1WBJA

Wildtype tryptophan synthase complexed with glycerol phosphate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Structural Basis of the Catalytic Mechanism and the Regulation of the Alpha Subunit of Tryptophan Synthase from Salmonella Typhimurium and Bx1 from Maize, Two Evolutionarily Related Enzymes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 101
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1wbjA00
1F74A 5U7SA 4O13A 1YDVA 3W7GA 3TKFA 5G5IA 3LHVA 5K9DA 4ML9A 5D30A 2YXGA 2PRLA 3EX1A 3B0VC 2NUXA 3S8HA 3B05A 4ORIA 1JCYA 3GR8A 4P61A 3PUOA 2RKXA 1LROA 1KBJA 1Z48A 1KFJA 1VLIA 2OMAA 5DBUA 4RXGA 4IXXA 4X3ZA 3MO7A 5D05A 3WK0A 2I1OA 2FLIA 3KXQA 1B9BA 1D3HA 2QCGA 1OK6A 3NPUA 4AVFA 4XBKA 3NQ8A 3HGRA 1DV7A 3GKAA 4MJZA 5EYWA 4GUFA 3M43A 3DH7A 4AAJA 4DO5A 1H7XA 5F1UA 1LP6A 3UPBA 3G18A 3VI2A 6ALDA 3G1YA 3FJ6A 3BLIA 3NVTA 1NSJA 1Z41A 4MZYA 1OFRA 4JXCA 5CPOA 4WOZA 1DORA 3TJLA 3P74A 4JTIA 3GNNA 3LI1A 3I6RA 3GDRA 1O5XA 4IX2A 4RKAA 1Z44A 5CPNA 1PCWA 4FNQA 3NQVA 1ZALA 2Y62A 1WBHA 1H51A 2C1HA 4CNOA 1OHLA 5C55A 4UTWC 3CEPA 2WOQA 3DHDA 3LCLA 3MBFA 4Z0JA 3PR2A 2NV1A 4M6PA 3NQCA 3A24A 5H2ZA 5LGZA 2NX1A 3CIWA 1VHCA 2CWNA 1OX4A 5CZJA 3EWXA 4DELA 3O06A 1FWWA 3GDTA 1HL2A 4GRSA 1PE1A 1VCGA 4LRTA 3N9SA 1K8XA 3M5VA 4BF9A 1PCKA 1L6SA 1GG1A 1XDMA 4FIRA 1HG3A 2ZZ7A 3FS2A 3CLMA 4LVBA 4Q4KA 2X2GA 1F6PA 1JCNA 2QCFA 1KFEA 2ZZ1A 1TV8A 2CFFA 2F7FA 4AB4A 3CWOX 1YTDA 4ZQMA 2NWRA 4WOQA 2HTMA 3N73A 4O1AA 4FNUA 4LVGA 4WY0F 4AF0B 3LTYA 1N7KA 3QZEA 2NWSA 4XZ9A 2CLHA 3TMLA 1AMKA 2NXGA 5I3HA 1VH7A 1QDSA 4LT9A 4YCPA 4UTTC 3BW3A 3STFA 4O57A 3L5AA 1TTJA 1M6JA 2WSRA 1EA0A 2R14A 3L0GA 1YADA 3TAKA 2TYSA 3G22A 4LTSA 1KFLA 1OFBA 1DL3A 5F2MA 2VFGA 1LOQA 3LHYA 3QRHA 5T26A 1R30A 5EKYA 1I8JA 5KZMA 4M7SA 4O1CA 4NZFA 1OX6A 1L9WA 3LCXA 5F4WA 3QC3A 4JN6A 2Q8ZA 1FX6A 1WXJA 3VCRA 1TQJA 5AHIA 1FWSA 3DFNA 4K37A 2C19A 3L67A 4CQ8A 1OFDA 4O8RA 5K9CA 2I9EA 3GZ3A 5LGXA 3PBWA 4PA8A 3QPYA 3FYOA 1FBAA 4LOCA 5H91A 3IV3A 2YYTA 5HINA 2V82A 1VZWA 2J6XA 5K9XA 2DU2A 3TJXA 4OGZA 1O4UA 2I14A 3GDLA 4IUOA 3W75A 2KZHA 4MFDA 2EPHA 4R7JA 2ZRYA 5LSMA 1YYAA 1YPIA 1EP3A 1HTIA 3W76A 5BOOA 1LBFA 3SSJA 4NXKA 2Y7FA 4UCGA 1JUBA 3G1VA 3W6YA 4IX0A 4S2BA 2ZRVA 1TO3A 2EHHA 2ZTJA 3OA3A 3R2GA 2C13A 4MIMA 4KKXA 1UUMA 2R8WA 4N9EA 5F2IA 1SQ7A 4LY8A 4N4PA 5HMSA 2WNQA 3YPIA 5E0KA 2Q3OA 4EOUA 4UIOA 4LU0A 2YPIA 3TFCA 2DP3A 2G96A 1TPEA 4K36A 4JYFA 2X1TA 4QM1A 2B0MA 3BGJA 2Z6JA 1LZOA 3LV5A 3I65A 1XC4A 5D2TA 1TJRA 2FFCA 3ABRA 1SO5A 4FNTA 3TQKA 2FIQA 3STEA 4I7VA 1TSIA 1Q6QA 3UWVA 2OJPA 4YCOA 4HN4A 4DBEA 1IIGA 4LUJA 4DPQA 4AHQA 4TU1A 4GUIA 4UMAA 3TDFA 2WSYA 1DVJA 4UNLA 1GEQA 1TTQA 1OFEA 1JCMP 5HWJA 1QPOA 1QPRA 4HSOA 2FDSA 4PL1A 3HIJA 5G2WA 1J4EA 1JRCA 4UFMA 3NYZA 1ONRA 4MJMA 1KBIA 1EWEA 1ZFJA 3SI9A 3GXTA 4IMDA 3V75A 1AW5A 4JICA 3QF0A 5AC7A 3W7MA 3EWYA 4JS3A 4YMZA 1DOSA 1J2WA 1ZCOA 4KFPA 3P80A 3TCEA 4IXHA 3TA6A 1A50A 1ZNNA 1W3NA 3UY8A 1W5QA 4OE7A 2QF7A 1S5WA 2E5CA 3G1AA 3KRUA 3O07A 3TROA 3VE9A 3W1UA 1OYCA 2H8XA 3QEZA 1EP2A 1F7BA 1FCVA 1VR6A 2TPSA 5AYXA 4MY9A 4ADUA 3GR7A 2VFDA 4N4QA 2CW6A 1KM1A 1SZGA 1ALDA 3M44A 4HPXA 1LBLA 3NDOA 3W1AA 2ALDA 3CTLA 1ZHAA 1VYSX 3CIXA 4K7YA 4UR7A 2CLIA 4RR4A 4MVAA 2GQ8A 4JY9A 3HG5A 3TQ0A 4WD0A 1QO2A 3LCWA 4UUIA 2Z1BA 2NX3A 1XL9A 5K4ZA 1LLWA 2VFIA 3IVSA 3BLFA 5G1TA 4MY8A 2A7RA 2A5HA 2PC4A 3W74A 3LCIA 2OCZA 1S5TA 3SJ3A 3CWNA 3CM4A 3KFTA 3N2XA 2ZYFA 4WXYA 1NVMA 3WK3A 3C56A 4M6VA 3C61A 3WFAA 3NZ1A 1FQ0A 2FPVA 3FLUA 3M6YA 4UFLA 1GPWA 2G95A 5AOUA 5G2HA 5DELA 2WJZA 1XM3A 2JKPA 3C52A 5CSSA 4BFAA 5I3GA 3LDVA 3M0ZA 4QISA 4LVDA 1ZAHA 1FCBA 4FX8A 4ZQOA 1K8ZA 4R33A 5FI8A 1KM2A 1OFOA 3W70A 3W72A 5KZDA 1HUVA 1VQTA 1U5JA 3RLUA 5EMUA 2E5BA 3W7PA 5DBTA 4Y9AA 5BW6A 1U83A 1X7FA 4Q33A 3R8RA 1YXCA 5C2XA 4S2CA 3BG3A 2QUUA 4PEKA 1B4KA 5G4EA 4JYDA 4A22A 2BXVA 2VEMA 2ZZ4A 1O60A 3FEMA 2H90A 3M9YA 4MY1A 4MLRA 2OT0A 3DFQA 5ABTA 2H6RA 5FF3A 3RF9A 3NOEA 3G1DA 1GG0A 2V0TA 1H7NA 1QMLA 3QMSA 2WSQA 4RZ5A 1OF6A 4OHQA 4UTTA 3W23A 2QDGA 3HMJG 1K7XA 4NJGA 4WX2A 1UUOA 3W73A 3U2OA 1MO0A 3HGOA 2RDWA 2X1SA 1A53A 3IIVA 3KOFA 5K3VA 3NQEA 5EY5A 1PL9A 4NZJA 1XBXA 5DN1A 2Y88A 4N6EA 4WZHA 4NT0A 1DJQA 1QPQA 3G8EA 3W2MA 3TE9A 3W85A 4P2VA 2YW4A 1LLZA 2ZBTA 3V1PA 4AHPA 3LTPA 3VFLA 5AHMA 1THFD 2YX0A 1VCFA 5DCEA 3DGRA 3THAA 3LI0A 1G6CA 4Z0SA 4ICNA 2ZA3A 1WOAA 3G8RA 3GK0A 2FB2A 3WJYA 3T40A 3TK7A 3OIXA 3B8DA 1KV8A 1L2UA 4EF9A 5LNWA 2VEPA 3DBPA 2A6NA 1XBZA 2FPYA 1YTKA 2HMCA 2TSYA 4M19A 1EIXA 3PAJA 4UC5A 2G5WA 4YXGA 1QOPA 1ZJIA 1YTEA 2DZSA 3BVJA 2QJGA 2QCLA 3IVTA 1DQWA 1SPQA 4XBSA 1KM3A 3A9IA 3DAQA 2E6DA 1M5WA 2Z0IA 5LHEA 2A7PA 4UTIA 4XWUA 3NZRA 3LRMA 3W7QA 2J27A 3M5ZA 4M7TA 4CLMA 4JTEA 2QCEA 2NUYA 3WJSA 5F2GA 4MFEA 4Z1DA 2NV2A 4LC8A 3W2JA 5I3JA 5AHLA 4YLWA 1FWNA 4IWWA 3S9YA 3TAOA 1BTMA 3N34A 1KM4A 4PC8A 4L4MA 5G4WA 5CPLA 1W0MA 4LW7A 1DHPA 4UFJA 5FEPA 1PV8A 1O95A 3C2EA 3W07A 2EF9A 3EXRA 4FHAA 1HO1A 5SWUA 4IPIA 1YDNA 1FCQA 1I2QA 4QSHA 1SO3A 1B57A 1G7VA 1Q6RA 3S1WA 3UYCA 3KRSA 5A8GA 1OFPA 4O4VA 3E9AA 1ZENA 1LYXA 2CLKA 4HNNA 3FIGA 3MP4A 5D02A 4M6QA 2RH9A 2V81A 1VPXA 4PH6A 2BSLA 3LB0A 1TREA 2JGQA 3IIZA 5KINA 2OX1A 5IBXA 3NQAA 1SZFA 1A5CA 4NJJA 4XUGA 1WOBA 4FXRA 3N14A 3IGXA 4UTUA 2RDUA 4QNEA 2G97A 4Q32A 4RK8A 3P7YA 3B4UA 1S3HA 4AWTA 3GKFA 3PY2A 3DKLA 1EB3A 3HQ1A 2QCDB 4GE8A 4LRSA 3C2RA 1UB3A 1MXSA 4GBUA 1RQHA 3EKLA 1KLYA 3UD6A 3D0CA 2EGZA 4UTKA 4UNKA 1SW0A 4I7WA 3QW4B 3M5YA 1CW2A 4HT3A 3GLCA 2DJLA 4ZQPA 4UTHA 1TRDA 3W7JA 1X8FA 5AHNA 4AHOA 1MEHA 3NL5A 4EF8A 5HR6A 5KTLA 3GAYA 4RZ4A 3ZR4A 4HNTA 2BZNA 5DXYA 3G1HA 3KVKA 1SFJA 5FF0A 2XN2A 3IIXA 4IQLA 1T8XA 3I7RA 3W1TA 4K39A 5AC6A 1K8YA 1OFAA 3LLFA 2C3ZA 3TIMA 3W84A 3SECA 2Z6IA 2TMDA 2TRSA 1PHQA 1WBJA 3HO8A 3STGA 1KW1A 1KFCA 3W7CA 3BO9A 3S5OA 3O63A 1YLVA 3UPWA 3LGEA 2O7QA 4ZQNA 1XFBA 1UJPA 4TMBA 5F2LA 3T44A 4JTFA 3TW7A 3NPVA 4JIQA 3QSRA 3QMTA 3M16A 2J24A 2B7OA 1SO4A 3QQ0A 4O16A 2CLEA 1T96A 1FWRA 3E49A 3ELFA 4WY0B 2VC6A 1KM5A 2YYUA 5AFDA 1DJNA 1LOSA 3P5YA 3INPA 3QMRA 4O19A 2FB3A 3O16A 4QIUA 2E6AA 3EB2A 2QCMA 3PSVA 1LRQA 4NNAA 1RR2A 1S5VA 2YCEA 3P60A 4LNYA 5CG7A 2GPTA 2PRMA 1JQVA 4RXFA 1EPXA 2FTPA 4RCXA 3HPXA 1CX9A 3HG3A 2YSWA 3LX9A 4Y96A 1CI1A 3HJZA 4YL2A 1NFBA 4XKYB 1JULA 2ZFAA 3DZ1A 4KFNA 1XCFA 3O8AA 2EKCA 3G1XA 2V2CA 1MSSA 4BK9A 3FOKA 3NQ2A 4CQ9A 3H55A 2Y89A 1KA9F 3C6CA 3R89A 4PODA 3PUDA 3KAOA 4CCDA 1UASA 4DO6A 1JCXA 1ZAIA 3F03K 1VLWA 3ATZA 1OFQA 2XFWA 4TR9A 1TV5A 2O7SA 3OVPA 2DZPA 3PG8A 2GVLA 1R2TA 1XKYA 1SFLA 4IMEA 2HS6A 2JBMA 3PC0A 3C2OA 2OZ0A 2WQPA 1WAUA 3LXBA 3PBYA 1H7RA 2QKFA 4POCA 3TSDA 5E1QA 1F6KA 2PE4A 1JCLA 3W1RA 3O1NA 4FNPA 1KM0A 1YPFA 3E0IA 3NA8A 3QSTA 1E51A 1H50A 2H3BA 1F73A 2VEKA 4JR5A 2ABBA 5D04C 4E0CA 3IGSA 5EA9A 3W7IA 2C16A 4GXMA 4UTMA 3MI6A 5DLCA 5AYYA 4U28A 1FDZA 3G0XA 3FKRA 1TPVA 4LV9A 1IGSA 4M5PA 4AWSA 3LBMA 1B3OA 4LWWA 1C29A 4CNPA 4J9JA 1R2RA 3EWUA 1SW3A 4W9TA 3CT7A 4C1KA 3MJYA 4O53A 5F4XA 2PRHA 3ZFHA 3Q58A 3T4CA 1SZNA 8TIMA 3R12A 2J9ZA 1VHNA 4UTLA 1KTBA 4ALDA 3MYOA 3BK0A 3LTSA 3TXVA 3SFKA 2GJLA 3G0UA 1G4EA 1A5BA 2ZZ6A 2ZCGA 1GTHA 4NXSA 4N2YA 4AF0A 1I4NA 4MZ1A 3NQFA 1F5ZA 2V8ZA 3UXAA 4ZMGA 5K4XA 4JTUA 1GVSA 2B7NA 2ZRWA 1GYLA 1LDCA 2RHGA 1ICSA 3E02A 1FY6A 4UFHA 4ZZ9A 3ABSA 2AQWA 3F4WA 1H5YA 3DFTA 1OVDA 1ADOA 2ZRXA 3C8FA 5U4NA 3NG3A 3SW6A 4EIVA 3MMTA 4NJKA 1UBSA 2QCHA 2WNNA 5CKSA 4IMFA 4JDBA 3W7DA 3IIOA 5FEWA 1W31A 2QCNA 4FX7A 4NVTA 3JS3A 5D09A 1R2SA 1ZAJA 4MZ8A 1G4TA 2Y6ZA 4RZ6A 3KRZA 4GNJA 3M41A 1FXQA 5DCDA 3PM6A 3OHIA 4WY0A 1L6WA 3C3NA 1ME8A 3TNOA 1HFBA 3HG2A 3IGUA 2HS8A 4ZVJA 2ZZ5A 3KVLA 4OQVA 2E09A 1IXQA 1P0NA 3UXDA 2X1RA 2ZA1A 3OBKA 3CB8A 4HKPA 3RLVA 1LM1A 1SU5A 3W2KA 1TRIA 2Y85A 2VENA 1I2NA 1BWLA 1I2OA 4GUHA 1P5BA 4E2BA 3NQDA 4PFMA 1WYIA 4JTHA 5L9FA 3E96A 3NQGA 1JVNA 2A7NA 3GDKA 3QM3A 4WXZA 1FXPA 3HOJA 4H6KA 1G69A 1QOQA 3TSBA 4BR1A 1KFKA 2P0OA 2C15A 1PS9A 1ML1A 2QDHA 1ICPA 3AO0A 5MHBA 3PS7A 2J88A 5EBUA 1PVNA 1IXOA 2Y63A 4TO8A 4CCEA 5F1VA 1M7PA 4O0KA 1ZY9A 5D38A 1IXNA 3W7LA 2NX9A 3C0JA 1EUAA 3B0PA 5L6UA 2VXNA 3TX9A 3S5NA 3U6WA 4HIBA 1H7OA 3BW2A 2C14A 2CZDA 1TTPA 3HBLA 5D2VA 3NQ7A 4X9SA 1BWKA 2Q8LA 4S1FA 1AG1O 4ONVA 1K02A 3L9CA 4DPPA 4O28A 3W83A 1GT8A 1YDOA 5IBXC 5AN7A 5HR7A 3RMJA 1SSGA 2C0AA 3L68A 3W2LA 3MHUA 3UY7A 4DO4A 1Q3NA 2WNZA 5KMYA 2X16A 3NL3A 5K2ZA 2ZRZA 1JJKA 1JQXA 1XI3A 1LRTA 3BGGA 4PTNA 3LOTA 1NF7A 2Z2UA 1IXPA 1R46A 1AK5A 3KVMA 1YXDA 1B4EA 3NXFA 1NF0A 3LLDA 3W22A 4XQ6A 2NXHA 5LNVA 3M7WA 3LHWA 1PHWA 5FF4A 4FNSA 4GJ1A 3HGSA 4I9AA 1G7UA 3LHZA 5FEXA 4ORMA 1H7PA 3G1FA 5TQLA 3TC6A 4OWGA 2BX7A 3DFOA 4N9BA 5F4SA 5HNRA 3NGJA 5CZ0A 4NJHA 1WDWA 2JKAA 3P84A 3P8IA 1EX5A 5HUOA 5TIMA 5KSWA 3L5LA 3NNTA 5D33A 3TR2A 5AB3A 4O52A 4QJ1A 1XXXA 4QAIA 2QAFA 1RZMA 4A3UA 1MEWA 1QPNA 4EVZA 4N02A 3W2UA 4DF1A 3I68A 3W1PA 2YW3A 4UFIA 5GVJA 1OX4B 3UWUA 2A85A 2P1FA 2ZZ3A 4AMAA 4XTIA 3CC1A 2ISWA 1XUZA 3O6CA 4BI7A 2XN0A 5FF2A 1GJPA 3LRLA 2YGYA 3A23A 4IJBA 5FF7A 2YDAA 3M47A 1VGAA 1AL7A 1TV7A 3W86A 3HPZA 3HPSA 4BWLC 3UQNA 3PVFA 1RPXA 5BMWA 2WV8A 3OEXA 3LRKA 1D3GA 1VRDA 3P8JA 1K7FA 4HHPA 4JX6A 3TSMA 4BI6A 3S1VA 1H7WA 2Y70A 5D32A 3E12A 4IOTA 1OYAA 5FESA 1H63A 3P61A 3TH6A 3NQ6A 2QJIA 3C4UA 1DKWA 2YR1A 4JTJA 1I2RA 3B06A 3WJWA 4A21A 2QJHA 3PBUA 3S5ZA 1J5TA 1SR9A 2FJKA 2V2DA 3W7NA 3LHTA 3UWQA 2QR6A 3ABQA 1AL8A 1W5NA 1TCDA 3S42A 3VKJA 3WJZA 3LM7A 3CEUA 1LBMA 3BPWA 3MP3A 3N9RA 5C6MA 3LBCA 4UXDA 3W7EA 3W1QA 1I2PA 1QNVA 4MOZA 4QITA 5IM51 1H1YA 5DCBA 1FUYA 1XDLA 4FX6M 4PCFA 3CHVA 4O54A 2R94A 1A5SA 3K30A 4K6AA 3UWWA 1SSDA 2A2IA 4LV4A 4C1LA 3DXIA 3L5MA 2VFHA 2IQTA 1VYRA 2DZTA 4LC6A 3NR0A 4AEOA 3FJLA 4LS0A 2J9YA 4NNCA 2VOMA 5BNKA 3H54A 2VKZG 5D2WA 2C18A 1MZHA 2E6YA 2A1YA 2DZVA 3W9ZA 3W7KA 5BRBA 5CZTA 1IIHA 1OJXA 1JUKA 4AWUA 3CPRA 2ZTKA 3IIPA 5LZLA 4GFSA 5I3KA 4XKYA 4ZQCA 1W5PA 2CZFA 1H62A 3EX6A 4R53A 3S1XA 1GQNA 2XN1A 4FXSA 3PBVA 2P10A 1VS1A 3TXZA 1GOXA 3PWAA 1G4SA 3MI3A 4OV9A 4BWLA 3EWBX 2CLMA 1T0OA 1K7EA 1QCWA 1TIMA 1OX5A 3BLEA 1O5KA 2B7PA 3OVRA 1IF2A 2CLOA 1BKSA 1XBYA 1NAL1 3P67A 1GVRA 4FIQA 2DZUA 1OABA 4WQ6A 3EWWA 4GUJA 2X30A 3L65A 1VYPX 3SIZA 4ADSA 4HPJA 3GIYA 1X6UA 4FF7A 4N6FA 2H8ZA 3U8GA 4JTLA 3F4NA 5D2YA 3DFPA 1JCJA 2JGYA 3B0UX 4JIPA 3N2MA 3UWYA 3Q94A 3MI2A 3C2VA 3LCHA 4IGHA 4XTDA 1OK4A 1QWGA 3Q37A 1VCVA 4O50A 2F84A 3S1UA 3PB2A 1F2JA 1QFEA 2AGKA 4A29A 5LNUA 1LCOA 3GB6A 4O15A 3QPZA 3B03A 1NEYA 1FDYA 1RQEA 2GUUA 3P82A 2CZ5A 1GTEA 3EX2A 3PUEA 1SW7A 1W1ZA 3RNDA 3CQ0A 4IPJA 1KM6A 1RQBA 4UMCA 4LS2A 1TPH1 4JX4A 1OYBA 2CZEA 5DY2A 4O12A 4JX5A 3ZS4A 3EEGA 4X22A 2Y61A 5EPDA 3KX6A 3ABOA 1H1ZA 2B7QA 1W8SA 5DXXA 1KTCA 1T99A 4LVAA 3S5YA 3VNDA 1QAPA 4O4WA 2VEIA 4TX9A 3LCFA 4RJEA 5CZSA 5LKYA 2VFFA 3MHGA 3O05A 2OT1A 3IEBA 3NM1A 3S6DA 3W88A 4IMGA 4DBDA 3R13A 3BARA 5HULA 1KTNA 3MWAA 3G1SA 4NNBA 4AXKA 3VE7A 5LNSA 3FFSA 3MYPA 4G1KA 1I45A 1W3IA 5J5DA 4UTJA 2GJNA 1ICQA 3G24A 3TMQA 4UMBA 2GQAA 4O17A 4JEQA 3TQVA 5FEZA 4KFOA 1W54A 3NL6A 5EL1A 3W2NA 2DZXA 3L21A 2QUTA 1GVFA 4L4LA 3ANYA 1WA3A 3A22A 3P81A 3LV6A 2BTMA 4DXVA 1D9EA 1L6YA 2GVGA 1K03A 4ADTA 1Q6LA 1RVGA 3BG9A 1V7YA 2YZRA 2B4GA 5A5WA 5KITA 1JUEA 2E68A 3EWZA 4ZQRA 1P4CA 2E77A 3RK8A 3GYEA 5BMXA 2E6FA 4R34A 4TIMA 2CU0A 1TPB1 3C2FA 5D37A 3ZWTA 3FA5A 1DQXA 2NXIA 4LS1A 4K8EA 3T78A 2HSAA 1F76A 4D2JA 1TPWA 2A21A 3QFEA 3GX9A 2QUVA 3W1NA 3W71A 1M7OA 1K3UA 3MW7A 1G4PA 3P62A 3UNDA 1VJIA 3TU9A 2V2HA 3L2IA 3I7QA 1TMHA 1C9DA 1TPFA 2PCQA 4E38A 3BV4A 5C5YA 2AAMA 2ISVA 4QNWA 5AC8A 2BWGA 3LCGA 4KWWA 2UV8G 5AHFA 4YWIA 4JNMA 2CLFA 2NUWA 1EP1A 4OBTA 3IRDA 2ZQ0A 3EXTA 3NPXA 1EEPA 4JTTA 4OU1A 5I3FA 1W37A 1Q45A 4O11A 3M5XA 3KHJA 3NO5A 4CCCA 1JR1A 2E1DA 4Y6GA 3O6YX 2GQ9A 1N8FA 1SZEA 4MPQA 4UR8A 1HO4A 4O18A 1WV2A 3UZ5A 3R5EA 1PIIA 3TC7A 3PSWA 3DHFA 2ATSA 3GVGA 3L66A 1W56A 3BG5A 3USBA 3A21A 2FQIA 1JRBA 1TPC1 4UFKA 3TW6A 3UWZA 3W3OA 3WK2A 3FKKA 4FB7A 4HSNA 1SO6A 1AW2A 2RFGA 3RFAA 3DENA 3AJXA 4WUIA 1A5AA 3A5VA 5D2XA 3QJAA 3OG3A 1GWJA 2Y7EA 2E5DA 2WKJA 3DU0A 3PB0A 1EUNA 1MEIA 1TJPA 3EX4A 4I7UA 4JTGA 3HGJA 4KWVA 5KZEA 4UTWA 1LORA 4BI5A 1LRNA 3GAKA 3PF3A 5G2IA 1EWDA 1LTDA 3G3MA 3TUUA 1C8VA 3STCA 2C6QA 3JRKA 1KV5A 3JR2A 3NAVA 4FO4A 4JDYA 4FNRA 3EKZA 3DI0A 2NLIA 2QAPA 1F05A 3G3DA 3QYQA 3ZWSA 1YXYA 2LLEA 3H53A 3SGZA 4RLIA 1W5MA 3HB9A 5LNRA 4QQ3A 1RV8A 4K7VA 3WK1A 2RDTA 2NZLA 5AHEA 3NM3A 2ZRUA 6TIMA 1OG0A 3HF3A 4Y8FA 1XUUA 3N3MA 2X1UA 1KFBA 3FYPA 2ZDRA 3DKJA 4NU7A 3W1XA 1H60A 1O94A 1W3TA 1VC4A 2DJXA 2GOUA 3CU2A 4HNUA 4JTKA 4MYXA 1TYGA 4GUGA 2Y7DA 2V30A 2WO5A 4B5NA 4N9DA 4Y90A 1XBVA 4GWEA 5HWMA 2JK2A 1GVQA 2W6RA 4CQAA 1V5XA 4WJEA 4OV4A 3P5ZA 3A5FA 4O1BA 5TBOA 1RD5A 2QEZA 2BLEA 3GDMA 4NJIA 4MKNA 1BEUA 2WPBA 3DI1A 1QO5A 4NX5A 3DFSA 2ISSA 4DEFA 4Z1BA 1TB3A 4TMCA 3SR7A 3W7OA 2A0NA 5E93A 3PULA 4MLJA 3O15A 4JY8A 3PG9A 1GZGA 2J9XA 3O6DA 3W87A 3W7HA 3GNDA 3W7RA 5DY3A 2ATMA 1H61A 3KVJA 3TFXA 4ZL1A 1ME7A 5HUPA 4GC4A 3QW3A 2DORA 2CLLA 4HNVA 5CSRA 3LXAA 5LHFA 3NQMA 4O10A 4N9CA 3UZJA 2H3DA 3TV8A 4E2DA 1X1ZA 3EXSA 1Z42A 3L0KA 4JD4A 2YFOA 1G67A 1W5OA 4H4IA 4K8HA 2ABAA 2FPTA 5D03A 2VFEA 1UCWA 2D73A 3B04A 2VELA 1DBTA 1FWTA 4K38A 4JGDA 4JTSA 4Z1AA 1SUXA 2QCCA 2PURA 3MBDA 1TTIA 1AW1A 2GVJA 5C54A 3EX3A 3MUXA 2QCDA 2W79A 4DF0A 2W0UA 1X1OA 3MHFA 4O14A 4NUWA 3GXNA 1ME9A 2Q3RA 3WJXA 3NEVA 3W1LA 1GYNA 3NL2A 1Y0EA 2R91A 1OF8A 4A2RA 1P0KA 7TIMA 3THQA 2ZA2A 5J5RA 3ATYA 1R47A 4JYEA 3G0SA 5HJLA 2V5BA 2YFNA 3NPWA 3BW4A 4O0ZA 4OT7A 4X2RA 4FEZA 4NX0A 1TQXA 3T55A 3F1QA 4H3DA 4NQ1A 3I7SA 4EWND 3Q2DA 3W1MA 1GVOA 2V5LA 4AH7A 5HWNA 2JKEA 3LERA 1WQ5A 1TPUA 3LHUA 4RX0A 4PL2A 4MYAA 4IMCA 3LXCA 5HQEA 3MP5A 4U4MA 3T7VA 4MUZA 3M1ZA 2A6LA 1WX0A 1Q6OA 3QQ1A 5G1YA 5AYZA 2ZZ2A 1FCUA 3S0CA 4LUIA 3N19B 2Y7GA 3OVQA 1KLZA 3IVUA 3SY5A 5CGQA 1FDJA 3L0NA 1N55A 3GXPA 4LVFA 1TPDA 4Z1CA 3QH2A 3HG4A 5K7JA 2V9DA 2DZWA 5CPMA 2A4AA 4A2SA 4Z08A 1P1XA 1LOLA 5I3IA 4DQWA 2EAWA 1QR7A 3SZ8A 4RV8A 4CNNA 4DF2A 4O1DA 3RU6A 3SGUA
chains in the Genus database with same CATH superfamily
4DZ5A 4CU7A 1OIMA 1JIBA 4PSRA 3KTCA 1MFUA 3DFYA 3N29A 3TKFA 1JYVA 2O92A 3OW1A 3AMGA 3B0VC 3B05A 1A80A 3GR8A 1W1A1 1KBJA 4NILA 4N42A 3GNXA 4IXXA 4MG4A 4XVEA 2CZVA 3FHAA 1B9BA 3WDIA 1D3HA 4GQBA 2X2YA 1OK6A 1WZAA 2C79A 5ECUA 4XBKA 1ZP4A 3NQ8A 5D9MA 3WX7A 5EYWA 3DH7A 4DO5A 3R11A 3D3AA 4F48A 3UPBA 3VI2A 3WQGA 2X05A 1VEMA 2GLKA 3H22A 4H2CA 1NSJA 1WNOA 4MZYA 4G2DA 1W9UA 1UMLA 3GNNA 2ZKMX 3H2MA 3I6RA 3GDRA 1O5XA 4D6HA 4HHMA 5A6SA 4RKAA 5CPNA 3ARTA 2V63A 5CC7A 3U5YA 5BCAA 2YKKA 1JI1A 4PMDA 3A24A 3KWSA 4J3ZA 2CWNA 2VCAA 3TN4A 1HL8A 4X60A 4DELA 5BXPA 1A5OC 3F4DA 3TTEA 1FWWA 1FKWA 3G5EA 1EJTC 4BF9A 2E3ZA 3AHYA 4FIRA 2WMKA 3U48A 2CBUA 4MF4A 1JCNA 2ZZ1A 1TV8A 2F7FA 3MZ2A 4ZQMA 5H8UA 4HP5A 5T8GA 1ADSA 1KKOA 5HAOA 2NXGA 1QDSA 4LT9A 5AZ1A 5CJ5A 1HQTA 3STFA 4A6GA 4QS5A 4X61A 4S3FA 4DYEA 1CXKA 5JVLA 2YA2A 1EA0A 2HVMA 4OFCA 3B9DA 1YADA 4PCPA 4DX3A 3VOCA 4ML4A 2PDJA 1LOQA 2VFGA 2PTXA 1R30A 5KZMA 4M7SA 4KCVA 4H04A 1G01A 2HWGA 4NZFA 1DWGM 3OLEA 1L9WA 1W1YA 3LCXA 5F4WA 2ZOXA 1WXJA 2XINA 1V8EA 4A3RA 4WDWA 2Z29A 2WSPA 3DFNA 4ZO7A 4JPGA 2PF8A 3L67A 4O8RA 1SMDA 3UJ2A 5LGXA 3WFZA 4ZSTA 1BVZA 4B3KA 3IV3A 2GVEA 1XLAA 1V3KA 5K9XA 2DU2A 5DO8A 1XG3A 4Y8EA 1OCNA 4OGZA 2I14A 4JBRA 3GDLA 2PCEA 1M7JA 2EPHA 4R7JA 4Q4MA 1YYAA 4LH8A 4BY3A 1YPIA 1SFSA 1HTIA 4W8LA 3SSJA 4ZO9A 2Y7FA 4S3DA 2H9AB 5BXSA 4IX0A 3UNTA 4S2BA 2DEPA 3AXMA 3OA3A 3R2GA 4MWAD 2C13A 3SQMA 4AD2A 1JF6A 4KKXA 1W1B1 4LUTA 5REQB 5F2IA 4LY8A 4FOJA 5MKGA 3YPIA 1BGGA 3WDHA 2B31A 3AS1A 4JIEA 3UETA 3MUAA 1SJAA 3NSNA 1TVPA 2YPIA 1TPEA 1O1ZA 3U2EA 4QM1A 3AQUA 3BGJA 2F61A 2RDXA 3LV5A 1UD8A 3CMFA 1CLKA 4NAEB 2X0YA 2G3JA 5JQ9A 4P8UA 4UQAA 3ABRA 4FNTA 2FIQA 1NDWA 5BWFA 2QUMA 1TKKA 1EO5A 3UWVA 3EDDA 2XM2A 4HN4A 1OD0A 4DBEA 4LUJA 3BLPX 4DPQA 4CN6A 4Z2LA 1UROA 3WY1A 1DVJA 2Y8VA 3IV8A 4UNLA 1GEQA 1TTQA 1JCMP 1RP8A 5HWJA 3AS0A 4QQUA 1TWSA 4JTDA 3RO6A 2BY0A 4I9JA 4MJMA 1KBIA 3S46A 3GXTA 4F40A 4JS3A 2Z7KA 3DHUA 3BMXA 1J2WA 3TN3A 3P80A 1OZMA 3SCWA 1IR1A 1Q66A 2V5DA 3G1AA 2E5CA 3W1UA 1E5JA 1GYMA 3VE9A 2XZ7A 1OYCA 2H8XA 3AOFA 5C9ZA 4MY9A 1LWIA 4R7WA 5CBIA 2XDFA 2VFDA 3PFRA 4DBUA 2CW6A 1SZGA 3M44A 1V77A 1G9HA 4FLQA 1DJZA 1DPMA 4UR7A 1QK2A 2CLIA 1HKWA 1IV8A 5EGRA 1XGDA 1QO2A 4UUIA 2OQLA 5K4ZA 1WO2A 3BLFA 5G1TA 1C91A 1O5RA 3H12A 1POKA 2IXVA 4MY8A 4JFWA 3FVDA 1VBGA 1S5TA 1RUSA 3EA3A 1C90A 4WGXA 3AYRA 1U22A 1NVMA 3WK3A 1XLGA 4B2DD 1REQB 4H1ZA 5JBEA 3SAZA 2PI6A 4U5IA 2YBTA 3QV7A 3QZ6A 3WQVA 2QXWA 4L1WA 5CSSA 3PN8A 3A64A 4B9ZA 4QISA 4PZVA 4LVDA 4FX8A 3IANA 2ACQA 1ZGDA 4HMDA 3W70A 1OFOA 3W72A 1G0CA 5AC4A 1AH0A 4BQ3A 3D47A 1HUVA 3KOXA 3WH7A 1C7TA 4R9XA 3G1RA 4AQLA 3QXBA 5DBTA 4Y9AA 4GJIA 4Q33A 4PMNA 3S47A 2ISDA 9RUBA 4TV5A 2ZZ4A 1O60A 2VEGA 3LNMA 4QTGA 3M9YA 1Q6GA 2H6RA 4GISA 5FF3A 1CWYA 2V0TA 1R5YA 1QMLA 4GG9A 1OF6A 4OHQA 4C6BA 1MRQA 3MCMA 2QDGA 1ZLPA 3K8LA 3CH0A 1TX0A 1QUMA 1A53A 3AI0A 3IIVA 4XK2A 1TVLA 3IJLA 4C90A 4C6JA 4FZIA 5DANA 1IGWA 3W2MA 1QPQA 3TE9A 3W85A 4I9MA 5CLWA 2ZBTA 4AHPA 1KCXA 4ZSUA 3DGRA 1G6CA 3CAWA 4ICNA 2ZA3A 3TTYA 1U5HA 4DJDC 1WOAA 3G8RA 1E71M 2GWNA 3MV11 3WJYA 4WSKA 3TK7A 3B8DA 3P93A 3COTA 2GDQA 2OO0A 4DLMA 1TFVA 2PDMA 3B97A 3EOOA 1UP0A 4ZXOA 4JCMA 1H5VA 1XBZA 2PDFA 2HMCA 2C8NA 4M19A 3R94A 4Y9NA 3E2SA 1VENA 3VOIA 1C9WA 3A9IA 4I3GA 3ME3A 1JZ4A 3VNIA 4PBGA 4LAKA 5IHSA 2Z0IA 3VUSA 3WLOA 3WDJA 2WANA 4TTUA 5A2AA 1VFMA 4E6MA 3M5ZA 1XQKA 4CLMA 3WDRA 1XYMA 3VDHA 1NP2A 1QI2A 3KHDA 4LC8A 3TP4A 4YLWA 4PBEA 3WD4A 1BVWA 3AROA 3H21A 3GC5A 1NY1A 4QR6A 3WUFA 4LW7A 4UFJA 1DHPA 5FEPA 1O95A 2EF9A 3AHVA 4Q8OA 4NZ1A 5SWUA 1E70M 1YDNA 3H2AA 3QR0A 3LD5A 1SO3A 1T6MA 2POTA 1X97A 2J79A 4QJ4B 3S1WA 3UYCA 4O4VA 2CLKA 3H2CA 3MP4A 4NY2A 2V81A 1PIGA 4R9OA 1RPKA 1CGWA 5IBXA 4PB4A 5A1AA 4XUGA 1WOBA 2PDCA 1R3QA 1BGAA 2VX6A 1F07A 1XSIA 3WQCA 4JNYA 1I75A 1S3HA 4D6EA 4UOQA 4MJ2A 4AWTA 3WMCA 3DKLA 3DESA 3I4KA 2ZXAA 5ABFA 4HPGA 4WHBA 3UD6A 2VL4A 4IP4A 2EGZA 4LYKA 2YB4A 5GJPA 2ZDSA 3M5YA 2Q6ZA 1CW2A 3A13A 3GLCA 4MNMA 3WLIA 3LEPA 4NF7A 1CIUA 1Q6EA 3BLKA 4ZQPA 4F0LA 3AIUA 1X8FA 3VIPA 4KEZA 5AHNA 1MEHA 5KTLA 4IG2A 4W7WA 5DXYA 3D6NA 4FSAA 4Q7BA 1LUCA 4PBFA 1Y5VA 1EO7A 4JCLA 3WQOA 2BODX 4B90A 3I7RA 3W26A 1K8YA 1AD4A 1HKIA 2Z6IA 3UCCA 1JAEA 1WBJA 3STGA 1KFCA 3PNUA 2D0FA 3NTYA 3BO9A 3S5OA 1IYXA 3UPWA 5LA1A 2JEQA 2NT1A 2VVSA 4C6DA 1UJPA 4DI9A 3QHMA 3AFBA 1VIWA 5F2LA 3SRFA 3IGHX 3TW7A 3NPVA 3VC6A 1XH2A 4KEVA 5HDRA 3IJQA 3E0WA 3SUSA 1FA2A 2VWSA 3NO1A 2VZTA 3VUPA 2VC6A 2BHYA 2YYUA 3KDOA 1P6BA 2C91A 3P5YA 2YB1A 4I6KA 4Q8VA 4DLFA 1NFPA 3U2CA 3KM8A 1S5VA 1GKRA 5D9PA 2GPTA 2PRMA 1JQVA 3UCQA 3CZJA 3HPXA 3HG3A 1E56A 2YSWA 3MPGA 4D8LA 2V38A 3FYYA 2EKGA 3GE7A 3GXMA 4MM1A 4NP7A 3EMZA 3SN4A 3G1XA 4BK9A 2W67A 3AWOA 2QJMA 2A3CA 3PUDA 3KAOA 3TN5A 5GNYA 3A12A 1JCXA 2GSEA 4DJED 3ATZA 1TV5A 3OVPA 1Z32X 3QQWA 4ZA0A 1R2TA 1XKYA 3I4EA 4IMEA 3HM7A 2HS6A 3S83A 3WZ0E 1R3WA 2DFAA 1UC5A 1W9PA 1UMYA 3J7HA 3VX1A 1H7RA 5E1QA 1JCLA 3QC0A 3REQB 1E6PA 3R7MA 1OC7A 1YPFA 3E0IA 1MRAA 2FKPA 3CWHA 3A4JA 3QY6A 2WZIA 2DZAA 4JR5A 1I1WA 3VYLA 3M7SA 5CCZA 1P0EA 2UY2A 1CCWB 1KBKA 2HK1A 3IGSA 4ERAA 3H6OA 3MWCA 1G5AA 4UZSA 4U28A 5XINA 2FZ9A 4BEQA 4GABA 4LV9A 1C29A 1R2RA 4D71A 1SW3A 3MJYA 5F4XA 2NSXA 8TIMA 2CHNA 4AIUA 3EGJA 5CC5A 2W91A 3E2RA 3LENA 3TXVA 3URQA 5HA7A 4CD7A 1XFCA 2ZZ6A 3TZNA 3OLDA 3LU2A 1GTHA 4NXSA 2VZUA 3V18A 4YN5A 1JF5A 4AF0A 2EPOA 3ITTA 3NQFA 4AY8A 3RRAA 1AJ2A 1F5ZA 1KO0A 4DHGA 4JTUA 1MW1A 5ECVA 2B7NA 3S9ZA 2RHGA 1ICSA 3E02A 4D6FA 1FY6A 1XLCA 4ZZ9A 3H24A 3DFTA 1OVDA 1ADOA 4B92A 2NQZA 1FWFC 3MDWA 3NG3A 2ADAA 4NYUA 3CMGA 5M17A 3RAOA 4FLRA 4IIFA 3K1DA 3W7DA 3KCLA 1W31A 1KD0A 4FLOA 2VUNA 3VNZA 4GQQA 1NDYA 5FACA 4NZ4A 1BFNA 5D09A 4Q6XA 2J78A 2OEMA 4P7QA 3JU2A 1IZKA 3KRZA 1UKTA 2ZVRA 3LZ3A 3Q45A 3M0YA 3OHIA 1L6WA 4RW3A 2PA6A 3C3NA 1ME8A 3WBAA 3TNOA 3VU2A 1EGMA 3IGUA 2VC9A 2HS8A 1W9DM 3KVLA 1HVQA 3WKZA 3UXDA 2QVHA 2FZDA 3WUBA 1VPQA 1UD5A 1LM1A 3GHRA 4HU3A 2YA0A 5CBJA 3OG2A 4A35A 1KRCC 3VGFA 2YDSA 3OQ8A 1BWLA 1YW1A 4ZB2A 1XHGA 1UWSA 4HNOA 1ZUAX 5GJNA 3VMPA 1JVNA 3AZSA 2DVXA 3GDKA 2PS2A 4GXPA 1PTAA 4L9YA 4WF7A 3JZEA 2JFEX 3FXGA 4LF2A 2PDGA 3LS9A 3T0AA 1ML1A 3AO0A 3E5PA 1FWEC 5EBUA 1GPFA 1PVNA 1ZL1A 1DHKA 3PZGA 5F1VA 3RIKA 5D38A 4ZFMA 1Z6KA 1B1YA 3EPMA 1WDDA 2W92A 3TX9A 3S5NA 4J27A 4C6IA 5FSEC 3KOYA 1TTPA 1J0ZA 5D2VA 2BVYA 4X9SA 2Q8LA 3FN9A 2GGJA 1AG1O 1K02A 4ERIA 1X96A 2J7CA 4GMEA 4WDUA 5IBXC 5AN7A 4FP1A 2W5FA 3OZOA 4DO4A 4F3HA 3THUA 1Q3NA 4H01A 4LUSB 2WNZA 5KMYA 1LQ0A 1WE5A 2ZRZA 3U7VA 1XI3A 3BGGA 1NF7A 4LPCA 4JOMA 1YXDA 3WENA 2VDHA 4J40A 4F66A 1NF0A 1V0KA 3UFYA 2QIWA 3RM4A 4ZOEA 4GJ1A 3WLLA 4I9AA 4WGHA 1N2VA 3SCQA 2DIJA 5TQLA 3TC6A 4N9BA 5HNRA 1HXJA 1ZJBA 5CZ0A 2E9LA 3P84A 1EX5A 1ODZA 4V27A 3AIEA 3WL1A 5D33A 3FEQA 3DHPA 3UVIA 1RZMA 2CWXA 4A3UA 1FWBC 3KBWA 1EF2A 5A2BA 3TOPA 1HKKA 4DN1A 5FJTA 4PMOA 3BAWA 2WBGA 3UWUA 2ZZ3A 1SM9A 4XTIA 2ISWA 1X39A 4DUXA 4PMZA 5FF2A 3PAOA 4UCFA 1GJPA 3LRLA 2YGYA 2YDAA 5C2CA 1XD0A 3W86A 3K46A 2PD9A 4I90A 3GZAA 1ZBKA 3CUJA 1EJVC 4Q8MA 2GDVA 3LRKA 3WD1A 4G7FA 4JX6A 3B4YA 4BI6A 3S1VA 3E12A 1OYAA 5FESA 3P61A 3TH6A 2V3EA 3A4WA 1L6GA 3C4UA 2YXOA 2YR1A 4KESA 1I2RA 2QJHA 3PBUA 1SJCA 3QR1A 1V6XA 3PHAA 4CN4A 3ICJA 4WVXA 4TQTA 5BWAA 1IQ8A 1SR9A 2FJKA 2V2DA 6REQB 1PKLA 3W7NA 3LHTA 5HQLA 1CLXA 3CUIA 1XIGA 1AL8A 1XLLA 2VGFA 4DUWA 3T8LA 3VNMA 1LBMA 5I06A 5C6MA 2HPIA 4QG6A 1E6QM 5HJXA 3I10A 3VNKA 6XIMA 4LYQA 3UJEA 1I2PA 4MOZA 5IM51 1H1YA 1KR1A 5EMLA 3B8UA 4DXXA 2WWDA 2NLYA 1RA0A 3HN3A 4ENLA 2R94A 2I5IA 1YRRA 4PB3A 1GOQA 4LV4A 1VYRA 3WF4A 2DW7A 2QLYA 4LC6A 1PZ0A 4NNCA 1AVAA 3CNYA 3PBGA 1L2QA 3IJIA 3UJSA 1KB3A 2A1YA 2DZVA 1B3XA 3HQPA 1JUKA 4AWUA 3IIPA 5LZLA 4GFSA 4XX6A 2CZFA 4KCUA 2CHRA 4W5ZA 2F6XA 2NQJA 2XIQA 3VABA 1M1BA 3VK5A 2F6KA 1JDEA 3B8IA 1CECA 4H9YA 1GOXA 3D3FA 2CLMA 1PIFA 3H2NA 1KFWA 3E0LA 4CNUA 4C6KA 1O5KA 2ZADA 2CLOA 4HMCA 5BXTA 3P67A 5EBAA 2XG9A 2VQUA 1VKFA 3OBEA 2DZUA 2X30A 4AZHA 3MZNA 4HPJA 3GIYA 5I23A 4JTLA 3N2MA 5JH1A 3S1UA 3VA8A 1V3IA 3GXDA 2REQA 4A29A 4O15A 2ZX6A 3W01A 1A3WA 3AXIA 4C6NA 4UQDA 3PUEA 2HNHA 1XRFA 1RQBA 4JX4A 2O0TA 4PTMA 2Y61A 5EPDA 5H8PA 3KX6A 1KTCA 1AODA 4LVAA 4HA1A 1LF1A 3MU7A 4O4WA 2VNCA 6ENLA 2VEIA 1RCQA 2VFFA 3O05A 2VP8A 3OPSA 1KXHA 3IEBA 5FIPA 3S6DA 3W88A 3ZJ7A 2A3HA 2DGAA 3BGAA 4DBDA 3P14A 3BARA 1XLMA 2OWCA 3MWAA 1Y65A 3B9NA 3VE7A 4DJEA 5LNSA 3MYPA 3WEOA 3GTIA 4EPBC 4GGBA 2O9RA 1W3IA 2D2JA 1ICQA 3ALFA 3ID7A 2VCCA 1EH9A 1W54A 3L21A 3KCOA 1ITUA 3ANYA 1WA3A 1RD6A 3ITCA 1QHPA 5BRPA 3UG5A 1UZHA 4PTVA 3ARUA 3VIFA 3POCA 1JUEA 2E68A 3EWZA 3AYSA 1U2YA 3CPUA 2E6FA 3NFUA 2CU0A 1XLJA 3C2FA 5D37A 2PLMA 1R3VA 3ZWTA 3FA5A 3U57A 1DQXA 4AW7A 4HYRA 3RXZA 4K68A 1CGVA 3T78A 2G37A 2HSAA 1DE6A 2GSHA 3GX9A 3N2TA 2QUVA 3FCPA 4U33A 4QDWA 2WZTA 2PZ0A 1G4PA 3TU9A 1BKHA 1TMHA 3GWQA 1TPFA 1R87A 3BV4A 5G1MA 4RPQA 2GQ3A 4KWWA 3LMZA 4YWIA 4LNCA 4D6IA 3M6DA 2QYGA 3NPXA 4IT1A 2VZOA 3H4WA 4CCCA 3RITA 4L65A 2PDBA 3O6YX 3SUTA 1XP3A 2NQ5A 1BD0A 1HO4A 4FALA 4C65A 2D1ZA 4L5ZA 2ATSA 2HROA 1J01A 4G7EB 4JKKA 3SCSA 3A21A 3LQLA 1TPC1 4AZIA 3PZQA 3TW6A 5FJRA 2VR5A 5FJIA 3U2ZA 3E2VA 1TV4A 3WBYA 4PMYA 4BQ5A 1KNWA 1SO6A 1AW2A 2RFGA 3RFAA 1U30A 4ZEPA 1YNYA 4H7CA 3GVWA 3QJAA 2Y7EA 3UJFA 4I7UA 2OYLA 3WIJA 4XZNX 3MKKA 1U1HA 3PZOA 1C8VA 2PGFA 2C6QA 4CQCA 1T7LA 2NLIA 5HMDA 3M64A 3G3DA 1XPYA 3F4VA 3ITXA 3SGZA 4E4UA 1PX3A 3HB9A 2NZLA 2IKJA 2ZRUA 6TIMA 3HF3A 1XUUA 1Q85A 3QHNA 2X1UA 3PJWA 3AU2A 3FYPA 3II1A 1H60A 4GX8A 1WUFA 1EHAA 4JTKA 1OG6A 3UJRA 1CNVA 2O9PA 2ZUSA 4B5NA 2P76A 2JK2A 1O1HA 1VFUA 4XAGA 1RD5A 3GHSA 2QEZA 1BEUA 1QI4A 3TNBA 4WEVX 4FLSA 3DFSA 5M5DA 1X98A 3SR7A 3E3HA 1H09A 3PG9A 1UH4A 3CQKA 3W87A 1UOZA 1V0MA 3E38A 4ZL1A 4GC4A 1EJWC 4GKTA 3BCJA 3NQMA 2H3DA 3TV8A 4E2DA 3EXSA 4JD4A 1G67A 4H4IA 2FPTA 1JPKA 1EIBA 4L61A 3NUKA 1J11A 3VINA 1FWTA 2VO5A 2Z1SA 4K38A 4XZHA 4DO7A 2QCCA 2PURA 3VIIA 1TTIA 3KE0A 2IQDA 3ZOAA 2GVJA 4YYCA 1EBHA 3EX3A 1LT7A 1XF0A 5LIUX 4PMRA 2XISA 2W0UA 2G0WA 1HJVA 2Q3RA 3GH4A 4GZJA 3WJXA 1GYNA 2XYLA 2UBPC 5FOOA 2R91A 3BOLA 4L6OA 3ES7A 3KWXA 3B8TA 3THQA 3OJGA 4ZO8A 1NOUA 3G0SA 1F8MA 5HJLA 3BW4A 1TQXA 5EU9A 1ZBCA 2OYMA 1JYXA 2A3EA 3W1MA 1GVOA 3D46A 3KP1A 1BF6A 3QGVA 1TPUA 4BF7A 4PL2A 4MYAA 3TJ4A 3VOFA 2ACUA 3LXCA 5PTDA 2A3AA 3M1ZA 3APTA 1QJWA 2A6LA 1WX0A 3RO8A 2ZZ2A 3TYDA 3S0CA 1XIDA 1TZ7A 4GQ0A 1KLZA 4I5UA 5CGQA 1FP8A 1N55A 3PJTA 1V3HA 4F2UA 3HG4A 2VRQA 2V9DA 5CPMA 1QI3A 2WC4A 3HJEA 4PUDA 2WPGA 1P1XA 4W7UA 1J79A 1W32A 2PSNA 1E4LA 4RV8A 3CYJA 4DF2A 2HE8A 3MANA 3SGUA 1CGXA 4RPPA 3VIKA 3SADA 3BWWA 3OA5A 5U7SA 4MNLA 3LHVA 5TF0A 5D30A 2PBGA 2QF8A 2PRLA 3DX5A 3EX1A 3S8HA 1J18A 3GD6A 4ORIA 1JCYA 4LUSA 3WLHA 1OCBA 1VAHA 4KIEA 3URBA 5DBUA 5EFDA 1CBGA 3CO4A 4JTAA 4IFRA 3N4AA 3ABXA 3NXLA 4D6JA 3HGRA 4B91A 3GKAA 3M43A 3OHMB 4INFA 4XB3A 1LP6A 3G18A 2DSZA 3PZNA 3WL0A 1OFRA 1RY0A 5CPOA 4DWSB 1DORA 3P74A 4WDXA 1SGJA 4R27A 3N3TA 4HK5A 1M03A 2AQOA 2C1HA 4LB4A 4PTDA 3KOWA 1W8GA 3LCLA 2NV1A 4M6PA 3L4ZA 5CZJA 1KXVA 2CEQA 3O06A 3GDTA 4ZB5A 1VCGA 4GCXA 2G3MA 4CQDA 2PWHA 1G94A 5I78A 3CV1A 1XDMA 4TUFA 1PZ1A 3G6MA 5FL1A 2F6UA 2ZZ7A 6PTDA 4LVBA 1MXDA 3WQDA 3CHCA 4XD6A 4YYFA 3L12A 1DP0A 2NQLA 1YTDA 3FXYA 3VDCA 4L64A 1QW7A 3UWEA 4WOQA 1J9YA 3U7BA 4LVGA 1N7KA 4FA3A 4GYPC 2CLHA 2VYOA 1AMKA 5I3HA 1VH7A 4YCPA 2XPKA 5XIAA 1FWJC 3USZA 3L5AA 5A6JA 1TTJA 3WLTA 1M6JA 4YPJA 2WSRA 3AXXA 4PUNA 1XIBA 6REQA 3G22A 1OFBA 1DL3A 1XR2A 3R58A 1OGSA 3LHYA 3QRHA 2H9AA 3CT2A 5EKYA 4O1CA 2OODA 2E40A 3FW6A 2J62A 1EJUC 1UR1A 1FX6A 2CLPA 2YXXA 5AHIA 2XIOA 5A6AA 2AKMA 1EYEA 4V15A 1OFDA 1EDGA 3QGKC 5K9CA 2I9EA 3GZ3A 1I6NA 3QPYA 1GEHA 3UR2A 3GTXA 3WUGA 1ZBVA 3R1ZA 4Q4SA 3ORWA 1VZWA 2J6XA 1EGVA 3CUFA 1NM9A 5J8LA 1MUMA 1OT2A 4XSLA 3K4DA 2KZHA 4MFDA 4XUYA 1IWPA 4ZOAA 4V1XA 1TUFA 1A4MA 3W76A 3SCRA 1EQCA 2ICSA 1TO3A 2ZTJA 4NZ3A 1JFXA 1VBRA 1PWMA 3SUWA 3WQ8A 3T9PA 3BOFA 2G8ZA 1WUEA 5E0KA 1F9CA 3ARSA 4MHBA 4LU0A 5I09A 4JYFA 2X1TA 4D72A 2B0MA 4N7QA 3AWNA 3FGCA 1XC4A 1QTWA 2FFCA 1SO5A 4ECLA 4PCTA 4XO6A 1Q6QA 1M04A 2I16A 1KWGA 4UQEA 5AECA 4YCOA 1IIGA 1VEPA 4GUIA 3GU1A 4M0XA 4UMAA 4LANA 2ZIDA 1R3RA 2YL8A 3I3BA 3BXWA 1QATA 1E6ZA 4HSOA 3VKKA 3HIJA 5G2WA 3K5XA 2PWUA 3NYZA 1R7OA 1DTUA 1X7IA 1EFZA 2WAGA 2X0HA 3V75A 4IFKB 3EWYA 3ENLA 4J1OA 1MXGA 1ZCOA 3CL7A 4W86A 3UBPC 3TCEA 3TYEA 4RZBA 3TA6A 4XZLX 3AMCA 3UY8A 4OE7A 2CETA 2QF7A 2BXYA 3B9OA 4IIDA 1S5WA 2VQTA 3QEZA 3GNOA 4KRUA 1EJSC 5AYXA 4ADUA 3GR7A 3WF2A 1UWIA 3WD2A 1ALDA 3ONCA 4EK7A 4HPXA 3W1AA 2ALDA 3CTLA 5I02A 1VYSX 4K7YA 2WVTA 4KEMA 4RR4A 2JQXA 3HG5A 3ZO9A 2NX3A 1KWKA 6CGTA 3EBVA 5BROA 3VIHA 2CITA 2OWXA 5B7ZA 1K9TA 2VHLA 3W74A 4LFYA 4L80A 2OCZA 3FDKA 3CWNA 1ZJHA 3MUCA 5E6ZA 5A94A 2ASHA 1Q6CA 3N2XA 4WXYA 4RNIA 4M6VA 3V0UA 4GYKA 2IKHA 6A3HA 2GZXA 2Q01A 1FWDC 3FAWA 1E4IA 1FHDA 5AOUA 5G2HA 2WJZA 3WDPP 2IUZA 1HP4A 2CBVA 3FHQA 1P43A 5DMNA 4LCRA 5FI8A 1W1TA 1TJ1A 1F4AA 5GPRA 1VQTA 4ZB0A 3RPMA 1PX8A 3RLUA 3THDA 4NG3A 3VDBA 2E5BA 3OZMA 3TYZA 1U83A 2DZBA 3R8RA 1Q8JA 1YXCA 4DNHA 4S2CA 5TNVA 1Z69A 2XU2A 3GBEA 1B4KA 4JYDA 5C7HA 4KMQA 2PWGA 3S6TA 3MSRA 1AJZA 1S2VA 4CVWA 1WXYA 3ZLGA 5ABTA 2ZX9A 3NOEA 1GG0A 2FDMA 3WCZA 1H7NA 2DDXA 2WSQA 4RZ5A 4PGLA 3TONA 4UTTA 3W23A 3T2QA 3SM0A 4EAMA 3HMJG 1T41A 3HV8A 1K7XA 4Y9MA 3W73A 3U2OA 3HGOA 2X1SA 3NQEA 2X09A 4CU6A 3IJ9A 4NZJA 5DN1A 1TIWA 3VGHA 3W27A 3IK2A 2Y88A 3NJ3A 3G8EA 3GG1A 4P2VA 2BFGA 2V5CA 3GR4A 3LTPA 5AHMA 3T07A 5LXEA 1TVNA 3GK0A 1M53A 2RGMA 4GKLA 4IZGA 1KRBC 3OGVA 3WQ5A 2AL2B 5CSUA 2VEPA 4D1IA 2XFYA 2MANA 2Z1VA 1W6TA 2FPYA 1YTKA 5H6HA 2TSYA 1EIXA 2G5WA 1YTEA 2DZSA 1PZ3A 5HK4A 3IVTA 1GVYA 1E72M 1ZQ5A 3K2GA 5LHEA 4UTIA 5HXMA 4X0NA 4NI3A 4XWUA 3GSMA 4X2PA 3LRMA 2J4GA 1V08A 2QCEA 4JAWA 4K1GA 4Z1DA 4LALA 3CL6A 2J47A 3CYVA 4J3UA 1JPMA 4IWWA 4MNJA 5I77A 3S9YA 1Q65A 3SJNA 2G4FA 2J8GA 1BTMA 3N34A 1QXLA 3C0QA 2PU0A 3MS8A 5G4WA 4HSHA 1B90A 2ZUVA 2OEKA 1PV8A 2AMXA 1BHGA 1HO1A 3DBNA 3RM9A 3VNJA 2PDIA 1FCQA 1I2QA 4QSHA 1B57A 3KL3A 1D7FA 2Z27A 4HMNA 5A8GA 3E9AA 1ZENA 4F0SA 4M6QA 2RH9A 1N8WA 3LB0A 1TREA 3U9IA 1BXBA 5KINA 2WCAA 3NQBA 4EP8C 4IG2B 2OX1A 4XAZA 1IEWA 2DVTA 1SZFA 3R43A 1GGOA 2FTYA 4TVUA 3O3RA 3MSDA 1AQMA 4RK8A 2NW0A 4ATLA 3B4UA 3L7RA 3MTWA 4WLCA 3HQ1A 4LRSA 1UB3A 1LWJA 3VCNA 4B2DA 3EKLA 4LX4A 3SCVA 4S3KA 4RE4A 1KLYA 4JQ4A 3N25A 3VZZA 4UTKA 4H00A 2G3FA 3L4WA 4P7NA 2FYMA 4A3YA 1AUSL 4GI6A 1B3ZA 2WZHA 2EXOA 1FRBA 4UTHA 3NL5A 3GAYA 3ZR4A 4HNTA 2BZNA 1JZ2A 3VKDA 3G1HA 1K6AA 5FF0A 1KC7A 4PCSA 2YLAA 1T8XA 1JZ8A 4K39A 5AC6A 5DT5A 2C3ZA 3NZPA 3O9NA 2TRSA 1KW1A 2JIEA 3W7CA 3EPOA 3ZVHA 1YLVA 2WMGA 3G6LA 2VCBA 4O1EA 3V3WA 5ABFB 1W1PA 4TMBA 3GFYA 3T44A 3UW6A 5DRCA 4JTFA 4K2SA 1NARA 1R9XA 3QMTA 3M16A 4X9YA 2J25A 2B7OA 1SO4A 2VR4A 2CLEA 1T96A 4DYJA 2AL2A 3E49A 2EBNA 1GKQA 1KM5A 1R8LA 1US3A 1DJNA 3INPA 4O19A 2PWVA 3CHDA 5C2GA 4QIUA 3EB2A 3VZXA 3ARYA 4AU0A 2ACRA 1QT1A 4DWSC 2D20A 4LNYA 1IT8A 2FTPA 2BGSA 3LX9A 4Y96A 5IDIA 1CI1A 1BYAA 1A5LC 3SO7A 3DZ1A 1C3FA 2GGIA 4YJ5A 4M3PA 4Z2GA 2EKCA 4CQ9A 1JPHA 3FOKA 3NQ2A 3H55A 1LLOA 4MWAE 1K4GA 4AUBA 4PODA 4MB1A 3VOGA 1CEOA 1UASA 4DO6A 3V16A 1ZAIA 1VLWA 1FWGC 4TR9A 2O7SA 1VFSA 2ZUUA 1H11A 1JEZA 2OU4A 3WFLA 3MT1A 1O7AA 2IPGA 3F5JA 4H8UA 4E4FA 2OZ0A 2Q09A 3GG7A 3EEZA 2WQPA 1JZ7A 4DJDD 4S3EA 3IUDA 2WMHA 1XYAA 2W62A 3OO2A 1F6KA 3DIPA 3O1NA 3VD4A 1KM0A 4YHEA 1RSCA 4XKMA 3UF9A 2DT2A 3TYUA 1H50A 4DWSD 5D04C 1RJPA 4PRWA 4E0CA 3TYAA 5C0QA 1TUXA 3MI6A 2REQB 3EKGA 5DLCA 5AYYA 2J66A 3ZR5A 1CXFA 4MPKA 1L6FA 4B9YA 5IHRA 3RDKA 4C1KA 3CT7A 1GQKA 2PRHA 3W37A 2B81A 3Q58A 3T4CA 1SZNA 2YCLA 3M0VA 1KTBA 2OGJA 4A8IA 1FHLA 3MYOA 3SDOA 1E55A 2GJLA 4OIFA 3AMKA 3ARWA 3MC5A 2BY2A 4A8NA 3KP0A 1I4NA 2V8ZA 1XLDA 4KRTA 4ZMGA 2OWWA 1LDCA 3CV2A 3LUTA 2OEJA 2AQWA 3WLRA 3O0KA 2J8FA 3C8FA 3FAXA 3E5BA 4NJKA 1UBSA 2GYIA 2QCHA 4HU8A 2WMFA 4IMFA 3UESA 1SVDA 3SY1A 4HA0A 1VB9A 1EC8A 2FMOA 2R1LA 3VO0A 1R2SA 1HX0A 4OJYA 1QI5A 1G4TA 1NDZA 4GNJA 2XSAA 3M41A 1FXQA 5DCDA 3VIOA 2Y5SA 1BRLA 3R4IA 4WY0A 1RY8A 4RDYA 4AXNA 3QLLA 3UCDA 4GVGA 1LG2A 3XIMA 4LAOA 2ZZ5A 4OQVA 1IWAA 1IXQA 1P0NA 2PWEA 1XICA 1UD6A 2X1RA 2ZA1A 1TMLA 3OBKA 1ONEA 5A6BD 2VC5A 2VENA 2P88A 3H2OA 4US5A 2PD5A 3AS3A 1I2NA 2E7FA 1BSLA 4GUHA 3TWAA 1P5BA 2HBXA 1W3KA 3PWIA 2FGZA 4JTHA 1O5QA 2A7NA 1K6WA 4WXZA 5DX7A 3S3GA 2QT3A 3HOJA 3M0JA 2O56A 3AYVA 1QOQA 4IIGA 3TSBA 4BR1A 2P0OA 1DIOA 1AJ0A 3M07A 3KLLA 3VD5A 1PS9A 2CERA 2J88A 2Y63A 1XH1A 4RNHA 4CCEA 4AX6A 3VKAA 7A3HA 3GVVA 3QY7A 3CZEA 5A69A 3L2LA 2V6AA 1EUAA 2VXNA 3K4WA 4XO7A 4G7EA 3FGCB 3FX4A 1A4LA 2C14A 1XG4A 5E6YA 1XPGA 1BWKA 4L56A 3MUIA 1IEVA 3IAQA 2DVUA 1SJDA 2EEXA 5A6KA 4O28A 4C6CA 1ZBWA 1OBAA 4KGJA 4DJEC 2O4QA 3CAVA 4XZMX 3RMJA 3MY9A 1E1CB 1QRQA 1XGZA 3SCNA 1TX2A 2WNWA 5DEZA 2Z2BA 5K2ZA 4HOXA 2YCJA 1JQXA 4PMJA 3LOTA 1XH0A 4XD5A 1YKWA 1ZJAA 2OGYA 2WVSA 2BG5A 3W22A 4XQ6A 4QE5A 2BP1A 4CEXC 1PAMA 2YL5A 2QZRA 3HGSA 1EDTA 1G7UA 5FEXA 2QPUA 4Q4RA 4NIRA 4OWGA 4AVNA 3R79A 3BJFA 4QEEA 3NGJA 2W9MA 1NWRA 2BV9A 4B15A 1Z7AA 3UGVA 4IIHA 1GQJA 2WHJA 3T42A 3FY1A 4B5SA 2EG6A 1XXXA 3WG6A 2GJRA 4QAWA 3HU7A 2P1FA 2CESA 2XSBA 1XRVA 2XN0A 1P1MA 3W82A 1DIEA 1H4PA 2WSKA 3M47A 5J04A 4S39A 5CJMA 4F9JA 1TV7A 4BWLC 1JDDA 1RPXA 3WLMA 1NIUA 3LQGA 5HMEA 3BUVA 3LM3A 4GI9A 2PTWA 2HEJA 1VRDA 3CHFA 4JFVA 2IPFA 1H7WA 5D32A 2VX4A 1PKMA 3A6OA 1WPCA 4R5EA 4QCEA 2I56A 4J3WA 3NQ6A 3FNDA 6XIAA 1X8CA 3SRDA 4JTJA 3B06A 3WJWA 4A21A 4D8AA 2P3EA 1R85A 1GVIA 3LK6A 3WLJA 1A3HA 1J6PA 2D23A 1S38A 3M0LA 5FL0A 3KL0A 2Y5EA 1KKRA 2IQ0A 2PU1A 1WDQA 4KPLA 1M9HA 1TCDA 1RP9A 1UUQA 3UZYA 3B8SA 3EMCA 3CO8A 3LM7A 3CEUA 2J6VA 3MP3A 3N9RA 3LBCA 3T2PA 3W1QA 1QNVA 5M03A 5FJPA 2BY3A 1XDLA 2QGHA 4FX6M 4OUIA 1V0NA 3C2YA 4LBSA 4O54A 1A5SA 3K30A 4K6AA 3UWWA 4ES4A 4JFSA 1V6TA 1H49A 4C1LA 3CAKA 4AEOA 3FJLA 1YX1A 2XVPA 1HKJA 5BNKA 4HTYA 1VF8A 3VGBA 1UD4A 2VKZG 5D2WA 2C18A 1MZHA 2E6YA 1UWTA 3W9ZA 5CAKA 1ITXA 3THCA 1EJ7L 3CPRA 2OELA 3CUXA 3GO2A 5I3KA 4XKYA 3C8NA 1Q8AA 3N1AA 3PBVA 3GUWA 1UA7A 3TXZA 4OBSA 1RBLA 2X7VA 5TD4A 3EWCA 4XD3A 2GK1B 2HZGA 2IPJA 1T0OA 2G41A 1KXTA 3CB3A 3QYSA 1LL7A 3ZSTA 2B7PA 5A8MA 1CGUA 1RALA 3RJYA 3BAIA 1UPPA 2OLHA 5BZAA 1TJ0A 3EWWA 4GUJA 1XLBA 2VUYA 1VYPX 1UH2A 3LN3A 3Q4DA 3BLLA 1V02E 1LJYA 5EB8A 3QR3A 4N6FA 3REQA 2XVGA 3F4NA 5D2YA 1JCJA 5HNNA 5HQMA 4PMQA 3Q94A 3MI2A 1E0XA 4IGHA 1X6LA 3WSUA 4J3SA 3Q37A 4CQBA 4O50A 2F84A 4H7VA 2AGKA 5BXRA 3IWPA 3MV01 3ISIX 5LNUA 1LCOA 3ZT5A 2J7BA 1ELSA 1PTGA 1XYLA 2PP0A 1HKVA 1GTEA 3EX2A 1UHVA 2DUXA 4I9TA 5FA5A 3RNDA 4LS2A 1TPH1 1OYBA 2CZEA 5DY2A 3PPGA 3EEGA 4WJXA 3ABOA 2PDXA 5DXXA 5HOSA 1SR0A 3L4TA 1DE5A 4TX9A 2JIWA 5LKYA 2OT1A 1J0JA 3C86A 4U5KA 3IAPA 3R13A 5AYIA 5HULA 1W9VA 3G1SA 4AXKA 1EXPA 1TZ9A 1OC5A 3GVRA 3S2CA 1S2WA 4UTJA 4UMBA 4DUVA 2GQAA 4O17A 4S3JA 3TQVA 1SJBA 3RU8X 3UGRA 3GFXA 3UXLA 3BURA 3H2EA 2DZXA 3W28A 1EHNA 2QUTA 1L0PA 1GVFA 1JPIA 2G4JA 3VTRA 4GLEA 1EGZA 2BTMA 2GVGA 2YZ5A 1Q6LA 1MUWA 4Q8UA 2NT0A 4TVDA 5A5WA 1F3WA 1XCWA 4WSJA 4Y7EA 3UERA 4MWAC 1TPB1 1XJBA 1AZ2A 4LS1A 4S3CA 2AOSA 2RJGA 1CB2A 4CD5A 2JF7A 3SCPA 3VX0A 2A21A 5C71A 2IKIA 1PO9A 4QBXA 3R25A 2Q71A 4IIBA 3APGA 3CAQA 3S2NA 1VJIA 1NU5A 4I8DA 4AZGA 2PCQA 3BAJA 1AZ1A 4W87A 2AAMA 2ISVA 1QI0A 5AC8A 4JQAA 2XGIA 3LCGA 2UV8G 4DZHA 1P7TB 4JNMA 2NUWA 5E9XA 1D8WA 4IM4A 4OBTA 1I60A 3GXFA 4I8YA 4JTTA 4OU1A 1HJXA 5A95A 3Q65A 2E0PA 1OQFA 5EMJA 1JR1A 2E1DA 3N13A 1NDVA 4F0KA 1N8FA 3ZQ9A 1JFHA 4UR8A 4AISA 5IXEA 1M01A 1WV2A 3R5EA 4AYSA 5KEZA 3PSWA 3DHFA 4UQ9A 4FXFA 4WK9A 3GVGA 3L66A 4O0QA 1W56A 3NZGA 4ATDA 4EACA 3ZT6A 1JRBA 4UFKA 4E3VA 3RX4A 3VIJA 3FKKA 2AGTA 4HSNA 3CJPA 3KTXA 3GC4A 4WUIA 3AJXA 3A5VA 2BHZA 5D2XA 2WKJA 2XVNA 2WJEA 1UWAA 3DU0A 3KTSA 4XISA 4ZTXA 3HGJA 1Q63A 1XGEA 4Z2JA 1LORA 1WZKA 3PZMA 3LG3A 3MCNA 3G3MA 1BG4A 3TR9A 4AIOA 5E9AA 4D8ZA 3JR2A 2DIEA 4W89A 3NAVA 4FO4A 2YA1A 1K4HA 4JDYA 1OZQA 4RDWA 1F05A 1NTHA 3QYQA 2VURA 5I07A 1S2AA 1V79A 4RLIA 1W5MA 1Q2RA 1RV8A 4IPPA 5AHEA 3GIPA 3NM3A 2OTDA 1OG0A 4Y8FA 3UA3A 3HMCA 4PRTA 3AISA 4NYYA 2ZDRA 4NU7A 3W1XA 2GFTA 2C1IA 3EA1A 3ZT7A 2DJXA 3BC9A 1OIFA 4HNUA 3GW0A 3GTFA 3RLGA 3GNPA 3RMEA 4O8AA 4OV4A 2QUNA 4O1BA 4NJIA 3AZRA 3Q67A 1RJRA 2ISSA 3BE7A 4OOUA 1T5AA 2TAAA 3NZQA 4KCWA 4TMCA 3W7OA 5E93A 3PULA 4MLJA 3W6LA 1FVPA 1F3XA 3O6DA 5LA0A 2IXUA 4QXIA 3W7HA 3W7RA 5DY3A 2YCLB 3TFXA 4F0RA 2XZ9A 1XISA 2YBUA 1TWWA 1OSEA 1FP9A 1YPXA 2I5GA 3AMLA 2CLLA 4J4KA 2AQVA 4M81A 4V2XA 5LHFA 1GOMA 2BOGX 2VGBA 3L0KA 3IK4A 1WDPA 2PAJA 4UB9A 1W5OA 2GUBA 3O6AA 4HU0A 2YOCA 2ABAA 3VOHA 4I5XA 3F5LA 5D03A 1UCWA 4MKVA 3NCOA 2QW5A 5A8NA 1DBTA 4HYWA 2EO7A 4M80A 2I7GA 1K1DA 1IT0A 1SUXA 3WELA 1AW1A 4RE0A 1HIZA 2L5HA 1ZS2A 3MUXA 2QCDA 2W79A 4DF0A 1LT8A 4O14A 4J2MA 1ME9A 2BB0A 1UC4A 1WP6A 4CCZA 4A2RA 3ARXA 1P0KA 7TIMA 1HP5A 4PSPA 2OR2A 4FOKA 1RCXB 1YBQA 1R47A 3GG0A 5IRPA 4OT7A 4FEZA 4NX0A 3LZ5A 3T55A 3VMOA 1S2CA 1R38A 4NQ1A 3I7SA 4EWND 2V5LA 2W4XA 3ITOA 3F7JA 1JGIA 3A3XA 1WQ5A 4IJRA 4PUKA 1OGBA 4C6QA 4F4RA 2WVVA 3ALGA 4RX0A 5JU6A 1L8PA 3PFMA 2DUAA 2UWFA 4WDTA 1XSKA 2IMRA 3GQYA 4L7ZA 5LA2A 4TX8A 3SCUA 3VGEA 2BY1A 1FHUA 1MQRA 3SY8A 3IVUA 4L9XA 2W61A 1EBGA 4DY1A 1VJZA 5BU6A 2GGEA 3GHTA 2OG9A 3N6JA 3F2BA 4YTRA 1R3YA 4MMWA 4Z1CA 1Q2SA 3LA4A 1JXKA 2DZWA 2A4AA 4A2SA 2DT1A 2PGRA 1LOLA 4DQWA 4HA4A 3IARA 1DIDA 4CNNA 4O1DA 4G8TA 3RU6A 4UR9A 3MUY1 4UOZA 1F74A 1V3LA 4J3TA 4O13A 3IJ8A 4HJFA 1EA9C 4JIIX 5G5IA 5K9DA 2QHAA 2XFFA 2NUXA 3TJIA 4ZTYA 2RKXA 4J28A 4QE1A 1Z48A 3FSUA 1KFJA 1R3TA 1VLIA 2OMAA 4PUJA 3WK0A 4GQGA 1EEXA 4E5TA 1DYSA 2QCGA 4F2TA 3ZR6A 2P50A 2PDLA 2YCKX 3UU0A 1ONWA 4MJZA 2ZC8A 1S2UA 4AAJA 5F1UA 1YE6A 1X1NA 3G1YA 3FJ6A 5C7VA 2DQWA 1BSIA 3NIYA 3ARVA 1Z41A 1QNQA 2C71A 4WOZA 3GW3A 4HD5A 2GOKA 3TJLA 1EXBA 4JTIA 4M24A 3WYZA 1ODUA 1UR2A 4W4QA 1RXOB 1PCWA 4U31A 4PUMA 1R7AA 4QCFA 5FJOA 2BDQA 1WBHA 1H51A 5C55A 3DHDA 4Z0JA 1UKSA 2NX1A 1OX4A 2ZE3A 3EWXA 5E09A 4MADA 2D3LA 1PE1A 4LRTA 3S6OA 1PCKA 4E2VA 4PTXA 1L6SA 4YIWA 1DWJM 3VPLA 3QTGA 4F2BA 3LY0A 3FS2A 2F2KA 4Q4KA 4Q4PA 4Z17A 2X2GA 7TAAA 1OCQA 2QCFA 1KFEA 1FHVA 4OECA 2ZICA 2XUCA 4UWMA 3DGBA 2VX7A 2HTMA 3AXKA 3N73A 4FNUA 4O1AA 3RILA 4AF0B 3LTYA 3QZEA 3CQHA 1XLHA 4C7GA 1QNOA 4XZ9A 1B3WA 2DW6A 1B3YA 1ZSXA 4UTTC 3TA9A 2PB1A 3BW3A 1C7SA 2R14A 1R9YA 2YL9A 3TAKA 4GQRA 5F2MA 2PEVA 1JDAA 1I8JA 1B54A 1N8IA 2JEPA 1OX6A 1F3EA 3QC3A 3E74A 1Y5XA 2Q8ZA 3BQ6A 1UOKA 1FWSA 4K37A 2C19A 3PBWA 4PA8A 4EWJA 3FYOA 4LOCA 5H91A 3DG7A 2GDUA 1F3TA 2V82A 3TJXA 2A3LA 1O4UA 2E4TA 1TMQA 2WKLA 1UD3A 2Q8XA 3VIGA 4IUOA 3W75A 3MMWA 5LSMA 1EP3A 2DUZA 4YTTA 1XDJA 1N82A 1RBAA 3WNPA 4U3AA 1H3GA 5BOOA 1LBFA 3IACA 3W6YA 3GU9A 2ZRVA 2EHHA 4C1NA 2A3BA 3CQJA 4NRRA 4AIEA 4PUWA 3NSMA 4YS1A 2R8WA 2V3GA 3H4XA 4N4PA 5JH2A 4CKQA 2Q3OA 4JN8A 4EOUA 4UIOA 1V4YA 2DP3A 4K36A 1XIJA 4B5TA 2C1GA 5I03A 1TJRA 2V69A 3QY8A 5CG0A 3TQKA 3STEA 4I7VA 5T9BG 4YTSA 4H8NA 2WHMA 1VFOA 2BHUA 4AHQA 3A47A 3TDFA 3VDAA 3CUHA 3ZXWA 1U5VA 4BZYA 1J2BA 1OFEA 4HQVA 1FTXA 2FDSA 3WH6A 3QN3A 2Z1KA 4UFMA 4UQCA 3T4WA 4ZCWA 4HOWA 3WH8A 1TZZA 4IGNA 1EWEA 1ZFJA 1DXEA 1AW5A 4JICA 3QF0A 4IMAA 3MUZ1 4KFPA 4ATWA 1W3HA 2Z4GA 1KGXA 4Q8TA 1UYQA 1ZNNA 2XVKA 1W5QA 5CJNA 1QBBA 1GZ1A 1XIHA 1EP2A 2WLZA 1F7BA 1FCVA 1VR6A 3RPTA 4YU1A 1J5SA 1KM1A 1BWVA 1OADA 3VGGA 3LPFA 3GDBA 1DTNA 3R10A 1LBLA 2O9OA 3NDOA 4JHZA 5G4HC 3ECQA 5ENLA 1H1NA 4MVAA 2GQ8A 2Z2AA 4JY9A 2FFIA 3TYBA 3TQ0A 3RHGA 1ECQA 1HJUA 1D8CA 2YJQA 4REQB 4GO8A 1XL9A 3U3HA 1LLWA 2VFIA 3W53A 3IVSA 5HPCA 3IJDA 2YCIX 1TELA 4IPLA 2A7RA 2A5HA 3B3DA 3SJ3A 3V0SA 3CM4A 2WW5A 2ZYFA 4GXWA 3BOXA 1S5MA 4C91A 1FQ0A 1PJ9A 2FPVA 3FLUA 4L4OA 1HJSA 5FD0A 2HXTA 2G95A 4TXEA 3OLIA 1XM3A 5HNUA 3C52A 1QU4A 3E1F1 1TV3A 1AD1A 3M0ZA 1GNXA 2ZUTA 1Q7QA 4PMUA 4ACZB 2OSXA 4W85A 1K8ZA 4R33A 1KM2A 5KZDA 2ZUNA 1JG9A 1U5JA 1PB0A 5EMUA 4C1NB 1GW9A 1CXIA 5A2CA 3W7PA 1UKPA 2VMFA 1X7FA 4LUTB 5REQA 5ABHA 1TE1A 3RM8A 1VP5A 2DIKA 3BG3A 3KCJA 4M8UA 1H2JA 5G4EA 4A22A 2BXVA 1PEZA 3WD3A 2XHYA 2H90A 1XC6A 2OT0A 3DFQA 9CGTA 3BAXA 3RF9A 3G1DA 1KCKA 4ERGA 7XIMA 3ZZ1A 4Q8NA 1IT7A 5LXXA 3GH7A 2XM1A 4DI8A 3HTWA 4NJGA 3UP8A 1MO0A 3ZVIA 4ZR8A 5RUBA 3KOFA 5K3VA 2PLCA 3UXIA 5EY5A 4GGHA 1XBXA 4A05A 4CVUA 1QNSA 2WXDM 2OQYA 1S1RA 4N6EA 4WZHA 2OLSA 4AYGA 3AMDA 3WDQA 1LLZA 3V1PA 3VFLA 3V5OA 2YX0A 3RRXA 4MAVA 5DCEA 1MWOA 1L8NA 1E4NA 4Z0SA 3UR8A 2FZBA 1L2UA 4GH3A 1IEXA 3GTHA 3LGDA 4EF9A 2QDEA 3DBPA 1XINA 2XJ7A 1EOKA 3L4XA 5C9WA 1WZLA 3KUMA 4WIWA 3TYCA 3V0TA 1W2VA 3DYOA 1XKJA 4QE4A 3GM8A 3H70A 3PAJA 4UC5A 4S3GA 2E8ZA 1QOPA 2VJXA 4YXGA 3DYPA 1VPYA 2QJGA 5C9XA 2QCLA 1DQWA 4XBSA 3FV9A 2I5QA 4ZFCA 1KM3A 1W3LA 3DAQA 2E6DA 1M5WA 3MCOA 4M51A 3NZRA 2VGIA 5EMMA 3RG6A 1UR0A 2J27A 1E5NA 2XWEA 4M7TA 3EDKA 3GBDA 1WKEA 3WJSA 2CC0A 4B5XA 5F2GA 4ZENA 3W2JA 1BPLB 5AHLA 3SURA 1CB7B 1B3VA 4C6PA 3KBSA 2XIIA 2O55A 4HZ6A 3ZIZA 1JNDA 4MDPA 4L4MA 4W8BA 4GIEA 1W0MA 3C2EA 5JIPA 4FHAA 3B8WA 5EMKA 4Q7NA 1MFVA 2P5NA 3PJUA 1G7VA 2Z24A 2VDGA 3FDGA 3L2MA 3EWDA 4XV0A 1LYXA 4HNNA 3FIGA 1BG9A 5D02A 3WLPA 1VPXA 4WJ8A 2AAAA 4DM2A 3BLOA 4R85A 4AD4A 4M1RA 1BLIA 4KWSA 4US5D 3KZPA 4J35A 2HVNA 2OZ3A 3N14A 1VFLA 4DZIA 1JAKA 3IGXA 2WVUA 1A0DA 2RDUA 4UTUA 4QNEA 2G97A 4Q32A 3P7YA 4C6MA 4JFUA 3WF0A 2E1WA 4W88A 3PY2A 4M6UA 4LEFA 1Q4NX 1EB3A 3VVGA 2QCDB 4UOJA 3LGGA 3AIRA 3PANA 1MXSA 1QBAA 4GBUA 5I00A 3M0HA 3KRBA 1TE6A 3D0CA 2OVLA 4UNKA 1SW0A 1A3XA 3UVAA 3PZ9A 2WQDA 4HT3A 4B3LA 8CGTA 5JIWA 2WMJA 3TZFA 3UT0A 3P2VA 4DZAA 1TRDA 3W7JA 4P8WA 4AHOA 3MVTA 3SCOA 4L6HA 1C92A 4H8HA 4HNCA 3KVKA 2J7GA 2XN2A 4IQLA 3W1TA 4FI4A 1OFAA 1Q5MA 1OT1A 3W84A 3SECA 4QG8A 2V3FA 2TMDA 3HO8A 1RH9A 3E0VA 3A3WA 3H7UA 4AX7A 3QPEA 5T91A 1V7AA 4HBKA 2OO6A 3AIBA 3BLDA 4P7LA 1E0WA 1NOWA 4KBXA 4QP0A 2Z1XA 2J7FA 3QHOA 5JMUA 3C0SA 2HCVA 4JIQA 3SBFA 2J24A 2FHFA 4EANA 3QQ0A 4O16A 3WMSA 3ELFA 2HRWA 1FKXA 1FH7A 5AFDA 2FHBA 2J7EA 3NOYA 1ISYA 2FB3A 3O16A 4BF5A 2E6AA 3LMYA 1FFQA 2EG8A 3FSTA 3PSVA 1LRQA 3LPPA 3V4BA 1RR2A 2YCEA 3EA2A 5FAGA 1VEOA 3PNZA 4V28A 4RXFA 1EPXA 1CX9A 4HK7A 1UQYA 4XVDA 1NFBA 2PGEA 4XKYB 1JULA 2ZFAA 3LSCA 3W0KA 4ROQA 1XCFA 3O8AA 4TTGA 2V2CA 1MSSA 1JDFA 3T0CA 2Y89A 2FMNA 3C6CA 4MNKA 3F03K 2ZXDA 1OFQA 2XFWA 2XIMA 4PUEA 4B3ZA 2DZPA 3KDNA 4J5NA 3XINA 2JBMA 3PC0A 1J0YA 4RE3A 1ZZMA 4JFTA 3LXBA 3PBYA 4POCA 3MSYA 3T09A 1V0LA 4FNPA 4QDMA 3U0HA 4B5WA 1VFTA 4QDPA 3NA8A 1E51A 3R0UA 2H3BA 3WBWA 4MUPA 4OVXA 1EOMA 2BBFA 1AA1B 5EA9A 2C16A 4GXMA 3W7IA 3WQPA 4UTMA 2Q02A 1DJGA 1GORA 4RW5A 1FDZA 8XIMA 1PWLA 3FKRA 1TPVA 4AWSA 1E0TA 1IGSA 1B3OA 4LWWA 4TX6A 4CNPA 4J9JA 3EWUA 4E8CA 1OCJA 4O53A 3N04A 3BTNA 3R12A 2J9ZA 1VHNA 4UTLA 4QRNA 4IL0A 1TJ2A 1BRLB 4FF5A 3LTSA 3VD3A 4QS6A 4IGSA 3G0UA 1G4EA 2ZCGA 5I0DA 4N2YA 2PTZA 1AH4A 1XQLA 3BCFA 4MZ1A 5HATA 1UKOA 3CK5A 3UXAA 5K4XA 1GVSA 2XIJA 2ZRWA 1GYLA 1KBLA 2XTKA 5E70A 3ABSA 1LUCB 3F4WA 3RJXA 2ZXBA 1H5YA 5I24A 1CGTA 1MNSA 2NSOA 2ZRXA 3UEQA 5ABEA 1RCOB 1QOXA 3SW6A 3MMTA 4Q4QA 4EIVA 2XGZA 3AIVA 5AYBA