1WB7A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title The Role of Tyr41 and His155 in the Functional Properties of Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb7A02
1VARA 1IX9A 1BT8A 1EN6A 1KKCA 4JZGA 1BS3A 1BSMA 1XILA 1IXBA 1PM9A 2ADQB 3OT7A 1ZLZA 1I08A 1GN2A 5A9GA 3QVNA 2AW9A 1MA1A 1N0JA 3LSUA 3C3TA 1IDSA 2QKCA 1JA8A 3DC5A 1Y67A 1ZSPA 1MNGA 5AG2A 3TJTA 1MMMA 4JYYA 4JZ2A 4E4EA 1MSDA 1QNMA 3CEIA 4F6EA 4X9QA 1GN3A 3AK2A 4BR6A 1AP5A 1XREA 4FFKA 2ADPA 1WB7A 3KKYA 1AVMA 2GDSA 3DC6A 3BFRA 4GUNA 4YIOA 2RCVA 1GN6A 3RN4A 1P7GA 1SZXA 3AK1A 1WB8A 2P4KA 1EN4A 1PL4A 1LUWA 2CE4A 1N0NA 3IC9A 4C7UA 1AR5A 3C3SA 1AR4A 1D5NA 1LUVA 3EVKA 1ZUQA 1ZTEA 1I0HA 1JR9A 1XUQA 3K9SA 1EM1A 3AK3A 1GN4A 2QKAA 3MDSA 1B06A 1EN5A 2CDYA 1VEWA 1XDCA 4YIPA 1AP6A
chains in the Genus database with same CATH superfamily
1YI2V 1TA8A 4H33A 5TISZ 4TUYA 1XOUA 1WN7A 4Q6GA 2ZE5A 4U7OA 3T1HO 4KP4A 2ADQB 2EJRA 3PJSK 3K03A 5HFLA 5IE9A 1V54B 4D6TH 2LP7A 5KA5A 4GT1A 2DYRC 4DR7O 4DV6O 4G2KA 5LOVB 5LMUB 1N4CA 1SQQH 2IH3C 4JI6B 1R3IC 3I56V 5CBFA 3JCUZ 4JF3A 3JAMN 5B1AC 2QKCA 1K4CC 5IY5B 2EJ7A 2WLJA 1KD1W 4FLXA 2VWJA 3FAVA 2L6LA 1FXVA 3OGCC 3TJTA 3SJAC 4DR3B 2Q68A 3CMAV 1P7BA 1TGOA 1E1RG 1J5EB 2P06A 1O9GA 2UUAB 5LYJA 2ZCEA 3W7UA 2O57A 2RJZA 3IFXA 2XNDG 4MTFA 5FPOA 1S3JA 2BOCC 3ZRSA 1FAFA 1XHZA 3QO7A 1FOUA 1P7GA 3MAQA 1RSOB 2OYQA 2PYJA 1HDJA 4FPPA 2B5UA 1IBLO 3CMEV 2ILMA 3DSQA 1IURA 3ZMTA 2CTPA 4DO2A 5EBLC 3QF7A 1QLEC 2EIKC 3APQA 1GM7A 1M57B 4MTXA 4TWKA 1QR8A 3SJBC 2ZIOA 3K9SA 2UXDB 3K04A 2VQFO 2ZNJA 1W0JG 3AG3B 2WLMA 4ZI7A 4O4JA 3LNMB 3I5DA 4IHJB 4GLXA 3DXRA 4YXWG 2NNUA 3OTFA 3HB3B 4O4HB 5HFMA 1ENVA 3J80N 3CHXA 2JGDA 1IXBA 3KCYA 5J2TA 3WB2A 5B1BC 4ABMA 3A0HZ 4LWSB 5IJ0A 3D8CA 3FFQA 1MA1A 4RQEA 1XNRO 4I5SA 3JAKB 1JCHA 2QGNA 1JNBA 4DR1B 4DW1A 2ATKC 2KQXA 5B3SC 4I4TA 4RO2A 3CCJV 2ZNIA 4DRXA 2YS8A 4GCZA 4JI4B 1QHTA 4LFCO 2F43G 3T2MA 2VQEO 3RYCB 4EFEA 1W59A 1VQ9V 1Q82W 2V7QG 4EB6A 2W6IG 2W0FC 2ZDIC 2HEPA 4RAIA 1SKVA 1GN6A 3ZEDA 2HHHO 4JYAB 2MK3A 1N33B 2OWOA 4I50B 1U97A 1OCZC 2QTSA 1F51A 3HPLC 4DUYO 4O2AA 1GM8A 2DYRB 3VQXA 1YCIA 4LFAB 3B09A 3ABTA 5IYDO 1Q86W 5IJ9B 2AZ2A 4B3TB 4X1IA 5B1AB 3OE7G 2BTQB 3UT5B 5EC1C 2OTJV 2UUCO 4PI2A 4N21A 4O4IB 2DWEC 4FJCC 5B1NA 4FK5C 4UCVA 1V55B 3E35A 4IIJA 4QIWF 5FLXN 3LDEA 3CWBH 2D2CB 4JI2B 4LF8O 1H8HG 3CCEV 4JTCB 1PV0A 3BA8A 1VQKV 1V9PA 2YI8A 5KHJA 4H13B 1L0NH 3L9DA 5LHHA 2XAJA 1FFXA 2AW9A 1SQXH 1WJZA 1QLEB 2Q69A 2EIKB 3C3TA 5JQGA 5KMGA 3JCZA 2ZR2A 4I9QA 1R3LC 5B5EZ 3MHSC 2QWQB 3H1HH 4LNUA 3E22A 1PKXA 3ETGA 5JVDA 4LF7O 1W2BU 4DUZB 2A9HA 1M93A 2YIDA 4AI8A 3RW0A 4PA9A 1H2MA 2GTAA 1AI4A 1AROP 4LF5B 4X66B 1G6UA 4GX0A 2WLNA 3IGAC 5K1PA 1N36O 3ETDA 1RPRA 2GDSA 1I5XA 1SF9A 3CCSV 1SQGA 1SQBH 2DYSC 4NTWA 5KHIA 1JQ0A 2QDOA 4RWUA 5CB4B 4LBEC 1VF5B 5LHGA 2CE4A 4ASUG 3MHHC 4DYLA 1S72V 2LGWA 2HVJC 4YJ2A 3KZIZ 1GRJA 4B3SO 4LF9O 1SA0B 1GTOA 1UPGA 2WA3A 5H6RA 2AHZA 4Z2WA 5B3SB 3WFVA 3G67A 1VF6C 4X20B 2CUGA 4DR4B 3IAYA 1M1KW 4NXNB 1WAZA 2Y69C 2P5OA 2IBZH 1XNQB 1H2NA 4DV4O 3OD4A 4J7ZA 1EZJA 4TQDA 2ZXWC 1VQOV 3QO5A 2XASA 3R65A 4F6RB 2F23A 4JI3B 4JI7O 4MVRA 3RVZA 5EZYA 2XAHA 4O4LB 1AB3A 1OCZB 1HW7A 4JTDB 1CXZB 4B3MO 2FTKA 1NU1H 4OPHA 5L3FA 1Y76A 3B8NA 2N74A 3SJQC 3S3WA 5H9CA 5L3DA 2FYUH 5A2QN 4JV5O 3UCSC 1Y4MA 1KUQA 2CH7B 4XBFA 3CJHB 2YXHA 2LO1A 1SQPH 1VQ5V 1G8MA 2ZE7A 2UXBO 2P7TC 2UXCO 3P32A 1P4RA 4YIOA 3L75H 3SPIA 3ZRWA 5LHIA 2R9AA 3TGUH 1E1QG 2GUZA 4TQFA 3CC4V 4JYBA 3JSLA 3G6BA 4YJ3B 1L1FA 1HNWO 4UCTA 4C7UA 1AR5A 3G71V 3OMIB 1T5EA 1G4YB 4NVPA 4LF4B 4KUMA 1MZFA 1WA8A 3HR0A 3P3NA 3GWOA 1A32A 4FM2A 4X65O 1DK1A 5IYCO 3H1JH 2YXLA 3P3PA 2BOBC 1KECA 1L8DA 1Q6HA 1GN4A 3SYPA 4HNAB 3LDDA 3F7VC 2A0LA 1VEWA 4UB6Z 3N2KA 3BA9A 4EKWA 1F23A 4JASA 4I55A 3SPGA 5LMNB 1US6A 3RYHB 1DF4A 2Z5UA 2DYSB 5LP6C 4OX9O 1BHBA 4MVZA 3ZBHA 1K3EA 4J41A 3ZCCA 1TVKB 2CGOA 5L3GA 1QBZA 5FPRA 1K7DA 4OXSA 1Q43A 4CH6A 4ZBMA 3A0BZ 5C8YA 4JAVA 2E3CA 5KX5B 1B04A 4UFZA 2F4VB 1EZVH 2HG5C 2QEXV 4CH3A 3LNNA 1IBMB 4QPKA 1S5LZ 5D5QA 4JYYA 2UUBO 3GWKC 3K58A 2PGGA 4I0XB 1MZEA 2XUMA 2Y69B 1Y74B 1RSOA 3CRRA 2P22C 5BMVB 3OAAG 2EIJC 2ZXWB 1AJPA 1DLBA 1PL4A 3AG3C 3OW2U 4PI0A 1YJWV 4RQFA 2WSSG 4DR5B 1YITV 2Q4PA 1N0NA 2E5LB 2MW2B 5EBWC 3CB2A 3N2GB 1AR4A 2PF4E 4FLVA 4BIZA 3EVKA 5L3CA 3LDCA 2LGQA 3CXCU 2XOKG 4TT3G 3JATB 4MSWC 3O9OA 3VQVA 1FXKA 1YHQV 1KP2A 1GK9A 4DV0B 3E89A 3CCVV 1HR0B 4RUEA 4L8JA 3AK3A 3M7MX 1YZBA 4O4HA 2ITDC 3ABMC 1EN5A 4DR2B 3C90A 2WAMA 4MT8A 2BSKA 1XDCA 4LFBB 4P30A 2RNBA 4MTGA 3F5WC 2QWOB 4X88A 4JZGA 5L3EA 3T1HB 3CRQA 1BSMA 1XILA 4LWSA 2N04A 3LUTB 5JWPA 4MW8A 1M56C 1FS0G 4PD4F 3RWRD 4DR7B 4DV6B 2QWPB 2JS3A 4UVBA 3JAKA 3F7YC 5EK0A 4DV3O 3OEHG 4LF6B 4JI1O 2EILC 3D3IA 1N0JA 3X2QC 4MW3A 1IBKO 3ABLC 5KLVH 2OTLV 2NLJC 4LP8A 3CC2V 1K97A 5J9PC 5D5PA 2HJFC 4X62B 1ZSPA 4YHHO 3UKMA 3RYCA 1OCRC 2DMXA 3L70H 2QSAA 2NR5A 3AK2A 4DV5B 5J2UB 4PELA 1K34A 1H38A 3JAWB 3OEEG 1ZL8B 3FB5C 1RPOA 3ZN0A 1RFYA 2P6JA 3BFRA 4I50A 4XDJA 3W7TA 1Y66A 4IGGA 4UCSA 5LP6B 4GYCB 4Z1MG 1SC5B 1LUWA 1XMOO 1F4NA 2QWRB 4BWAA 1V55C 4X1YB 3ZMUA 2BTQA 5LXTA 3UT5A 5CA0B 4ZKIA 1N32O 2QTOA 3CC7V 3M99B 3IJ4A 2P90A 4DV2O 3W7XA 2PI4A 4DK0A 1M5IA 3FD9A 2YIBD 1VQNV 2VQFB 4XDLA 1VQMV 4GX2A 1H8EG 2HKOA 4FLTA 4JI6O 5DECA 3K06A 2Q7HA 3B40A 2CAZC 4O2BB 1WP7A 5DM6V 4UB8Z 4X1KB 2ZE8A 1BCCH 1RM1B 1ZX3A 1EBOA 3FX7A 4J42A 5EYPA 2EIJB 2JJ2G 3CXHF 1NJIW 4X89A 2OT5A 3JD2A 1NT2B 1I08A 3SGIA 3BAAA 4FLWA 1J5EO 1Q3EA 3U0ZA 4HYOA 3RYFB 1XNRB 3BEHA 1HNZB 1OZ0A 2BCCH 1RP3B 4AQYB 2WWWA 2P67A 4K8XA 4DR6O 1YIJV 2RMKB 4TV9B 3BPZA 4HAMA 1M4UA 5EBMC 2Q0AA 5FNVA 1MSDA 3OFNG 2ZR3A 2QJ1A 2VQEB 3L73H 5KAIZ 3ABMB 1FD9A 2ADPA 1VMGA 1PNMA 3UM7A 5CB4A 3OGIB 1HWYA 3WG7C 2HHHB 3AG2C 3OR6C 4ICGA 2JRIA 5KUKA 3CCLV 1S5JA 2UXDO 2Q7EA 4DUYB 2HP8A 3FYEB 1M56B 1B3QA 3CRMA 3TETA 3STLC 2XTAA 1L0LH 3OMAB 3H9VA 3AG1C 4KHPB 4CH4A 2EILB 2AZ0A 1P49A 1MG1A 4TOIA 3X2QB 1ZUQA 3ABLB 1AI7A 3RYIA 3HKBB 1BMFG 1I0HA 1JR9A 2X0LA 4X20A 4WF9V 2PI5A 1MSWD 4QGPA 1AILA 3CCMV 1P84F 4ZHQB 2IH1C 1OCRB 3MDSA 2CDYA 2OIGA 1QVFU 4JYCA 2AXTZ 1AI6A 1YEWA 3TK1A 2ZDIA 3ASNC 4F6RA 3RFRA 3OTOO 4LF8B 3ABUA 4LH7A 4JI4O 3OT7A 1YF2A 2CGNA 3ZS8C 3T4ZA 1MOFA 1PD3A 1TUBB 2CH7A 3UQ8A 1VQ4V 2A79B 3VBBA 3DC5A 4FZ0A 1VQ8V 4K8ZA 5H5NA 2F66C 2F1MA 2X6AA 3RBZA 3H01A 4JYAO 1N33O 2ZQMA 4K35A 4LF7B 1MMMA 1NKDA 3QNEA 4X9QA 4Q20A 2EZPA 4PA7A 1PP9H 2RQ6A 3FB7C 4BR6A 4LFAO 1BQ0A 1N36B 1JX9A 3KKYA 1S76D 2ZM6O 1AVMA 2Q0OC 4GX1A 5BZBA 2YEVB 4W4LA 2ETNA 4LR3A 4OPAA 2DW4A 5LL6Y 5KHHA 1R1BA 4YJ3A 2K9PA 3JYCA 3I55V 4GKKB 4GKJO 1SQFA 2FKXA 2P4KA 5BY1A 2H8PC 1YJ9V 2M6YA 1OV9A 1PPJH 4UXNA 1K73W 2VWKA 3L72H 2ZT9B 5GTHZ 3B2EE 2ZE6A 4YY3O 4ZI7B 1ZWIC 5EIBC 2WLKA 2Y4UA 3W7WA 4K0KB 4HNAA 3ICXA 5BR8O 3K5LA 2LW7A 4J80A 1KYOF 4KL1A 1SRYA 5J2TB 1FPOA 4NXMO 1I94O 5BXZA 5CA1B 4DV4B 2LJ2A 5F2VO 2ZIMA 5L3BA 3SPCA 1KKCA 2Z3YA 3ZRXA 3VQWA 3DTUB 5LGTA 2A3QA 4OGQB 2JJ1G 4JI7B 1JFFB 3WG7B 3AG2B 3ASOC 2GV9A 4I4TB 4B3MB 1YXBA 3T1CA 3J7AU 4FFBB 4NTXA 2C2AA 4NR1A 5KX5A 1B6QA 3SJCC 3P30A 3HKDB 3Q4HA 3D36C 3JALB 4JV5B 3AG1B 1JA8A 1ROPA 3CS5A 1J95A 3JD1A 3CP1A 4EB6B 4JI5O 1VF6A 2X7RB 4I0XA 4E4EA 2Y4TA 2JVDA 4FLYA 4FLUA 2ZD9A 3K3WA 2IJKA 3H1LH 4JPRA 2UXBB 3D3QA 3HKCB 2UXCB 1XL6A 2ITCC 4D7TA 2IJHA 3ASNB 3WB1A 5DN6G 3LSSA 2QR4A 1DF5A 2LQTA 3K08A 4DV7O 2NN4A 4X64B 1HNWB 5JJJB 4U3JB 3DGEA 3G80A 3JATA 2UU9B 1QU7A 1SERA 1D5NA 1IZ3A 4JTAB 1FJGO 2WLIB 4LCUC 2LW1A 4MVMA 4EFBA 4G27B 5K1XA 5ITZA 3E86A 1QCEA 3T1YO 2K1EA 2YXYA 4WBNB 5IWAO 3ZHSA 1B06A 4PJ0Z 2YDEA 4YIPA 4B3RO 4IT5A 4X8AA 3NXSA 1O9HA 5KHKA 4UVCA 1KP3A 5CMUA 4BAYA 3H1IH 1PM9A 3PN1A 4DV1B 3G6EV 5KMGB 1KBHA 2JEXA 3CE2A 1BHAA 3CRAA 4A5UB 4AILC 1S0VA 5IYZB 2GSMB 2EX3A 4U7NA 3J81N 3MD0A 2RN9A 1Q81W 3E8BA 3M8AA 1K33A 5LOVA 1GM9A 4IYIA 3SPJA 4JI0O 5J2UA 1VP7A 2OIEA 1XHXA 4J11A 4QE9A 2UUBB 3ZX6A 3JAWA 4JGSA 1FKAO 1GN3A 1ZL8A 2RDCA 5E79Z 1CEZA 1OCCC 3SYCA 4LF4O 4FFKA 1IVSA 3K5MA 1KMIZ 4JI8O 5LP6A 2JK5C 2YUAA 5H2FZ 1URFA 1S77D 2AHYA 2IU3A 3ASOB 3RGBA 2R9RB 4PHZA 1QVGU 4QPJA 1KB9F 4X1YA 2PUSA 5GTIZ 4CBCA 5CA0A 3K79A 4ZOLB 4TV8B 4NTYA 1JJ2U 2EBOA 3QTCA 2JEUA 4CZZA 3ZMZA 1U96A 2XAQA 1ZTEA 1RM1C 1NQTA 5IYBO 2KKWA 3EXAA 1Q8IA 1OCOC 3QG5A 5EZYB 1S5HC 1HNXO 1XMQO 4PDRA 2GHYA 1G1XB 2PTMA 1AP6A 1Z2GA 1Y76B 3A8TA 2CTRA 1EN6A 4CS4A 1IBMO 1FXKC 2GTSA 4P9PA 1GMGA 1X59A 4FZ1A 1NVPB 1ZLZA 4J10A 2B1IA 4W4KA 4IHJA 4H0LB 4DV3B 4JI1B 3K57A 1GKFA 3BVOA 1GH6A 4TV9A 1F4MA 1K5SA 1IBKB 3AG7A 1W0KG 2YSUB 2OCCC 1ZAUA 5JCOC 3FKSG 2WPDG 1NBMG 4WFGA 5EIBD 1MNGA 4YHHB 3ZRWB 4BIOA 1XI1A 4DR5O 1JOYA 1Z5WA 1WB7A 2VS0A 1UFIA 3CX5F 5JJNB 5GONB 3E8GA 3JARB 4DXWA 4DV0O 1NI8A 3SDLA 3JD4A 1K9MW 5EC2C 3ZMVA 1YJNV 1XL4A 4R6ZA 1YSCA 1XMOB 3G4SV 4H44B 3CRCA 1KQSU 1NR1A 3HKBA 1XQ8A 1WP8A 1N32B 3OM3B 2DN9A 3N2KB 3A2FA 3B77A 4DV2B 4I55B 4PDLA 2Y0PA 2WLLB 4I7ZB 4ZHQA 3AEIA 4CC6A 1YTFB 3E2EA 1LNQA 4FMTA 4P2ZA 1IBLB 3FB6C 2DJVA 5IJ9A 2R9IA 4AHCA 1N34O 3LSQA 4LF6O 2A06H 3EHBB 1KC8W 1OCCB 3K0DA 5LA6B 1IX9A 3WU2Z 1BT8A 2IM9A 1SS3A 5DEDA 2QM4A 3K9AA 1H5WA 5C8YB 3BABA 1BS3A 4X62O 4WCEV 4J7JA 3ZHRA 1QLNA 4O4IA 4CS3A 1KKDA 1TUBA 4GX5A 2F93B 5A9GA 1NVPD 5LMUO 3K5OA 4DV5O 1DTOA 4KFMA 4PDMA 2EIMC 5JH7B 5CBGA 2CK3G 1FYJA 2JIZG 2KG7B 4DR6B 2B9ZA 1Y67A 1WPXA 2R72A 3AG4C 1R3KC 3OUSA 2YC0A 3A0RA 1VF7A 1KU9A 2CTQA 1K92A 4BW9A 4DR3O 1SETA 4IYHA 1OCOB 1M90W 2YEVA 2UUAO 4FM1A 1BQZA 4HBNA 2E74B 2EINC 3ABKC 4GUNA 2RCVA 2D3OW 2Q6AA 1R73A 1H2LA 3TCUA 4G28B 2EZOA 3SYAA 4F4LA 2KB1A 3KCXA 1Q90D 2WA4A 3E83A 1FXKB 2Q7GA 1EN4A 4TSFG 1Z5VA 1I7FA 4LFCB 3RVYA 4DW0A 1CPYA 1PNKA 2BSKB 1D2DA 2OCCB 1XUQA 4UUJC 2DQ3A 3JASB 1YTFD 1FFTB 3UO3A 5CA1A 3HKEB 2AGAA 1VQ7V 1SA0A 1WPBA 1X4TA 3ETQA 1HNZO 1ORQC 1VARA 3GVMA 3OTOB 1JFFA 4AQYO 3B8MA 2Q9LA 1JMKC 2V1DA 2XT9A 3IC7A 4TUYB 3CCQV 4FFBA 2UUCB 2H94A 3ZHQA 4MS2A 3T4DA 3HKDA 2Q73A 3JALA 2A7WA 2LFRA 3K5NA 3H1KH 2FL4A 1IDSA 4FVMA 4DR1O 1QR9A 3R66A 4UCUA 4RUFA 4O4LA 4MVOA 1SZTA 2R70A 5KHGA 3FYIB 3SR2C 4U3FH 3FAVB 3HKCA 4QJFB 4UCOA 2Q8VA 2X6BA 4E2LA 1COWG 2E75B 2G38A 4KHPO 4K3AA 2ZM6B 1OHHG 1E79G 1HP8A 5LYJB 3CJHA 5LXTB 5LGNA 4GKJB 4L87A 1WB8A 4U3JA 4UV8A 2Y48A 3JD3A 4UVAA 2DE0X 3W7SA 3CD6V 4FM0A 1SESA 2BE3A 4J7KA 2QA4V 4PA4A 3K59A 4YY3B 2HFEC 2WLIA 1IJGA 2EIMB 3VQYA 1NS1A 4B3TO 3SPHA 4LH6A 2XAFA 2Z0AA 3AG4B 3UO2A 3B4SA 1WNSA 4WBNA 2ARHA 1XEQA 5BR8B 2HVKC 2EULA 1VIBA 5EYPB 1BL8A 1EM1A 5E1AC 1R6KA 4LC1A 2BTOA 3K0GA 4XDKA 2DOSA 2Q67A 4NXMB 1I94B 4UCRA 3BCCH 2LFSA 3OMNB 4WFEA 4B3SB 4LF9B 4O4JB 1PNLA 3NR7A 2EINB 3ABKB 3QO8A 4JI2O 3BRCA 3DXRB 5B1OA 3TXSA 2QM8A 3RT3C 3CYOA 4D7SA 2JGDB 1VQLV 5IYZA 1GN2A 1EFRG 3QVNA 5FNVB 5LGUA 3VOUA 3OUFA 3RYHA 1CP9A 3ZJZA 1PL0A 5GW7A 5IJ0B 1NTMH 4HZ3A 3JSNA 4JI5B 4GKKO 4QE7A 5AG2A 2QE7G 1TVKA 4WFFA 4DUZO 1NR7A 5B1BB 2ODMA 5KUMA 1QNMA 4DRXB 4QNHB 2IJJA 2ZINA 3CCRV 1K4DC 4GZRB 4LF5O 4X66O 1YDXA 3BHPA 3DC6A 1IXMA 2QM7A 2Q5ZA 5CA3A 3RN4A 1SZXA 1R6NA 4K0KO 4BW5A 2M7WA 3CPWU 3RYIB 2P4VA 4DV7B 1FXHA 1BE3H 1OJHA 4ZOLA 5FL7G 2IJIA 4TV8A 2DQ0A 2IW5A 5C93A 3ETEA 3D36A 1NTZH 1Y74A 3ZHUA 5BMVA 4B08A 3APOA 4O2AB 5CBHA 1FJGB 4NB5A 2PZSA 2L35A 4MVUA 4B7EA 4X1IB 4R50A 3T1YB 1XBLA 3N2GA 4PA3A 5IWAB 1AJQA 3EFFK 2QKAA 4DR4O 2UXXA 5H6QA 4B3RB 2QWNB 4NXNO 3TXQA 3ZHVA 2PYLA 1H2SB 5IDJA 1GAXA 1JVMA 1XNQO 2YIBA 3BY6A 1GO3F 1JPXA 4X65B 3F5TA 2N05A 4IIJB 3SYQA 4MTOA 4JI3O 1BZKA 1NH2B 3STZC 4B7KA 1Q7YW 3SYOA 3KG2A 2E76B 2H3OA 4H37A 1Y6XA 3N27A 4PV1B 3LSUA 4BIUA 1UJWB 2HJDA 3JD0A 1Q5OA 1FFXB 5LBQA 3E8FA 3U11A 4OX9B 5JQGB 1WLEA 4JI0B 2JS5A 4JZ2A 4J9ZB 4X64O 4FLZA 3CEIA 4J9YB 3E22B 4LNUB 5JVDB 1DGSA 3ZRVA 1VQPV 2JGUA 5JJEB 1F7YA 1AP5A 2GBOA 1I5YA 5GONA 2UU9O 3KDRA 3JARA 3L74H 4CH5A 4JI8B 2ZKOA 2CTWA 1V54C 2FB5A 4R7CA 1R6TA 4PA6A 4JAAA 2YICA 3IC9A 1TAEA 3C3SA 3ZMSA 5IY5C 4IL6Z 1LUVA 1QQCA 2WLLA 2W6JG 4P9OA 3WB0A 4EEQA 4MVQA 2XAGA 1R3JC 4YJ2B 4DV1O 4NYKA 4ZIBA 2QKSA 4MVSA 4R8CA 5LA6A 1HNXB 1XMQB 3E8HA 1AI5A 2XHBA 4NKGB 3FB8C 1K8AW 5CN0A 2HR3A 1VQ6V 3CSXA 3GB7C 4PDVA 1AJNA 3Q4HB 4WFHA 4Z1VA 5LMNO 2IU0A 2WLHA 2B1GA 3THOA 2YI9A 4CC5A 3O65A 2UXNA 3ML0A 5JH7A 3ZIAG 1THZA 1BGYH 2X6CA 3ZN1A 1NH2D 2KG7A 4O2BA 1M57C 1Q6UA 2F95B 4X1KA 2JDIG 2V4DA 4UV9A 1D5AA 2W0XA 2Y0IA 2VRZA 2F4VO 1N8RW 2PY5A 1K5QA 1H2GA 2YIAA 3CCUV 3RYFA 4F6EA 1SQVH 1TUEB 1M9NA 1XREA 2DWDC 2OCHA 4N23A 1Q6IA 4JAUA 3OR7C 1JJOA 3AK1A 1YVWA 2HLDG 4CS2A 2GUZB 1AR1B 5ITZB 3L71H 1H2KA 4DK1A 3U10A 5KA6A 2E5LO 3S3XA 5JCOA 4FIPC 4KXRA 4WFAV 3ZHTA 1MABG 3JASA 1NZ6A 3HKEA 1WA8B 1NTKH 5IT9N 4I9WA 1HR0O 4WFBV 5B66Z 2FMLA 2KSDA 1LR1A 1N34B 5KAFZ 4DR2O 4LFBO
chains in the Genus database with same CATH topology
1VARA 1IX9A 1BT8A 1EN6A 1KKCA 4JZGA 1BS3A 1BSMA 1XILA 1IXBA 1PM9A 2ADQB 3OT7A 1ZLZA 1I08A 1GN2A 5A9GA 3QVNA 2AW9A 1MA1A 1N0JA 3LSUA 3C3TA 1IDSA 2QKCA 1JA8A 3DC5A 1Y67A 1ZSPA 1MNGA 5AG2A 3TJTA 1MMMA 4JYYA 4JZ2A 4E4EA 1MSDA 1QNMA 3CEIA 4F6EA 4X9QA 1GN3A 3AK2A 4BR6A 1AP5A 1XREA 4FFKA 2ADPA 1WB7A 3KDRA 3KKYA 1AVMA 2GDSA 3DC6A 3BFRA 4GUNA 4YIOA 2RCVA 1GN6A 3RN4A 1P7GA 1SZXA 3AK1A 1WB8A 2P4KA 1EN4A 1PL4A 1LUWA 2CE4A 1N0NA 3IC9A 4C7UA 1AR5A 3C3SA 1AR4A 1D5NA 1LUVA 3EVKA 1ZUQA 1ZTEA 1I0HA 1JR9A 1XUQA 3K9SA 1EM1A 3AK3A 1GN4A 2QKAA 3MDSA 1B06A 1EN5A 2CDYA 1VEWA 1XDCA 4YIPA 1AP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAR A;  1IX9 A;  1BT8 A;  1EN6 A;  1KKC A;  4JZG A;  1BS3 A;  1BSM A;  1XIL A;  1IXB A;  1PM9 A;  2ADQ B;  3OT7 A;  1ZLZ A;  1I08 A;  1GN2 A;  5A9G A;  3QVN A;  2AW9 A;  1MA1 A;  1N0J A;  3LSU A;  3C3T A;  1IDS A;  2QKC A;  1JA8 A;  3DC5 A;  1Y67 A;  1ZSP A;  1MNG A;  5AG2 A;  3TJT A;  1MMM A;  4JYY A;  4JZ2 A;  4E4E A;  1MSD A;  1QNM A;  3CEI A;  4F6E A;  4X9Q A;  1GN3 A;  3AK2 A;  4BR6 A;  1AP5 A;  1XRE A;  4FFK A;  2ADP A;  1WB7 A;  3KKY A;  1AVM A;  2GDS A;  3DC6 A;  3BFR A;  4GUN A;  4YIO A;  2RCV A;  1GN6 A;  3RN4 A;  1P7G A;  1SZX A;  3AK1 A;  1WB8 A;  2P4K A;  1EN4 A;  1PL4 A;  1LUW A;  2CE4 A;  1N0N A;  3IC9 A;  4C7U A;  1AR5 A;  3C3S A;  1AR4 A;  1D5N A;  1LUV A;  3EVK A;  1ZUQ A;  1ZTE A;  1I0H A;  1JR9 A;  1XUQ A;  3K9S A;  1EM1 A;  3AK3 A;  1GN4 A;  2QKA A;  3MDS A;  1B06 A;  1EN5 A;  2CDY A;  1VEW A;  1XDC A;  4YIP A;  1AP6 A; 
#chains in the Genus database with same CATH topology
 1YI2 V;  1TA8 A;  4H33 A;  5TIS Z;  4TUY A;  1XOU A;  1WN7 A;  4Q6G A;  2ZE5 A;  4U7O A;  3T1H O;  4KP4 A;  2ADQ B;  2EJR A;  3PJS K;  3K03 A;  5HFL A;  5IE9 A;  1V54 B;  4D6T H;  2LP7 A;  5KA5 A;  4GT1 A;  2DYR C;  4DR7 O;  4DV6 O;  4G2K A;  5LOV B;  5LMU B;  1N4C A;  1SQQ H;  2IH3 C;  4JI6 B;  1R3I C;  3I56 V;  5CBF A;  3JCU Z;  4JF3 A;  3JAM N;  5B1A C;  2QKC A;  1K4C C;  5IY5 B;  2EJ7 A;  2WLJ A;  1KD1 W;  4FLX A;  2VWJ A;  3FAV A;  2L6L A;  1FXV A;  3OGC C;  3TJT A;  3SJA C;  4DR3 B;  2Q68 A;  3CMA V;  1P7B A;  1TGO A;  1E1R G;  1J5E B;  2P06 A;  1O9G A;  2UUA B;  5LYJ A;  2ZCE A;  3W7U A;  2O57 A;  2RJZ A;  3IFX A;  2XND G;  4MTF A;  5FPO A;  1S3J A;  2BOC C;  3ZRS A;  1FAF A;  1XHZ A;  3QO7 A;  1FOU A;  1P7G A;  3MAQ A;  1RSO B;  2OYQ A;  2PYJ A;  1HDJ A;  4FPP A;  2B5U A;  1IBL O;  3CME V;  2ILM A;  3DSQ A;  1IUR A;  3ZMT A;  2CTP A;  4DO2 A;  5EBL C;  3QF7 A;  1QLE C;  2EIK C;  3APQ A;  1GM7 A;  1M57 B;  4MTX A;  4TWK A;  1QR8 A;  3SJB C;  2ZIO A;  3K9S A;  2UXD B;  3K04 A;  2VQF O;  2ZNJ A;  1W0J G;  3AG3 B;  2WLM A;  4ZI7 A;  4O4J A;  3LNM B;  3I5D A;  4IHJ B;  4GLX A;  3DXR A;  4YXW G;  2NNU A;  3OTF A;  3HB3 B;  4O4H B;  5HFM A;  1ENV A;  3J80 N;  3CHX A;  2JGD A;  1IXB A;  3KCY A;  5J2T A;  3WB2 A;  5B1B C;  4ABM A;  3A0H Z;  4LWS B;  5IJ0 A;  3D8C A;  3FFQ A;  1MA1 A;  4RQE A;  1XNR O;  4I5S A;  3JAK B;  1JCH A;  2QGN A;  1JNB A;  4DR1 B;  4DW1 A;  2ATK C;  2KQX A;  5B3S C;  4I4T A;  4RO2 A;  3CCJ V;  2ZNI A;  4DRX A;  2YS8 A;  4GCZ A;  4JI4 B;  1QHT A;  4LFC O;  2F43 G;  3T2M A;  2VQE O;  3RYC B;  4EFE A;  1W59 A;  1VQ9 V;  1Q82 W;  2V7Q G;  4EB6 A;  2W6I G;  2W0F C;  2ZDI C;  2HEP A;  4RAI A;  1SKV A;  1GN6 A;  3ZED A;  2HHH O;  4JYA B;  2MK3 A;  1N33 B;  2OWO A;  4I50 B;  1U97 A;  1OCZ C;  2QTS A;  1F51 A;  3HPL C;  4DUY O;  4O2A A;  1GM8 A;  2DYR B;  3VQX A;  1YCI A;  4LFA B;  3B09 A;  3ABT A;  5IYD O;  1Q86 W;  5IJ9 B;  2AZ2 A;  4B3T B;  4X1I A;  5B1A B;  3OE7 G;  2BTQ B;  3UT5 B;  5EC1 C;  2OTJ V;  2UUC O;  4PI2 A;  4N21 A;  4O4I B;  2DWE C;  4FJC C;  5B1N A;  4FK5 C;  4UCV A;  1V55 B;  3E35 A;  4IIJ A;  4QIW F;  5FLX N;  3LDE A;  3CWB H;  2D2C B;  4JI2 B;  4LF8 O;  1H8H G;  3CCE V;  4JTC B;  1PV0 A;  3BA8 A;  1VQK V;  1V9P A;  2YI8 A;  5KHJ A;  4H13 B;  1L0N H;  3L9D A;  5LHH A;  2XAJ A;  1FFX A;  2AW9 A;  1SQX H;  1WJZ A;  1QLE B;  2Q69 A;  2EIK B;  3C3T A;  5JQG A;  5KMG A;  3JCZ A;  2ZR2 A;  4I9Q A;  1R3L C;  5B5E Z;  3MHS C;  2QWQ B;  3H1H H;  4LNU A;  3E22 A;  1PKX A;  3ETG A;  5JVD A;  4LF7 O;  1W2B U;  4DUZ B;  2A9H A;  1M93 A;  2YID A;  4AI8 A;  3RW0 A;  4PA9 A;  1H2M A;  2GTA A;  1AI4 A;  1ARO P;  4LF5 B;  4X66 B;  1G6U A;  4GX0 A;  2WLN A;  3IGA C;  5K1P A;  1N36 O;  3ETD A;  1RPR A;  2GDS A;  1I5X A;  1SF9 A;  3CCS V;  1SQG A;  1SQB H;  2DYS C;  4NTW A;  5KHI A;  1JQ0 A;  2QDO A;  4RWU A;  5CB4 B;  4LBE C;  1VF5 B;  5LHG A;  2CE4 A;  4ASU G;  3MHH C;  4DYL A;  1S72 V;  2LGW A;  2HVJ C;  4YJ2 A;  3KZI Z;  1GRJ A;  4B3S O;  4LF9 O;  1SA0 B;  1GTO A;  1UPG A;  2WA3 A;  5H6R A;  2AHZ A;  4Z2W A;  5B3S B;  3WFV A;  3G67 A;  1VF6 C;  4X20 B;  2CUG A;  4DR4 B;  3IAY A;  1M1K W;  4NXN B;  1WAZ A;  2Y69 C;  2P5O A;  2IBZ H;  1XNQ B;  1H2N A;  4DV4 O;  3OD4 A;  4J7Z A;  1EZJ A;  4TQD A;  2ZXW C;  1VQO V;  3QO5 A;  2XAS A;  3R65 A;  4F6R B;  2F23 A;  4JI3 B;  4JI7 O;  4MVR A;  3RVZ A;  5EZY A;  2XAH A;  4O4L B;  1AB3 A;  1OCZ B;  1HW7 A;  4JTD B;  1CXZ B;  4B3M O;  2FTK A;  1NU1 H;  4OPH A;  5L3F A;  1Y76 A;  3B8N A;  2N74 A;  3SJQ C;  3S3W A;  5H9C A;  5L3D A;  2FYU H;  5A2Q N;  4JV5 O;  3UCS C;  1Y4M A;  1KUQ A;  2CH7 B;  4XBF A;  3CJH B;  2YXH A;  2LO1 A;  1SQP H;  1VQ5 V;  1G8M A;  2ZE7 A;  2UXB O;  2P7T C;  2UXC O;  3P32 A;  1P4R A;  4YIO A;  3L75 H;  3SPI A;  3ZRW A;  5LHI A;  2R9A A;  3TGU H;  1E1Q G;  2GUZ A;  4TQF A;  3CC4 V;  4JYB A;  3JSL A;  3G6B A;  4YJ3 B;  1L1F A;  1HNW O;  4UCT A;  4C7U A;  1AR5 A;  3G71 V;  3OMI B;  1T5E A;  1G4Y B;  4NVP A;  4LF4 B;  4KUM A;  1MZF A;  1WA8 A;  3HR0 A;  3P3N A;  3GWO A;  1A32 A;  4FM2 A;  4X65 O;  1DK1 A;  5IYC O;  3H1J H;  2YXL A;  3P3P A;  2BOB C;  1KEC A;  1L8D A;  1Q6H A;  1GN4 A;  3SYP A;  4HNA B;  3LDD A;  3F7V C;  2A0L A;  1VEW A;  4UB6 Z;  3N2K A;  3BA9 A;  4EKW A;  1F23 A;  4JAS A;  4I55 A;  3SPG A;  5LMN B;  1US6 A;  3RYH B;  1DF4 A;  2Z5U A;  2DYS B;  5LP6 C;  4OX9 O;  1BHB A;  4MVZ A;  3ZBH A;  1K3E A;  4J41 A;  3ZCC A;  1TVK B;  2CGO A;  5L3G A;  1QBZ A;  5FPR A;  1K7D A;  4OXS A;  1Q43 A;  4CH6 A;  4ZBM A;  3A0B Z;  5C8Y A;  4JAV A;  2E3C A;  5KX5 B;  1B04 A;  4UFZ A;  2F4V B;  1EZV H;  2HG5 C;  2QEX V;  4CH3 A;  3LNN A;  1IBM B;  4QPK A;  1S5L Z;  5D5Q A;  4JYY A;  2UUB O;  3GWK C;  3K58 A;  2PGG A;  4I0X B;  1MZE A;  2XUM A;  2Y69 B;  1Y74 B;  1RSO A;  3CRR A;  2P22 C;  5BMV B;  3OAA G;  2EIJ C;  2ZXW B;  1AJP A;  1DLB A;  1PL4 A;  3AG3 C;  3OW2 U;  4PI0 A;  1YJW V;  4RQF A;  2WSS G;  4DR5 B;  1YIT V;  2Q4P A;  1N0N A;  2E5L B;  2MW2 B;  5EBW C;  3CB2 A;  3N2G B;  1AR4 A;  2PF4 E;  4FLV A;  4BIZ A;  3EVK A;  5L3C A;  3LDC A;  2LGQ A;  3CXC U;  2XOK G;  4TT3 G;  3JAT B;  4MSW C;  3O9O A;  3VQV A;  1FXK A;  1YHQ V;  1KP2 A;  1GK9 A;  4DV0 B;  3E89 A;  3CCV V;  1HR0 B;  4RUE A;  4L8J A;  3AK3 A;  3M7M X;  1YZB A;  4O4H A;  2ITD C;  3ABM C;  1EN5 A;  4DR2 B;  3C90 A;  2WAM A;  4MT8 A;  2BSK A;  1XDC A;  4LFB B;  4P30 A;  2RNB A;  4MTG A;  3F5W C;  2QWO B;  4X88 A;  4JZG A;  5L3E A;  3T1H B;  3CRQ A;  1BSM A;  1XIL A;  4LWS A;  2N04 A;  3LUT B;  5JWP A;  4MW8 A;  1M56 C;  1FS0 G;  4PD4 F;  3RWR D;  4DR7 B;  4DV6 B;  2QWP B;  2JS3 A;  4UVB A;  3JAK A;  3F7Y C;  5EK0 A;  4DV3 O;  3OEH G;  4LF6 B;  4JI1 O;  2EIL C;  3D3I A;  1N0J A;  3X2Q C;  4MW3 A;  1IBK O;  3ABL C;  5KLV H;  2OTL V;  2NLJ C;  4LP8 A;  3CC2 V;  1K97 A;  5J9P C;  5D5P A;  2HJF C;  4X62 B;  1ZSP A;  4YHH O;  3UKM A;  3RYC A;  1OCR C;  2DMX A;  3L70 H;  2QSA A;  2NR5 A;  3AK2 A;  4DV5 B;  5J2U B;  4PEL A;  1K34 A;  1H38 A;  3JAW B;  3OEE G;  1ZL8 B;  3FB5 C;  1RPO A;  3ZN0 A;  1RFY A;  2P6J A;  3BFR A;  4I50 A;  4XDJ A;  3W7T A;  1Y66 A;  4IGG A;  4UCS A;  5LP6 B;  4GYC B;  4Z1M G;  1SC5 B;  1LUW A;  1XMO O;  1F4N A;  2QWR B;  4BWA A;  1V55 C;  4X1Y B;  3ZMU A;  2BTQ A;  5LXT A;  3UT5 A;  5CA0 B;  4ZKI A;  1N32 O;  2QTO A;  3CC7 V;  3M99 B;  3IJ4 A;  2P90 A;  4DV2 O;  3W7X A;  2PI4 A;  4DK0 A;  1M5I A;  3FD9 A;  2YIB D;  1VQN V;  2VQF B;  4XDL A;  1VQM V;  4GX2 A;  1H8E G;  2HKO A;  4FLT A;  4JI6 O;  5DEC A;  3K06 A;  2Q7H A;  3B40 A;  2CAZ C;  4O2B B;  1WP7 A;  5DM6 V;  4UB8 Z;  4X1K B;  2ZE8 A;  1BCC H;  1RM1 B;  1ZX3 A;  1EBO A;  3FX7 A;  4J42 A;  5EYP A;  2EIJ B;  2JJ2 G;  3CXH F;  1NJI W;  4X89 A;  2OT5 A;  3JD2 A;  1NT2 B;  1I08 A;  3SGI A;  3BAA A;  4FLW A;  1J5E O;  1Q3E A;  3U0Z A;  4HYO A;  3RYF B;  1XNR B;  3BEH A;  1HNZ B;  1OZ0 A;  2BCC H;  1RP3 B;  4AQY B;  2WWW A;  2P67 A;  4K8X A;  4DR6 O;  1YIJ V;  2RMK B;  4TV9 B;  3BPZ A;  4HAM A;  1M4U A;  5EBM C;  2Q0A A;  5FNV A;  1MSD A;  3OFN G;  2ZR3 A;  2QJ1 A;  2VQE B;  3L73 H;  5KAI Z;  3ABM B;  1FD9 A;  2ADP A;  1VMG A;  1PNM A;  3UM7 A;  5CB4 A;  3OGI B;  1HWY A;  3WG7 C;  2HHH B;  3AG2 C;  3OR6 C;  4ICG A;  2JRI A;  5KUK A;  3CCL V;  1S5J A;  2UXD O;  2Q7E A;  4DUY B;  2HP8 A;  3FYE B;  1M56 B;  1B3Q A;  3CRM A;  3TET A;  3STL C;  2XTA A;  1L0L H;  3OMA B;  3H9V A;  3AG1 C;  4KHP B;  4CH4 A;  2EIL B;  2AZ0 A;  1P49 A;  1MG1 A;  4TOI A;  3X2Q B;  1ZUQ A;  3ABL B;  1AI7 A;  3RYI A;  3HKB B;  1BMF G;  1I0H A;  1JR9 A;  2X0L A;  4X20 A;  4WF9 V;  2PI5 A;  1MSW D;  4QGP A;  1AIL A;  3CCM V;  1P84 F;  4ZHQ B;  2IH1 C;  1OCR B;  3MDS A;  2CDY A;  2OIG A;  1QVF U;  4JYC A;  2AXT Z;  1AI6 A;  1YEW A;  3TK1 A;  2ZDI A;  3ASN C;  4F6R A;  3RFR A;  3OTO O;  4LF8 B;  3ABU A;  4LH7 A;  4JI4 O;  3OT7 A;  1YF2 A;  2CGN A;  3ZS8 C;  3T4Z A;  1MOF A;  1PD3 A;  1TUB B;  2CH7 A;  3UQ8 A;  1VQ4 V;  2A79 B;  3VBB A;  3DC5 A;  4FZ0 A;  1VQ8 V;  4K8Z A;  5H5N A;  2F66 C;  2F1M A;  2X6A A;  3RBZ A;  3H01 A;  4JYA O;  1N33 O;  2ZQM A;  4K35 A;  4LF7 B;  1MMM A;  1NKD A;  3QNE A;  4X9Q A;  4Q20 A;  2EZP A;  4PA7 A;  1PP9 H;  2RQ6 A;  3FB7 C;  4BR6 A;  4LFA O;  1BQ0 A;  1N36 B;  1JX9 A;  3KKY A;  1S76 D;  2ZM6 O;  1AVM A;  2Q0O C;  4GX1 A;  5BZB A;  2YEV B;  4W4L A;  2ETN A;  4LR3 A;  4OPA A;  2DW4 A;  5LL6 Y;  5KHH A;  1R1B A;  4YJ3 A;  2K9P A;  3JYC A;  3I55 V;  4GKK B;  4GKJ O;  1SQF A;  2FKX A;  2P4K A;  5BY1 A;  2H8P C;  1YJ9 V;  2M6Y A;  1OV9 A;  1PPJ H;  4UXN A;  1K73 W;  2VWK A;  3L72 H;  2ZT9 B;  5GTH Z;  3B2E E;  2ZE6 A;  4YY3 O;  4ZI7 B;  1ZWI C;  5EIB C;  2WLK A;  2Y4U A;  3W7W A;  4K0K B;  4HNA A;  3ICX A;  5BR8 O;  3K5L A;  2LW7 A;  4J80 A;  1KYO F;  4KL1 A;  1SRY A;  5J2T B;  1FPO A;  4NXM O;  1I94 O;  5BXZ A;  5CA1 B;  4DV4 B;  2LJ2 A;  5F2V O;  2ZIM A;  5L3B A;  3SPC A;  1KKC A;  2Z3Y A;  3ZRX A;  3VQW A;  3DTU B;  5LGT A;  2A3Q A;  4OGQ B;  2JJ1 G;  4JI7 B;  1JFF B;  3WG7 B;  3AG2 B;  3ASO C;  2GV9 A;  4I4T B;  4B3M B;  1YXB A;  3T1C A;  3J7A U;  4FFB B;  4NTX A;  2C2A A;  4NR1 A;  5KX5 A;  1B6Q A;  3SJC C;  3P30 A;  3HKD B;  3Q4H A;  3D36 C;  3JAL B;  4JV5 B;  3AG1 B;  1JA8 A;  1ROP A;  3CS5 A;  1J95 A;  3JD1 A;  3CP1 A;  4EB6 B;  4JI5 O;  1VF6 A;  2X7R B;  4I0X A;  4E4E A;  2Y4T A;  2JVD A;  4FLY A;  4FLU A;  2ZD9 A;  3K3W A;  2IJK A;  3H1L H;  4JPR A;  2UXB B;  3D3Q A;  3HKC B;  2UXC B;  1XL6 A;  2ITC C;  4D7T A;  2IJH A;  3ASN B;  3WB1 A;  5DN6 G;  3LSS A;  2QR4 A;  1DF5 A;  2LQT A;  3K08 A;  4DV7 O;  2NN4 A;  4X64 B;  1HNW B;  5JJJ B;  4U3J B;  3DGE A;  3G80 A;  3JAT A;  2UU9 B;  1QU7 A;  1SER A;  1D5N A;  1IZ3 A;  4JTA B;  1FJG O;  2WLI B;  4LCU C;  2LW1 A;  4MVM A;  4EFB A;  4G27 B;  5K1X A;  5ITZ A;  3E86 A;  1QCE A;  3T1Y O;  2K1E A;  2YXY A;  4WBN B;  5IWA O;  3ZHS A;  1B06 A;  4PJ0 Z;  2YDE A;  4YIP A;  4B3R O;  4IT5 A;  4X8A A;  3NXS A;  1O9H A;  5KHK A;  4UVC A;  1KP3 A;  5CMU A;  4BAY A;  3H1I H;  1PM9 A;  3PN1 A;  4DV1 B;  3G6E V;  5KMG B;  1KBH A;  2JEX A;  3CE2 A;  1BHA A;  3CRA A;  4A5U B;  4AIL C;  1S0V A;  5IYZ B;  2GSM B;  2EX3 A;  4U7N A;  3J81 N;  3MD0 A;  2RN9 A;  1Q81 W;  3E8B A;  3M8A A;  1K33 A;  5LOV A;  1GM9 A;  4IYI A;  3SPJ A;  4JI0 O;  5J2U A;  1VP7 A;  2OIE A;  1XHX A;  4J11 A;  4QE9 A;  2UUB B;  3ZX6 A;  3JAW A;  4JGS A;  1FKA O;  1GN3 A;  1ZL8 A;  2RDC A;  5E79 Z;  1CEZ A;  1OCC C;  3SYC A;  4LF4 O;  4FFK A;  1IVS A;  3K5M A;  1KMI Z;  4JI8 O;  5LP6 A;  2JK5 C;  2YUA A;  5H2F Z;  1URF A;  1S77 D;  2AHY A;  2IU3 A;  3ASO B;  3RGB A;  2R9R B;  4PHZ A;  1QVG U;  4QPJ A;  1KB9 F;  4X1Y A;  2PUS A;  5GTI Z;  4CBC A;  5CA0 A;  3K79 A;  4ZOL B;  4TV8 B;  4NTY A;  1JJ2 U;  2EBO A;  3QTC A;  2JEU A;  4CZZ A;  3ZMZ A;  1U96 A;  2XAQ A;  1ZTE A;  1RM1 C;  1NQT A;  5IYB O;  2KKW A;  3EXA A;  1Q8I A;  1OCO C;  3QG5 A;  5EZY B;  1S5H C;  1HNX O;  1XMQ O;  4PDR A;  2GHY A;  1G1X B;  2PTM A;  1AP6 A;  1Z2G A;  1Y76 B;  3A8T A;  2CTR A;  1EN6 A;  4CS4 A;  1IBM O;  1FXK C;  2GTS A;  4P9P A;  1GMG A;  1X59 A;  4FZ1 A;  1NVP B;  1ZLZ A;  4J10 A;  2B1I A;  4W4K A;  4IHJ A;  4H0L B;  4DV3 B;  4JI1 B;  3K57 A;  1GKF A;  3BVO A;  1GH6 A;  4TV9 A;  1F4M A;  1K5S A;  1IBK B;  3AG7 A;  1W0K G;  2YSU B;  2OCC C;  1ZAU A;  5JCO C;  3FKS G;  2WPD G;  1NBM G;  4WFG A;  5EIB D;  1MNG A;  4YHH B;  3ZRW B;  4BIO A;  1XI1 A;  4DR5 O;  1JOY A;  1Z5W A;  1WB7 A;  2VS0 A;  1UFI A;  3CX5 F;  5JJN B;  5GON B;  3E8G A;  3JAR B;  4DXW A;  4DV0 O;  1NI8 A;  3SDL A;  3JD4 A;  1K9M W;  5EC2 C;  3ZMV A;  1YJN V;  1XL4 A;  4R6Z A;  1YSC A;  1XMO B;  3G4S V;  4H44 B;  3CRC A;  1KQS U;  1NR1 A;  3HKB A;  1XQ8 A;  1WP8 A;  1N32 B;  3OM3 B;  2DN9 A;  3N2K B;  3A2F A;  3B77 A;  4DV2 B;  4I55 B;  4PDL A;  2Y0P A;  2WLL B;  4I7Z B;  4ZHQ A;  3AEI A;  4CC6 A;  1YTF B;  3E2E A;  1LNQ A;  4FMT A;  4P2Z A;  1IBL B;  3FB6 C;  2DJV A;  5IJ9 A;  2R9I A;  4AHC A;  1N34 O;  3LSQ A;  4LF6 O;  2A06 H;  3EHB B;  1KC8 W;  1OCC B;  3K0D A;  5LA6 B;  1IX9 A;  3WU2 Z;  1BT8 A;  2IM9 A;  1SS3 A;  5DED A;  2QM4 A;  3K9A A;  1H5W A;  5C8Y B;  3BAB A;  1BS3 A;  4X62 O;  4WCE V;  4J7J A;  3ZHR A;  1QLN A;  4O4I A;  4CS3 A;  1KKD A;  1TUB A;  4GX5 A;  2F93 B;  5A9G A;  1NVP D;  5LMU O;  3K5O A;  4DV5 O;  1DTO A;  4KFM A;  4PDM A;  2EIM C;  5JH7 B;  5CBG A;  2CK3 G;  1FYJ A;  2JIZ G;  2KG7 B;  4DR6 B;  2B9Z A;  1Y67 A;  1WPX A;  2R72 A;  3AG4 C;  1R3K C;  3OUS A;  2YC0 A;  3A0R A;  1VF7 A;  1KU9 A;  2CTQ A;  1K92 A;  4BW9 A;  4DR3 O;  1SET A;  4IYH A;  1OCO B;  1M90 W;  2YEV A;  2UUA O;  4FM1 A;  1BQZ A;  4HBN A;  2E74 B;  2EIN C;  3ABK C;  4GUN A;  2RCV A;  2D3O W;  2Q6A A;  1R73 A;  1H2L A;  3TCU A;  4G28 B;  2EZO A;  3SYA A;  4F4L A;  2KB1 A;  3KCX A;  1Q90 D;  2WA4 A;  3E83 A;  1FXK B;  2Q7G A;  1EN4 A;  4TSF G;  1Z5V A;  1I7F A;  4LFC B;  3RVY A;  4DW0 A;  1CPY A;  1PNK A;  2BSK B;  1D2D A;  2OCC B;  1XUQ A;  4UUJ C;  2DQ3 A;  3JAS B;  1YTF D;  1FFT B;  3UO3 A;  5CA1 A;  3HKE B;  2AGA A;  1VQ7 V;  1SA0 A;  1WPB A;  1X4T A;  3ETQ A;  1HNZ O;  1ORQ C;  1VAR A;  3GVM A;  3OTO B;  1JFF A;  4AQY O;  3B8M A;  2Q9L A;  1JMK C;  2V1D A;  2XT9 A;  3IC7 A;  4TUY B;  3CCQ V;  4FFB A;  2UUC B;  2H94 A;  3ZHQ A;  4MS2 A;  3T4D A;  3HKD A;  2Q73 A;  3JAL A;  2A7W A;  2LFR A;  3K5N A;  3H1K H;  2FL4 A;  1IDS A;  4FVM A;  4DR1 O;  1QR9 A;  3R66 A;  4UCU A;  4RUF A;  4O4L A;  4MVO A;  1SZT A;  2R70 A;  5KHG A;  3FYI B;  3SR2 C;  4U3F H;  3FAV B;  3HKC A;  4QJF B;  4UCO A;  2Q8V A;  2X6B A;  4E2L A;  1COW G;  2E75 B;  2G38 A;  4KHP O;  4K3A A;  2ZM6 B;  1OHH G;  1E79 G;  1HP8 A;  5LYJ B;  3CJH A;  5LXT B;  5LGN A;  4GKJ B;  4L87 A;  1WB8 A;  4U3J A;  4UV8 A;  2Y48 A;  3JD3 A;  4UVA A;  2DE0 X;  3W7S A;  3CD6 V;  4FM0 A;  1SES A;  2BE3 A;  4J7K A;  2QA4 V;  4PA4 A;  3K59 A;  4YY3 B;  2HFE C;  2WLI A;  1IJG A;  2EIM B;  3VQY A;  1NS1 A;  4B3T O;  3SPH A;  4LH6 A;  2XAF A;  2Z0A A;  3AG4 B;  3UO2 A;  3B4S A;  1WNS A;  4WBN A;  2ARH A;  1XEQ A;  5BR8 B;  2HVK C;  2EUL A;  1VIB A;  5EYP B;  1BL8 A;  1EM1 A;  5E1A C;  1R6K A;  4LC1 A;  2BTO A;  3K0G A;  4XDK A;  2DOS A;  2Q67 A;  4NXM B;  1I94 B;  4UCR A;  3BCC H;  2LFS A;  3OMN B;  4WFE A;  4B3S B;  4LF9 B;  4O4J B;  1PNL A;  3NR7 A;  2EIN B;  3ABK B;  3QO8 A;  4JI2 O;  3BRC A;  3DXR B;  5B1O A;  3TXS A;  2QM8 A;  3RT3 C;  3CYO A;  4D7S A;  2JGD B;  1VQL V;  5IYZ A;  1GN2 A;  1EFR G;  3QVN A;  5FNV B;  5LGU A;  3VOU A;  3OUF A;  3RYH A;  1CP9 A;  3ZJZ A;  1PL0 A;  5GW7 A;  5IJ0 B;  1NTM H;  4HZ3 A;  3JSN A;  4JI5 B;  4GKK O;  4QE7 A;  5AG2 A;  2QE7 G;  1TVK A;  4WFF A;  4DUZ O;  1NR7 A;  5B1B B;  2ODM A;  5KUM A;  1QNM A;  4DRX B;  4QNH B;  2IJJ A;  2ZIN A;  3CCR V;  1K4D C;  4GZR B;  4LF5 O;  4X66 O;  1YDX A;  3BHP A;  3DC6 A;  1IXM A;  2QM7 A;  2Q5Z A;  5CA3 A;  3RN4 A;  1SZX A;  1R6N A;  4K0K O;  4BW5 A;  2M7W A;  3CPW U;  3RYI B;  2P4V A;  4DV7 B;  1FXH A;  1BE3 H;  1OJH A;  4ZOL A;  5FL7 G;  2IJI A;  4TV8 A;  2DQ0 A;  2IW5 A;  5C93 A;  3ETE A;  3D36 A;  1NTZ H;  1Y74 A;  3ZHU A;  5BMV A;  4B08 A;  3APO A;  4O2A B;  5CBH A;  1FJG B;  4NB5 A;  2PZS A;  2L35 A;  4MVU A;  4B7E A;  4X1I B;  4R50 A;  3T1Y B;  1XBL A;  3N2G A;  4PA3 A;  5IWA B;  1AJQ A;  3EFF K;  2QKA A;  4DR4 O;  2UXX A;  5H6Q A;  4B3R B;  2QWN B;  4NXN O;  3TXQ A;  3ZHV A;  2PYL A;  1H2S B;  5IDJ A;  1GAX A;  1JVM A;  1XNQ O;  2YIB A;  3BY6 A;  1GO3 F;  1JPX A;  4X65 B;  3F5T A;  2N05 A;  4IIJ B;  3SYQ A;  4MTO A;  4JI3 O;  1BZK A;  1NH2 B;  3STZ C;  4B7K A;  1Q7Y W;  3SYO A;  3KG2 A;  2E76 B;  2H3O A;  4H37 A;  1Y6X A;  3N27 A;  4PV1 B;  3LSU A;  4BIU A;  1UJW B;  2HJD A;  3JD0 A;  1Q5O A;  1FFX B;  5LBQ A;  3E8F A;  3U11 A;  4OX9 B;  5JQG B;  1WLE A;  4JI0 B;  2JS5 A;  4JZ2 A;  4J9Z B;  4X64 O;  4FLZ A;  3CEI A;  4J9Y B;  3E22 B;  4LNU B;  5JVD B;  1DGS A;  3ZRV A;  1VQP V;  2JGU A;  5JJE B;  1F7Y A;  1AP5 A;  2GBO A;  1I5Y A;  5GON A;  2UU9 O;  3KDR A;  3JAR A;  3L74 H;  4CH5 A;  4JI8 B;  2ZKO A;  2CTW A;  1V54 C;  2FB5 A;  4R7C A;  1R6T A;  4PA6 A;  4JAA A;  2YIC A;  3IC9 A;  1TAE A;  3C3S A;  3ZMS A;  5IY5 C;  4IL6 Z;  1LUV A;  1QQC A;  2WLL A;  2W6J G;  4P9O A;  3WB0 A;  4EEQ A;  4MVQ A;  2XAG A;  1R3J C;  4YJ2 B;  4DV1 O;  4NYK A;  4ZIB A;  2QKS A;  4MVS A;  4R8C A;  5LA6 A;  1HNX B;  1XMQ B;  3E8H A;  1AI5 A;  2XHB A;  4NKG B;  3FB8 C;  1K8A W;  5CN0 A;  2HR3 A;  1VQ6 V;  3CSX A;  3GB7 C;  4PDV A;  1AJN A;  3Q4H B;  4WFH A;  4Z1V A;  5LMN O;  2IU0 A;  2WLH A;  2B1G A;  3THO A;  2YI9 A;  4CC5 A;  3O65 A;  2UXN A;  3ML0 A;  5JH7 A;  3ZIA G;  1THZ A;  1BGY H;  2X6C A;  3ZN1 A;  1NH2 D;  2KG7 A;  4O2B A;  1M57 C;  1Q6U A;  2F95 B;  4X1K A;  2JDI G;  2V4D A;  4UV9 A;  1D5A A;  2W0X A;  2Y0I A;  2VRZ A;  2F4V O;  1N8R W;  2PY5 A;  1K5Q A;  1H2G A;  2YIA A;  3CCU V;  3RYF A;  4F6E A;  1SQV H;  1TUE B;  1M9N A;  1XRE A;  2DWD C;  2OCH A;  4N23 A;  1Q6I A;  4JAU A;  3OR7 C;  1JJO A;  3AK1 A;  1YVW A;  2HLD G;  4CS2 A;  2GUZ B;  1AR1 B;  5ITZ B;  3L71 H;  1H2K A;  4DK1 A;  3U10 A;  5KA6 A;  2E5L O;  3S3X A;  5JCO A;  4FIP C;  4KXR A;  4WFA V;  3ZHT A;  1MAB G;  3JAS A;  1NZ6 A;  3HKE A;  1WA8 B;  1NTK H;  5IT9 N;  4I9W A;  1HR0 O;  4WFB V;  5B66 Z;  2FML A;  2KSD A;  1LR1 A;  1N34 B;  5KAF Z;  4DR2 O;  4LFB O; 
#chains in the Genus database with same CATH homology
 1VAR A;  1IX9 A;  1BT8 A;  1EN6 A;  1KKC A;  4JZG A;  1BS3 A;  1BSM A;  1XIL A;  1IXB A;  1PM9 A;  2ADQ B;  3OT7 A;  1ZLZ A;  1I08 A;  1GN2 A;  5A9G A;  3QVN A;  2AW9 A;  1MA1 A;  1N0J A;  3LSU A;  3C3T A;  1IDS A;  2QKC A;  1JA8 A;  3DC5 A;  1Y67 A;  1ZSP A;  1MNG A;  5AG2 A;  3TJT A;  1MMM A;  4JYY A;  4JZ2 A;  4E4E A;  1MSD A;  1QNM A;  3CEI A;  4F6E A;  4X9Q A;  1GN3 A;  3AK2 A;  4BR6 A;  1AP5 A;  1XRE A;  4FFK A;  2ADP A;  1WB7 A;  3KDR A;  3KKY A;  1AVM A;  2GDS A;  3DC6 A;  3BFR A;  4GUN A;  4YIO A;  2RCV A;  1GN6 A;  3RN4 A;  1P7G A;  1SZX A;  3AK1 A;  1WB8 A;  2P4K A;  1EN4 A;  1PL4 A;  1LUW A;  2CE4 A;  1N0N A;  3IC9 A;  4C7U A;  1AR5 A;  3C3S A;  1AR4 A;  1D5N A;  1LUV A;  3EVK A;  1ZUQ A;  1ZTE A;  1I0H A;  1JR9 A;  1XUQ A;  3K9S A;  1EM1 A;  3AK3 A;  1GN4 A;  2QKA A;  3MDS A;  1B06 A;  1EN5 A;  2CDY A;  1VEW A;  1XDC A;  4YIP A;  1AP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...