1WB7A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Tyr41 and His155 in the Functional Properties of Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [FE]
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb7A02
3TJTA 3IC9A 1EN4A 1P7GA 1IXBA 3DC6A 2GDSA 2ADPA 4C7UA 4JZGA 4FFKA 3AK1A 1EN6A 3C3TA 1JR9A 1AR4A 1JA8A 1AP5A 1BSMA 1D5NA 1XDCA 3KKYA 2QKAA 3OT7A 4X9QA 1VEWA 4E4EA 3CEIA 1XUQA 1BT8A 1WB8A 2P4KA 5A9GA 1I08A 4JYYA 1B06A 3EVKA 3C3SA 4JZ2A 1GN3A 1WB7A 1KKCA 1N0NA 3DC5A 1GN6A 2RCVA 4F6EA 1LUWA 1ZUQA 2QKCA 3AK3A 4YIPA 5AG2A 1ZLZA 1IDSA 1PM9A 4YIOA 4GUNA 1MA1A 3K9SA 1AP6A 3LSUA 1XILA 4BR6A 1PL4A 1VARA 2CDYA 3AK2A 1N0JA 2ADQB 1IX9A 1XREA 1QNMA 2CE4A 1I0HA 1LUVA 1BS3A 1EN5A 1GN4A 3QVNA 1MMMA 1MNGA 1GN2A 1Y67A 3RN4A 1ZSPA 1SZXA 1EM1A 1AR5A 2AW9A 3BFRA 1AVMA 1ZTEA 1MSDA 3MDSA
chains in the Genus database with same CATH superfamily
3LSQA 3ASOC 2ZM6B 3K03A 3M8AA 3B2EE 4I0XA 4JGSA 1KBHA 1AJPA 2QTSA 2JGUA 3CXCU 4UCRA 1EN6A 1M9NA 4JI4O 1VQ7V 2IM9A 5FNVB 1OCCB 4G27B 4DV0B 3ZRSA 2WPDG 5KAFZ 1D5NA 4JI2O 3TK1A 1QU7A 2JGDB 1K92A 1VEWA 3SYQA 4DR3O 3CCRV 3N2KB 5CA1B 3T1HO 1ROPA 3GWOA 2GUZA 3FYEB 2YEVB 2GHYA 4EB6B 4J41A 3ICXA 4JZ2A 4LWSA 3K57A 2IJHA 1JJOA 2Q7HA 2UU9O 1N0NA 3CHXA 2GTSA 3ABTA 1VQLV 5K1XA 2EZPA 4CH3A 5IJ9A 3RVYA 2E5LO 4DW0A 5IWAB 1DK1A 2QEXV 4UB6Z 4FLTA 4TV8B 1H38A 4EB6A 4LFAB 4GZRB 1KP2A 1XQ8A 2GUZB 2ZE8A 2WA3A 4HNAB 1L0NH 3JD0A 2M6YA 5B1AC 1XILA 2YIDA 1YZBA 2JVDA 4X88A 1Y4MA 2X7RB 3AG1B 2FB5A 3K06A 3K08A 1GK9A 2DYSC 1IBMB 3JCUZ 4LF9B 1NR1A 2KSDA 4B3RO 1JQ0A 3RYFA 1NI8A 1R1BA 1ZSPA 3SYCA 5ITZA 3SR2C 2AW9A 1Q81W 1HWYA 1S5HC 3JASA 4BW5A 3IFXA 2ZQMA 2YIBD 2W0XA 2IH1C 1M5IA 2GDSA 4U7NA 1OCOB 5LP6B 2AGAA 4C7UA 4D7SA 1VQ5V 1O9GA 1NVPD 3TCUA 1WP8A 2RNBA 3QTCA 1FFXB 5C93A 5KHJA 4ASUG 4UV8A 2VWJA 3C3TA 5JJJB 4K0KO 2ZM6O 2CH7B 5C8YB 4O2BA 3CCVV 3SYOA 4BWAA 2YUAA 2MW2B 2HHHB 1OJHA 4YHHO 3T2MA 3QO8A 1YJNV 4DR6O 3ZMTA 1O9HA 4GKJO 2P22C 2N05A 2ZD9A 4EKWA 4L8JA 3SDLA 4QPKA 2EILC 3CS5A 3ZX6A 2Q67A 3ETGA 3G80A 4F6EA 3N2KA 4UUJC 1R6KA 1TUEB 4CBCA 3ZIAG 3FKSG 2UUCB 2ITDC 4DV4O 3BRCA 5LHIA 3OTOO 5EK0A 3OD4A 4NR1A 2F66C 5CA0A 4DV1B 2V4DA 4UCTA 4DV7B 1YIJV 3CE2A 1P49A 1MABG 1I0HA 4CC5A 1LUVA 4P9PA 4JYCA 3FB7C 4LFCO 1AI6A 1DGSA 3BA8A 5LHHA 4P2ZA 3PJSK 1OCRB 4CC6A 1SKVA 4DUZB 1MSDA 1TGOA 4DUZO 4EEQA 2CGNA 1R73A 1K33A 2Y69C 4Z1VA 4UCOA 3CC4V 3H1KH 2JRIA 4O4HB 5ITZB 4DRXB 4GKJB 3RYFB 4MVOA 2B1IA 2QJ1A 4A5UB 3ZRXA 2ILMA 2V7QG 3OW2U 1SA0B 2JK5C 3UKMA 3OM3B 5LXTA 1XDCA 3D8CA 4U3JB 2HVKC 3NR7A 4DV2O 4D7TA 4B3SB 2A3QA 1QQCA 3T4DA 5EIBD 1I08A 3ETDA 4TWKA 2XTAA 1IBKO 3CRMA 3FFQA 5JWPA 1KECA 1Y74B 1IBLB 3ML0A 5CBGA 2UU9B 4PDLA 3FB5C 3ZHQA 4WFHA 1X59A 2UXNA 1JOYA 4BIZA 1GKFA 4JI5O 5L3CA 2F4VB 3OMIB 2JS5A 3OMAB 2OYQA 3X2QC 1TVKB 3JSNA 1HR0O 4JI0B 1UPGA 3BAAA 4JI2B 2QWRB 4BR6A 5B5EZ 5J2UA 1QNMA 3GWKC 1PP9H 4ABMA 2QWOB 3F7YC 3CRAA 2HFEC 3ASOB 2B1GA 1TVKA 2EINB 3JSLA 1SQFA 5CA0B 4DR4O 3OUSA 4O4JA 4FLYA 1VQPV 1P7BA 1ZTEA 4JI6O 1XMOO 1E1QG 2GTAA 3AG2B 1WPXA 4Q6GA 3W7SA 2CH7A 3ABMB 3ETEA 1M90W 4IL6Z 4WBNA 3CCJV 4B3TO 4I55B 5LYJA 4LP8A 1VQOV 3O65A 4FFKA 2UXDB 1NQTA 4Z2WA 1Y76B 1EZJA 3OE7G 4WFGA 1OV9A 4RUEA 3HKEA 3QO5A 4JYAO 4X89A 3E2EA 1UFIA 1FJGB 1CPYA 1Q8IA 4GX2A 3ABLC 4MVZA 2QKAA 1FD9A 1V55C 3X2QB 1XMQB 1B06A 4DV6B 2DJVA 4NXMB 1V9PA 2Q7GA 4O4IB 4XDKA 4HNAA 4K8XA 2JJ2G 4I5SA 1WB7A 1BMFG 4DR3B 3MD0A 1GN6A 2XNDG 1OHHG 2WLJA 1JJ2U 3OR6C 3SYPA 3TETA 4YIPA 1VP7A 1PM9A 3AG1C 1XNRB 4UCVA 4NB5A 4MVUA 3K9SA 4FPPA 5L3BA 2MK3A 4OX9O 5H6QA 3JASB 4GKKO 3B4SA 5IWAO 2EBOA 1K8AW 3JALA 3N27A 1U97A 4CH4A 4TT3G 3ZHRA 2LO1A 3ZMZA 4ZKIA 3IJ4A 3LDDA 3E86A 4Z1MG 2A06H 2OTJV 2ZDIC 1YTFB 4KHPB 4MW3A 2PYLA 1BZKA 3H1JH 3ZEDA 2UUAB 3JD3A 4IHJB 2IJIA 1N32O 4U3JA 3IC9A 4DO2A 1EN4A 4PELA 5EBLC 1KMIZ 3AG3B 3K9AA 3IAYA 2C2AA 2QWNB 1NTKH 5EC1C 3RYIB 5KX5A 3ZCCA 4QE7A 1RM1B 1HNZB 4H13B 5L3DA 3QNEA 4JAAA 4NYKA 3W7UA 3BVOA 3N2GA 2EIJC 1B04A 3C90A 1GTOA 4I0XB 3NXSA 4B3TB 1XL4A 2LFRA 4DV3O 1FKAO 2BOBC 4DV3B 1VQKV 2XAHA 5LL6Y 3LNNA 3WG7B 1YVWA 3UO3A 2QSAA 5LP6A 2DWEC 3D36A 2AXTZ 2XHBA 2WLIB 4P30A 4I4TB 2ZNJA 3CCSV 2HHHO 4QE9A 2WAMA 2F43G 4PDRA 1SQXH 2EIMC 4LWSB 2AHYA 2A0LA 5HFMA 1VQ6V 4LF4O 2JEUA 3RBZA 2Q4PA 2Y0PA 3WFVA 4LBEC 1MA1A 4GCZA 5IYBO 4ZOLB 4DK0A 4IGGA 4R7CA 3Q4HA 4QNHB 1FXKB 2CDYA 4IIJB 3FD9A 1A32A 2VRZA 4LR3A 1I94O 4YJ2B 2UXBO 2YSUB 5LBQA 5GW7A 1MMMA 3TGUH 4I9WA 3T1YO 4K0KB 4CH6A 1VQMV 4GT1A 2ETNA 4JI3O 1URFA 2F1MA 5LHGA 1Y67A 5GTHZ 1AR1B 2DYRC 5KMGA 3I56V 4CZZA 5KHGA 1H8HG 1FFTB 1AVMA 1FXHA 4O2AB 2BSKB 4FIPC 3SPHA 5KHHA 5B1BB 3M99B 1BQ0A 1G8MA 3JATB 1BHAA 3E22B 4X20B 2P5OA 3CRRA 2EIJB 2ZR3A 5LXTB 2HR3A 1D5AA 3ZHSA 5CA1A 2ITCC 2P67A 3BEHA 1AR4A 4U7OA 3AG2C 1BSMA 3OMNB 1HP8A 3DXRB 2Q73A 4B3RB 4JPRA 1NTMH 2YDEA 1YCIA 3W7XA 1SC5B 2RN9A 4LH7A 4MVSA 4J10A 1W59A 2GSMB 4I50A 3OTFA 5IJ9B 4FLUA 1GM8A 1HNZO 4TV9A 4WCEV 4FFBB 1T5EA 5EBWC 4TSFG 4HBNA 3LSSA 4PI2A 2EX3A 1RP3B 3IC7A 3T1CA 2AZ0A 2WLLA 2W6JG 1NVPB 4PV1B 1EFRG 1K7DA 3CX5F 4JF3A 5EYPB 4EFEA 1ZUQA 2CTPA 4RQEA 2CGOA 2B5UA 4TV9B 1IDSA 2IU3A 1DTOA 4O4JB 1N36B 1J5EO 1N33O 4JI1B 3T4ZA 1N33B 1XREA 3HKDB 3A2FA 1XMQO 2BTQA 3BCCH 5EYPA 4DR2B 5LA6A 3ABUA 1Y74A 4MTOA 1YDXA 2YI9A 1Y76A 2Q9LA 5IE9A 1Z5VA 1TA8A 1DF5A 2G38A 1N32B 3OEHG 4I55A 5LYJB 2WLMA 1VF7A 2W6IG 3G67A 4DV4B 4NXNB 1THZA 1L1FA 4NTYA 5TISZ 4DYLA 5D5PA 2VS0A 3K5LA 3ZJZA 4JZGA 2OCHA 2BE3A 1N34O 3QF7A 4X1IB 4DV5B 1H2GA 1WNSA 3RWRD 3FAVA 5EIBC 4AI8A 4DUYB 2HP8A 3B77A 3OT7A 1F51A 4YJ3A 1RFYA 2VQEO 3JATA 2CTRA 5BMVA 2KG7B 2EIKB 4FM2A 1SA0A 1VIBA 3HPLC 4BIOA 5IT9N 1KP3A 3E8HA 4X1IA 2QTOA 3G4SV 4ZI7B 3CWBH 3D3IA 3BPZA 3DGEA 4RAIA 1V54B 1XNQB 1WN7A 4LC1A 1OZ0A 1MZFA 2P4VA 4JTDB 2KG7A 3AG4C 2UUBB 1F23A 1FXKA 4JI7O 1VQ8V 2A79B 3ZRWA 2Y0IA 1VF6A 4LFAO 4B3SO 2OTLV 4X1KA 2IH3C 4P9OA 5IJ0B 2HJDA 3VQWA 3CRQA 1V54C 3FB8C 3JCZA 5L3EA 4G28B 1G4YB 4CS4A 2BTQB 3KG2A 3AG4B 3L73H 2XASA 4X64O 1XI1A 5J2TB 4GX5A 4O2AA 4K3AA 3W7TA 3UCSC 4JI4B 1W0KG 3CCQV 4O4HA 3AG7A 2HJFC 3ABKC 5BY1A 5C8YA 3P3NA 4DR5B 3L9DA 3K5NA 1IXBA 5B1AB 3G6EV 4LFBB 5J2UB 4ZHQB 3B8NA 1RPRA 4X1KB 1LNQA 2YICA 2ARHA 1YXBA 1PD3A 1CEZA 3H1LH 1VF5B 2KQXA 2QM8A 2Y48A 3UQ8A 3A0BZ 1K3EA 2NLJC 4E4EA 1QVFU 4JYYA 3FYIB 2EILB 1I5XA 1KUQA 4RO2A 4FVMA 3SPGA 1G6UA 2GV9A 1XL6A 1GN3A 2QM4A 2DMXA 2Q7EA 2JJ1G 1HR0B 5FL7G 5H9CA 3APQA 2E74B 4RUFA 4UV9A 1US6A 2LGWA 4PA9A 2LGQA 5CB4B 2QKCA 4W4LA 4IYHA 4FLWA 4JI8O 1WP7A 2M7WA 1YHQV 3ZN1A 4B3MO 3RYHA 5JJEB 1IJGA 3G6BA 1S72V 2DQ3A 5B66Z 1ZL8A 2OCCC 1JPXA 1NT2B 4UCUA 4J9ZB 5LMNO 1WJZA 4LFCB 3ASNC 3UT5A 1AR5A 2XAJA 5JQGB 5JVDA 2ATKC 1W2BU 2RDCA 4ZIBA 3CP1A 1K73W 5IYCO 3BY6A 5BR8O 5FLXN 1P7GA 4QGPA 1FJGO 1I5YA 2H8PC 4FFBA 1KC8W 2YIAA 4X66B 4RQFA 4N21A 3LNMB 2YS8A 3HR0A 1TUBA 4AHCA 4DR1B 1S77D 3CCUV 3OGIB 3RYCB 5IYDO 1COWG 3QO7A 5BXZA 3E83A 1H2SB 1XUQA 5LMUB 1WB8A 4MS2A 3FX7A 5JVDB 1ZWIC 4OXSA 2EJ7A 1TAEA 2HG5C 1NKDA 3H01A 1YSCA 1FYJA 3N2GB 1BHBA 3CJHA 5GTIZ 2Y4UA 3K59A 2UUCO 3STLC 3CXHF 3SPCA 3OTOB 1SRYA 4YXWG 3E35A 4X65B 3K58A 1FXVA 4R6ZA 3CPWU 4MTGA 3ZRVA 3TXSA 1R3KC 4WFFA 1HNWO 2OCCB 5DEDA 2YXYA 1SS3A 5AG2A 2ZE5A 3SPJA 5KHKA 5CB4A 1AI4A 1X4TA 1PV0A 3R66A 2ZXWC 1YTFD 1EBOA 4NTXA 2CE4A 4FM1A 1PNKA 2L35A 3BA9A 3L71H 3QVNA 1PNLA 1Q82W 1OCCC 2E75B 1N36O 3F5WC 4I4TA 1IXMA 2DW4A 3E8GA 4XDLA 5E1AC 5L3FA 4E2LA 3JD4A 1F4NA 4KXRA 4QPJA 2F95B 2PGGA 4UVCA 4DV0O 2UXCB 3CB2A 4ZBMA 5FNVA 1OCZC 1M93A 3CD6V 4FZ0A 1VQ9V 4LF7O 4O4LA 2IJKA 4XBFA 1K5SA 4TQFA 5KX5B 5BMVB 4LFBO 4UFZA 3K04A 4BIUA 5LGUA 3D3QA 2PI4A 1OCOC 5LP6C 3GB7C 2YC0A 3IGAC 2UXBB 2P7TC 2Z0AA 1G1XB 4X1YA 1R3LC 1JR9A 2N74A 1JA8A 4UCSA 2ZIOA 2BOCC 2DWDC 4J7ZA 2CTQA 5DECA 4JI3B 2V1DA 2PI5A 3BABA 1BT8A 3EHBB 1FPOA 5A9GA 4DR6B 5LOVA 4IYIA 4JYBA 3ZN0A 4DR2O 4OPHA 3B09A 2QA4V 3U10A 2QM7A 2XAFA 3CJHB 1YITV 5CBFA 2WWWA 1Q5OA 4UVAA 4WFBV 2Z5UA 5KUMA 1IVSA 4H33A 4CS2A 1FS0G 4GX0A 1AI5A 1LUWA 1F4MA 1QCEA 5H5NA 2F23A 2XT9A 4YJ3B 2X6BA 4J42A 3APOA 4B08A 1QLNA 3KCYA 1IBKB 4JV5O 3FAVB 4N23A 3ZHUA 2KB1A 2HKOA 1W0JG 1PL4A 1VARA 3H1IH 1P4RA 2ADQB 2QDOA 3ZHVA 1XMOB 1HNWB 4PJ0Z 4LF5B 2P6JA 4AQYB 1NS1A 4DV5O 4PA4A 1BCCH 1VQ4V 2F4VO 2VQFO 1QR8A 1JX9A 2R9RB 1QHTA 2A7WA 2VQEB 2UXDO 1SERA 1YJWV 1XEQA 3CCLV 5BR8B 1NR7A 3ABMC 1Q6IA 5FPRA 4BAYA 3U11A 2WA4A 4YY3B 2RQ6A 2H94A 1YEWA 3S3XA 4YY3O 1NH2D 1XOUA 2WLKA 5CA3A 1KD1W 2UXCO 4MW8A 1YI2V 2Y4TA 1R6NA 2FMLA 2IBZH 4LH6A 3B8MA 2OIGA 1AILA 2YXHA 2KKWA 3D36C 5IYZA 3KZIZ 1AJNA 3ZHTA 2OIEA 4DXWA 5A2QN 5JJNB 4JV5B 3JARA 4UB8Z 3CSXA 3THOA 1XBLA 3JD2A 1SETA 1XHZA 3L72H 3TXQA 5CMUA 4RWUA 2R72A 3OGCC 4JI5B 2FYUH 3P3PA 5LOVB 2Q68A 1NH2B 1FXKC 3SJQC 1VQNV 4DR5O 1ZLZA 2YEVA 1NU1H 4TUYB 4DV6O 4GUNA 2P90A 1S3JA 1FAFA 3JAWA 1D2DA 2AHZA 4CH5A 4WFEA 1CXZB 4B7EA 2YI8A 4TV8A 4X62B 3K5OA 2FTKA 2ZR2A 1GN4A 2YIBA 4O4IA 4MVQA 3K3WA 3DXRA 3RN4A 2EINC 1XNQO 3P30A 3ZBHA 1XNRO 4DV7O 5B1BC 3I55V 2O57A 1KB9F 2R70A 4I50B 4MSWC 2IW5A 4X1YB 3UM7A 3OR7C 4JASA 4JI6B 2E5LB 1DLBA 2GBOA 1K97A 1JNBA 1Q6HA 2Y69B 4KFMA 3JAKA 1BE3H 5EBMC 2OWOA 1H2NA 2PUSA 5KUKA 4R8CA 1MOFA 3HKBB 1Q90D 2X0LA 1IBLO 5IJ0A 1Q6UA 3CYOA 2ZKOA 3B40A 4J7KA 1Z5WA 4JYAB 3CRCA 2JEXA 5KAIZ 1ZX3A 3GVMA 4UXNA 4YHHB 2CUGA 3MAQA 1JMKC 4B3MB 2XOKG 3A8TA 4G2KA 4JI0O 3HKDA 3SJBC 2EIKC 3G71V 2Q0AA 3SJAC 1N8RW 4LF6B 1AROP 2JGDA 1KYOF 2E3CA 4X62O 2RCVA 3RYCA 1SQPH 3ZMUA 4PDMA 3AK3A 2CK3G 4AILC 5GONB 2L6LA 1KQSU 1WAZA 3S3WA 5IDJA 1R3IC 4GX1A 4L87A 5LA6B 3LSUA 1K4CC 1I7FA 4X64B 4FZ1A 3K79A 3MHSC 5B3SB 1BS3A 3JAMN 5J9PC 4DR7B 1H2MA 1K34A 2WLIA 1Q86W 5F2VO 1B6QA 2R9IA 5KHIA 1MNGA 5KLVH 4IIJA 2OT5A 4FJCC 2QWPB 1SZXA 2P06A 2UXXA 2PTMA 3FB6C 1HW7A 1E1RG 1IURA 1RPOA 1NTZH 4TOIA 2ZT9B 4UVBA 1DF4A 4KL1A 4LNUA 2Q5ZA 5LMUO 1BQZA 1PL0A 2Z3YA 3UT5B 4GLXA 5IY5B 2EULA 1RSOB 1OCRC 5DN6G 1GAXA 2JS3A 4FM0A 1M56C 1HNXB 1ZL8B 4OPAA 1JVMA 3T1YB 4DR4B 2BSKA 4PI0A 4H0LB 1NBMG 2YXLA 4NKGB 1PKXA 1Q7YW 2CAZC 2LJ2A 1AP5A 1K9MW 1CP9A 2RMKB 2ZE6A 4AQYO 1HDJA 2Q69A 2BCCH 1L8DA 3CMAV 4DV2B 1WLEA 3HKBA 4JTCB 3STZC 4FLZA 4LNUB 1KKDA 1S5LZ 3CEIA 2XUMA 1QLEC 2DOSA 4TUYA 1FOUA 1B3QA 3CMEV 2XAGA 3P32A 2FKXA 3BHPA 4F4LA 1TUBB 4JI8B 4PDVA 3E22A 2LQTA 4X20A 1Z2GA 2HVJC 4H37A 2ODMA 4X66O 4JI1O 3JALB 2D2CB 1S5JA 2NN4A 5JCOA 1GM7A 3UO2A 4CS3A 1AJQA 1QBZA 4FMTA 1WA8A 4LF4B 4PD4F 3K0GA 4PA3A 3E89A 2QE7G 4XDJA 1GMGA 2AZ2A 2UUAO 1L0LH 1BL8A 2LW1A 3JYCA 4OGQB 2NNUA 4WF9V 1H8EG 2F93B 5LGTA 5FPOA 4HAMA 1SQVH 1GN2A 1MSWD 1UJWB 4ZI7A 2Q8VA 2ZIMA 2B9ZA 4HYOA 2R9AA 1JFFB 3JD1A 4LF8O 5H2FZ 1K4DC 3WB2A 4LF8B 4O2BB 4DR7O 2LP7A 3WB1A 1GM9A 5IYZB 5L3GA 2E76B 4PHZA 3LUTB 4KHPO 3W7WA 1AI7A 1RM1C 4WBNB 1IZ3A 3R65A 1BGYH 3T1HB 3J81N 1SQQH 4J9YB 5B1NA 1Y66A 5E79Z 1S0VA 5LGNA 2ZNIA 2H3OA 3L75H 1RSOA 3AEIA 4GYCB 5J2TA 2NR5A 1AB3A 4FLXA 2P4KA 3RFRA 3RYHB 1Q43A 3C3SA 3WU2Z 1SQBH 4LF5O 5LMNB 4MT8A 1M57B 3ZMSA 1KKCA 2XAQA 3U0ZA 2X6AA 4EFBA 5KA6A 3DTUB 3M7MX 4DUYO 1GO3F 4ZOLA 3JAWB 1QLEB 3MHHC 5JQGA 4B7KA 1Q3EA 3HB3B 5JCOC 2PY5A 4PA7A 1WA8B 2WLNA 2PF4E 2DQ0A 4F6RB 1QR9A 3F7VC 1SZTA 3F5TA 4WFAV 4NXMO 3JARB 1M1KW 1VMGA 3KCXA 2JDIG 2EZOA 3SPIA 1R6TA 3HKCA 2X6CA 1NZ6A 1EM1A 1K5QA 3BFRA 3ZRWB 1VF6C 2Q6AA 1J95A 3MDSA 3TJTA 3L74H 4JTAB 3WG7C 1S76D 4HZ3A 4MTFA 2D3OW 5D5QA 2ZCEA 3OFNG 2PZSA 4KP4A 4W4KA 1LR1A 4DV1O 3OEEG 5EZYA 1KU9A 2LFSA 3AK1A 1N34B 3ZMVA 4JAVA 4MTXA 2EJRA 3AG3C 5KA5A 2K1EA 2ZINA 5H6RA 5JH7A 2ZDIA 2WLLB 5BZBA 5K1PA 1F7YA 2W0FC 3KKYA 3CCMV 4IHJA 1H5WA 3JAKB 3VOUA 1OCZB 3OAAG 1IBMO 3RGBA 1J5EB 1V55B 5JH7B 3PN1A 4NTWA 3CC2V 2ZE7A 4QJFB 4R50A 3SJCC 1M4UA 1E79G 5CN0A 4X65O 1JCHA 4LF7B 2ZXWB 2UUBO 2PYJA 2DN9A 4YIOA 1YF2A 1H2KA 4JI7B 2VQFB 4DW1A 1R3JC 4J80A 3RW0A 3EXAA 1N0JA 3H1HH 1IX9A 4O4LB 1PNMA 1SQGA 3LDEA 3A0HZ 1ZAUA 2CTWA 1PPJH 4I9QA 5B1OA 4DRXA 1YJ9V 4ICGA 4LF9O 4JAUA 3SYAA 3J80N 3ABLB 1Y6XA 5CBHA 2DYSB 2QR4A 4F6RA 3ABKB 1M56B 2DE0X 1H2LA 1NJIW 4X8AA 4J7JA 3E8BA 5KMGB 4H44B 1QVGU 3LDCA 3QG5A 3Q4HB 1GRJA 3WB0A 5DM6V 2JIZG 4FLVA 3DC6A 3HKEB 3SGIA 4LF6O 1U96A 2ADPA 3J7AU 1SF9A 4IT5A 3HKCB 3DSQA 4TQDA 3EFFK 2EIMB 4NXNO 3ETQA 1MG1A 1EZVH 4MVMA 3I5DA 1WPBA 5EZYB 3CCEV 2HEPA 2BTOA 5HFLA 4FK5C 2A9HA 1HNXO 4I7ZB 4X9QA 1GH6A 3K0DA 4GKKB 1XHXA 3RT3C 4PA6A 4OX9B 4KUMA 4LCUC 3EVKA 4DR1O 2QWQB 3E8FA 2HLDG 2IJJA 2WSSG 2DYRB 3DC5A 4U3FH 5B3SC 1ORQC 3O9OA 3OUFA 4MVRA 1MZEA 3A0RA 2QGNA 2QKSA 2K9PA 4D6TH 4BW9A 2WLHA 3VQXA 2N04A 3RVZA 3CC7V 2VWKA 2IU0A 4J11A 2Q0OC 3VBBA 1AP6A 1SESA 3K5MA 2RJZA 4DK1A 4K8ZA 1JFFA 3VQYA 3VQVA 4NVPA 3AK2A 5GONA 3KDRA 4K35A 1N4CA 1EN5A 4QIWF 3RYIA 1ENVA 1P84F 1M57C 3H9VA 4YJ2A 4ZHQA 3ASNB 1FFXA 3L70H 2LW7A 5IY5C 3ZS8C 4Q20A 1I94B 2FL4A 5EC2C
chains in the Genus database with same CATH topology
3TJTA 3IC9A 1EN4A 1P7GA 1IXBA 3DC6A 2GDSA 2ADPA 4C7UA 4JZGA 4FFKA 3AK1A 1EN6A 3C3TA 1JR9A 1AR4A 1JA8A 1AP5A 1BSMA 1D5NA 1XDCA 3KKYA 2QKAA 3OT7A 4X9QA 1VEWA 4E4EA 3CEIA 1XUQA 1BT8A 1WB8A 2P4KA 5A9GA 1I08A 4JYYA 1B06A 3EVKA 3C3SA 4JZ2A 1GN3A 1WB7A 1KKCA 1N0NA 3DC5A 1GN6A 2RCVA 4F6EA 1LUWA 1ZUQA 2QKCA 3AK3A 4YIPA 5AG2A 1ZLZA 1IDSA 1PM9A 4YIOA 4GUNA 1MA1A 3K9SA 1AP6A 3LSUA 1XILA 4BR6A 1PL4A 1VARA 2CDYA 3AK2A 1N0JA 2ADQB 1IX9A 1XREA 3KDRA 1QNMA 2CE4A 1I0HA 1LUVA 1BS3A 1EN5A 1GN4A 3QVNA 1MMMA 1MNGA 1GN2A 1Y67A 3RN4A 1ZSPA 1SZXA 1EM1A 1AR5A 2AW9A 3BFRA 1AVMA 1ZTEA 1MSDA 3MDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJT A;  3IC9 A;  1EN4 A;  1P7G A;  1IXB A;  3DC6 A;  2GDS A;  2ADP A;  4C7U A;  4JZG A;  4FFK A;  3AK1 A;  1EN6 A;  3C3T A;  1JR9 A;  1AR4 A;  1JA8 A;  1AP5 A;  1BSM A;  1D5N A;  1XDC A;  3KKY A;  2QKA A;  3OT7 A;  4X9Q A;  1VEW A;  4E4E A;  3CEI A;  1XUQ A;  1BT8 A;  1WB8 A;  2P4K A;  5A9G A;  1I08 A;  4JYY A;  1B06 A;  3EVK A;  3C3S A;  4JZ2 A;  1GN3 A;  1WB7 A;  1KKC A;  1N0N A;  3DC5 A;  1GN6 A;  2RCV A;  4F6E A;  1LUW A;  1ZUQ A;  2QKC A;  3AK3 A;  4YIP A;  5AG2 A;  1ZLZ A;  1IDS A;  1PM9 A;  4YIO A;  4GUN A;  1MA1 A;  3K9S A;  1AP6 A;  3LSU A;  1XIL A;  4BR6 A;  1PL4 A;  1VAR A;  2CDY A;  3AK2 A;  1N0J A;  2ADQ B;  1IX9 A;  1XRE A;  1QNM A;  2CE4 A;  1I0H A;  1LUV A;  1BS3 A;  1EN5 A;  1GN4 A;  3QVN A;  1MMM A;  1MNG A;  1GN2 A;  1Y67 A;  3RN4 A;  1ZSP A;  1SZX A;  1EM1 A;  1AR5 A;  2AW9 A;  3BFR A;  1AVM A;  1ZTE A;  1MSD A;  3MDS A; 
#chains in the Genus database with same CATH topology
 3LSQ A;  3ASO C;  2ZM6 B;  3K03 A;  3M8A A;  3B2E E;  4I0X A;  4JGS A;  1KBH A;  1AJP A;  2QTS A;  2JGU A;  3CXC U;  4UCR A;  1EN6 A;  1M9N A;  4JI4 O;  1VQ7 V;  2IM9 A;  5FNV B;  1OCC B;  4G27 B;  4DV0 B;  3ZRS A;  2WPD G;  5KAF Z;  1D5N A;  4JI2 O;  3TK1 A;  1QU7 A;  2JGD B;  1K92 A;  1VEW A;  3SYQ A;  4DR3 O;  3CCR V;  3N2K B;  5CA1 B;  3T1H O;  1ROP A;  3GWO A;  2GUZ A;  3FYE B;  2YEV B;  2GHY A;  4EB6 B;  4J41 A;  3ICX A;  4JZ2 A;  4LWS A;  3K57 A;  2IJH A;  1JJO A;  2Q7H A;  2UU9 O;  1N0N A;  3CHX A;  2GTS A;  3ABT A;  1VQL V;  5K1X A;  2EZP A;  4CH3 A;  5IJ9 A;  3RVY A;  2E5L O;  4DW0 A;  5IWA B;  1DK1 A;  2QEX V;  4UB6 Z;  4FLT A;  4TV8 B;  1H38 A;  4EB6 A;  4LFA B;  4GZR B;  1KP2 A;  1XQ8 A;  2GUZ B;  2ZE8 A;  2WA3 A;  4HNA B;  1L0N H;  3JD0 A;  2M6Y A;  5B1A C;  1XIL A;  2YID A;  1YZB A;  2JVD A;  4X88 A;  1Y4M A;  2X7R B;  3AG1 B;  2FB5 A;  3K06 A;  3K08 A;  1GK9 A;  2DYS C;  1IBM B;  3JCU Z;  4LF9 B;  1NR1 A;  2KSD A;  4B3R O;  1JQ0 A;  3RYF A;  1NI8 A;  1R1B A;  1ZSP A;  3SYC A;  5ITZ A;  3SR2 C;  2AW9 A;  1Q81 W;  1HWY A;  1S5H C;  3JAS A;  4BW5 A;  3IFX A;  2ZQM A;  2YIB D;  2W0X A;  2IH1 C;  1M5I A;  2GDS A;  4U7N A;  1OCO B;  5LP6 B;  2AGA A;  4C7U A;  4D7S A;  1VQ5 V;  1O9G A;  1NVP D;  3TCU A;  1WP8 A;  2RNB A;  3QTC A;  1FFX B;  5C93 A;  5KHJ A;  4ASU G;  4UV8 A;  2VWJ A;  3C3T A;  5JJJ B;  4K0K O;  2ZM6 O;  2CH7 B;  5C8Y B;  4O2B A;  3CCV V;  3SYO A;  4BWA A;  2YUA A;  2MW2 B;  2HHH B;  1OJH A;  4YHH O;  3T2M A;  3QO8 A;  1YJN V;  4DR6 O;  3ZMT A;  1O9H A;  4GKJ O;  2P22 C;  2N05 A;  2ZD9 A;  4EKW A;  4L8J A;  3SDL A;  4QPK A;  2EIL C;  3CS5 A;  3ZX6 A;  2Q67 A;  3ETG A;  3G80 A;  4F6E A;  3N2K A;  4UUJ C;  1R6K A;  1TUE B;  4CBC A;  3ZIA G;  3FKS G;  2UUC B;  2ITD C;  4DV4 O;  3BRC A;  5LHI A;  3OTO O;  5EK0 A;  3OD4 A;  4NR1 A;  2F66 C;  5CA0 A;  4DV1 B;  2V4D A;  4UCT A;  4DV7 B;  1YIJ V;  3CE2 A;  1P49 A;  1MAB G;  1I0H A;  4CC5 A;  1LUV A;  4P9P A;  4JYC A;  3FB7 C;  4LFC O;  1AI6 A;  1DGS A;  3BA8 A;  5LHH A;  4P2Z A;  3PJS K;  1OCR B;  4CC6 A;  1SKV A;  4DUZ B;  1MSD A;  1TGO A;  4DUZ O;  4EEQ A;  2CGN A;  1R73 A;  1K33 A;  2Y69 C;  4Z1V A;  4UCO A;  3CC4 V;  3H1K H;  2JRI A;  4O4H B;  5ITZ B;  4DRX B;  4GKJ B;  3RYF B;  4MVO A;  2B1I A;  2QJ1 A;  4A5U B;  3ZRX A;  2ILM A;  2V7Q G;  3OW2 U;  1SA0 B;  2JK5 C;  3UKM A;  3OM3 B;  5LXT A;  1XDC A;  3D8C A;  4U3J B;  2HVK C;  3NR7 A;  4DV2 O;  4D7T A;  4B3S B;  2A3Q A;  1QQC A;  3T4D A;  5EIB D;  1I08 A;  3ETD A;  4TWK A;  2XTA A;  1IBK O;  3CRM A;  3FFQ A;  5JWP A;  1KEC A;  1Y74 B;  1IBL B;  3ML0 A;  5CBG A;  2UU9 B;  4PDL A;  3FB5 C;  3ZHQ A;  4WFH A;  1X59 A;  2UXN A;  1JOY A;  4BIZ A;  1GKF A;  4JI5 O;  5L3C A;  2F4V B;  3OMI B;  2JS5 A;  3OMA B;  2OYQ A;  3X2Q C;  1TVK B;  3JSN A;  1HR0 O;  4JI0 B;  1UPG A;  3BAA A;  4JI2 B;  2QWR B;  4BR6 A;  5B5E Z;  5J2U A;  1QNM A;  3GWK C;  1PP9 H;  4ABM A;  2QWO B;  3F7Y C;  3CRA A;  2HFE C;  3ASO B;  2B1G A;  1TVK A;  2EIN B;  3JSL A;  1SQF A;  5CA0 B;  4DR4 O;  3OUS A;  4O4J A;  4FLY A;  1VQP V;  1P7B A;  1ZTE A;  4JI6 O;  1XMO O;  1E1Q G;  2GTA A;  3AG2 B;  1WPX A;  4Q6G A;  3W7S A;  2CH7 A;  3ABM B;  3ETE A;  1M90 W;  4IL6 Z;  4WBN A;  3CCJ V;  4B3T O;  4I55 B;  5LYJ A;  4LP8 A;  1VQO V;  3O65 A;  4FFK A;  2UXD B;  1NQT A;  4Z2W A;  1Y76 B;  1EZJ A;  3OE7 G;  4WFG A;  1OV9 A;  4RUE A;  3HKE A;  3QO5 A;  4JYA O;  4X89 A;  3E2E A;  1UFI A;  1FJG B;  1CPY A;  1Q8I A;  4GX2 A;  3ABL C;  4MVZ A;  2QKA A;  1FD9 A;  1V55 C;  3X2Q B;  1XMQ B;  1B06 A;  4DV6 B;  2DJV A;  4NXM B;  1V9P A;  2Q7G A;  4O4I B;  4XDK A;  4HNA A;  4K8X A;  2JJ2 G;  4I5S A;  1WB7 A;  1BMF G;  4DR3 B;  3MD0 A;  1GN6 A;  2XND G;  1OHH G;  2WLJ A;  1JJ2 U;  3OR6 C;  3SYP A;  3TET A;  4YIP A;  1VP7 A;  1PM9 A;  3AG1 C;  1XNR B;  4UCV A;  4NB5 A;  4MVU A;  3K9S A;  4FPP A;  5L3B A;  2MK3 A;  4OX9 O;  5H6Q A;  3JAS B;  4GKK O;  3B4S A;  5IWA O;  2EBO A;  1K8A W;  3JAL A;  3N27 A;  1U97 A;  4CH4 A;  4TT3 G;  3ZHR A;  2LO1 A;  3ZMZ A;  4ZKI A;  3IJ4 A;  3LDD A;  3E86 A;  4Z1M G;  2A06 H;  2OTJ V;  2ZDI C;  1YTF B;  4KHP B;  4MW3 A;  2PYL A;  1BZK A;  3H1J H;  3ZED A;  2UUA B;  3JD3 A;  4IHJ B;  2IJI A;  1N32 O;  4U3J A;  3IC9 A;  4DO2 A;  1EN4 A;  4PEL A;  5EBL C;  1KMI Z;  3AG3 B;  3K9A A;  3IAY A;  2C2A A;  2QWN B;  1NTK H;  5EC1 C;  3RYI B;  5KX5 A;  3ZCC A;  4QE7 A;  1RM1 B;  1HNZ B;  4H13 B;  5L3D A;  3QNE A;  4JAA A;  4NYK A;  3W7U A;  3BVO A;  3N2G A;  2EIJ C;  1B04 A;  3C90 A;  1GTO A;  4I0X B;  3NXS A;  4B3T B;  1XL4 A;  2LFR A;  4DV3 O;  1FKA O;  2BOB C;  4DV3 B;  1VQK V;  2XAH A;  5LL6 Y;  3LNN A;  3WG7 B;  1YVW A;  3UO3 A;  2QSA A;  5LP6 A;  2DWE C;  3D36 A;  2AXT Z;  2XHB A;  2WLI B;  4P30 A;  4I4T B;  2ZNJ A;  3CCS V;  2HHH O;  4QE9 A;  2WAM A;  2F43 G;  4PDR A;  1SQX H;  2EIM C;  4LWS B;  2AHY A;  2A0L A;  5HFM A;  1VQ6 V;  4LF4 O;  2JEU A;  3RBZ A;  2Q4P A;  2Y0P A;  3WFV A;  4LBE C;  1MA1 A;  4GCZ A;  5IYB O;  4ZOL B;  4DK0 A;  4IGG A;  4R7C A;  3Q4H A;  4QNH B;  1FXK B;  2CDY A;  4IIJ B;  3FD9 A;  1A32 A;  2VRZ A;  4LR3 A;  1I94 O;  4YJ2 B;  2UXB O;  2YSU B;  5LBQ A;  5GW7 A;  1MMM A;  3TGU H;  4I9W A;  3T1Y O;  4K0K B;  4CH6 A;  1VQM V;  4GT1 A;  2ETN A;  4JI3 O;  1URF A;  2F1M A;  5LHG A;  1Y67 A;  5GTH Z;  1AR1 B;  2DYR C;  5KMG A;  3I56 V;  4CZZ A;  5KHG A;  1H8H G;  1FFT B;  1AVM A;  1FXH A;  4O2A B;  2BSK B;  4FIP C;  3SPH A;  5KHH A;  5B1B B;  3M99 B;  1BQ0 A;  1G8M A;  3JAT B;  1BHA A;  3E22 B;  4X20 B;  2P5O A;  3CRR A;  2EIJ B;  2ZR3 A;  5LXT B;  2HR3 A;  1D5A A;  3ZHS A;  5CA1 A;  2ITC C;  2P67 A;  3BEH A;  1AR4 A;  4U7O A;  3AG2 C;  1BSM A;  3OMN B;  1HP8 A;  3DXR B;  2Q73 A;  4B3R B;  4JPR A;  1NTM H;  2YDE A;  1YCI A;  3W7X A;  1SC5 B;  2RN9 A;  4LH7 A;  4MVS A;  4J10 A;  1W59 A;  2GSM B;  4I50 A;  3OTF A;  5IJ9 B;  4FLU A;  1GM8 A;  1HNZ O;  4TV9 A;  4WCE V;  4FFB B;  1T5E A;  5EBW C;  4TSF G;  4HBN A;  3LSS A;  4PI2 A;  2EX3 A;  1RP3 B;  3IC7 A;  3T1C A;  2AZ0 A;  2WLL A;  2W6J G;  1NVP B;  4PV1 B;  1EFR G;  1K7D A;  3CX5 F;  4JF3 A;  5EYP B;  4EFE A;  1ZUQ A;  2CTP A;  4RQE A;  2CGO A;  2B5U A;  4TV9 B;  1IDS A;  2IU3 A;  1DTO A;  4O4J B;  1N36 B;  1J5E O;  1N33 O;  4JI1 B;  3T4Z A;  1N33 B;  1XRE A;  3HKD B;  3A2F A;  1XMQ O;  2BTQ A;  3BCC H;  5EYP A;  4DR2 B;  5LA6 A;  3ABU A;  1Y74 A;  4MTO A;  1YDX A;  2YI9 A;  1Y76 A;  2Q9L A;  5IE9 A;  1Z5V A;  1TA8 A;  1DF5 A;  2G38 A;  1N32 B;  3OEH G;  4I55 A;  5LYJ B;  2WLM A;  1VF7 A;  2W6I G;  3G67 A;  4DV4 B;  4NXN B;  1THZ A;  1L1F A;  4NTY A;  5TIS Z;  4DYL A;  5D5P A;  2VS0 A;  3K5L A;  3ZJZ A;  4JZG A;  2OCH A;  2BE3 A;  1N34 O;  3QF7 A;  4X1I B;  4DV5 B;  1H2G A;  1WNS A;  3RWR D;  3FAV A;  5EIB C;  4AI8 A;  4DUY B;  2HP8 A;  3B77 A;  3OT7 A;  1F51 A;  4YJ3 A;  1RFY A;  2VQE O;  3JAT A;  2CTR A;  5BMV A;  2KG7 B;  2EIK B;  4FM2 A;  1SA0 A;  1VIB A;  3HPL C;  4BIO A;  5IT9 N;  1KP3 A;  3E8H A;  4X1I A;  2QTO A;  3G4S V;  4ZI7 B;  3CWB H;  3D3I A;  3BPZ A;  3DGE A;  4RAI A;  1V54 B;  1XNQ B;  1WN7 A;  4LC1 A;  1OZ0 A;  1MZF A;  2P4V A;  4JTD B;  2KG7 A;  3AG4 C;  2UUB B;  1F23 A;  1FXK A;  4JI7 O;  1VQ8 V;  2A79 B;  3ZRW A;  2Y0I A;  1VF6 A;  4LFA O;  4B3S O;  2OTL V;  4X1K A;  2IH3 C;  4P9O A;  5IJ0 B;  2HJD A;  3VQW A;  3CRQ A;  1V54 C;  3FB8 C;  3JCZ A;  5L3E A;  4G28 B;  1G4Y B;  4CS4 A;  2BTQ B;  3KG2 A;  3AG4 B;  3L73 H;  2XAS A;  4X64 O;  1XI1 A;  5J2T B;  4GX5 A;  4O2A A;  4K3A A;  3W7T A;  3UCS C;  4JI4 B;  1W0K G;  3CCQ V;  4O4H A;  3AG7 A;  2HJF C;  3ABK C;  5BY1 A;  5C8Y A;  3P3N A;  4DR5 B;  3L9D A;  3K5N A;  1IXB A;  5B1A B;  3G6E V;  4LFB B;  5J2U B;  4ZHQ B;  3B8N A;  1RPR A;  4X1K B;  1LNQ A;  2YIC A;  2ARH A;  1YXB A;  1PD3 A;  1CEZ A;  3H1L H;  1VF5 B;  2KQX A;  2QM8 A;  2Y48 A;  3UQ8 A;  3A0B Z;  1K3E A;  2NLJ C;  4E4E A;  1QVF U;  4JYY A;  3FYI B;  2EIL B;  1I5X A;  1KUQ A;  4RO2 A;  4FVM A;  3SPG A;  1G6U A;  2GV9 A;  1XL6 A;  1GN3 A;  2QM4 A;  2DMX A;  2Q7E A;  2JJ1 G;  1HR0 B;  5FL7 G;  5H9C A;  3APQ A;  2E74 B;  4RUF A;  4UV9 A;  1US6 A;  2LGW A;  4PA9 A;  2LGQ A;  5CB4 B;  2QKC A;  4W4L A;  4IYH A;  4FLW A;  4JI8 O;  1WP7 A;  2M7W A;  1YHQ V;  3ZN1 A;  4B3M O;  3RYH A;  5JJE B;  1IJG A;  3G6B A;  1S72 V;  2DQ3 A;  5B66 Z;  1ZL8 A;  2OCC C;  1JPX A;  1NT2 B;  4UCU A;  4J9Z B;  5LMN O;  1WJZ A;  4LFC B;  3ASN C;  3UT5 A;  1AR5 A;  2XAJ A;  5JQG B;  5JVD A;  2ATK C;  1W2B U;  2RDC A;  4ZIB A;  3CP1 A;  1K73 W;  5IYC O;  3BY6 A;  5BR8 O;  5FLX N;  1P7G A;  4QGP A;  1FJG O;  1I5Y A;  2H8P C;  4FFB A;  1KC8 W;  2YIA A;  4X66 B;  4RQF A;  4N21 A;  3LNM B;  2YS8 A;  3HR0 A;  1TUB A;  4AHC A;  4DR1 B;  1S77 D;  3CCU V;  3OGI B;  3RYC B;  5IYD O;  1COW G;  3QO7 A;  5BXZ A;  3E83 A;  1H2S B;  1XUQ A;  5LMU B;  1WB8 A;  4MS2 A;  3FX7 A;  5JVD B;  1ZWI C;  4OXS A;  2EJ7 A;  1TAE A;  2HG5 C;  1NKD A;  3H01 A;  1YSC A;  1FYJ A;  3N2G B;  1BHB A;  3CJH A;  5GTI Z;  2Y4U A;  3K59 A;  2UUC O;  3STL C;  3CXH F;  3SPC A;  3OTO B;  1SRY A;  4YXW G;  3E35 A;  4X65 B;  3K58 A;  1FXV A;  4R6Z A;  3CPW U;  4MTG A;  3ZRV A;  3TXS A;  1R3K C;  4WFF A;  1HNW O;  2OCC B;  5DED A;  2YXY A;  1SS3 A;  5AG2 A;  2ZE5 A;  3SPJ A;  5KHK A;  5CB4 A;  1AI4 A;  1X4T A;  1PV0 A;  3R66 A;  2ZXW C;  1YTF D;  1EBO A;  4NTX A;  2CE4 A;  4FM1 A;  1PNK A;  2L35 A;  3BA9 A;  3L71 H;  3QVN A;  1PNL A;  1Q82 W;  1OCC C;  2E75 B;  1N36 O;  3F5W C;  4I4T A;  1IXM A;  2DW4 A;  3E8G A;  4XDL A;  5E1A C;  5L3F A;  4E2L A;  3JD4 A;  1F4N A;  4KXR A;  4QPJ A;  2F95 B;  2PGG A;  4UVC A;  4DV0 O;  2UXC B;  3CB2 A;  4ZBM A;  5FNV A;  1OCZ C;  1M93 A;  3CD6 V;  4FZ0 A;  1VQ9 V;  4LF7 O;  4O4L A;  2IJK A;  4XBF A;  1K5S A;  4TQF A;  5KX5 B;  5BMV B;  4LFB O;  4UFZ A;  3K04 A;  4BIU A;  5LGU A;  3D3Q A;  2PI4 A;  1OCO C;  5LP6 C;  3GB7 C;  2YC0 A;  3IGA C;  2UXB B;  2P7T C;  2Z0A A;  1G1X B;  4X1Y A;  1R3L C;  1JR9 A;  2N74 A;  1JA8 A;  4UCS A;  2ZIO A;  2BOC C;  2DWD C;  4J7Z A;  2CTQ A;  5DEC A;  4JI3 B;  2V1D A;  2PI5 A;  3BAB A;  1BT8 A;  3EHB B;  1FPO A;  5A9G A;  4DR6 B;  5LOV A;  4IYI A;  4JYB A;  3ZN0 A;  4DR2 O;  4OPH A;  3B09 A;  2QA4 V;  3U10 A;  2QM7 A;  2XAF A;  3CJH B;  1YIT V;  5CBF A;  2WWW A;  1Q5O A;  4UVA A;  4WFB V;  2Z5U A;  5KUM A;  1IVS A;  4H33 A;  4CS2 A;  1FS0 G;  4GX0 A;  1AI5 A;  1LUW A;  1F4M A;  1QCE A;  5H5N A;  2F23 A;  2XT9 A;  4YJ3 B;  2X6B A;  4J42 A;  3APO A;  4B08 A;  1QLN A;  3KCY A;  1IBK B;  4JV5 O;  3FAV B;  4N23 A;  3ZHU A;  2KB1 A;  2HKO A;  1W0J G;  1PL4 A;  1VAR A;  3H1I H;  1P4R A;  2ADQ B;  2QDO A;  3ZHV A;  1XMO B;  1HNW B;  4PJ0 Z;  4LF5 B;  2P6J A;  4AQY B;  1NS1 A;  4DV5 O;  4PA4 A;  1BCC H;  1VQ4 V;  2F4V O;  2VQF O;  1QR8 A;  1JX9 A;  2R9R B;  1QHT A;  2A7W A;  2VQE B;  2UXD O;  1SER A;  1YJW V;  1XEQ A;  3CCL V;  5BR8 B;  1NR7 A;  3ABM C;  1Q6I A;  5FPR A;  4BAY A;  3U11 A;  2WA4 A;  4YY3 B;  2RQ6 A;  2H94 A;  1YEW A;  3S3X A;  4YY3 O;  1NH2 D;  1XOU A;  2WLK A;  5CA3 A;  1KD1 W;  2UXC O;  4MW8 A;  1YI2 V;  2Y4T A;  1R6N A;  2FML A;  2IBZ H;  4LH6 A;  3B8M A;  2OIG A;  1AIL A;  2YXH A;  2KKW A;  3D36 C;  5IYZ A;  3KZI Z;  1AJN A;  3ZHT A;  2OIE A;  4DXW A;  5A2Q N;  5JJN B;  4JV5 B;  3JAR A;  4UB8 Z;  3CSX A;  3THO A;  1XBL A;  3JD2 A;  1SET A;  1XHZ A;  3L72 H;  3TXQ A;  5CMU A;  4RWU A;  2R72 A;  3OGC C;  4JI5 B;  2FYU H;  3P3P A;  5LOV B;  2Q68 A;  1NH2 B;  1FXK C;  3SJQ C;  1VQN V;  4DR5 O;  1ZLZ A;  2YEV A;  1NU1 H;  4TUY B;  4DV6 O;  4GUN A;  2P90 A;  1S3J A;  1FAF A;  3JAW A;  1D2D A;  2AHZ A;  4CH5 A;  4WFE A;  1CXZ B;  4B7E A;  2YI8 A;  4TV8 A;  4X62 B;  3K5O A;  2FTK A;  2ZR2 A;  1GN4 A;  2YIB A;  4O4I A;  4MVQ A;  3K3W A;  3DXR A;  3RN4 A;  2EIN C;  1XNQ O;  3P30 A;  3ZBH A;  1XNR O;  4DV7 O;  5B1B C;  3I55 V;  2O57 A;  1KB9 F;  2R70 A;  4I50 B;  4MSW C;  2IW5 A;  4X1Y B;  3UM7 A;  3OR7 C;  4JAS A;  4JI6 B;  2E5L B;  1DLB A;  2GBO A;  1K97 A;  1JNB A;  1Q6H A;  2Y69 B;  4KFM A;  3JAK A;  1BE3 H;  5EBM C;  2OWO A;  1H2N A;  2PUS A;  5KUK A;  4R8C A;  1MOF A;  3HKB B;  1Q90 D;  2X0L A;  1IBL O;  5IJ0 A;  1Q6U A;  3CYO A;  2ZKO A;  3B40 A;  4J7K A;  1Z5W A;  4JYA B;  3CRC A;  2JEX A;  5KAI Z;  1ZX3 A;  3GVM A;  4UXN A;  4YHH B;  2CUG A;  3MAQ A;  1JMK C;  4B3M B;  2XOK G;  3A8T A;  4G2K A;  4JI0 O;  3HKD A;  3SJB C;  2EIK C;  3G71 V;  2Q0A A;  3SJA C;  1N8R W;  4LF6 B;  1ARO P;  2JGD A;  1KYO F;  2E3C A;  4X62 O;  2RCV A;  3RYC A;  1SQP H;  3ZMU A;  4PDM A;  3AK3 A;  2CK3 G;  4AIL C;  5GON B;  2L6L A;  1KQS U;  1WAZ A;  3S3W A;  5IDJ A;  1R3I C;  4GX1 A;  4L87 A;  5LA6 B;  3LSU A;  1K4C C;  1I7F A;  4X64 B;  4FZ1 A;  3K79 A;  3MHS C;  5B3S B;  1BS3 A;  3JAM N;  5J9P C;  4DR7 B;  1H2M A;  1K34 A;  2WLI A;  1Q86 W;  5F2V O;  1B6Q A;  2R9I A;  5KHI A;  1MNG A;  5KLV H;  4IIJ A;  2OT5 A;  4FJC C;  2QWP B;  1SZX A;  2P06 A;  2UXX A;  2PTM A;  3FB6 C;  1HW7 A;  1E1R G;  1IUR A;  1RPO A;  1NTZ H;  4TOI A;  2ZT9 B;  4UVB A;  1DF4 A;  4KL1 A;  4LNU A;  2Q5Z A;  5LMU O;  1BQZ A;  1PL0 A;  2Z3Y A;  3UT5 B;  4GLX A;  5IY5 B;  2EUL A;  1RSO B;  1OCR C;  5DN6 G;  1GAX A;  2JS3 A;  4FM0 A;  1M56 C;  1HNX B;  1ZL8 B;  4OPA A;  1JVM A;  3T1Y B;  4DR4 B;  2BSK A;  4PI0 A;  4H0L B;  1NBM G;  2YXL A;  4NKG B;  1PKX A;  1Q7Y W;  2CAZ C;  2LJ2 A;  1AP5 A;  1K9M W;  1CP9 A;  2RMK B;  2ZE6 A;  4AQY O;  1HDJ A;  2Q69 A;  2BCC H;  1L8D A;  3CMA V;  4DV2 B;  1WLE A;  3HKB A;  4JTC B;  3STZ C;  4FLZ A;  4LNU B;  1KKD A;  1S5L Z;  3CEI A;  2XUM A;  1QLE C;  2DOS A;  4TUY A;  1FOU A;  1B3Q A;  3CME V;  2XAG A;  3P32 A;  2FKX A;  3BHP A;  4F4L A;  1TUB B;  4JI8 B;  4PDV A;  3E22 A;  2LQT A;  4X20 A;  1Z2G A;  2HVJ C;  4H37 A;  2ODM A;  4X66 O;  4JI1 O;  3JAL B;  2D2C B;  1S5J A;  2NN4 A;  5JCO A;  1GM7 A;  3UO2 A;  4CS3 A;  1AJQ A;  1QBZ A;  4FMT A;  1WA8 A;  4LF4 B;  4PD4 F;  3K0G A;  4PA3 A;  3E89 A;  2QE7 G;  4XDJ A;  1GMG A;  2AZ2 A;  2UUA O;  1L0L H;  1BL8 A;  2LW1 A;  3JYC A;  4OGQ B;  2NNU A;  4WF9 V;  1H8E G;  2F93 B;  5LGT A;  5FPO A;  4HAM A;  1SQV H;  1GN2 A;  1MSW D;  1UJW B;  4ZI7 A;  2Q8V A;  2ZIM A;  2B9Z A;  4HYO A;  2R9A A;  1JFF B;  3JD1 A;  4LF8 O;  5H2F Z;  1K4D C;  3WB2 A;  4LF8 B;  4O2B B;  4DR7 O;  2LP7 A;  3WB1 A;  1GM9 A;  5IYZ B;  5L3G A;  2E76 B;  4PHZ A;  3LUT B;  4KHP O;  3W7W A;  1AI7 A;  1RM1 C;  4WBN B;  1IZ3 A;  3R65 A;  1BGY H;  3T1H B;  3J81 N;  1SQQ H;  4J9Y B;  5B1N A;  1Y66 A;  5E79 Z;  1S0V A;  5LGN A;  2ZNI A;  2H3O A;  3L75 H;  1RSO A;  3AEI A;  4GYC B;  5J2T A;  2NR5 A;  1AB3 A;  4FLX A;  2P4K A;  3RFR A;  3RYH B;  1Q43 A;  3C3S A;  3WU2 Z;  1SQB H;  4LF5 O;  5LMN B;  4MT8 A;  1M57 B;  3ZMS A;  1KKC A;  2XAQ A;  3U0Z A;  2X6A A;  4EFB A;  5KA6 A;  3DTU B;  3M7M X;  4DUY O;  1GO3 F;  4ZOL A;  3JAW B;  1QLE B;  3MHH C;  5JQG A;  4B7K A;  1Q3E A;  3HB3 B;  5JCO C;  2PY5 A;  4PA7 A;  1WA8 B;  2WLN A;  2PF4 E;  2DQ0 A;  4F6R B;  1QR9 A;  3F7V C;  1SZT A;  3F5T A;  4WFA V;  4NXM O;  3JAR B;  1M1K W;  1VMG A;  3KCX A;  2JDI G;  2EZO A;  3SPI A;  1R6T A;  3HKC A;  2X6C A;  1NZ6 A;  1EM1 A;  1K5Q A;  3BFR A;  3ZRW B;  1VF6 C;  2Q6A A;  1J95 A;  3MDS A;  3TJT A;  3L74 H;  4JTA B;  3WG7 C;  1S76 D;  4HZ3 A;  4MTF A;  2D3O W;  5D5Q A;  2ZCE A;  3OFN G;  2PZS A;  4KP4 A;  4W4K A;  1LR1 A;  4DV1 O;  3OEE G;  5EZY A;  1KU9 A;  2LFS A;  3AK1 A;  1N34 B;  3ZMV A;  4JAV A;  4MTX A;  2EJR A;  3AG3 C;  5KA5 A;  2K1E A;  2ZIN A;  5H6R A;  5JH7 A;  2ZDI A;  2WLL B;  5BZB A;  5K1P A;  1F7Y A;  2W0F C;  3KKY A;  3CCM V;  4IHJ A;  1H5W A;  3JAK B;  3VOU A;  1OCZ B;  3OAA G;  1IBM O;  3RGB A;  1J5E B;  1V55 B;  5JH7 B;  3PN1 A;  4NTW A;  3CC2 V;  2ZE7 A;  4QJF B;  4R50 A;  3SJC C;  1M4U A;  1E79 G;  5CN0 A;  4X65 O;  1JCH A;  4LF7 B;  2ZXW B;  2UUB O;  2PYJ A;  2DN9 A;  4YIO A;  1YF2 A;  1H2K A;  4JI7 B;  2VQF B;  4DW1 A;  1R3J C;  4J80 A;  3RW0 A;  3EXA A;  1N0J A;  3H1H H;  1IX9 A;  4O4L B;  1PNM A;  1SQG A;  3LDE A;  3A0H Z;  1ZAU A;  2CTW A;  1PPJ H;  4I9Q A;  5B1O A;  4DRX A;  1YJ9 V;  4ICG A;  4LF9 O;  4JAU A;  3SYA A;  3J80 N;  3ABL B;  1Y6X A;  5CBH A;  2DYS B;  2QR4 A;  4F6R A;  3ABK B;  1M56 B;  2DE0 X;  1H2L A;  1NJI W;  4X8A A;  4J7J A;  3E8B A;  5KMG B;  4H44 B;  1QVG U;  3LDC A;  3QG5 A;  3Q4H B;  1GRJ A;  3WB0 A;  5DM6 V;  2JIZ G;  4FLV A;  3DC6 A;  3HKE B;  3SGI A;  4LF6 O;  1U96 A;  2ADP A;  3J7A U;  1SF9 A;  4IT5 A;  3HKC B;  3DSQ A;  4TQD A;  3EFF K;  2EIM B;  4NXN O;  3ETQ A;  1MG1 A;  1EZV H;  4MVM A;  3I5D A;  1WPB A;  5EZY B;  3CCE V;  2HEP A;  2BTO A;  5HFL A;  4FK5 C;  2A9H A;  1HNX O;  4I7Z B;  4X9Q A;  1GH6 A;  3K0D A;  4GKK B;  1XHX A;  3RT3 C;  4PA6 A;  4OX9 B;  4KUM A;  4LCU C;  3EVK A;  4DR1 O;  2QWQ B;  3E8F A;  2HLD G;  2IJJ A;  2WSS G;  2DYR B;  3DC5 A;  4U3F H;  5B3S C;  1ORQ C;  3O9O A;  3OUF A;  4MVR A;  1MZE A;  3A0R A;  2QGN A;  2QKS A;  2K9P A;  4D6T H;  4BW9 A;  2WLH A;  3VQX A;  2N04 A;  3RVZ A;  3CC7 V;  2VWK A;  2IU0 A;  4J11 A;  2Q0O C;  3VBB A;  1AP6 A;  1SES A;  3K5M A;  2RJZ A;  4DK1 A;  4K8Z A;  1JFF A;  3VQY A;  3VQV A;  4NVP A;  3AK2 A;  5GON A;  3KDR A;  4K35 A;  1N4C A;  1EN5 A;  4QIW F;  3RYI A;  1ENV A;  1P84 F;  1M57 C;  3H9V A;  4YJ2 A;  4ZHQ A;  3ASN B;  1FFX A;  3L70 H;  2LW7 A;  5IY5 C;  3ZS8 C;  4Q20 A;  1I94 B;  2FL4 A;  5EC2 C; 
#chains in the Genus database with same CATH homology
 3TJT A;  3IC9 A;  1EN4 A;  1P7G A;  1IXB A;  3DC6 A;  2GDS A;  2ADP A;  4C7U A;  4JZG A;  4FFK A;  3AK1 A;  1EN6 A;  3C3T A;  1JR9 A;  1AR4 A;  1JA8 A;  1AP5 A;  1BSM A;  1D5N A;  1XDC A;  3KKY A;  2QKA A;  3OT7 A;  4X9Q A;  1VEW A;  4E4E A;  3CEI A;  1XUQ A;  1BT8 A;  1WB8 A;  2P4K A;  5A9G A;  1I08 A;  4JYY A;  1B06 A;  3EVK A;  3C3S A;  4JZ2 A;  1GN3 A;  1WB7 A;  1KKC A;  1N0N A;  3DC5 A;  1GN6 A;  2RCV A;  4F6E A;  1LUW A;  1ZUQ A;  2QKC A;  3AK3 A;  4YIP A;  5AG2 A;  1ZLZ A;  1IDS A;  1PM9 A;  4YIO A;  4GUN A;  1MA1 A;  3K9S A;  1AP6 A;  3LSU A;  1XIL A;  4BR6 A;  1PL4 A;  1VAR A;  2CDY A;  3AK2 A;  1N0J A;  2ADQ B;  1IX9 A;  1XRE A;  3KDR A;  1QNM A;  2CE4 A;  1I0H A;  1LUV A;  1BS3 A;  1EN5 A;  1GN4 A;  3QVN A;  1MMM A;  1MNG A;  1GN2 A;  1Y67 A;  3RN4 A;  1ZSP A;  1SZX A;  1EM1 A;  1AR5 A;  2AW9 A;  3BFR A;  1AVM A;  1ZTE A;  1MSD A;  3MDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...