  1SKV A;  2DYR C;  5LP6 C;  1FJG O;  3KG2 A;  1R6K A;  4NB5 A;  1HW7 A;  1OCR B;  1AP5 A;  3KKY A;  2GTS A;  5A2Q N;  4IHJ A;  4IT5 A;  5CA0 B;  3BHP A;  4F4L A;  1SA0 B;  3ZIA G;  1H2G A;  5FL7 G;  3LSQ A;  2IW5 A;  2ARH A;  2WAM A;  4KFM A;  3WFV A;  2AHY A;  3HKE A;  1WP7 A;  4X20 B;  4RUE A;  4LF5 B;  1JJO A;  1QR9 A;  2ZM6 O;  2ILM A;  4DR3 O;  2BTQ A;  2DN9 A;  4O2A B;  4X1I B;  2EIL B;  4X1K A;  1Y76 A;  4MS2 A;  5AG2 A;  4TQF A;  1Q81 W;  5IDJ A;  3JAL A;  1SS3 A;  4LFC B;  4DK0 A;  1K4C C;  3GWK C;  5CBF A;  1N4C A;  5K1P A;  4TV8 B;  4B3R B;  4FZ1 A;  2D3O W;  2R9A A;  1JA8 A;  3QO7 A;  2DQ3 A;  3OE7 G;  4DV6 O;  1G8M A;  3FB5 C;  1TUB B;  1FXH A;  1RFY A;  1GM8 A;  5EK0 A;  1XL6 A;  3ZN1 A;  3CE2 A;  1XNR O;  3J7A U;  5EC1 C;  4GKK B;  3ICX A;  3H1L H;  1RM1 C;  1FFT B;  4IHJ B;  1M90 W;  4B7E A;  3CME V;  2YSU B;  5FNV A;  3FKS G;  5DN6 G;  4ZOL A;  2FML A;  1PL0 A;  3CP1 A;  5E79 Z;  1XHZ A;  1N8R W;  1SET A;  2ZE5 A;  1I08 A;  3HKE B;  1W59 A;  2Y0P A;  4WFA V;  2EIN C;  5JQG A;  4UCV A;  1XNQ B;  4CH5 A;  3T1Y B;  5CMU A;  4X1K B;  1Y76 B;  2Q7H A;  1I94 O;  1OCO C;  2N05 A;  1A32 A;  2H8P C;  4WFB V;  2FKX A;  2UU9 O;  3OR7 C;  3JAL B;  3T1H O;  4EB6 A;  4NXM B;  3K5L A;  2ZR3 A;  4K8X A;  3OT7 A;  2ITD C;  5KHJ A;  3BAB A;  2P6J A;  1XMO B;  1S5J A;  1Z2G A;  5FLX N;  2JGU A;  4KL1 A;  2Z5U A;  2CTR A;  3JD4 A;  3S3W A;  1M57 C;  3AK2 A;  3ZMU A;  1V55 B;  4K8Z A;  4N23 A;  1HNX B;  1R6T A;  4KHP B;  1D5N A;  3CHX A;  1BQ0 A;  2XAF A;  1OCZ B;  2BE3 A;  2JRI A;  4H44 B;  4DR6 B;  3FD9 A;  1PKX A;  1UFI A;  1V54 C;  2LGQ A;  1VF6 C;  4YY3 B;  1I7F A;  4TWK A;  1MA1 A;  2CGN A;  4HYO A;  5FNV B;  3MAQ A;  3OUS A;  3G80 A;  3TXS A;  5LA6 A;  4H37 A;  4ZOL B;  4JV5 O;  5IT9 N;  4DV0 O;  4O2B A;  1H2M A;  4B3T O;  1DF4 A;  1F7Y A;  2Y69 C;  1XMQ B;  3ZHT A;  4MVS A;  2F4V O;  2P90 A;  1B06 A;  4JGS A;  2K1E A;  2OTJ V;  2GHY A;  1GAX A;  4JYA B;  1W2B U;  4FLV A;  5B1B B;  1AJP A;  1WNS A;  5EBW C;  2DYS B;  2QEX V;  3RYI A;  4Q20 A;  4EB6 B;  1NJI W;  5LGT A;  4QE7 A;  5BY1 A;  4DR2 B;  3AK3 A;  3OMN B;  1NZ6 A;  4G27 B;  1YTF D;  4RO2 A;  1MZE A;  1K34 A;  4WCE V;  3W7W A;  2V4D A;  3K08 A;  2QWN B;  1AJQ A;  4DV3 O;  4JTD B;  5BXZ A;  3RYH A;  1B04 A;  5JH7 A;  2QR4 A;  3ZMS A;  1G6U A;  5EZY A;  4OX9 O;  1KKC A;  4K0K O;  1WN7 A;  4DW1 A;  2MK3 A;  3H1J H;  1TA8 A;  4DXW A;  1E1Q G;  3E8G A;  3F5T A;  2GV9 A;  2FL4 A;  4CH6 A;  1ZL8 A;  2QM4 A;  5IYC O;  4DUY B;  5LA6 B;  2UUC B;  1M4U A;  3E8B A;  2F43 G;  2YIB D;  1XIL A;  3ASO B;  3RFR A;  1JFF A;  4TT3 G;  3I5D A;  2X6C A;  4O2B B;  2YXY A;  1HWY A;  2AGA A;  5BR8 O;  5EIB D;  2E3C A;  5CN0 A;  2JJ2 G;  1QVG U;  4EFB A;  3TXQ A;  3ZBH A;  1BCC H;  4BWA A;  3T2M A;  1YIT V;  4MTF A;  4XBF A;  1J5E B;  1QLE B;  2EIJ C;  1VQM V;  2WLM A;  1XBL A;  3AG3 C;  1RP3 B;  2LQT A;  2AXT Z;  1MZF A;  1Y74 A;  3CC7 V;  3NR7 A;  5KUM A;  2ZQM A;  5L3G A;  3ZHR A;  2B5U A;  2R72 A;  3RT3 C;  3B8M A;  3OTF A;  1KUQ A;  3ZRS A;  4UV9 A;  3RYH B;  4TQD A;  3ABL B;  1T5E A;  3K79 A;  2LO1 A;  5JH7 B;  4TV9 B;  4EEQ A;  2ZNI A;  4ZKI A;  4J80 A;  3C3T A;  4DR4 B;  1XUQ A;  3UT5 B;  4HAM A;  3TCU A;  1Q6I A;  1WB7 A;  1JMK C;  2V1D A;  3H1I H;  1ZL8 B;  2Q6A A;  4X66 B;  4R8C A;  1VQK V;  3STL C;  3IC9 A;  2Q7E A;  5LBQ A;  1ZTE A;  5DM6 V;  3ZHS A;  4DR7 B;  1JFF B;  1QU7 A;  2ZXW C;  5LGU A;  3ABM C;  3ZHV A;  1JOY A;  4LFB O;  3SJA C;  4C7U A;  3CS5 A;  1KMI Z;  1BS3 A;  4FLZ A;  5C8Y A;  2CAZ C;  2ZKO A;  5KHH A;  2ZDI A;  1E79 G;  3K0D A;  4KUM A;  3L73 H;  1J95 A;  3AG2 B;  1Q5O A;  2LFS A;  4AQY O;  3K3W A;  3SPJ A;  1WPB A;  5D5P A;  3SPH A;  4DR1 O;  3OMI B;  1Y74 B;  4LH7 A;  1VQ5 V;  2DW4 A;  2FYU H;  3F5W C;  3RWR D;  1H2K A;  5JJE B;  1PV0 A;  3JAR A;  1WP8 A;  3E2E A;  3AG1 C;  5B3S B;  3O9O A;  2VQF O;  3B2E E;  4J7J A;  3FAV A;  1IBL O;  1SF9 A;  2IJH A;  2EIM C;  2ZE7 A;  2IU3 A;  2QTO A;  3SPI A;  1JJ2 U;  3BA9 A;  2QWP B;  1AI7 A;  2UXN A;  1AJN A;  4JI2 B;  1JCH A;  4LF8 B;  4LFA O;  1JVM A;  3KZI Z;  3L75 H;  2UXC B;  1EN6 A;  1HDJ A;  1Z5V A;  4HNA B;  3A8T A;  1P84 F;  2XAJ A;  3FYE B;  3M99 B;  1R3I C;  2CGO A;  3L74 H;  3W7T A;  3EHB B;  1P4R A;  4F6R A;  5KMG A;  4DR6 O;  2RMK B;  3APQ A;  1YI2 V;  4P2Z A;  2NLJ C;  4D7T A;  4YY3 O;  4CC5 A;  4L8J A;  2ZNJ A;  3HKB A;  4CC6 A;  4I5S A;  4MSW C;  1Z5W A;  4JAU A;  3SPC A;  5C8Y B;  2XT9 A;  1GTO A;  4CS3 A;  1P7B A;  4LF6 B;  1OJH A;  2YID A;  1NTZ H;  3SYC A;  1FD9 A;  1N36 B;  1VQ4 V;  4H33 A;  2QM7 A;  1MSW D;  1IXM A;  4IIJ B;  4TSF G;  5LP6 A;  5JJN B;  3FB8 C;  5B1A B;  2PI5 A;  1YSC A;  2OCC C;  1JNB A;  3JAR B;  1GN6 A;  3JD1 A;  4PA6 A;  3OGI B;  4DR2 O;  3FAV B;  1K7D A;  3G4S V;  3ASN C;  3PN1 A;  3OMA B;  1COW G;  4LWS A;  2UUA O;  1IBK O;  2IU0 A;  3UO3 A;  1NH2 D;  3K58 A;  2P4K A;  1KP2 A;  2QJ1 A;  4G2K A;  3ABK B;  2F93 B;  2JGD B;  4BR6 A;  1XQ8 A;  4LF4 O;  4DV7 O;  1H2N A;  4MW8 A;  4F6R B;  4J9Y B;  1EN4 A;  3HPL C;  2PTM A;  1KEC A;  3ABU A;  3HKB B;  3CCJ V;  4YIO A;  1HP8 A;  2WWW A;  5KHI A;  1P7G A;  1ZLZ A;  4YHH O;  2BCC H;  4PA9 A;  2F66 C;  2ZCE A;  1F51 A;  1AB3 A;  5LHH A;  3B8N A;  2GTA A;  3CXH F;  1WJZ A;  2P06 A;  2QM8 A;  4UV8 A;  3I55 V;  4GKJ O;  1GO3 F;  1VEW A;  2UXD B;  1B3Q A;  4DO2 A;  1TUE B;  1IDS A;  2VQE O;  1O9H A;  2UXB O;  1EN5 A;  5LP6 B;  3ZJZ A;  1KB9 F;  1YF2 A;  1N34 O;  4B7K A;  1H2S B;  1IBM O;  2R9I A;  4BIO A;  1XHX A;  2VWJ A;  5L3F A;  2B1G A;  3JYC A;  1KBH A;  4QPJ A;  2KQX A;  1SZT A;  3MD0 A;  3LSS A;  4KP4 A;  1NR1 A;  4B3M B;  1XDC A;  4ASU G;  3QNE A;  1QBZ A;  4FM1 A;  1QLN A;  1GK9 A;  3CSX A;  4DV5 O;  2EJ7 A;  4LWS B;  2OTL V;  4IL6 Z;  3L71 H;  2ITC C;  2F23 A;  5LMN O;  2E5L B;  3TET A;  2E74 B;  4OPA A;  5LMU B;  1NBM G;  1TAE A;  4OPH A;  3SYP A;  3UO2 A;  1FKA O;  2HP8 A;  4BAY A;  4JI6 O;  4X62 B;  3ZRW A;  1GMG A;  4LF7 B;  4GX1 A;  2DJV A;  2QE7 G;  4GCZ A;  1M5I A;  3M8A A;  4LF9 B;  1KD1 W;  1K92 A;  1CXZ B;  4X65 B;  3A0H Z;  4PI0 A;  2Q68 A;  4RQF A;  1UJW B;  2XTA A;  3SYA A;  3ZMT A;  5KX5 A;  3QTC A;  3OTO B;  1NKD A;  1BMF G;  1YVW A;  1N33 B;  4JZG A;  2QKC A;  4JI7 B;  2JS3 A;  3AK1 A;  4JI1 O;  1N32 O;  1NI8 A;  4EKW A;  1HNW O;  1KKD A;  1RM1 B;  3RW0 A;  1VF6 A;  4U3J A;  3PJS K;  5KHK A;  1PPJ H;  5LOV A;  5D5Q A;  2WLN A;  4X1Y A;  4UB8 Z;  3BFR A;  3GVM A;  1I5X A;  3LSU A;  1S3J A;  5H2F Z;  2ZIN A;  4ABM A;  1SQF A;  2RJZ A;  4KXR A;  3J81 N;  2EIN B;  5LL6 Y;  4FMT A;  2YIA A;  4W4K A;  4O4L A;  1QHT A;  3KCX A;  1ARO P;  4JI5 B;  2UUB O;  1FPO A;  2R9R B;  1PNK A;  1OCO B;  3QF7 A;  3ZRW B;  4J9Z B;  2HJF C;  5KA6 A;  2IH3 C;  2M6Y A;  1MNG A;  1FXK C;  1M9N A;  4UUJ C;  2A3Q A;  3CRR A;  1RSO A;  1K9M W;  2QWR B;  4JYC A;  3E89 A;  1ROP A;  1BSM A;  1M57 B;  2E76 B;  5KX5 B;  4DV2 B;  4DV1 O;  5B66 Z;  2NR5 A;  4QGP A;  3O65 A;  2BTQ B;  3C90 A;  3F7V C;  3WG7 C;  3SPG A;  4XDK A;  5IJ9 A;  3JAM N;  3BAA A;  4AIL C;  1V54 B;  5H5N A;  4U3J B;  5L3B A;  3DSQ A;  1DLB A;  2IJJ A;  5JCO C;  1FS0 G;  5LOV B;  3CJH A;  4QJF B;  4JI4 B;  3FYI B;  3OFN G;  2JDI G;  2VWK A;  3JSL A;  2AW9 A;  4QE9 A;  4CZZ A;  3L72 H;  4FLY A;  2Y69 B;  5F2V O;  1HR0 B;  4ZHQ A;  2IH1 C;  3EVK A;  2W6J G;  5KLV H;  4I7Z B;  2UXX A;  2IJI A;  1HNZ O;  4U3F H;  1NVP D;  1Q7Y W;  2WA3 A;  2RDC A;  2XND G;  2JS5 A;  4UCT A;  5EBL C;  1BE3 H;  2HFE C;  3K06 A;  3TK1 A;  3CCV V;  1KYO F;  1FOU A;  2Q7G A;  2YIC A;  4HBN A;  1QVF U;  4PI2 A;  3K9S A;  2XAH A;  5KUK A;  2YXH A;  1K33 A;  1RSO B;  2HEP A;  2FTK A;  3IAY A;  4I50 A;  3TGU H;  2P67 A;  4O4I A;  1NR7 A;  1GM7 A;  1WAZ A;  2Q0A A;  3OEH G;  1H5W A;  4LCU C;  3EFF K;  3J80 N;  3H9V A;  2FB5 A;  4FM0 A;  5JQG B;  3SGI A;  3SYO A;  3OD4 A;  4MVQ A;  1ZUQ A;  3JAW A;  3K5O A;  3HR0 A;  4X64 B;  1H8H G;  1M93 A;  1U96 A;  1VF5 B;  5IJ9 B;  1Q8I A;  2ODM A;  3RN4 A;  5DED A;  2OIG A;  4U7O A;  4CH3 A;  5IWA O;  4ICG A;  3L70 H;  1MOF A;  4YJ3 A;  4JI3 O;  2WLL A;  3JD2 A;  3IJ4 A;  2JEU A;  3CJH B;  1GKF A;  5HFL A;  1V55 C;  5E1A C;  1H8E G;  1I0H A;  1QNM A;  1AR1 B;  2EBO A;  2EIK C;  4RQE A;  3OAA G;  4B3S B;  1BT8 A;  3ML0 A;  2V7Q G;  4DUZ B;  4ZHQ B;  4JI8 B;  4D7S A;  3W7S A;  2KB1 A;  4LH6 A;  1Y6X A;  1DGS A;  3D3Q A;  5CB4 A;  1KC8 W;  2ATK C;  2EIJ B;  1EZV H;  1BHA A;  3AG3 B;  3ZMZ A;  1M56 C;  4PA3 A;  2PGG A;  5C93 A;  4X62 O;  4JAS A;  4NR1 A;  2WA4 A;  2IJK A;  4X9Q A;  1JX9 A;  4I50 B;  4FK5 C;  4O4I B;  5H6Q A;  4I9W A;  3I56 V;  3H1K H;  3CXC U; 
#chains in the Genus database with same CATH homology
 1LUV A;  3BFR A;  2CDY A;  3LSU A;  1B06 A;  1VEW A;  4YIP A;  1PL4 A;  1IXB A;  1IDS A;  3K9S A;  1AR4 A;  2GDS A;  1EN5 A;  3C3T A;  3DC5 A;  2QKA A;  1I08 A;  1XUQ A;  1Y67 A;  3AK3 A;  1AP6 A;  1PM9 A;  1GN2 A;  1XDC A;  5A9G A;  1WB7 A;  4F6E A;  1AP5 A;  1ZUQ A;  1MNG A;  3KKY A;  3IC9 A;  1ZTE A;  3TJT A;  3KDR A;  3RN4 A;  2RCV A;  2ADQ B;  4GUN A;  4C7U A;  1BS3 A;  1BSM A;  2CE4 A;  3CEI A;  3OT7 A;  1KKC A;  1GN6 A;  3C3S A;  1VAR A;  1WB8 A;  1AVM A;  1I0H A;  1QNM A;  1BT8 A;  4FFK A;  3DC6 A;  1XRE A;  2ADP A;  3AK2 A;  1IX9 A;  1SZX A;  1N0N A;  5AG2 A;  1GN3 A;  1XIL A;  4JZ2 A;  1D5N A;  3MDS A;  1EM1 A;  2P4K A;  1AR5 A;  4BR6 A;  1JA8 A;  1LUW A;  1EN4 A;  4JZG A;  1MA1 A;  2QKC A;  2AW9 A;  4X9Q A;  3AK1 A;  1MMM A;  3EVK A;  4JYY A;  4YIO A;  4E4E A;  1ZSP A;  1N0J A;  1P7G A;  1ZLZ A;  1EN6 A;  1MSD A;  1GN4 A;  3QVN A;  1JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...