1WB7A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Tyr41 and His155 in the Functional Properties of Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [FE]
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb7A02
3OT7A 1GN2A 1ZTEA 1IX9A 1MNGA 1BT8A 4YIPA 4GUNA 2CDYA 4YIOA 1N0JA 1AP5A 5A9GA 1EN5A 3QVNA 3AK1A 5AG2A 4X9QA 4JYYA 4JZGA 3DC5A 3IC9A 1XREA 3K9SA 3EVKA 1QNMA 1XILA 4BR6A 1EN4A 2AW9A 3BFRA 2QKCA 4C7UA 1ZUQA 1MSDA 1ZLZA 1Y67A 1GN3A 1I0HA 1BSMA 2GDSA 1XUQA 1AR5A 1EM1A 4F6EA 1BS3A 4FFKA 1D5NA 3LSUA 4JZ2A 1MA1A 1WB7A 1VARA 2RCVA 2CE4A 1VEWA 1PM9A 2ADPA 1IXBA 4E4EA 1P7GA 1N0NA 3RN4A 3C3SA 3MDSA 3KKYA 1WB8A 1AVMA 1JR9A 3AK3A 1AR4A 1LUVA 1KKCA 3CEIA 1JA8A 3C3TA 1ZSPA 3TJTA 2P4KA 1GN6A 1XDCA 1IDSA 2ADQB 1I08A 3DC6A 1B06A 2QKAA 1AP6A 1GN4A 1LUWA 1EN6A 3AK2A 1MMMA 1PL4A 1SZXA
chains in the Genus database with same CATH superfamily
3ZMVA 1SQFA 2ILMA 1F4NA 2F66C 3N2KA 4X1YA 1VQMV 3T1YO 3RYHB 3JAKA 3HKDB 5B1AB 3AK1A 1GAXA 3RYCB 4KP4A 2YIBD 3AG7A 2ZIOA 2N05A 1VQPV 2JGDB 3BFRA 3RT3C 2H3OA 4RAIA 3ZRVA 2LO1A 4UCTA 1HNXO 3L75H 3IC7A 2UU9O 5BZBA 2EX3A 1G8MA 3M7MX 2UXBO 3CSXA 1I7FA 5CA1A 4LFBO 3JD0A 5GONB 2CTRA 2QTSA 4J7KA 2CTPA 3OGIB 1K8AW 4KL1A 4XBFA 3SR2C 1DTOA 2EILC 1VIBA 4D7TA 4DW0A 2UXNA 3W7XA 4WFFA 4DV2B 4ZI7B 1NVPD 1W59A 3F5TA 3FB5C 5EYPA 3ZHVA 4RQEA 2UXDO 3P3NA 1NS1A 1HR0B 2QDOA 3NR7A 4O4LA 4UUJC 4TV9A 4MS2A 1BQ0A 3AK3A 2ZNIA 3BVOA 3MD0A 3S3XA 4JI0O 4XDKA 4DV0O 2EIMB 4K8XA 1NTZH 3VQVA 5L3GA 1M56B 1NKDA 1ZX3A 1YITV 4X65O 1JFFA 4YJ3B 2X0LA 2YEVB 4PD4F 4UB8Z 4DUZB 4L8JA 3RYFB 4JI8O 2Y4TA 1E1QG 3JD1A 3APOA 4LH7A 5H6QA 4DRXB 2K9PA 2HJFC 1KKDA 3AG2C 3W7SA 3JSLA 3UCSC 1FXHA 1YEWA 1QLNA 2OCCB 2P22C 4FM1A 2XAFA 4GKJO 1D2DA 3RYCA 3B2EE 1Y4MA 3CS5A 3ETQA 2CUGA 4LF9O 3K5NA 1Q90D 2N74A 2RNBA 4OX9B 3K06A 2CGNA 3DSQA 1FAFA 3G71V 3E8HA 3OM3B 4RO2A 2E74B 2WLJA 1FFTB 2PZSA 1Y67A 4FPPA 4G2KA 4DV3O 2ZINA 5B3SC 1IBMO 4R8CA 4LF6O 4X1KB 1XL6A 3E22B 3UM7A 1X4TA 1RSOB 4ZHQB 4DV0B 3SPGA 4Z2WA 5LXTA 5B1BB 1T5EA 2D3OW 1YTFD 1HR0O 4X64B 2A9HA 1GO3F 1NU1H 3LNNA 1YDXA 1VQOV 4KHPB 2NNUA 1BHBA 4IYIA 3FAVA 4GX2A 4DV6B 3JD2A 2ZIMA 1RPRA 1P7GA 3P30A 5IYBO 2QGNA 2UXCB 2LP7A 2HJDA 4FMTA 4RUFA 1TUBA 4B08A 2BE3A 3VQXA 1JMKC 1SQXH 1RFYA 4PDMA 1FXKC 5LGNA 1PD3A 4DK0A 3QNEA 1YCIA 4UVBA 1TUBB 4DUYO 2DYSB 4FLUA 2Q7GA 2JEXA 3TXSA 3A0RA 4GX1A 1MNGA 1S5LZ 1OJHA 4CH5A 3H01A 2IH3C 4F4LA 4CBCA 2CDYA 3B4SA 1PNMA 5CBGA 1DLBA 3QVNA 1BGYH 2DWDC 4NXMO 2QKSA 4AI8A 3G6EV 3DC5A 1R73A 3IGAC 4DO2A 3TETA 5J2TB 4C7UA 1XQ8A 2UUCO 1RM1B 4UCVA 3CX5F 4DR1O 2EBOA 3D36C 1R6KA 1NT2B 3STLC 2ZXWB 1SETA 3ZMZA 1BMFG 1VP7A 2W0XA 5IY5C 1EM1A 1YSCA 4MTOA 5B1OA 2KQXA 1ZL8A 4YJ2A 5GTIZ 2UUAB 1GMGA 4DR2O 4TQFA 1M5IA 1GM9A 1N33O 3B77A 1M9NA 4PA6A 2DMXA 1B04A 5LOVA 4IIJB 2F43G 3QO8A 1G4YB 2XOKG 2YXLA 2ITDC 5LL6Y 4MTXA 1Q6UA 5ITZB 4QPKA 3CB2A 2YEVA 2XHBA 2WWWA 4CH3A 4U3JB 5C93A 1K97A 1P49A 4JI4O 4RWUA 4JAUA 2YSUB 2HHHB 4YY3B 1BL8A 3JCZA 3JCUZ 3B8MA 4UFZA 2ZDIA 4PDVA 4X20B 4X1IA 5IE9A 3RYFA 4JI7B 1WPBA 3OT7A 2JVDA 3ASOB 1AP5A 3L72H 1XNQB 2VQFO 4UCUA 1IBMB 3OD4A 2RMKB 1ENVA 1H8HG 2PTMA 2WLLB 2WAMA 2Z3YA 2EIKB 4DV1O 4JYYA 4AQYO 4BAYA 1J5EB 2WLIA 2XTAA 4AILC 4GX5A 1VF7A 3CCUV 4X64O 3U11A 3WG7C 1JVMA 5LOVB 1OCOB 2ZCEA 2ZT9B 4TUYA 5KHIA 3S3WA 2XAQA 2Q9LA 4JYBA 5LMUB 1OCOC 3N2GB 2P06A 3STZC 4MVZA 3N2KB 5LP6A 3L70H 1JX9A 2LFRA 1VF5B 1GM8A 4X20A 4LF7O 5EK0A 3SJCC 3K5LA 1GTOA 2ZQMA 5CA1B 1NBMG 2JGDA 4W4LA 1SA0B 4JF3A 2RCVA 2IJHA 4W4KA 2LJ2A 4B3MO 2QM7A 4J80A 2IM9A 3TK1A 5CB4A 4ZI7A 2MW2B 2L6LA 1S77D 1Q82W 1JOYA 4FLTA 1KMIZ 4Z1MG 2FMLA 3C3SA 3MDSA 3CCVV 4NVPA 2EILB 2XASA 2A06H 5KMGA 4MVMA 5GONA 2UUAO 2CH7B 4IGGA 4K0KO 1YJNV 1N34B 4UCSA 3B8NA 4BIUA 2CGOA 1VQ5V 2ZDIC 1XMOO 2BTQB 3OEHG 3ML0A 1YJ9V 2QM8A 1O9HA 2DJVA 4DR1B 2DWEC 1GN2A 2OWOA 1ZTEA 2PGGA 1BT8A 5KAIZ 1X59A 2A3QA 4MVQA 1H2NA 4OXSA 1VQLV 2PYLA 2UU9B 5J2UB 4JYAO 5CN0A 4ZKIA 2X6CA 1K4CC 3PJSK 2YICA 1SQVH 2OCHA 5TISZ 4X62B 4NXNO 2RJZA 5DM6V 4DR4B 2OCCC 1SZTA 1SESA 4PHZA 1I5XA 3CC7V 1N33B 5D5PA 4FFBA 5JCOA 4JTAB 2PI4A 5H6RA 4JV5B 4BWAA 2CH7A 1HW7A 3ABKC 5KHHA 3D36A 4TV8A 4B3SB 2OTJV 2H94A 1P4RA 3ZMTA 2A7WA 1MA1A 4HBNA 4HNAB 4TT3G 1VARA 2JS3A 3CCRV 3K08A 2WA4A 4JAAA 1VQ6V 3ABUA 4K0KB 3MAQA 3WG7B 3RN4A 2YDEA 1NI8A 1AROP 1P84F 2BTOA 5FNVA 2DYRC 2MK3A 4MT8A 1N4CA 2LW1A 4O4JB 3UQ8A 2Y4UA 1AR4A 1H2SB 5KAFZ 2EIKC 3QTCA 3BHPA 4I4TA 5L3DA 2DYSC 1IDSA 1WN7A 5KUKA 3N2GA 4PDLA 4DV3B 5BR8B 4MVRA 4I9WA 3I56V 3CC4V 4TUYB 1RSOA 5CA3A 4FJCC 4FIPC 1XMQB 3ZRWB 4GUNA 4U7NA 1WNSA 2Q0AA 1H38A 5AG2A 5LMUO 3HR0A 3CRQA 4JZGA 1IJGA 4H44B 2V1DA 5DECA 4B3RO 5L3CA 1R3IC 1WPXA 2IU3A 1H8EG 1QLEB 3OW2U 2QWRB 1JNBA 4JI8B 2Y0IA 3JALB 3GWOA 3Q4HB 3JALA 1I0HA 2GDSA 4NKGB 5B66Z 5KHGA 4J7JA 3JD4A 2EJ7A 2ARHA 3K3WA 5C8YB 3TGUH 4J9YB 3MHSC 3LSUA 4JZ2A 3BCCH 2F93B 4X1YB 3NXSA 1WB7A 5B1NA 4Q20A 3L71H 1W2BU 2IW5A 5E79Z 1OHHG 2CE4A 1VEWA 3HKEB 1FD9A 3A0HZ 4FLYA 1SS3A 4X8AA 4PI0A 1XHXA 1FJGB 5JJNB 3T2MA 1HWYA 5FPOA 2LGWA 1VQ9V 2WLIB 2GBOA 1GM7A 4O4HB 4BIOA 1MZEA 3HKBB 4NTWA 1HNZB 1N0NA 4RQFA 2HFEC 4LWSA 4LF4B 1AVMA 4B3RB 5FNVB 1LUVA 2R9RB 1KKCA 3C3TA 2ZKOA 4ZOLB 4PA7A 4PELA 5JWPA 4UCRA 1SKVA 3T1HB 4OPAA 1L0NH 4YY3O 4LR3A 1GN4A 3ABKB 3OE7G 5JQGA 5FLXN 1YTFB 3D3IA 2VQEB 2E76B 4P9PA 4O2AB 1JJOA 4UXNA 1NTKH 4DV7B 4DR5O 2PI5A 1Z5VA 2XAHA 5ITZA 3CD6V 1G6UA 5J2UA 1AJPA 1F4MA 5KHKA 4JYAB 2ZE6A 3BRCA 4LF8B 4JI0B 4J7ZA 2A0LA 3EVKA 2PY5A 2V4DA 3KDRA 2JDIG 3ASOC 4HZ3A 1EZJA 3ZEDA 4CC6A 2P5OA 2WSSG 1M57C 3OR6C 1BE3H 4O4JA 2QKCA 4I0XB 1WA8B 4DW1A 1MSDA 1S3JA 4J9ZB 3E8FA 3SJBC 2XAJA 3CRMA 1IURA 3CCLV 3DXRA 4ZBMA 1WLEA 2JEUA 2HKOA 4DV7O 3CE2A 4EKWA 1K33A 4JI3O 5KLVH 2YIAA 3E2EA 4IHJB 3E8BA 1KUQA 2YI9A 3HPLC 4ICGA 2DE0X 3ZX6A 3T1HO 4I0XA 1EBOA 4IYHA 2XAGA 2W6JG 3CJHA 4X62O 3SYPA 3OEEG 1HNWB 2F1MA 2WA3A 3L74H 5LYJB 1PKXA 4DR7O 1UPGA 4J10A 2Y0PA 4FZ1A 3ZHSA 1BHAA 5CBFA 1DGSA 3JARB 4I50B 1GN6A 3AG1C 3DGEA 3O65A 1UFIA 4QJFB 3T1YB 1VQ7V 4LFCO 1LR1A 3JSNA 1K34A 1YVWA 4UV8A 3BEHA 1RM1C 3E22A 4MW3A 1YJWV 1U97A 4X66O 2WLHA 4O2BB 1WJZA 1CEZA 1NJIW 2Q7EA 1OCZB 3RYIA 2Y48A 3RFRA 4XDLA 1K7DA 1XMOB 5JQGB 2GUZB 3LNMB 1VMGA 2GSMB 3CMEV 4PA4A 4H37A 3ZJZA 4ASUG 4O4HA 4NTYA 3OUSA 4OX9O 1LNQA 1OV9A 3CXHF 5EC1C 5LGTA 3R66A 2GHYA 2KG7B 3CC2V 4EFBA 1K9MW 4MW8A 5JJEB 2W0FC 3ASNC 3ZMSA 1NQTA 4B3MB 1Y76B 2LQTA 4F6RB 4ZHQA 4LC1A 5LHIA 1JCHA 1M4UA 1SQBH 4JPRA 1S72V 1QHTA 5LBQA 3BA9A 3CP1A 4YHHO 3BPZA 1SF9A 4DRXA 4CH6A 2KSDA 1IZ3A 2HVKC 2V7QG 2IU0A 4TQDA 1DF5A 4DYLA 5EIBD 4O4IA 4X1IB 2Q73A 3SJQC 4GKJB 2QA4V 1W0JG 3UT5B 2HVJC 2QWOB 4WBNB 2F95B 1A32A 2UXDB 2CAZC 1YF2A 2HEPA 5JVDA 3MHHC 2DYRB 3Q4HA 3OMIB 1YIJV 4WFHA 3K5OA 4MTGA 3B09A 5IJ9A 1CP9A 3FD9A 1R3KC 2BOCC 4YJ3A 4A5UB 3F7VC 1ORQC 3D3QA 3AK2A 2FL4A 5BY1A 3ZRSA 2WLMA 4FZ0A 3FKSG 3A8TA 2DQ3A 3JAWA 2GV9A 3N27A 2B9ZA 3OR7C 3SGIA 4MVSA 4CS3A 2VS0A 1K3EA 4DR3B 4QNHB 2OYQA 2ZE7A 5IWAB 4K8ZA 3OGCC 1Q5OA 3ABTA 1F51A 3O9OA 4I4TB 1QNMA 3ETEA 1N36O 4JTDB 5JH7B 3KZIZ 4UV9A 1G1XB 3FB6C 2KG7A 4PA9A 1OCCB 4AHCA 1H2KA 4EEQA 5L3BA 4DV4O 2YI8A 4DR3O 4JASA 1Q6IA 3K57A 1XUQA 1AR5A 1B6QA 4IT5A 2NR5A 3KG2A 4NTXA 3ZIAG 4FFKA 4JI5B 1PL0A 1HDJA 4I50A 4LNUB 5BXZA 2FTKA 1YXBA 1K5SA 2JRIA 2OT5A 2KB1A 3AG4C 3K79A 5B5EZ 3CRCA 4JI2B 2YUAA 4H0LB 2XT9A 4BIZA 1XHZA 1JJ2U 4HNAA 1PV0A 4WFEA 2DW4A 4EB6A 1FJGO 1V9PA 3G4SV 5IYZA 1PNKA 2Z5UA 2OTLV 4B7EA 1OZ0A 3JAKB 3SYQA 2R9IA 3QO5A 5JH7A 2H8PC 4CH4A 3ZN1A 4LF8O 2P4KA 1VQ4V 3VQWA 1JPXA 4NYKA 3K5MA 1Z5WA 4LH6A 5EZYB 4CC5A 5KMGB 1FXVA 2CTWA 1PL4A 4R6ZA 2JJ2G 3J7AU 2VQEO 1Q81W 4DK1A 1R1BA 3X2QB 4DXWA 4FVMA 3HKCA 1N0JA 5L3FA 5EC2C 5A9GA 1MABG 4LWSB 2PF4E 4O2AA 3A0BZ 4U7OA 4TWKA 3QO7A 2FB5A 3M8AA 1FXKA 4Q6GA 3J80N 4LF4O 1M56C 2ZNJA 2F23A 5IY5B 1UJWB 1TVKA 2PUSA 2BTQA 1ZUQA 1JQ0A 1HNZO 1XMQO 1ZLZA 3LDCA 4DUZO 1NH2B 4DV1B 3RBZA 4X65B 2EIJC 4UCOA 2VQFB 1R6TA 1SA0A 3B40A 1MZFA 1GRJA 2EJRA 2R72A 3T4DA 3H1JH 1V55C 2QR4A 3BA8A 2Y69C 2NLJC 2IJKA 3ZHQA 4JYCA 2ADPA 3E89A 4MVUA 2JIZG 2LGQA 1AI4A 1YI2V 3SPIA 4XDJA 1NR7A 5IJ0B 2C2AA 3KKYA 1WB8A 3E83A 1WP7A 2O57A 1WP8A 1URFA 2WLLA 4R7CA 5A2QN 3L73H 4ZOLA 2CTQA 1KP2A 4JI5O 3GVMA 1XEQA 4LBEC 5LP6C 1L1FA 4JV5O 3QG5A 3W7TA 4JTCB 1S0VA 1I08A 4WBNA 4LFCB 5DEDA 4KXRA 4G28B 2UXBB 1Y76A 1DF4A 4JI4B 4BW5A 1MMMA 1KC8W 3ZRXA 1FOUA 4DR4O 4ABMA 1IX9A 1I5YA 5JJJB 4YXWG 2P90A 3OTOB 5IJ0A 5BR8O 4HYOA 2JK5C 4GKKO 1ZWIC 3AG4B 3ABMC 4R50A 5KUMA 4X9QA 3ZHUA 2RQ6A 3K0GA 2N04A 5LMNB 1E79G 4U3JA 1EFRG 2GTAA 3UO2A 3FB7C 3ZMUA 1L8DA 5KX5B 1US6A 4KFMA 5E1AC 5LMNO 5EYPB 3ZRWA 2YXHA 3W7WA 4DV2O 4JAVA 4TSFG 4JI2O 3RYHA 5IDJA 5K1PA 4QPJA 3RW0A 3X2QC 1I94B 1VQNV 3JARA 1D5NA 3ABLC 3CCEV 1ZL8B 3ASNB 1SQGA 2B5UA 2RDCA 2R9AA 4I9QA 5B3SB 3IAYA 3JYCA 2Q69A 4DUYB 2RN9A 1MSWD 1GH6A 4WFAV 2E5LB 1IBLB 3WB0A 2IBZH 2YS8A 1NZ6A 3LSQA 1PPJH 5B1BC 5HFMA 4FLWA 3L9DA 1YZBA 1VF6A 3T4ZA 3TCUA 1WA8A 3KCXA 4MVOA 5J2TA 3ZHRA 4I7ZB 1ZSPA 1P7BA 4G27B 2YXYA 3CXCU 3U10A 4CS2A 2EIJB 4JI1O 2OIEA 1QU7A 4EB6B 4N21A 2DN9A 1YHQV 4YIOA 3EFFK 1ROPA 2QM4A 4LF6B 4QE9A 2ITCC 2F4VO 2E75B 3FYEB 3RGBA 3D8CA 3K9SA 4LNUA 1XI1A 5JCOC 1KYOF 3HKCB 1XNQO 4FFBB 5IYZB 2AGAA 1KP3A 2CK3G 1QQCA 5FPRA 3ZBHA 5KHJA 1XL4A 2HLDG 4LF5O 1WAZA 4JI7O 4X89A 4DV5B 3HKBA 1Q6HA 5IYCO 4PJ0Z 3K0DA 3K03A 3LDDA 1S5JA 2K1EA 3HB3B 3I5DA 2Q67A 4P30A 3RWRD 3ZCCA 3FB8C 1PNLA 1SQQH 1AI5A 5CA0B 4TV9B 4DV5O 3IFXA 3JAWB 4GCZA 2E5LO 3R65A 4RUEA 1Y74B 2GTSA 3G6BA 2D2CB 3OUFA 4J41A 4J42A 1V54B 2ZM6B 4X1KA 1JFFB 1MOFA 1JR9A 3DTUB 1FYJA 3CHXA 1AJQA 3H1LH 4H33A 4E2LA 1XDCA 3THOA 1B06A 2QE7G 1D5AA 1E1RG 2YIDA 3IJ4A 4O4LB 1IBKB 4I55B 3K59A 1S76D 2E3CA 2WPDG 1KQSU 1GK9A 1AB3A 1N8RW 4UVCA 4JI1B 4LFAB 4FLXA 1K4DC 3VOUA 4O4IB 4F6RA 4FLVA 3CPWU 1Q3EA 2B1IA 1EN5A 2PYJA 3W7UA 3CYOA 2P4VA 4X88A 2R70A 1TA8A 1HNXB 1Q43A 1SQPH 4NXMB 4NXNB 5BMVA 3FFQA 4DR7B 1BZKA 4NR1A 4DR5B 3SPJA 4PI2A 2P7TC 1M93A 3OTFA 4B3SO 1MG1A 3BAAA 3UT5A 4JI6B 1NH2D 5C8YA 1KECA 2W6IG 3GWKC 1GN3A 5BMVB 3BY6A 4PV1B 4LFBB 1BSMA 1M57B 3JAMN 4GT1A 2AZ2A 3WB1A 5CA0A 2Q68A 3E8GA 3SPCA 4P2ZA 4BW9A 1IBKO 1CPYA 1N36B 3AG3B 5CBHA 5L3EA 2JGUA 5J9PC 1FKAO 3JATA 1SC5B 1IXBA 1Y66A 3ICXA 1H2GA 4FM2A 3ETGA 2QEXV 4KHPO 2EULA 2AXTZ 4CZZA 2DQ0A 1QR8A 2KKWA 4J11A 1RP3B 2AZ0A 1J95A 1Y74A 2ADQB 1F7YA 3K58A 1R6NA 3SDLA 2VRZA 1GKFA 2VWKA 5LYJA 4GKKB 3EHBB 2YIBA 3AG1B 2HP8A 1NTMH 3CCQV 4YHHB 5F2VO 2X7RB 3LSSA 3CCMV 4B3TB 4LF7B 1Q86W 2XNDG 3H1HH 3C90A 3K04A 4LF9B 1F23A 3HKDA 1THZA 4HAMA 1XNRB 2Q5ZA 4WFGA 5KA6A 3IC9A 3UO3A 4IL6Z 2Q7HA 5D5QA 1XILA 3VBBA 3FAVB 1V54C 5CMUA 4D7SA 1DK1A 4OPHA 1RPOA 2ZE8A 3GB7C 4CS4A 2UUBO 4H13B 2BCCH 3UKMA 3P3PA 4I5SA 2YC0A 3CMAV 4NB5A 2QSAA 3OMNB 1QVFU 4LCUC 5IT9N 1Q7YW 2F4VB 3E35A 5H9CA 4WFBV 4LF5B 2FKXA 2WLKA 3ZHTA 4LP8A 1K92A 2L35A 2A79B 3T1CA 2ZD9A 3CJHB 2QWPB 4D6TH 2WLNA 4K35A 4FK5C 1U96A 1H5WA 2ZE5A 1AJNA 1QLEC 3SYAA 3JASB 3VQYA 4E4EA 2Q4PA 3FYIB 1W0KG 1AR1B 3ZN0A 3WB2A 3LUTB 4OGQB 3OMAB 4GYCB 2UUBB 1VF6C 3ETDA 4ZIBA 2UXXA 1OCRC 2OIGA 3TXQA 2Q0OC 3CEIA 5IYDO 2AHYA 4U3FH 2HR3A 2QWNB 1R3LC 3TJTA 2ZR2A 2ATKC 4GZRB 2Q6AA 4K3AA 1AP6A 1LUWA 2EIMC 1VQ8V 5EIBC 3RVYA 3ABMB 1QR9A 3JATB 3E86A 4EFEA 3APQA 4GX0A 4JI6O 3OAAG 1SERA 4UVAA 3A2FA 1K73W 4JI3B 1FPOA 3U0ZA 3HKEA 1HNWO 2IJJA 1Q8IA 4L87A 2EZPA 4QIWF 2ZR3A 1N32B 3SJAC 1TUEB 1KU9A 1XREA 5CB4B 1TGOA 3WU2Z 4WCEV 4BR6A 1EN4A 3CWBH 1O9GA 4PA3A 3AG3C 1L0LH 5IJ9B 5H2FZ 2Q8VA 2JS5A 5LGUA 5HFLA 1XOUA 3F7YC 5JVDB 2QWQB 3ABLB 3EXAA 1PP9H 2BSKB 5LHHA 2QTOA 1VQKV 4QGPA 1XBLA 4QE7A 5LP6B 3I55V 3K9AA 5DN6G 1FFXB 2JJ1G 5KA5A 1QVGU 3CCSV 1BS3A 3G67A 3H1IH 2XUMA 3CCJV 1FS0G 1AI6A 2UUCB 4KUMA 2ODMA 3SYOA 3ZS8C 5B1AC 2GUZA 4P9OA 1SRYA 4DV4B 5EBWC 2X6BA 4O2BA 5GTHZ 3P32A 4IIJA 2IH1C 1N32O 1QCEA 1OCZC 3JD3A 1IXMA 3OTOO 1FFXA 3CRRA 3JASA 4I55A 1V55B 2BSKA 5IWAO 1FXKB 2Z0AA 3DC6A 3RYIB 4B7KA 1KD1W 5FL7G 4LFAO 3F5WC 4TV8B 1KB9F 4DR6B 5LHGA 4JGSA 1NVPB 4YJ2B 4YIPA 1B3QA 2UXCO 1M1KW 2HG5C 2LFSA 4MSWC 1J5EO 4DV6O 1CXZB 1QBZA 1N34O 3WFVA 1KBHA 1OCCC 1Y6XA 4N23A 2AW9A 3CRAA 5H5NA 5EBMC 2EZOA 2ZM6O 4UB6Z 3H1KH 3DXRB 4GLXA 3M99B 4DR6O 2BOBC 4X66B 1IVSA 3SYCA 2P6JA 5EZYA 2VWJA 1BQZA 3QF7A 2ZXWC 5LA6B 2LW7A 3AEIA 2HHHO 2FYUH 3BABA 5EBLC 1OCRB 4IHJA 4TOIA 4F6EA 4WF9V 4PDRA 4B3TO 1S5HC 1EZVH 2M7WA 3SPHA 1HP8A 3AG2B 2B1GA 3LDEA 4FM0A 5LXTB 3PN1A 3RVZA 1BCCH 1AILA 3KCYA 3OFNG 3J81N 2AHZA 1TVKB 2G38A 1PM9A 1R3JC 4Z1VA 2IJIA 1XNRO 3H9VA 5K1XA 1IBLO 4FLZA 2Y69B 3FX7A 2P67A 1M90W 2EINC 1COWG 4MTFA 5LA6A 2M6YA 1TAEA 4DR2B 2DOSA 1ZAUA 2EINB 1Z2GA 3G80A 1JA8A 1I94O 4AQYB 1H2MA 1K5QA 2NN4A 2X6AA 5GW7A 1H2LA 2QKAA 1EN6A 1AI7A 5KX5A 1SZXA 2QJ1A 1NR1A 2ETNA
chains in the Genus database with same CATH topology
3OT7A 1GN2A 1ZTEA 1IX9A 1MNGA 1BT8A 4YIPA 4GUNA 2CDYA 4YIOA 1N0JA 1AP5A 5A9GA 1EN5A 3QVNA 3AK1A 5AG2A 4X9QA 4JYYA 4JZGA 3DC5A 3IC9A 1XREA 3K9SA 3EVKA 1QNMA 3KDRA 1XILA 4BR6A 1EN4A 2AW9A 3BFRA 2QKCA 4C7UA 1ZUQA 1MSDA 1ZLZA 1Y67A 1GN3A 1I0HA 1BSMA 2GDSA 1XUQA 1AR5A 1EM1A 4F6EA 1BS3A 4FFKA 1D5NA 3LSUA 4JZ2A 1MA1A 1WB7A 1VARA 2RCVA 2CE4A 1VEWA 1PM9A 2ADPA 1IXBA 4E4EA 1P7GA 1N0NA 3RN4A 3C3SA 3MDSA 3KKYA 1WB8A 1AVMA 1JR9A 3AK3A 1AR4A 1LUVA 1KKCA 3CEIA 1JA8A 3C3TA 1ZSPA 3TJTA 2P4KA 1GN6A 1XDCA 1IDSA 2ADQB 1I08A 3DC6A 1B06A 2QKAA 1AP6A 1GN4A 1LUWA 1EN6A 3AK2A 1MMMA 1PL4A 1SZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT7 A;  1GN2 A;  1ZTE A;  1IX9 A;  1MNG A;  1BT8 A;  4YIP A;  4GUN A;  2CDY A;  4YIO A;  1N0J A;  1AP5 A;  5A9G A;  1EN5 A;  3QVN A;  3AK1 A;  5AG2 A;  4X9Q A;  4JYY A;  4JZG A;  3DC5 A;  3IC9 A;  1XRE A;  3K9S A;  3EVK A;  1QNM A;  1XIL A;  4BR6 A;  1EN4 A;  2AW9 A;  3BFR A;  2QKC A;  4C7U A;  1ZUQ A;  1MSD A;  1ZLZ A;  1Y67 A;  1GN3 A;  1I0H A;  1BSM A;  2GDS A;  1XUQ A;  1AR5 A;  1EM1 A;  4F6E A;  1BS3 A;  4FFK A;  1D5N A;  3LSU A;  4JZ2 A;  1MA1 A;  1WB7 A;  1VAR A;  2RCV A;  2CE4 A;  1VEW A;  1PM9 A;  2ADP A;  1IXB A;  4E4E A;  1P7G A;  1N0N A;  3RN4 A;  3C3S A;  3MDS A;  3KKY A;  1WB8 A;  1AVM A;  1JR9 A;  3AK3 A;  1AR4 A;  1LUV A;  1KKC A;  3CEI A;  1JA8 A;  3C3T A;  1ZSP A;  3TJT A;  2P4K A;  1GN6 A;  1XDC A;  1IDS A;  2ADQ B;  1I08 A;  3DC6 A;  1B06 A;  2QKA A;  1AP6 A;  1GN4 A;  1LUW A;  1EN6 A;  3AK2 A;  1MMM A;  1PL4 A;  1SZX A; 
#chains in the Genus database with same CATH topology
 3ZMV A;  1SQF A;  2ILM A;  1F4N A;  2F66 C;  3N2K A;  4X1Y A;  1VQM V;  3T1Y O;  3RYH B;  3JAK A;  3HKD B;  5B1A B;  3AK1 A;  1GAX A;  3RYC B;  4KP4 A;  2YIB D;  3AG7 A;  2ZIO A;  2N05 A;  1VQP V;  2JGD B;  3BFR A;  3RT3 C;  2H3O A;  4RAI A;  3ZRV A;  2LO1 A;  4UCT A;  1HNX O;  3L75 H;  3IC7 A;  2UU9 O;  5BZB A;  2EX3 A;  1G8M A;  3M7M X;  2UXB O;  3CSX A;  1I7F A;  5CA1 A;  4LFB O;  3JD0 A;  5GON B;  2CTR A;  2QTS A;  4J7K A;  2CTP A;  3OGI B;  1K8A W;  4KL1 A;  4XBF A;  3SR2 C;  1DTO A;  2EIL C;  1VIB A;  4D7T A;  4DW0 A;  2UXN A;  3W7X A;  4WFF A;  4DV2 B;  4ZI7 B;  1NVP D;  1W59 A;  3F5T A;  3FB5 C;  5EYP A;  3ZHV A;  4RQE A;  2UXD O;  3P3N A;  1NS1 A;  1HR0 B;  2QDO A;  3NR7 A;  4O4L A;  4UUJ C;  4TV9 A;  4MS2 A;  1BQ0 A;  3AK3 A;  2ZNI A;  3BVO A;  3MD0 A;  3S3X A;  4JI0 O;  4XDK A;  4DV0 O;  2EIM B;  4K8X A;  1NTZ H;  3VQV A;  5L3G A;  1M56 B;  1NKD A;  1ZX3 A;  1YIT V;  4X65 O;  1JFF A;  4YJ3 B;  2X0L A;  2YEV B;  4PD4 F;  4UB8 Z;  4DUZ B;  4L8J A;  3RYF B;  4JI8 O;  2Y4T A;  1E1Q G;  3JD1 A;  3APO A;  4LH7 A;  5H6Q A;  4DRX B;  2K9P A;  2HJF C;  1KKD A;  3AG2 C;  3W7S A;  3JSL A;  3UCS C;  1FXH A;  1YEW A;  1QLN A;  2OCC B;  2P22 C;  4FM1 A;  2XAF A;  4GKJ O;  1D2D A;  3RYC A;  3B2E E;  1Y4M A;  3CS5 A;  3ETQ A;  2CUG A;  4LF9 O;  3K5N A;  1Q90 D;  2N74 A;  2RNB A;  4OX9 B;  3K06 A;  2CGN A;  3DSQ A;  1FAF A;  3G71 V;  3E8H A;  3OM3 B;  4RO2 A;  2E74 B;  2WLJ A;  1FFT B;  2PZS A;  1Y67 A;  4FPP A;  4G2K A;  4DV3 O;  2ZIN A;  5B3S C;  1IBM O;  4R8C A;  4LF6 O;  4X1K B;  1XL6 A;  3E22 B;  3UM7 A;  1X4T A;  1RSO B;  4ZHQ B;  4DV0 B;  3SPG A;  4Z2W A;  5LXT A;  5B1B B;  1T5E A;  2D3O W;  1YTF D;  1HR0 O;  4X64 B;  2A9H A;  1GO3 F;  1NU1 H;  3LNN A;  1YDX A;  1VQO V;  4KHP B;  2NNU A;  1BHB A;  4IYI A;  3FAV A;  4GX2 A;  4DV6 B;  3JD2 A;  2ZIM A;  1RPR A;  1P7G A;  3P30 A;  5IYB O;  2QGN A;  2UXC B;  2LP7 A;  2HJD A;  4FMT A;  4RUF A;  1TUB A;  4B08 A;  2BE3 A;  3VQX A;  1JMK C;  1SQX H;  1RFY A;  4PDM A;  1FXK C;  5LGN A;  1PD3 A;  4DK0 A;  3QNE A;  1YCI A;  4UVB A;  1TUB B;  4DUY O;  2DYS B;  4FLU A;  2Q7G A;  2JEX A;  3TXS A;  3A0R A;  4GX1 A;  1MNG A;  1S5L Z;  1OJH A;  4CH5 A;  3H01 A;  2IH3 C;  4F4L A;  4CBC A;  2CDY A;  3B4S A;  1PNM A;  5CBG A;  1DLB A;  3QVN A;  1BGY H;  2DWD C;  4NXM O;  2QKS A;  4AI8 A;  3G6E V;  3DC5 A;  1R73 A;  3IGA C;  4DO2 A;  3TET A;  5J2T B;  4C7U A;  1XQ8 A;  2UUC O;  1RM1 B;  4UCV A;  3CX5 F;  4DR1 O;  2EBO A;  3D36 C;  1R6K A;  1NT2 B;  3STL C;  2ZXW B;  1SET A;  3ZMZ A;  1BMF G;  1VP7 A;  2W0X A;  5IY5 C;  1EM1 A;  1YSC A;  4MTO A;  5B1O A;  2KQX A;  1ZL8 A;  4YJ2 A;  5GTI Z;  2UUA B;  1GMG A;  4DR2 O;  4TQF A;  1M5I A;  1GM9 A;  1N33 O;  3B77 A;  1M9N A;  4PA6 A;  2DMX A;  1B04 A;  5LOV A;  4IIJ B;  2F43 G;  3QO8 A;  1G4Y B;  2XOK G;  2YXL A;  2ITD C;  5LL6 Y;  4MTX A;  1Q6U A;  5ITZ B;  4QPK A;  3CB2 A;  2YEV A;  2XHB A;  2WWW A;  4CH3 A;  4U3J B;  5C93 A;  1K97 A;  1P49 A;  4JI4 O;  4RWU A;  4JAU A;  2YSU B;  2HHH B;  4YY3 B;  1BL8 A;  3JCZ A;  3JCU Z;  3B8M A;  4UFZ A;  2ZDI A;  4PDV A;  4X20 B;  4X1I A;  5IE9 A;  3RYF A;  4JI7 B;  1WPB A;  3OT7 A;  2JVD A;  3ASO B;  1AP5 A;  3L72 H;  1XNQ B;  2VQF O;  4UCU A;  1IBM B;  3OD4 A;  2RMK B;  1ENV A;  1H8H G;  2PTM A;  2WLL B;  2WAM A;  2Z3Y A;  2EIK B;  4DV1 O;  4JYY A;  4AQY O;  4BAY A;  1J5E B;  2WLI A;  2XTA A;  4AIL C;  4GX5 A;  1VF7 A;  3CCU V;  4X64 O;  3U11 A;  3WG7 C;  1JVM A;  5LOV B;  1OCO B;  2ZCE A;  2ZT9 B;  4TUY A;  5KHI A;  3S3W A;  2XAQ A;  2Q9L A;  4JYB A;  5LMU B;  1OCO C;  3N2G B;  2P06 A;  3STZ C;  4MVZ A;  3N2K B;  5LP6 A;  3L70 H;  1JX9 A;  2LFR A;  1VF5 B;  1GM8 A;  4X20 A;  4LF7 O;  5EK0 A;  3SJC C;  3K5L A;  1GTO A;  2ZQM A;  5CA1 B;  1NBM G;  2JGD A;  4W4L A;  1SA0 B;  4JF3 A;  2RCV A;  2IJH A;  4W4K A;  2LJ2 A;  4B3M O;  2QM7 A;  4J80 A;  2IM9 A;  3TK1 A;  5CB4 A;  4ZI7 A;  2MW2 B;  2L6L A;  1S77 D;  1Q82 W;  1JOY A;  4FLT A;  1KMI Z;  4Z1M G;  2FML A;  3C3S A;  3MDS A;  3CCV V;  4NVP A;  2EIL B;  2XAS A;  2A06 H;  5KMG A;  4MVM A;  5GON A;  2UUA O;  2CH7 B;  4IGG A;  4K0K O;  1YJN V;  1N34 B;  4UCS A;  3B8N A;  4BIU A;  2CGO A;  1VQ5 V;  2ZDI C;  1XMO O;  2BTQ B;  3OEH G;  3ML0 A;  1YJ9 V;  2QM8 A;  1O9H A;  2DJV A;  4DR1 B;  2DWE C;  1GN2 A;  2OWO A;  1ZTE A;  2PGG A;  1BT8 A;  5KAI Z;  1X59 A;  2A3Q A;  4MVQ A;  1H2N A;  4OXS A;  1VQL V;  2PYL A;  2UU9 B;  5J2U B;  4JYA O;  5CN0 A;  4ZKI A;  2X6C A;  1K4C C;  3PJS K;  2YIC A;  1SQV H;  2OCH A;  5TIS Z;  4X62 B;  4NXN O;  2RJZ A;  5DM6 V;  4DR4 B;  2OCC C;  1SZT A;  1SES A;  4PHZ A;  1I5X A;  3CC7 V;  1N33 B;  5D5P A;  4FFB A;  5JCO A;  4JTA B;  2PI4 A;  5H6R A;  4JV5 B;  4BWA A;  2CH7 A;  1HW7 A;  3ABK C;  5KHH A;  3D36 A;  4TV8 A;  4B3S B;  2OTJ V;  2H94 A;  1P4R A;  3ZMT A;  2A7W A;  1MA1 A;  4HBN A;  4HNA B;  4TT3 G;  1VAR A;  2JS3 A;  3CCR V;  3K08 A;  2WA4 A;  4JAA A;  1VQ6 V;  3ABU A;  4K0K B;  3MAQ A;  3WG7 B;  3RN4 A;  2YDE A;  1NI8 A;  1ARO P;  1P84 F;  2BTO A;  5FNV A;  2DYR C;  2MK3 A;  4MT8 A;  1N4C A;  2LW1 A;  4O4J B;  3UQ8 A;  2Y4U A;  1AR4 A;  1H2S B;  5KAF Z;  2EIK C;  3QTC A;  3BHP A;  4I4T A;  5L3D A;  2DYS C;  1IDS A;  1WN7 A;  5KUK A;  3N2G A;  4PDL A;  4DV3 B;  5BR8 B;  4MVR A;  4I9W A;  3I56 V;  3CC4 V;  4TUY B;  1RSO A;  5CA3 A;  4FJC C;  4FIP C;  1XMQ B;  3ZRW B;  4GUN A;  4U7N A;  1WNS A;  2Q0A A;  1H38 A;  5AG2 A;  5LMU O;  3HR0 A;  3CRQ A;  4JZG A;  1IJG A;  4H44 B;  2V1D A;  5DEC A;  4B3R O;  5L3C A;  1R3I C;  1WPX A;  2IU3 A;  1H8E G;  1QLE B;  3OW2 U;  2QWR B;  1JNB A;  4JI8 B;  2Y0I A;  3JAL B;  3GWO A;  3Q4H B;  3JAL A;  1I0H A;  2GDS A;  4NKG B;  5B66 Z;  5KHG A;  4J7J A;  3JD4 A;  2EJ7 A;  2ARH A;  3K3W A;  5C8Y B;  3TGU H;  4J9Y B;  3MHS C;  3LSU A;  4JZ2 A;  3BCC H;  2F93 B;  4X1Y B;  3NXS A;  1WB7 A;  5B1N A;  4Q20 A;  3L71 H;  1W2B U;  2IW5 A;  5E79 Z;  1OHH G;  2CE4 A;  1VEW A;  3HKE B;  1FD9 A;  3A0H Z;  4FLY A;  1SS3 A;  4X8A A;  4PI0 A;  1XHX A;  1FJG B;  5JJN B;  3T2M A;  1HWY A;  5FPO A;  2LGW A;  1VQ9 V;  2WLI B;  2GBO A;  1GM7 A;  4O4H B;  4BIO A;  1MZE A;  3HKB B;  4NTW A;  1HNZ B;  1N0N A;  4RQF A;  2HFE C;  4LWS A;  4LF4 B;  1AVM A;  4B3R B;  5FNV B;  1LUV A;  2R9R B;  1KKC A;  3C3T A;  2ZKO A;  4ZOL B;  4PA7 A;  4PEL A;  5JWP A;  4UCR A;  1SKV A;  3T1H B;  4OPA A;  1L0N H;  4YY3 O;  4LR3 A;  1GN4 A;  3ABK B;  3OE7 G;  5JQG A;  5FLX N;  1YTF B;  3D3I A;  2VQE B;  2E76 B;  4P9P A;  4O2A B;  1JJO A;  4UXN A;  1NTK H;  4DV7 B;  4DR5 O;  2PI5 A;  1Z5V A;  2XAH A;  5ITZ A;  3CD6 V;  1G6U A;  5J2U A;  1AJP A;  1F4M A;  5KHK A;  4JYA B;  2ZE6 A;  3BRC A;  4LF8 B;  4JI0 B;  4J7Z A;  2A0L A;  3EVK A;  2PY5 A;  2V4D A;  3KDR A;  2JDI G;  3ASO C;  4HZ3 A;  1EZJ A;  3ZED A;  4CC6 A;  2P5O A;  2WSS G;  1M57 C;  3OR6 C;  1BE3 H;  4O4J A;  2QKC A;  4I0X B;  1WA8 B;  4DW1 A;  1MSD A;  1S3J A;  4J9Z B;  3E8F A;  3SJB C;  2XAJ A;  3CRM A;  1IUR A;  3CCL V;  3DXR A;  4ZBM A;  1WLE A;  2JEU A;  2HKO A;  4DV7 O;  3CE2 A;  4EKW A;  1K33 A;  4JI3 O;  5KLV H;  2YIA A;  3E2E A;  4IHJ B;  3E8B A;  1KUQ A;  2YI9 A;  3HPL C;  4ICG A;  2DE0 X;  3ZX6 A;  3T1H O;  4I0X A;  1EBO A;  4IYH A;  2XAG A;  2W6J G;  3CJH A;  4X62 O;  3SYP A;  3OEE G;  1HNW B;  2F1M A;  2WA3 A;  3L74 H;  5LYJ B;  1PKX A;  4DR7 O;  1UPG A;  4J10 A;  2Y0P A;  4FZ1 A;  3ZHS A;  1BHA A;  5CBF A;  1DGS A;  3JAR B;  4I50 B;  1GN6 A;  3AG1 C;  3DGE A;  3O65 A;  1UFI A;  4QJF B;  3T1Y B;  1VQ7 V;  4LFC O;  1LR1 A;  3JSN A;  1K34 A;  1YVW A;  4UV8 A;  3BEH A;  1RM1 C;  3E22 A;  4MW3 A;  1YJW V;  1U97 A;  4X66 O;  2WLH A;  4O2B B;  1WJZ A;  1CEZ A;  1NJI W;  2Q7E A;  1OCZ B;  3RYI A;  2Y48 A;  3RFR A;  4XDL A;  1K7D A;  1XMO B;  5JQG B;  2GUZ B;  3LNM B;  1VMG A;  2GSM B;  3CME V;  4PA4 A;  4H37 A;  3ZJZ A;  4ASU G;  4O4H A;  4NTY A;  3OUS A;  4OX9 O;  1LNQ A;  1OV9 A;  3CXH F;  5EC1 C;  5LGT A;  3R66 A;  2GHY A;  2KG7 B;  3CC2 V;  4EFB A;  1K9M W;  4MW8 A;  5JJE B;  2W0F C;  3ASN C;  3ZMS A;  1NQT A;  4B3M B;  1Y76 B;  2LQT A;  4F6R B;  4ZHQ A;  4LC1 A;  5LHI A;  1JCH A;  1M4U A;  1SQB H;  4JPR A;  1S72 V;  1QHT A;  5LBQ A;  3BA9 A;  3CP1 A;  4YHH O;  3BPZ A;  1SF9 A;  4DRX A;  4CH6 A;  2KSD A;  1IZ3 A;  2HVK C;  2V7Q G;  2IU0 A;  4TQD A;  1DF5 A;  4DYL A;  5EIB D;  4O4I A;  4X1I B;  2Q73 A;  3SJQ C;  4GKJ B;  2QA4 V;  1W0J G;  3UT5 B;  2HVJ C;  2QWO B;  4WBN B;  2F95 B;  1A32 A;  2UXD B;  2CAZ C;  1YF2 A;  2HEP A;  5JVD A;  3MHH C;  2DYR B;  3Q4H A;  3OMI B;  1YIJ V;  4WFH A;  3K5O A;  4MTG A;  3B09 A;  5IJ9 A;  1CP9 A;  3FD9 A;  1R3K C;  2BOC C;  4YJ3 A;  4A5U B;  3F7V C;  1ORQ C;  3D3Q A;  3AK2 A;  2FL4 A;  5BY1 A;  3ZRS A;  2WLM A;  4FZ0 A;  3FKS G;  3A8T A;  2DQ3 A;  3JAW A;  2GV9 A;  3N27 A;  2B9Z A;  3OR7 C;  3SGI A;  4MVS A;  4CS3 A;  2VS0 A;  1K3E A;  4DR3 B;  4QNH B;  2OYQ A;  2ZE7 A;  5IWA B;  4K8Z A;  3OGC C;  1Q5O A;  3ABT A;  1F51 A;  3O9O A;  4I4T B;  1QNM A;  3ETE A;  1N36 O;  4JTD B;  5JH7 B;  3KZI Z;  4UV9 A;  1G1X B;  3FB6 C;  2KG7 A;  4PA9 A;  1OCC B;  4AHC A;  1H2K A;  4EEQ A;  5L3B A;  4DV4 O;  2YI8 A;  4DR3 O;  4JAS A;  1Q6I A;  3K57 A;  1XUQ A;  1AR5 A;  1B6Q A;  4IT5 A;  2NR5 A;  3KG2 A;  4NTX A;  3ZIA G;  4FFK A;  4JI5 B;  1PL0 A;  1HDJ A;  4I50 A;  4LNU B;  5BXZ A;  2FTK A;  1YXB A;  1K5S A;  2JRI A;  2OT5 A;  2KB1 A;  3AG4 C;  3K79 A;  5B5E Z;  3CRC A;  4JI2 B;  2YUA A;  4H0L B;  2XT9 A;  4BIZ A;  1XHZ A;  1JJ2 U;  4HNA A;  1PV0 A;  4WFE A;  2DW4 A;  4EB6 A;  1FJG O;  1V9P A;  3G4S V;  5IYZ A;  1PNK A;  2Z5U A;  2OTL V;  4B7E A;  1OZ0 A;  3JAK B;  3SYQ A;  2R9I A;  3QO5 A;  5JH7 A;  2H8P C;  4CH4 A;  3ZN1 A;  4LF8 O;  2P4K A;  1VQ4 V;  3VQW A;  1JPX A;  4NYK A;  3K5M A;  1Z5W A;  4LH6 A;  5EZY B;  4CC5 A;  5KMG B;  1FXV A;  2CTW A;  1PL4 A;  4R6Z A;  2JJ2 G;  3J7A U;  2VQE O;  1Q81 W;  4DK1 A;  1R1B A;  3X2Q B;  4DXW A;  4FVM A;  3HKC A;  1N0J A;  5L3F A;  5EC2 C;  5A9G A;  1MAB G;  4LWS B;  2PF4 E;  4O2A A;  3A0B Z;  4U7O A;  4TWK A;  3QO7 A;  2FB5 A;  3M8A A;  1FXK A;  4Q6G A;  3J80 N;  4LF4 O;  1M56 C;  2ZNJ A;  2F23 A;  5IY5 B;  1UJW B;  1TVK A;  2PUS A;  2BTQ A;  1ZUQ A;  1JQ0 A;  1HNZ O;  1XMQ O;  1ZLZ A;  3LDC A;  4DUZ O;  1NH2 B;  4DV1 B;  3RBZ A;  4X65 B;  2EIJ C;  4UCO A;  2VQF B;  1R6T A;  1SA0 A;  3B40 A;  1MZF A;  1GRJ A;  2EJR A;  2R72 A;  3T4D A;  3H1J H;  1V55 C;  2QR4 A;  3BA8 A;  2Y69 C;  2NLJ C;  2IJK A;  3ZHQ A;  4JYC A;  2ADP A;  3E89 A;  4MVU A;  2JIZ G;  2LGQ A;  1AI4 A;  1YI2 V;  3SPI A;  4XDJ A;  1NR7 A;  5IJ0 B;  2C2A A;  3KKY A;  1WB8 A;  3E83 A;  1WP7 A;  2O57 A;  1WP8 A;  1URF A;  2WLL A;  4R7C A;  5A2Q N;  3L73 H;  4ZOL A;  2CTQ A;  1KP2 A;  4JI5 O;  3GVM A;  1XEQ A;  4LBE C;  5LP6 C;  1L1F A;  4JV5 O;  3QG5 A;  3W7T A;  4JTC B;  1S0V A;  1I08 A;  4WBN A;  4LFC B;  5DED A;  4KXR A;  4G28 B;  2UXB B;  1Y76 A;  1DF4 A;  4JI4 B;  4BW5 A;  1MMM A;  1KC8 W;  3ZRX A;  1FOU A;  4DR4 O;  4ABM A;  1IX9 A;  1I5Y A;  5JJJ B;  4YXW G;  2P90 A;  3OTO B;  5IJ0 A;  5BR8 O;  4HYO A;  2JK5 C;  4GKK O;  1ZWI C;  3AG4 B;  3ABM C;  4R50 A;  5KUM A;  4X9Q A;  3ZHU A;  2RQ6 A;  3K0G A;  2N04 A;  5LMN B;  1E79 G;  4U3J A;  1EFR G;  2GTA A;  3UO2 A;  3FB7 C;  3ZMU A;  1L8D A;  5KX5 B;  1US6 A;  4KFM A;  5E1A C;  5LMN O;  5EYP B;  3ZRW A;  2YXH A;  3W7W A;  4DV2 O;  4JAV A;  4TSF G;  4JI2 O;  3RYH A;  5IDJ A;  5K1P A;  4QPJ A;  3RW0 A;  3X2Q C;  1I94 B;  1VQN V;  3JAR A;  1D5N A;  3ABL C;  3CCE V;  1ZL8 B;  3ASN B;  1SQG A;  2B5U A;  2RDC A;  2R9A A;  4I9Q A;  5B3S B;  3IAY A;  3JYC A;  2Q69 A;  4DUY B;  2RN9 A;  1MSW D;  1GH6 A;  4WFA V;  2E5L B;  1IBL B;  3WB0 A;  2IBZ H;  2YS8 A;  1NZ6 A;  3LSQ A;  1PPJ H;  5B1B C;  5HFM A;  4FLW A;  3L9D A;  1YZB A;  1VF6 A;  3T4Z A;  3TCU A;  1WA8 A;  3KCX A;  4MVO A;  5J2T A;  3ZHR A;  4I7Z B;  1ZSP A;  1P7B A;  4G27 B;  2YXY A;  3CXC U;  3U10 A;  4CS2 A;  2EIJ B;  4JI1 O;  2OIE A;  1QU7 A;  4EB6 B;  4N21 A;  2DN9 A;  1YHQ V;  4YIO A;  3EFF K;  1ROP A;  2QM4 A;  4LF6 B;  4QE9 A;  2ITC C;  2F4V O;  2E75 B;  3FYE B;  3RGB A;  3D8C A;  3K9S A;  4LNU A;  1XI1 A;  5JCO C;  1KYO F;  3HKC B;  1XNQ O;  4FFB B;  5IYZ B;  2AGA A;  1KP3 A;  2CK3 G;  1QQC A;  5FPR A;  3ZBH A;  5KHJ A;  1XL4 A;  2HLD G;  4LF5 O;  1WAZ A;  4JI7 O;  4X89 A;  4DV5 B;  3HKB A;  1Q6H A;  5IYC O;  4PJ0 Z;  3K0D A;  3K03 A;  3LDD A;  1S5J A;  2K1E A;  3HB3 B;  3I5D A;  2Q67 A;  4P30 A;  3RWR D;  3ZCC A;  3FB8 C;  1PNL A;  1SQQ H;  1AI5 A;  5CA0 B;  4TV9 B;  4DV5 O;  3IFX A;  3JAW B;  4GCZ A;  2E5L O;  3R65 A;  4RUE A;  1Y74 B;  2GTS A;  3G6B A;  2D2C B;  3OUF A;  4J41 A;  4J42 A;  1V54 B;  2ZM6 B;  4X1K A;  1JFF B;  1MOF A;  1JR9 A;  3DTU B;  1FYJ A;  3CHX A;  1AJQ A;  3H1L H;  4H33 A;  4E2L A;  1XDC A;  3THO A;  1B06 A;  2QE7 G;  1D5A A;  1E1R G;  2YID A;  3IJ4 A;  4O4L B;  1IBK B;  4I55 B;  3K59 A;  1S76 D;  2E3C A;  2WPD G;  1KQS U;  1GK9 A;  1AB3 A;  1N8R W;  4UVC A;  4JI1 B;  4LFA B;  4FLX A;  1K4D C;  3VOU A;  4O4I B;  4F6R A;  4FLV A;  3CPW U;  1Q3E A;  2B1I A;  1EN5 A;  2PYJ A;  3W7U A;  3CYO A;  2P4V A;  4X88 A;  2R70 A;  1TA8 A;  1HNX B;  1Q43 A;  1SQP H;  4NXM B;  4NXN B;  5BMV A;  3FFQ A;  4DR7 B;  1BZK A;  4NR1 A;  4DR5 B;  3SPJ A;  4PI2 A;  2P7T C;  1M93 A;  3OTF A;  4B3S O;  1MG1 A;  3BAA A;  3UT5 A;  4JI6 B;  1NH2 D;  5C8Y A;  1KEC A;  2W6I G;  3GWK C;  1GN3 A;  5BMV B;  3BY6 A;  4PV1 B;  4LFB B;  1BSM A;  1M57 B;  3JAM N;  4GT1 A;  2AZ2 A;  3WB1 A;  5CA0 A;  2Q68 A;  3E8G A;  3SPC A;  4P2Z A;  4BW9 A;  1IBK O;  1CPY A;  1N36 B;  3AG3 B;  5CBH A;  5L3E A;  2JGU A;  5J9P C;  1FKA O;  3JAT A;  1SC5 B;  1IXB A;  1Y66 A;  3ICX A;  1H2G A;  4FM2 A;  3ETG A;  2QEX V;  4KHP O;  2EUL A;  2AXT Z;  4CZZ A;  2DQ0 A;  1QR8 A;  2KKW A;  4J11 A;  1RP3 B;  2AZ0 A;  1J95 A;  1Y74 A;  2ADQ B;  1F7Y A;  3K58 A;  1R6N A;  3SDL A;  2VRZ A;  1GKF A;  2VWK A;  5LYJ A;  4GKK B;  3EHB B;  2YIB A;  3AG1 B;  2HP8 A;  1NTM H;  3CCQ V;  4YHH B;  5F2V O;  2X7R B;  3LSS A;  3CCM V;  4B3T B;  4LF7 B;  1Q86 W;  2XND G;  3H1H H;  3C90 A;  3K04 A;  4LF9 B;  1F23 A;  3HKD A;  1THZ A;  4HAM A;  1XNR B;  2Q5Z A;  4WFG A;  5KA6 A;  3IC9 A;  3UO3 A;  4IL6 Z;  2Q7H A;  5D5Q A;  1XIL A;  3VBB A;  3FAV B;  1V54 C;  5CMU A;  4D7S A;  1DK1 A;  4OPH A;  1RPO A;  2ZE8 A;  3GB7 C;  4CS4 A;  2UUB O;  4H13 B;  2BCC H;  3UKM A;  3P3P A;  4I5S A;  2YC0 A;  3CMA V;  4NB5 A;  2QSA A;  3OMN B;  1QVF U;  4LCU C;  5IT9 N;  1Q7Y W;  2F4V B;  3E35 A;  5H9C A;  4WFB V;  4LF5 B;  2FKX A;  2WLK A;  3ZHT A;  4LP8 A;  1K92 A;  2L35 A;  2A79 B;  3T1C A;  2ZD9 A;  3CJH B;  2QWP B;  4D6T H;  2WLN A;  4K35 A;  4FK5 C;  1U96 A;  1H5W A;  2ZE5 A;  1AJN A;  1QLE C;  3SYA A;  3JAS B;  3VQY A;  4E4E A;  2Q4P A;  3FYI B;  1W0K G;  1AR1 B;  3ZN0 A;  3WB2 A;  3LUT B;  4OGQ B;  3OMA B;  4GYC B;  2UUB B;  1VF6 C;  3ETD A;  4ZIB A;  2UXX A;  1OCR C;  2OIG A;  3TXQ A;  2Q0O C;  3CEI A;  5IYD O;  2AHY A;  4U3F H;  2HR3 A;  2QWN B;  1R3L C;  3TJT A;  2ZR2 A;  2ATK C;  4GZR B;  2Q6A A;  4K3A A;  1AP6 A;  1LUW A;  2EIM C;  1VQ8 V;  5EIB C;  3RVY A;  3ABM B;  1QR9 A;  3JAT B;  3E86 A;  4EFE A;  3APQ A;  4GX0 A;  4JI6 O;  3OAA G;  1SER A;  4UVA A;  3A2F A;  1K73 W;  4JI3 B;  1FPO A;  3U0Z A;  3HKE A;  1HNW O;  2IJJ A;  1Q8I A;  4L87 A;  2EZP A;  4QIW F;  2ZR3 A;  1N32 B;  3SJA C;  1TUE B;  1KU9 A;  1XRE A;  5CB4 B;  1TGO A;  3WU2 Z;  4WCE V;  4BR6 A;  1EN4 A;  3CWB H;  1O9G A;  4PA3 A;  3AG3 C;  1L0L H;  5IJ9 B;  5H2F Z;  2Q8V A;  2JS5 A;  5LGU A;  5HFL A;  1XOU A;  3F7Y C;  5JVD B;  2QWQ B;  3ABL B;  3EXA A;  1PP9 H;  2BSK B;  5LHH A;  2QTO A;  1VQK V;  4QGP A;  1XBL A;  4QE7 A;  5LP6 B;  3I55 V;  3K9A A;  5DN6 G;  1FFX B;  2JJ1 G;  5KA5 A;  1QVG U;  3CCS V;  1BS3 A;  3G67 A;  3H1I H;  2XUM A;  3CCJ V;  1FS0 G;  1AI6 A;  2UUC B;  4KUM A;  2ODM A;  3SYO A;  3ZS8 C;  5B1A C;  2GUZ A;  4P9O A;  1SRY A;  4DV4 B;  5EBW C;  2X6B A;  4O2B A;  5GTH Z;  3P32 A;  4IIJ A;  2IH1 C;  1N32 O;  1QCE A;  1OCZ C;  3JD3 A;  1IXM A;  3OTO O;  1FFX A;  3CRR A;  3JAS A;  4I55 A;  1V55 B;  2BSK A;  5IWA O;  1FXK B;  2Z0A A;  3DC6 A;  3RYI B;  4B7K A;  1KD1 W;  5FL7 G;  4LFA O;  3F5W C;  4TV8 B;  1KB9 F;  4DR6 B;  5LHG A;  4JGS A;  1NVP B;  4YJ2 B;  4YIP A;  1B3Q A;  2UXC O;  1M1K W;  2HG5 C;  2LFS A;  4MSW C;  1J5E O;  4DV6 O;  1CXZ B;  1QBZ A;  1N34 O;  3WFV A;  1KBH A;  1OCC C;  1Y6X A;  4N23 A;  2AW9 A;  3CRA A;  5H5N A;  5EBM C;  2EZO A;  2ZM6 O;  4UB6 Z;  3H1K H;  3DXR B;  4GLX A;  3M99 B;  4DR6 O;  2BOB C;  4X66 B;  1IVS A;  3SYC A;  2P6J A;  5EZY A;  2VWJ A;  1BQZ A;  3QF7 A;  2ZXW C;  5LA6 B;  2LW7 A;  3AEI A;  2HHH O;  2FYU H;  3BAB A;  5EBL C;  1OCR B;  4IHJ A;  4TOI A;  4F6E A;  4WF9 V;  4PDR A;  4B3T O;  1S5H C;  1EZV H;  2M7W A;  3SPH A;  1HP8 A;  3AG2 B;  2B1G A;  3LDE A;  4FM0 A;  5LXT B;  3PN1 A;  3RVZ A;  1BCC H;  1AIL A;  3KCY A;  3OFN G;  3J81 N;  2AHZ A;  1TVK B;  2G38 A;  1PM9 A;  1R3J C;  4Z1V A;  2IJI A;  1XNR O;  3H9V A;  5K1X A;  1IBL O;  4FLZ A;  2Y69 B;  3FX7 A;  2P67 A;  1M90 W;  2EIN C;  1COW G;  4MTF A;  5LA6 A;  2M6Y A;  1TAE A;  4DR2 B;  2DOS A;  1ZAU A;  2EIN B;  1Z2G A;  3G80 A;  1JA8 A;  1I94 O;  4AQY B;  1H2M A;  1K5Q A;  2NN4 A;  2X6A A;  5GW7 A;  1H2L A;  2QKA A;  1EN6 A;  1AI7 A;  5KX5 A;  1SZX A;  2QJ1 A;  1NR1 A;  2ETN A; 
#chains in the Genus database with same CATH homology
 3OT7 A;  1GN2 A;  1ZTE A;  1IX9 A;  1MNG A;  1BT8 A;  4YIP A;  4GUN A;  2CDY A;  4YIO A;  1N0J A;  1AP5 A;  5A9G A;  1EN5 A;  3QVN A;  3AK1 A;  5AG2 A;  4X9Q A;  4JYY A;  4JZG A;  3DC5 A;  3IC9 A;  1XRE A;  3K9S A;  3EVK A;  1QNM A;  3KDR A;  1XIL A;  4BR6 A;  1EN4 A;  2AW9 A;  3BFR A;  2QKC A;  4C7U A;  1ZUQ A;  1MSD A;  1ZLZ A;  1Y67 A;  1GN3 A;  1I0H A;  1BSM A;  2GDS A;  1XUQ A;  1AR5 A;  1EM1 A;  4F6E A;  1BS3 A;  4FFK A;  1D5N A;  3LSU A;  4JZ2 A;  1MA1 A;  1WB7 A;  1VAR A;  2RCV A;  2CE4 A;  1VEW A;  1PM9 A;  2ADP A;  1IXB A;  4E4E A;  1P7G A;  1N0N A;  3RN4 A;  3C3S A;  3MDS A;  3KKY A;  1WB8 A;  1AVM A;  1JR9 A;  3AK3 A;  1AR4 A;  1LUV A;  1KKC A;  3CEI A;  1JA8 A;  3C3T A;  1ZSP A;  3TJT A;  2P4K A;  1GN6 A;  1XDC A;  1IDS A;  2ADQ B;  1I08 A;  3DC6 A;  1B06 A;  2QKA A;  1AP6 A;  1GN4 A;  1LUW A;  1EN6 A;  3AK2 A;  1MMM A;  1PL4 A;  1SZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...