1WBJA

Wildtype tryptophan synthase complexed with glycerol phosphate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Structural Basis of the Catalytic Mechanism and the Regulation of the Alpha Subunit of Tryptophan Synthase from Salmonella Typhimurium and Bx1 from Maize, Two Evolutionarily Related Enzymes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 101
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1wbjA00
2RH9A 1NEYA 5KSWA 3W1NA 4J9JA 3P5ZA 3M7WA 1D9EA 1TIMA 5CKSA 3HGSA 5I3JA 3GDLA 4LNYA 4N4QA 1XKYA 3EX6A 2ZFAA 5AHIA 1G4PA 4DO6A 4OHQA 1AW2A 4JTSA 4L4MA 2PE4A 1ZFJA 3OA3A 2DJLA 4MFEA 1YPFA 1H1ZA 4FX8A 1TMHA 3D0CA 2X1UA 3KOFA 3P62A 4OU1A 3MP5A 1O5KA 4AAJA 1F73A 2PC4A 3R13A 4AEOA 2QCDA 5G1TA 3W7RA 1X7FA 4WOZA 1LOQA 1VYRA 2V81A 3W1LA 1EP2A 3P8JA 4E2BA 4ZQPA 1GEQA 5K4ZA 4S2BA 3UXAA 4D2JA 1TO3A 5LHEA 2BSLA 4O28A 3S1UA 3W7PA 3B05A 1PE1A 5FF3A 3FJLA 3HIJA 5I3FA 3M41A 2B4GA 3EWZA 1R2SA 1T99A 1F2JA 1YDVA 5FF2A 3M5ZA 4IX2A 5FF0A 1KFJA 5I3KA 1Q3NA 2RDUA 2FJKA 1E51A 3N9SA 2G97A 1H63A 3O8AA 4M19A 4ADSA 3TMQA 1BKSA 2DZUA 1SO4A 5IBXC 1PHQA 2DU2A 1TTJA 2A85A 1XDMA 1XXXA 1LBFA 4A2SA 1G4TA 4M5PA 1DKWA 1VPXA 3M6YA 3IVUA 2J9ZA 4TR9A 2QJGA 2NUYA 1DV7A 3DFNA 2I9EA 4HHPA 4LV9A 1N55A 3CM4A 4JTTA 4GUIA 3P81A 1EWDA 2NXIA 3PBUA 4HN4A 5EL1A 3SI9A 4CCDA 1SSDA 2O7SA 2QJIA 4KFNA 1FUYA 1K8YA 5D2XA 2ZDRA 1MO0A 1H61A 1K7FA 3NO5A 3LX9A 3S0CA 3SGUA 2FIQA 1TQXA 4KKXA 1G7UA 1VZWA 1YTDA 3P84A 3LTYA 1NAL1 4NX0A 3LCIA 3NM1A 2ATMA 4FIQA 3STFA 3LI1A 4JTIA 4UTLA 2WV8A 3MP3A 3MP4A 4C1KA 3FS2A 4O0ZA 1JQVA 3QH2A 3UPBA 1G4EA 3ANYA 1SZEA 1TSIA 3T78A 5AHFA 6ALDA 2ZA1A 2ZZ1A 1H7XA 3KVJA 1JUBA 3EXSA 1IGSA 2P1FA 3LCWA 4UFLA 2CLEA 4WD0A 4JTJA 3HGOA 2B7OA 5C55A 4IMCA 1U5JA 4JYDA 2R8WA 5BRBA 3BGJA 1PS9A 2E6YA 3PVFA 3A5FA 2H8ZA 4C1LA 4CLMA 1KBIA 2QCDB 2PURA 3MYOA 5J5DA 3NA8A 2WSQA 5FEXA 5K2ZA 3PG9A 4NXKA 3OEXA 2B7NA 4Z1BA 4NZJA 3RNDA 4CCCA 5SWUA 1KV5A 1JUKA 2DZSA 2VEPA 3KRZA 1G6CA 1GTHA 5D2WA 2C3ZA 4MIMA 3QJAA 4RLIA 1KFBA 3QZEA 4IX0A 1W5NA 3TNOA 1H5YA 1PIIA 2VFFA 5HNRA 4YCOA 4PH6A 3NPVA 4FXRA 1AL7A 1XCFA 3LCHA 5DBTA 1M7OA 4NVTA 4JX6A 5HMSA 4MY1A 3PBYA 3SFKA 2A21A 3PF3A 2NWRA 4XZ9A 2GJLA 2HS8A 3GX9A 4R34A 1VHCA 3KRSA 3SZ8A 1I4NA 1W37A 3W07A 4MLRA 5CZTA 1X1OA 1Z44A 3YPIA 3LCGA 3O63A 4A21A 3I6RA 4M7TA 2CWNA 4DEFA 2E77A 4O4VA 3VI2A 2Y6ZA 3VE7A 1TPVA 1GZGA 2C0AA 3PUOA 4X2RA 5HWJA 4FO4A 3PAJA 1KLYA 1LRQA 3VCRA 7TIMA 2CU0A 2VEMA 3A21A 1D3GA 2ZA2A 1ZHAA 5F2MA 3GZ3A 4AF0B 1QMLA 1WV2A 2QUVA 2VFGA 1LOSA 5FF7A 3MHFA 2VFHA 3W7MA 4NNBA 1I45A 4CQAA 4DO5A 3IEBA 3JR2A 3UZ5A 3GDTA 5DN1A 5IBXA 1JCNA 1YDOA 3PR2A 2Y61A 4DELA 3TXZA 1W56A 5LGXA 3UXDA 2OT0A 3GR8A 5K9XA 3M5VA 1KM3A 1H50A 4DF1A 3U6WA 3IIOA 2YYTA 2DZXA 3GB6A 4KWWA 5I3IA 1PV8A 4FNTA 4UFHA 3STCA 4CQ9A 2W0UA 4ZVJA 4NJJA 3NQDA 3QMTA 1HO1A 1XM3A 1O4UA 4Z1CA 4MKNA 1AW5A 1WYIA 1JVNA 3OVRA 4UTIA 4UFIA 4Q32A 3PULA 3FJ6A 3UQNA 1WAUA 5E93A 3NNTA 3QPYA 3EWXA 1YADA 3L5LA 3OHIA 1GT8A 2YFOA 3G3MA 1DOSA 2WPBA 3P80A 3NYZA 1F76A 3OBKA 3P5YA 5DLCA 5CZJA 3GKFA 2VOMA 1ME7A 3BARA 1WBJA 3TQVA 3SJ3A 3WJWA 4LU0A 3W87A 3MBDA 4JX4A 2E6DA 2OZ0A 3LRMA 2Y7GA 3LERA 1EEPA 3W74A 4NNCA 3W22A 1OK6A 5G4WA 2ZQ0A 4O15A 3P82A 3AO0A 4W9TA 3NQVA 1SZGA 5AC6A 1FCQA 1GG1A 5GVJA 3USBA 5KZEA 3Q37A 3TIMA 2J6XA 2E6FA 2Y7FA 4PTNA 1S3HA 3W72A 3BG9A 1FWNA 2X30A 3P67A 1VRDA 2ISWA 3QEZA 1QNVA 1LM1A 1K02A 1ML1A 5I3HA 3GXNA 2QAFA 1B4EA 4AWSA 3N9RA 4BI5A 3O6CA 3EXTA 1R30A 3QC3A 1VH7A 4N9CA 3W7EA 3NQ7A 3BW2A 4PEKA 4QAIA 4GFSA 1YDNA 4LVAA 1FWRA 4S1FA 4K36A 3PBVA 2Z6IA 3NQFA 3B06A 4DO4A 1YLVA 3QF0A 1A5AA 2AAMA 3TJLA 2ZBTA 2QCLA 1EWEA 4N9DA 1VYPX 5DCEA 3HB9A 1V7YA 4RV8A 2VC6A 4HNVA 3QSRA 2OMAA 4BI6A 1MEHA 3GR7A 3UWZA 4DPPA 1T0OA 4UCGA 2GQAA 1B3OA 4LUIA 1LLZA 3C0JA 2H3BA 4NJHA 2J88A 3LBMA 3RMJA 4CCEA 3W71A 3NR0A 3DFPA 1LBLA 1VLIA 3TCEA 1OK4A 4K7VA 1F7BA 5KINA 2QKFA 5HUPA 1TPC1 2ZZ5A 1L6YA 2A2IA 3QMSA 3MHGA 3G22A 4Y90A 1I2RA 4PCFA 3QSTA 4M6VA 2UV8G 5C54A 4DPQA 4O16A 3LHZA 2AQWA 2X1SA 2NV2A 4UTWC 1OFQA 3DI0A 3W83A 1KA9F 4JYFA 2YFNA 3N34A 5D30A 3LHTA 1SPQA 4EF8A 3W70A 2A1YA 3TUUA 3L68A 3BV4A 4HIBA 3OVQA 1BEUA 3NDOA 2NWSA 1OFAA 2V2CA 2CZFA 4IUOA 1YXCA 3B03A 1QOQA 3DFOA 1KTCA 2QEZA 3GAYA 1FCVA 3L2IA 1Q6OA 2VFEA 4TX9A 4IPIA 3BPWA 3TU9A 1H60A 3UY7A 3FKKA 2XN0A 2ZRZA 3TQ0A 3BW3A 3HG2A 4UUIA 4UTJA 5LKYA 5F4WA 4JXCA 5T26A 1THFD 1G69A 1LYXA 2OT1A 2XN2A 4YLWA 4XBSA 3HJZA 3SECA 2ISVA 2RDWA 1TCDA 3DFQA 3P8IA 2JKEA 3SGZA 1W5PA 4UNKA 4RKAA 1EX5A 2V2DA 3O1NA 4JTFA 1FCBA 1HG3A 3A23A 5FEZA 2R91A 4B5NA 3C8FA 4ADUA 1LRTA 1S5WA 3P61A 4IMEA 3QFEA 4QIUA 1LP6A 3NZRA 4HSNA 1XL9A 2WJZA 1O94A 3INPA 1WX0A 4TMCA 4Y9AA 3TH6A 3A5VA 1WA3A 1L2UA 1OFBA 1P5BA 5HR6A 1ZAJA 4JY9A 1OFPA 4WY0B 3TFXA 1XUZA 5F1UA 4UTWA 3E96A 3G1HA 4MZ1A 3M1ZA 2VFDA 4Z08A 4XWUA 3W7KA 3UYCA 4GNJA 3TA6A 1HUVA 2D73A 3B0VC 4S2CA 1H7NA 1TRIA 4FNQA 4UMBA 4UFJA 3ZFHA 4UC5A 4IQLA 4L4LA 3W3OA 2TPSA 1G7VA 4UIOA 4FF7A 1TV8A 4XQ6A 4H3DA 2OJPA 4KFPA 2Z2UA 3EKZA 3E49A 5E0KA 4LTSA 2ABAA 4BWLC 3KFTA 1ZNNA 3LRLA 3QPZA 2RFGA 3GDKA 5AYYA 4LC8A 4NZFA 2DZTA 2YCEA 3TMLA 1JUEA 1OVDA 4JR5A 3WJZA 3E02A 1SSGA 4EOUA 4UTHA 1DL3A 4MYXA 5FESA 1I2NA 3TK7A 2BZNA 2Y63A 1K7EA 2EHHA 4GRSA 2WNQA 3W1QA 3ATZA 4XBKA 5K9CA 5ABTA 2EAWA 3RU6A 2G95A 2QR6A 4HKPA 4BR1A 1WOAA 1Z41A 1IIGA 5F1VA 4LRTA 1EIXA 4JS3A 5BOOA 4HNTA 2ZCGA 5LHFA 2YW4A 2FFCA 1QR7A 2QUTA 1GVRA 1OX4B 3P7YA 1O95A 2I1OA 4OV9A 3N19B 1QDSA 4BF9A 4H4IA 1TTPA 2TRSA 1TJRA 4Q4KA 5D03A 4IMFA 3DFSA 5F4SA 3UWWA 5LNRA 1L6WA 4N6EA 4MPQA 4K6AA 1JCLA 4LVGA 5AC7A 3G1DA 5G2HA 1H7RA 4Z1AA 1MEIA 3S5YA 3VNDA 3LDVA 2YYUA 3ZWTA 5AHMA 4UTTC 1TPUA 4ZQOA 1NF0A 1OYBA 1A5SA 4ADTA 3DKJA 2QDHA 3IIXA 4BI7A 3NL5A 1TV5A 5C5YA 3B0PA 1BWKA 1QAPA 3KVMA 3SSJA 3TX9A 3BG3A 3L66A 1ONRA 3L0GA 4I7WA 1CW2A 2ZZ2A 2X1TA 3LCXA 3G1AA 3C2RA 1DORA 3W23A 1SFLA 4MLJA 1RPXA 2VFIA 4H6KA 5AYZA 1LOLA 4O53A 3SIZA 1M6JA 1SW7A 1HFBA 4QM1A 1OHLA 5HWNA 3EX2A 4LT9A 4FHAA 3C56A 1WXJA 3KRUA 1IXOA 3GDRA 4RK8A 1RQBA 5CPOA 3HO8A 2JGYA 3WFAA 5D2YA 4LRSA 1OX5A 2FLIA 4WUIA 1TPWA 4X3ZA 2LLEA 3MO7A 2V5BA 3W6YA 3NXFA 3PB0A 3I68A 3QQ1A 3EKLA 3RFAA 4AHOA 2J27A 4Y6GA 4O1BA 1U83A 2BXVA 3EX3A 4ZQCA 2FPYA 3S1WA 3UY8A 4IJBA 3BLEA 3L5AA 1SW3A 3DU0A 3NPUA 5U4NA 3BW4A 1MZHA 1VLWA 5EBUA 2NXGA 2QCCA 3JRKA 4JNMA 1X6UA 1FBAA 1KW1A 1RZMA 3DZ1A 1W5OA 3FYOA 1GYLA 3CIWA 1XDLA 1YTKA 4Y8FA 3LOTA 2QAPA 3SY5A 5AHNA 2V5LA 4LVFA 1GQNA 1KM1A 3M47A 1JR1A 3V75A 3LM7A 1VCGA 3HBLA 3TAKA 4QSHA 4JYEA 3W2UA 1JCJA 3CEUA 3F4WA 1AG1O 2AGKA 3R8RA 1KFEA 3IVSA 5FF4A 1GTEA 3BGGA 1VJIA 3NL3A 3TC6A 3MI3A 2A7NA 1D3HA 2CLIA 4LUJA 4CNOA 1KLZA 4JTEA 4JTGA 4ZZ9A 4UMAA 5K9DA 3GXPA 4PODA 1DQWA 2QCEA 5LZLA 3IV3A 1O5XA 4ZMGA 2C16A 3WK3A 1QFEA 1IXPA 3LBCA 1IF2A 4DQWA 3FFSA 3N2XA 4JTUA 4EWND 4UTUA 3GVGA 3W84A 4Z1DA 1LORA 1NSJA 1RR2A 1W31A 5L6UA 4O50A 4LW7A 5TQLA 1ZY9A 3CU2A 3GLCA 2VKZG 4AF0A 1DVJA 1P1XA 5FI8A 3HOJA 3KVKA 1B9BA 3EB2A 2PRMA 1RQEA 3RLVA 4M6QA 2GOUA 4FB7A 5C2XA 4A2RA 4NQ1A 1JRCA 3DGRA 1F5ZA 1GYNA 1N7KA 1ZAIA 5IM51 3ABOA 3H53A 2EPHA 3S42A 2WNNA 5HULA 4RXGA 3F4NA 1GVSA 2CZDA 3S5NA 1LTDA 3GNNA 1I2PA 4IMGA 3HPXA 2C19A 3C52A 3DKLA 3G1FA 3PSWA 4Y96A 1W5MA 1OABA 3QMRA 2ABBA 1Z48A 4RZ4A 5AOUA 1EB3A 2QCMA 4EVZA 1LZOA 4UMCA 4XKYB 2DP3A 3PUEA 5DXXA 2DZVA 2J9XA 4A22A 3W9ZA 1VS1A 3L21A 3W1TA 4OT7A 1UJPA 2EF9A 3C6CA 1H7WA 2H6RA 4GUGA 2EGZA 2FPVA 2NX9A 2P10A 5TIMA 3T55A 2C1HA 5EYWA 3LXCA 1IXNA 1EPXA 2CLLA 2TMDA 3W1AA 4JDBA 2A5HA 2V82A 2GUUA 3TQKA 3W7HA 4QISA 4CQ8A 2X2GA 3M5XA 3ABRA 1G4SA 3W1PA 1W3TA 4BK9A 4JTHA 5K3VA 2GVLA 3L0KA 3PUDA 4TO8A 1P0NA 2ALDA 3W2JA 1F6KA 3W7NA 4PL1A 3V1PA 3W7JA 2YPIA 1TPH1 3MI2A 5A8GA 1UUOA 5DCBA 4O10A 1VCFA 3LV5A 3QQ0A 1W3NA 1YXYA 3BK0A 2DORA 1PCWA 1B4KA 3LRKA 3TV8A 1HTIA 3STEA 1EP3A 1H7OA 2E5DA 3DAQA 2Y88A 3S8HA 3NQCA 1OX6A 1DQXA 3R2GA 4O1AA 4WY0A 1FDJA 4M7SA 1TPFA 1HO4A 4NU7A 1LCOA 2YDAA 1S5TA 1TTQA 3T7VA 3PY2A 1QPRA 2BTMA 3E0IA 3HGJA 4WJEA 1QOPA 3TKFA 1WOBA 2CLFA 4K38A 2DJXA 4MUZA 4JGDA 5D2VA 3QM3A 4O52A 2NX1A 1J5TA 1OF6A 2CFFA 4ORMA 1JRBA 1LROA 4AHQA 2GPTA 3TFCA 2TSYA 3TDFA 5J5RA 1FQ0A 3G24A 3KXQA 4JY8A 3W7LA 3W7QA 1H51A 4IGHA 1SZFA 3MWAA 2PCQA 3W7GA 3W75A 5AN7A 5K4XA 4RZ6A 1SFJA 4O1CA 4UFMA 4YL2A 3B4UA 1VGAA 5G4EA 1AK5A 1SUXA 1SO3A 1WDWA 3TSDA 4WOQA 2HTMA 2NUXA 1K03A 2P0OA 3S1XA 3W2KA 3W1XA 2CLMA 5DXYA 4UTTA 3MYPA 4NUWA 1Y0EA 4GC4A 2QCGA 4R33A 3UZJA 3SR7A 4YMZA 4N2YA 2OCZA 3HMJG 3R89A 4UXDA 5MHBA 4LS1A 1JJKA 1PCKA 3HG5A 1KTNA 2NZLA 3TW7A 4EF9A 5EPDA 2Z6JA 1OFOA 1C8VA 3W73A 2RDTA 3NQ2A 1ICPA 2YXGA 4JN6A 3LXAA 4GUJA 3W7DA 4OBTA 3LV6A 4JICA 4N6FA 1YTEA 4QNWA 5D04C 5CG7A 2NUWA 1TQJA 4NJKA 3B8DA 1G67A 1TTIA 5AHEA 3NG3A 4I7UA 3S5OA 2V30A 5HJLA 4HNNA 4AVFA 2QF7A 3C3NA 2JKPA 5KZDA 3G1VA 1BTMA 3BVJA 3CHVA 5CGQA 2C15A 3KAOA 1J2WA 3IGUA 3ABSA 3PG8A 3LHVA 5E1QA 5CPMA 2Q8ZA 4NJIA 1EUAA 2H90A 2O7QA 4PFMA 1FY6A 1VYSX 1I2OA 1TREA 2BWGA 1PL9A 2XFWA 2X1RA 2A7RA 3NQMA 2HSAA 3UD6A 1QCWA 4NXSA 2HMCA 4GUHA 2V9DA 4UR8A 5LSMA 4N9BA 1SU5A 2V2HA 5CPNA 2A4AA 4O54A 4I9AA 4EIVA 1TRDA 1LLWA 3FYPA 3LLDA 5AHLA 1LRNA 4LC6A 3I7QA 5EMUA 4ML9A 4Z0JA 3W86A 1F74A 1GVFA 4R7JA 2XN1A 2FB2A 4AHPA 2CLOA 3CT7A 1NFBA 3W7OA 1FX6A 4O18A 4O13A 5BMXA 3NQ8A 2Y85A 3W7CA 1FWTA 4XKYA 5LNUA 5DBUA 3DFTA 3PSVA 2YX0A 1KM2A 3IIPA 1T8XA 4DF0A 3TE9A 1W54A 3VKJA 1A5BA 2PRHA 1XBZA 3N2MA 3G1YA 3O16A 1H62A 1JCMP 2ZRUA 4DBEA 5D33A 2ZRYA 1M7PA 1YXDA 3CPRA 3ZS4A 2OX1A 3C2EA 4MFDA 3C4UA 2ZRXA 2C18A 1GJPA 1KFCA 4R53A 2FDSA 5BNKA 1O60A 4FX7A 4IMDA 3CQ0A 5HUOA 3T4CA 3TW6A 3B04A 2Y70A 3NEVA 3W1UA 3RLUA 4NT0A 1VR6A 2E5BA 3FIGA 1RQHA 3NPXA 5D2TA 2NV1A 4RJEA 1ZALA 1SZNA 3LCLA 4X22A 2ZYFA 3WJSA 2V0TA 2VEIA 1A50A 4UNLA 1MSSA 5KMYA 2BX7A 2J24A 1TPEA 4GUFA 1KM4A 1A53A 1H1YA 2DZWA 2W6RA 2FTPA 1KFKA 3LTSA 5HWMA 1XI3A 1ADOA 3M16A 2A0NA 5HINA 1KV8A 1OYCA 4QITA 1SW0A 1WQ5A 4K39A 1Z42A 1RV8A 4RZ5A 3WJYA 5I3GA 4WZHA 1VQTA 5H2ZA 4KFOA 3IIVA 1VC4A 1W3IA 2C6QA 2DZPA 3AJXA 3M9YA 4M6PA 4RCXA 3TJXA 3L5MA 2C14A 3T40A 3I65A 3QYQA 3HG3A 3NZ1A 3W1RA 3M5YA 1OF8A 2WSYA 3W1MA 3TSBA 1SO6A 2CZ5A 1GOXA 3CB8A 1GPWA 1OYAA 4MZYA 2ZTJA 3NOEA 4X9SA 1FXQA 1SQ7A 4HT3A 1MXSA 4XUGA 3TXVA 1QPQA 1PHWA 3PB2A 3DHFA 3M44A 4TU1A 3MJYA 2I14A 3T44A 5EA9A 3M0ZA 4RR4A 2G5WA 3BG5A 5D37A 4YWIA 3TSMA 2NLIA 2X16A 2ZZ7A 4P2VA 4A29A 3NVTA 3VFLA 1IIHA 4WXYA 3W76A 3NL6A 4IPJA 3LTPA 1FDYA 1ZAHA 4FIRA 3CLMA 4OWGA 1HL2A 3H54A 3DI1A 2QCFA 3G18A 3CIXA 4CNNA 3I7SA 1K7XA 3HPSA 3E12A 1TPB1 3DENA 4N9EA 5C6MA 3BLFA 1ZENA 3U2OA 4QNEA 2B7PA 3UWVA 3C61A 6TIMA 4DXVA 3PBWA 2ZZ4A 3MHUA 1X1ZA 4DF2A 3JS3A 1Q6LA 4QJ1A 3CTLA 4MJZA 5CPLA 4O11A 4JD4A 3OIXA 3G8EA 3LHUA 1FWWA 1Q6RA 3K30A 4ONVA 3R5EA 2JGQA 1R2RA 3G0UA 3NGJA 3LHYA 4MOZA 4LWWA 3HF3A 3HPZA 2QJHA 4LV4A 3FA5A 2CLKA 3O6DA 3QW4B 4BFAA 2WKJA 3IIZA 3Q2DA 3OVPA 4JEQA 4GBUA 4U4MA 4WQ6A 1OFDA 1EP1A 3GDMA 5KTLA 1XFBA 2WOQA 3N73A 5DY3A 3ZWSA 3GIYA 3CC1A 5TBOA 3TC7A 5DCDA 1CX9A 3MMTA 1EUNA 5LNSA 5G2IA 3WK2A 1M5WA 1X8FA 4WY0F 1P0KA 2E5CA 1KFLA 1JULA 5H91A 2YSWA 4N4PA 3VE9A 3UWQA 3G3DA 5KZMA 1FCUA 1WBHA 4NX5A 4N02A 1DBTA 1R47A 4GJ1A 5U7SA 3NQEA 3IRDA 4O0KA 3EWBX 5AYXA 5LNVA 1JCXA 5K7JA 3W2LA 1IXQA 1YPIA 3EWWA 4O1DA 2A7PA 2PRLA 3BO9A 1XBXA 4OV4A 5D05A 4FNRA 3EXRA 1TJPA 4GE8A 5F2LA 3F1QA 1OX4A 4MZ8A 5D38A 4MJMA 1F05A 3WK1A 3G1XA 4G1KA 2ZZ3A 3O6YX 3N3MA 3P60A 1H7PA 4NJGA 1AW1A 2ZA3A 4I7VA 1AL8A 3WJXA 2E1DA 3EWYA 3O07A 2B0MA 3GNDA 4OQVA 3NM3A 1C29A 3NPWA 5CSRA 2E09A 5FEWA 3H55A 4AB4A 4HPJA 4K7YA 3TROA 5BW6A 4OGZA 1I2QA 1A5CA 3CWOX 4ZL1A 4JTLA 2JK2A 3W2MA 2Y7EA 4UFKA 4TMBA 1KM6A 3A22A 1KBJA 1TPDA 2ZRVA 4Q33A 3UWUA 4FNPA 5AC8A 5FEPA 1UB3A 1ALDA 1QO5A 5EY5A 1ZCOA 5D09A 1AMKA 4GXMA 3ATYA 1C9DA 1XC4A 4LS0A 2ZRWA 3G8RA 3G0XA 3KHJA 2VELA 3L65A 1FXPA 2BLEA 3IGSA 4O4WA 4GWEA 5CZSA 2QCHA 1Q45A 5KITA 5A5WA 3LHWA 3S9YA 4LS2A 4YCPA 1P4CA 1FDZA 3W2NA 5F2IA 2G96A 4ALDA 4A3UA 4ZQMA 1MEWA 1OFEA 2R14A 3IGXA 3FOKA 5DY2A 2A6NA 2GVJA 3PC0A 2FPTA 3C2OA 3UWYA 4WXZA 4IOTA 4RX0A 4PA8A 3L9CA 4HNUA 5AB3A 1ICQA 4JIPA 3THQA 2ISSA 3LLFA 4LY8A 3FEMA 2Y7DA 4AMAA 1F6PA 5F2GA 3E9AA 3N14A 3Q94A 1ICSA 3R12A 4ICNA 4JDYA 4PL2A 1N8FA 4E0CA 3PS7A 2ZZ6A 5F4XA 2WQPA 4IWWA 3KVLA 4K8EA 5LGZA 1RD5A 1NF7A 4XTDA 1XUUA 1TB3A 5EKYA 4E2DA 3UNDA 2CW6A 8TIMA 4MYAA 1R46A 1TV7A 3L67A 1ME9A 1W0MA 4O57A 1XBYA 3KX6A 2VXNA 3GYEA 3L0NA 2IQTA 3C2FA 3NAVA 3HQ1A 1S5VA 1XBVA 3EWUA 4O8RA 1KM5A 4LVDA 3MW7A 1K8ZA 2HS6A 1VHNA 4DBDA 2JBMA 2Z0IA 4WX2A 2GJNA 2W79A 3S5ZA 3UPWA 2RHGA 3DXIA 3NQAA 2WO5A 4POCA 3O15A 3P74A 3W88A 2YZRA 3GK0A 3NL2A 4MY8A 2NX3A 2NXHA 4UTKA 4K37A 2J9YA 2KZHA 2GQ9A 5AFDA 1GG0A 1GVOA 2ZTKA 4RXFA 3OG3A 3TR2A 1OFRA 2V8ZA 1DHPA 1GWJA 2R94A 1VCVA 1RVGA 3NQ6A 4LVBA 3LI0A 1W1ZA 3S6DA 1QWGA 2F7FA 5HR7A 3HGRA 1K8XA 5CZ0A 1SR9A 4Z0SA 4TIMA 2QCNA 2WSRA 4KWVA 2FQIA 3SW6A 3LXBA 4HSOA 3EX4A 1JQXA 4K8HA 4BWLA 5D32A 5LNWA 4JTKA 2WNZA 4JIQA 3U8GA 2QUUA 4NNAA 3M43A 3QW3A 1ME8A 4MY9A 3S1VA 1UCWA 4O12A 4AH7A 3GAKA 1OJXA 1J4EA 3ZR4A 1R2TA 3LGEA 3C2VA 2ATSA 1LDCA 3LCFA 3QRHA 4UTMA 1V5XA 3B0UX 2TYSA 3W85A 1UBSA 1K3UA 4OE7A 2RKXA 3LB0A 2YW3A 4O19A 4QQ3A 4ORIA 1NVMA 1LBMA 1ZJIA 1YYAA 1I8JA 3DHDA 4IXXA 2Z1BA 3ELFA 1DJNA 3THAA 5CSSA 3MI6A 3GXTA 1T96A 2H8XA 4ZQNA 4P61A 3PWAA 1KTBA 2E6AA 3O06A 3PM6A 5L9FA 5HQEA 2B7QA 4FEZA 3G1SA 2Q3OA 3WK0A 4FNSA 1W5QA 4FNUA 1L9WA 5BMWA 1BWLA 3A24A 2VEKA 4YXGA 3STGA 2CZEA 2EKCA 3A9IA 3EX1A 3MBFA 3DH7A 4AXKA 1JCYA 2H3DA 4E38A 3I7RA 4MVAA 3Q58A 1GVQA 1UASA 3HG4A 2QDGA 3RF9A 2YR1A 3O05A 4FX6M 2JKAA 4IXHA 3BLIA 1QPOA 3FKRA 1Q6QA 1FWSA 2Y62A 2A6LA 1EA0A 1DJQA 4U28A 3RK8A 3NQGA 5G2WA 1UUMA 2Q3RA 1L6SA 2Y89A 3CWNA 4UR7A 5G5IA 2Q8LA 2CLHA 3DBPA 1B57A 4ZQRA 2YGYA 1SO5A 2VENA 1PVNA 3CEPA 5DELA 4PC8A 1OG0A 3IVTA 4HPXA 2C13A 4AWTA 3TAOA 4O14A 4LOCA 4FXSA 4XTIA 4AWUA 2GQ8A 1TYGA 5G1YA 4O17A 3F03K 3MUXA 2FB3A 5D02A 1W8SA 3EEGA 4JX5A 2GVGA 1CI1A 1KM0A 1QPNA 3GKAA 2E68A 4CNPA 1QO2A 3FLUA 2F84A 3W7IA 3ABQA 3G0SA
chains in the Genus database with same CATH superfamily
1DWGM 4L6DA 1NEYA 4OBRA 3CV6A 3PFMA 3M7WA 1TIMA 1X97A 3DG3A 2OU4A 5A8NA 5I3JA 1XKYA 2ZFAA 4OHQA 1XJBA 4CNSA 1VB9A 1B3YA 4AY7A 3VOHA 3OA3A 1FWHC 1JG9A 3V35A 3MSYA 1MXDA 1H1ZA 1EKOA 2VUYA 3WLHA 3HQOA 1TMHA 3D0CA 3KOFA 1G0CA 3P62A 4GQ0A 5ECVA 1JDDA 3ZYZA 4AEOA 5M5DA 2YL9A 4D6CA 8RUCA 3BAKA 4KERA 4ATDA 4E2BA 5K4ZA 3JUGA 3I6TA 4NZ4A 3UXAA 1JYWA 2O9TA 4GA8A 2CBUA 3W7PA 3B05A 3GVVA 1SJAA 2YCLB 4BCEA 1HJVA 1U5VA 3EWZA 3Q67A 1T99A 1F2JA 1UKQA 3VD3A 5REQB 5FF0A 1Q3NA 1Y65A 1MUMA 4B91A 2DT0A 1AH3A 3O8AA 4NG3A 4ADSA 2DZUA 2ZWYA 2DU2A 4D1JA 3ARYA 4A2SA 1W2PA 4MWAD 4M5PA 4KWUA 5BOEA 5CC7A 3M6YA 2J9ZA 4TR9A 2NUYA 1DV7A 3SQSA 4LV9A 3CM4A 4GUIA 3J7HA 3CS2A 4WRHA 3VILA 3POHA 3PBUA 1ZGDA 5EL1A 2VGIA 3SI9A 4CCDA 6XIMA 3WO8A 4ERGA 2QJIA 4YHGA 1FUYA 3LMZA 2D0FA 3HZ3A 1H61A 3NO5A 3LX9A 4GVHA 3SGUA 1KBBA 3N13A 3QTPA 3LK6A 4C6BA 3CAWA 1J9YA 4FLSA 3LCIA 3SCOA 4CU6A 3GH4A 3QZ6A 5BXTA 3QZAA 3DUGA 3IAQA 3H4WA 4UTLA 4C1KA 1F4AA 4O0ZA 4BA0A 1D2KA 4GYFA 4XG1A 3ANYA 3T78A 6ALDA 2D3NA 4LEQA 1TV4A 3AZSA 3WDJA 3HGOA 2IKHA 1E4NA 2RJHA 2B7OA 1TKKA 3RDKA 5C55A 1JIBA 4JYDA 4ACZA 3O7UA 5BRBA 3PVFA 2EPLX 2PURA 3SM0A 5GQBA 1W3HA 3MSGA 5LA1A 4GVFA 3CAKA 1R8LA 1F8MA 3PG9A 2AGTA 4DUOA 4Z1BA 3JVAA 4FMVA 1K1DA 4IP4A 1GVIA 4M0XA 3V7PA 3U7VA 4RLIA 3TLLA 1H5YA 3GTHA 1TWDA 5HNRA 1CXFA 4LUTB 1GOIA 5HBFA 4FXRA 3BZGA 4NVTA 4JQ3A 2PWHA 3S5SA 2HS8A 4L6OA 1Q7MA 2DUZA 3SZ8A 3ZVHA 1XLBA 1I4NA 2J7DA 2IPJA 2NVCA 3MWCA 4MLRA 1XCWA 5CZTA 3EBVA 3CQHA 3O63A 4LSBA 1KCLA 3PUOA 4X2RA 3L4TA 3UG8A 7TIMA 3CASA 4MADA 2CU0A 3GNRA 3FGCB 1D3GA 1EXBA 2ZA2A 1LUCB 2PP1A 5D9PA 1WV2A 3V18A 5FF7A 3B4YA 1W3LA 3W7MA 4CQAA 1RJRA 3AMDA 3ITYA 1JCNA 2DT2A 2VX6A 4DELA 3TXZA 2BOEX 3CQJA 4JCLA 3UXDA 2OT0A 3GR8A 5BOFA 2EG7A 2WANA 3PTQA 3WBXA 4H8UA 5I3IA 4UFHA 3STCA 1AQMA 5B7YA 4H83A 3AU2A 4NJJA 1DJGA 4FOUA 4YYFA 3OOQA 4OOUA 1ODZA 4MKNA 3DG7A 1JVNA 1Z3NA 3WUFA 4KW2A 1WAUA 1YADA 1TE1A 1UQZA 1DOSA 2WPBA 2E9LA 1LQAA 3THUA 3O0KA 1W3JA 4IICA 3WLQA 5CZJA 2YL5A 3BMVA 4HA4A 1R3TA 1WBJA 4L64A 5HANA 2V69A 1XDJA 4MWAB 3W87A 1EH9A 1W9DM 3UG3A 3LERA 3OP2A 2DV0A 4GABA 5G4WA 2ZQ0A 2H9AB 3P82A 2ZUNA 1A49A 3VU2A 1UWSA 4MB1A 4Q4SA 1BYDA 4J2PA 4HVXA 5KZEA 3Q37A 2HZGA 2J6XA 4MMWA 2MUCA 1S3HA 3ZMRA 2FGZA 3BG9A 4E4PA 1FWNA 3MZNA 4NL1A 2ISWA 4XVDA 2ZX5A 1DWAM 3AYVA 1U1HA 2QAFA 4IIHA 3EXTA 4JL1A 1ISVA 2CBJA 4QAIA 1FWRA 4K36A 2Z6IA 3PBVA 2BS9A 1YLVA 4H6RA 3TJLA 3ERPA 5I03A 2ZBTA 4N9DA 4CU8A 1V7YA 2XU2A 1OT1A 3UVIA 4BI6A 4C1NA 2E9BA 3S1GA 4DPPA 3QPEA 1LLZA 4S39A 2POZA 2QJMA 1R9XA 2PBOA 1IEQA 2J88A 3LBMA 1OCNA 3NR0A 3TZNA 1POKA 3MV11 4N42A 4DI9A 4UQ9A 1H3GA 1S2CA 1F7BA 4EAMA 1KBKA 1S5MA 1YHTA 1L6YA 2OOFA 3G22A 1Z8AA 1I2RA 1WDPA 3FJ4A 4DPQA 1XCXA 2AQWA 3AIBA 4E6MA 4JIEA 3KWXA 1KA9F 1ECQA 2FHBA 4DZHA 3W70A 2WPGA 2OEJA 4V1XA 4NASA 4PBEA 1DIDA 2NWSA 2V2CA 2VDGA 4IUOA 5FIPA 4IG2B 2Z1WA 3DFOA 1FCVA 3W25A 4YVPA 4F9DA 4TX9A 3BPWA 1BSIA 3ZSTA 6CGTA 3FKKA 3TLQA 3BW3A 3QV9A 4UUIA 4JCMA 3WD0A 1TVNA 1SM9A 2VGGA 4JN8A 5DMMA 2RGLA 4GIYA 1RCQA 4IGSA 3O3RA 2RDWA 1P6CA 4WJXA 3KLLA 5M2FX 1HG3A 3OIHA 3C8FA 5FSDC 4EX4A 4MWAA 3QFEA 2ACUA 3A3WA 4C5YA 3VUSA 2RUSA 1XIEA 4TMCA 1E6ZA 4Y9AA 2J79A 3T07A 3K13A 3M0KA 4I5UA 4IIGA 5BXPA 1P5BA 2PF8A 4A8IA 3CL6A 5HR6A 4H9YA 1OFPA 2E40A 1UZ4A 3EA2A 1HF6A 3TFXA 2YLLA 1RUSA 3G1HA 4TTGA 4XWUA 3W53A 1ZL1A 3CMFA 2D73A 2MNRA 1H7NA 2D69A 4UFJA 3KBVA 3W3OA 2TPSA 3HM7A 2BDQA 4PB5A 4FF7A 3MTWA 2DZBA 3ZXWA 3IARA 1TV8A 2CITA 2QGYA 1C8XA 4LYQA 4XD3A 3GO2A 1VFFA 3KFTA 1ZNNA 4TVUA 5LYRA 3LRLA 3GDKA 2GDVA 4NZFA 3E2SA 2I9UA 3TMLA 2NT1A 4NAEB 4NP7A 3WJZA 4UTHA 1DL3A 1VENA 5FESA 3QKEA 3TK7A 3UZXA 4UQEA 3ATZA 4P7RA 5I3DA 2PFHA 3GRIA 2Q02A 4Z2KA 4C65A 4DYEA 3H2AA 4CUCA 4FA3A 5D4YA 2F9RA 4UBPC 4JS3A 1AQHA 4HQVA 7REQB 1QR7A 2F61A 4GX8A 3N19B 4H4IA 1UD8A 1TZ9A 2YA1A 4IMFA 1G1YA 1A5MC 1XQLA 5LXXA 4HZ6A 3RO8A 4YNGA 3T08A 1GKRA 4LVGA 3G1DA 4Z1AA 1MEIA 5AHMA 4C5ZA 3SRDA 3NQBA 3K8LA 2PWVA 1NF0A 3C8NA 1OYBA 1A5SA 3DKJA 1J10A 4S3CA 5C5YA 3B0PA 1EO7A 2FMOA 1EXPA 1UD5A 2J7HA 5DQPA 4MB4A 3TX9A 4GACA 3U4FA 4I7WA 3WQ5A 1MW2A 2ZZ2A 4UQBA 2X1TA 4ACZB 4WGHA 3C2RA 1B30A 1SFLA 3EPMA 3CZ8A 2DY3A 4P5UA 1HGWA 4GY1A 1WDQA 1SW7A 3MKVA 1QBAA 5C70A 3IJ6A 1OHLA 5HWNA 3EX2A 3SUWA 2VURA 4LT9A 4IFRA 4QFUA 1W9PA 2BY3A 3QGVA 4DJDC 5CPOA 4ZFMA 8A3HA 3WH8A 4AZCA 2CHRA 3E2QA 2QW5A 2OO0A 2XSBA 2NQLA 3NXFA 2O4MA 3EKLA 3F2CA 4AHOA 3KRBA 4G7FA 2BOFX 3RHGA 3LPGA 3EX3A 3FXYA 2QPUA 4ZQCA 1ONEA 3S1WA 3UY8A 1GJUA 1JEZA 4MPKA 2VO5A 4FPSA 4FOJA 1OG6A 5EBUA 1UP2A 2QCCA 3JRKA 1UOKA 1FH9A 4JNMA 4DIAA 3DZ1A 5A8PA 3D47A 1X7IA 3AUJA 3OODA 3LOTA 2D24A 5E5CA 3LZ5A 5AYBA 1W8GA 3SCVA 4GCXA 3M47A 1JR1A 3HBLA 4OECA 2VZOA 3CEUA 3F4WA 3FHAA 2XH4A 1UZHA 5FF4A 2YA2A 1GTEA 3BANA 3HU7A 3QXBA 1VJIA 3KL0A 3VIJA 1BQCA 4CNOA 1I0BA 4JTEA 4JTGA 4UMAA 1DQWA 5E9XA 1A5OC 4GIAA 2CBIA 3QHMA 1P7TA 1RY8A 4AW7A 3WK3A 1QFEA 1A47A 3A13A 1MFUA 1NSJA 5CXPA 1RR2A 3M0HA 4LW7A 3QHOA 3ZLFA 2VD8A 4U31A 1UIPA 4F3HA 2VKZG 1ITQA 1P1XA 2PLKA 2PWGA 4PMDA 2PDLA 1B9BA 1KCKA 4B5VA 4Q8PA 1RQEA 2Z7GA 4URIA 3PNZA 4QS5A 3WDPP 5HJYA 3CO8A 3AHTA 3KTCA 2PDCA 1NOUA 3IANA 4AEEA 3SUTA 4AZGA 5IM51 1IWBA 3ABOA 3H53A 2EPHA 2DPEA 2WNNA 1ZU8A 1Q8JA 4JAWA 4YJ5A 1ADSA 3QV6A 3GNNA 1I2PA 4IMGA 3RPTA 3HPXA 3CWHA 2C19A 4Y96A 1W5MA 1Q85A 1OABA 3N15A 1DWHM 2ABBA 2WWCA 1SJCA 5AOUA 3VM7A 4EVZA 4J7RA 5GJNA 1DWFM 2DZVA 2OPJA 2J9XA 1XLGA 1VS1A 1QI4A 4K68A 2X2YA 2HVMA 1X6NA 4GQQA 4Q7NA 4RDYA 2BHYA 3VX0A 4MNLA 1CGUA 1FHVA 4ZB5A 4GUGA 4BF7A 4V2XA 5GPRA 3NSNA 2FPVA 2NX9A 4O1FA 1NFGA 3QY8A 4HZ8A 3T55A 4GXPA 3MDWA 3EDFA 2CLLA 2TMDA 3O2LA 4JDBA 2GUUA 3QTGA 1VBUA 3W7HA 3ABRA 2DDXA 3W1PA 4O0QA 1MUCA 1J0KA 1KWGA 5K3VA 4BF5A 3L0KA 1AMYA 3K2GA 1RK5A 3W2JA 2QPSA 4PL1A 2YZ5A 3Q4DA 2YPIA 1TPH1 3MI2A 4HNCA 4ZGYA 1HN1A 1XKJA 2DORA 1PCWA 3LRKA 4RNFA 3IJIA 3STEA 2E5DA 3DAQA 1JYNA 4B90A 1Q4NX 7CGTA 3SCQA 3R2GA 1JAEA 3GS6A 2O92A 1KO0A 1WOBA 3RIKA 4JGDA 1VAHA 1DE5A 5FA5A 3UXKA 4HCDA 4AHQA 2XFRA 4JQ1A 4S3JA 3L2LA 3ZT6A 4QBXA 1EF2A 1QHOA 2PDIA 1JF5A 2F2HA 2FDMA 3W75A 5AN7A 3W24A 4LAZA 5K4XA 4WF7A 3VVGA 4W8BA 1S1RA 4L4PA 2BB0A 3W4RA 3QR0A 1WDWA 2OR2A 2NUXA 1UP0A 4E4FA 3S1XA 3CUJA 3KHDA 2CLMA 5IOBA 5DXYA 5IHSA 4GVGA 1GCYA 2QIWA 3VOJA 3MYPA 1TA3A 4KRTA 3SR7A 4I8YA 4YMZA 2XUCA 4GIEA 4DJEA 4FLRA 5MHBA 4LS1A 1PCKA 3TOYA 1L6FA 3TW7A 3TWAA 4EF9A 3V3WA 1V02A 2J8GA 3UCDA 3TYZA 3KOWA 3EZ4A 4JICA 4TUFA 4V1YA 2EPNA 5D04C 3VX1A 4XO7A 2I5QA 1TQJA 5HAOA 3REQA 3H26A 3NG3A 5HJLA 1YDYA 4KCUA 4P7NA 3WNKA 4GYPA 4TV5A 1E3ZA 3LEPA 3IS4A 4S3DA 3ABSA 1I60A 5C9WA 3LHVA 9CGTA 4NJIA 1F3XA 3IV8A 3VK5A 5JIPA 1U5HA 3GNPA 1EJXC 2B31A 2BWGA 4S3EA 3LN3A 1JAKA 1C8QA 5B7ZA 1PX4A 1XSJA 3T0BA 4GUHA 2JIWA 3G2GA 3GR4A 4UR8A 1SU5A 2V2HA 3I4KA 5CPNA 3VDCA 2OZ3A 4AIEA 4GBDA 3B8IA 4EIVA 1LLWA 1M7XA 3FYPA 2ADAA 3I7QA 1HJWA 4ML9A 1FHLA 1WPCA 1F74A 1GZJA 4R7JA 2FH6A 3GNXA 4FSAA 2XN1A 1Z7AA 2FB2A 4AHPA 1A5KC 2CLOA 3R58A 3A3HA 1E6PA 4CVWA 2Y85A 1FWTA 2GSJA 1KBLA 3OLGA 4QEEA 3PSVA 2YX0A 1KM2A 3IIPA 1W54A 3UR8A 1F6YA 3N2MA 4PBFA 1BYAA 2ZRUA 2WKGA 1YXDA 3CPRA 4HMNA 4MFDA 4DUXA 2ZRXA 2C18A 1GJPA 1VEPA 3FXGA 1E9YB 5BNKA 1O60A 4QLJA 2IQ0A 3CHCA 1XPYA 1YIXA 5JUVA 3R25A 4XBJA 1XYBA 4DJEC 2Y70A 1V93A 3PWGA 2W91A 4S38A 3RR4A 3W1UA 4HA1A 1P0BA 3RLUA 2D3LA 2Y5JA 1SZNA 4X22A 4JTRA 1I6NA 2VEIA 1JZ7A 1R7OA 4GUFA 1A53A 1FH8A 1VD6A 2OO6A 2W66A 1KFKA 1OCQA 1XI3A 1GKPA 1ADOA 1GHRA 5HINA 2D2OA 4OKDA 1KV8A 4QITA 4K39A 5D9NA 3T9PA 1O1ZA 4RZ5A 3WJYA 1QTWA 4X60A 4LYPA 1XC6A 5I6SA 1PYMA 1PXGA 3AJXA 1DIEA 4M6PA 4AVNA 3BL3A 2CNCA 4CN1A 1AJ2A 4HP5A 1R9YA 2W92A 1KKRA 3PAOA 4HZ7A 2PCEA 4AIUA 1GPWA 4JFVA 2OYKA 5M03A 4MZYA 4X9SA 1SQ7A 1MXSA 4XUGA 2WMKA 3ORWA 1PHWA 3M44A 3VTRA 2I14A 4CQBA 4E8GA 3LLXA 4GKLA 4IGNA 4YWIA 2WZTA 4Q4MA 4DX3A 2XISA 1ZJHA 3W76A 4IPJA 2J6VA 5CJ5A 4FIRA 4OWGA 5C8BB 1UPPA 4GY0A 5LA2A 2QCFA 3UZWA 3G18A 1EJTC 4D9PA 4L56A 5C6MA 1TX0A 3U2OA 3SUVA 2B7PA 3UWVA 4DXVA 3PBWA 2FZDA 5IRPA 1HL8A 1XLJA 3CTLA 4GNKB 1EQCA 1NFPA 3JZEA 4JD4A 3G8EA 1MRAA 3K30A 3BURA 3R5EA 1CDGA 3UA4A 1R2RA 1TWZA 2PU1A 1MNSA 4AIBA 3M6DA 4JFTA 2QJHA 4YYCA 4ES4A 2NV9A 3NZQA 4I3GA 2WKJA 4NRRA 1TIWA 1UR0A 3K46A 4GISA 4IT1A 3OVPA 2OX4A 4HYVA 1EP1A 5KTLA 1V08A 1YNYA 1AH0A 1X6LA 2I5IA 3CC1A 3UETA 2AL1A 2C91A 4HBKA 5DCDA 4W86A 1NY1A 2VZVA 4WY0F 4P7LA 2VX7A 3AXIA 1I1XA 1KFLA 1JULA 3KOYA 1RLCL 5H91A 5CG0A 1WUFA 3V36A 4H7CA 3W81A 4NX5A 5JH1A 2ZOXA 1E6NA 2JALA 7XIMA 1DHKA 3W2LA 1YPIA 1A5UA 4BEQA 3WMCA 1XBXA 4B3KA 4OV4A 1HIZA 3EXRA 3AROA 1V6XA 3KBJA 4DO7A 1W1A1 1F05A 1OQFA 2OGJA 1PYFA 1H2JA 1KC7A 3VIKA 2FVKA 3O6YX 4XD5A 3THDA 4QXIA 4H04A 2ZA3A 3WJXA 1DQUA 3DHPA 4J27A 4OQVA 3NM3A 1C29A 3JZUA 9RUBA 2E09A 3T05A 5FEWA 1CTNA 2PBGA 4AB4A 4HPJA 4AY1A 5DMYA 2B81A 4K7YA 3PPHA 1QNQA 3CWOX 2NT0A 2JK2A 1V6WA 4W88A 4C7FA 1GJWA 3WL0A 4FNPA 2E7FA 1TVPA 5EY5A 7PTDA 3WMSA 1AMKA 1C9DA 1CXHA 4ROQA 4LAOA 2GVYA 3KHJA 2VELA 1PSCA 3IGSA 3TWBA 1GQJA 3N18A 2XPKA 4AD3A 2ONEA 2ISFA 3AHVA 5F2IA 2IKIA 4ALDA 1T6MA 5BROA 4ZE4A 2O4QA 3WBWA 3UZZA 5C71A 1SVDA 3LA4A 3VGGA 1ZJBA 2GVJA 4IF2A 3BJTA 1PZ1A 3KUMA 3WLKX 3TTQA 3BQ6A 1ICQA 5DFAA 2ISSA 2W62A 4EXQA 1V6YA 4GCAA 2WK2A 1DJHA 5HPCA 4ICNA 3RX3A 4PL2A 3VC6A 2J74A 2VZUA 5T91A 2ZZ6A 1WKFA 1C7TA 1ZBCA 4JNZA 4Q8MA 1XUUA 1TB3A 2W63A 2OWWA 2CW6A 4OVXA 1R3YA 2G3JA 1XBYA 1GW9A 3TZFA 2CHNA 1AJ0A 1SGJA 3NAVA 3ZVIA 3HQ1A 2E8YA 2ZXDA 2X09A 1MXGA 4ZCWA 4FR1A 1WAWA 4DBDA 2IPFA 3F4CA 3L4UA 2JBMA 2GJNA 1Y5WA 4KIEA 1TJ2A 3DXIA 5EGRA 2WO5A 1US0A 1J6OA 2GSEA 3N2TA 4GHRA 1UYQA 1M41A 2CEQA 4AQLA 1NQ6A 4ROPA 2QZRA 4K37A 4EXAA 4YS1A 4ZE5A 3VGDA 1O12A 1GVOA 1R7AA 4GYPC 1S2VA 1B9ZA 2V8ZA 1D8CA 4M80A 1FKWA 2R94A 2RJGA 1RVGA 1JZ5A 3MCMA 3LI0A 1EBHA 1QWGA 4K1WA 3HGRA 3OPSA 4ZTXA 2FQIA 3FW6A 3SW6A 3LXBA 2J7CA 1TE6A 3EX4A 4JN7A 1RBOB 4IMAA 1E40A 5HOSA 4JTKA 4JIQA 4AC1X 1HVXA 3U8GA 4TVDA 1XIFA 4NNAA 5CZKA 4AH7A 2QPXA 1UWTA 3DYPA 1J4EA 3BLLA 2G41A 1LDCA 3LCFA 3QRHA 1V5XA 3STPA 3W85A 4NSBA 4J3UA 4OE7A 5DEZA 1OT2A 4MSSA 1OINA 2P3ZA 4O19A 1K8CA 1NVMA 3DX5A 3DHDA 3AXHA 3RO6A 5CBIA 3BSHA 3GXTA 1BG4A 2H8XA 3PWAA 1KTBA 2E6AA 4HHLA 3PP7A 1QW9A 3G1SA 1W5QA 4FNUA 3WLLA 3WD2A 4LYRA 4AISA 1L9WA 1BWLA 3A24A 1QNOA 3FN9A 4X63A 5E6ZA 2EKCA 3A9IA 3MBFA 3UR2A 3CAQA 2PMQA 2REQA 3Q58A 4E8CA 4LY4A 4IFKB 1UASA 2QDGA 3O05A 2PDXA 1JDCA 1P6WA 4FX6M 1FWSA 1ISWA 2IPGA 3N25A 1DJQA 3AXMA 4DM1A 2WM0A 1LG1A 3GXDA 4AYGA 4QLKA 2P8BA 4GNVA 3DBPA 3PN8A 4ZQRA 2WJEA 2YGYA 1PIGA 2VENA 4M1BA 3UU0A 1OG0A 3W00A 2OYMA 2GDUA 4LQ1A 2VVSA 2A3EA 3GE7A 2G8ZA 1EO5A 3IK4A 2FB3A 5D02A 1W8SA 2F38A 3EEGA 4JX5A 1GUVA 1VBRA 1B54A 2ACSA 5IXEA 1R5YA 4RPPA 2OEKA 1C91A 3SCPA 1QO2A 1ITCA 2F84A 2ZUMA 3W29A 2OYLA 3BSMA 3E2RA 3W82A 3ITXA 3T0DA 4A6GA 3W1NA 2Z7KA 3KCLA 3VNIA 3HGSA 3ARZA 4IM4A 2VYOA 4LNYA 4DO6A 3OLDA 1AW2A 2Z26A 2HPIA 1C9WA 3F2BA 3VOCA 2A3HA 5GJPA 4HNOA 4AZCB 3IJDA 2X1UA 1Q65A 3SCSA 4G7EA 2PC4A 4AAJA 3R13A 2XHYA 5G1TA 1X7FA 2EPMX 3UGRA 1GOQA 1LT8A 4P8XA 1XRSA 1XYAA 4KEMA 4XZWA 1TO3A 1HP5A 2ZUVA 1PE1A 2VGBA 4S3FA 3H24A 4ZOEA 4ZOCA 3ZLGA 1EJ7L 5I3KA 3AYSA 3SRFA 1M3UA 1NP2A 1XLKA 2RDUA 2G97A 2YBVA 3APTA 4M19A 3K4AA 1QK2A 3BQ5A 3TMQA 6PTDA 4YVVA 5IBXC 1CLVA 1XH0A 4PULA 1TTJA 1XDMA 3NJ3A 4F48A 1DKWA 1E6RA 1IZCA 2VCCA 1VPXA 1H49A 2OZTA 2I9EA 4AUBA 1RPKA 4JTTA 4ZSTA 1EWDA 5XIMA 2XINA 5HQLA 4HN4A 1OBAA 1SSDA 2JQXA 2QXWA 1MO0A 3VFCA 1K7FA 2X41A 4DYJA 1CGXA 2BFGA 3WF1A 3B9NA 3UJ2A 3USZA 1VZWA 3NWRA 3LTYA 4NX0A 5C9ZA 4V27A 1BXCA 1GOOA 2J7GA 3WH5A 3OG2A 4JTIA 4Z1YA 3RJXA 2D23A 2HXTA 3MP3A 3VDGA 3C0QA 3FS2A 1KRCC 1A0DA 1S3TC 1JI2A 3QH2A 3UPBA 1SZEA 3WQOA 5AHFA 1E9LA 5DT7A 1IZJA 2CLEA 2YCLA 4WD0A 4JTJA 3GHUA 1QHPA 3WF2A 3GIQA 3KOXA 1KKOA 4DLFA 2Z2BA 3B3DA 1BTCA 3A5FA 3IRSA 3GM8A 1LQ2A 4C1LA 2ACQA 4CLMA 3AXKA 2QDEA 4U33A 3MYOA 2GJRA 3NA8A 2WSQA 1J0JA 4GZJA 3G77A 3KL3A 2GYIA 1YNPA 1G01A 3CZLA 4OTKA 4EE9A 5DT5A 3PZUA 4F79A 3OEXA 1V7AA 2Z00A 3GHRA 4J5NA 3KRZA 1GTHA 3V0UA 3H2OA 3QZEA 3KCOA 3TNOA 1PIIA 3URAA 1EC9A 4YCOA 3K1GA 1AL7A 1XCFA 5DBTA 4JX6A 3H23A 2A21A 3IUHA 4XZ9A 2P88A 3F5JA 3GX9A 2AL2A 4B16A 1B0IA 3KRSA 1XISA 2YL6A 5A8OA 3CMJA 1X1OA 1Z44A 4X2PA 3LCGA 1EF3A 4A21A 1MW0A 1KQYA 4M7TA 2CWNA 1E70M 2E77A 5I06A 5A69A 2QMJA 3VE7A 1TPVA 3TC3A 5HWJA 2QQ6A 1J0IA 3NVDA 2Y1HA 3VCRA 3DBNA 4IQDA 2VEMA 2OODA 3I4EA 2BNJA 1ZHAA 2O56A 3GZ3A 3SGGA 3COTA 4KEUA 3FAWA 3BLDA 1EX1A 2AQOA 3GDTA 5DN1A 4Z2HA 3PR2A 4A3HA 3KTSA 1NM9A 1H1NA 1BAGA 1EJSC 1H50A 4DF1A 3U6WA 1XYFA 3IIOA 4XKMA 3SY1A 1HQTA 5C9UA 2DZXA 3BICA 3RUBL 5LXEA 4CQ9A 4F8XA 1XH1A 2V6AA 1O5QA 1XM3A 1O4UA 4UQAA 3CBWA 1LJYA 1XGDA 3SRHA 3FJ6A 5FJTA 3DG6A 2FVMA 3L4ZA 2GUYA 1UWQA 4AMCA 3NYZA 4LGXA 5M17A 3GKFA 4Y9PA 3ARTA 1TZ7A 2VOMA 4WKHA 3SSZA 3GYCA 3WJWA 4LU0A 3WLTA 1EIBA 4C1NB 1L8NA 2E6DA 1MZRA 2OZ0A 1OCBA 1XP3A 4CN6A 1AZ1A 2R1MA 3DFHA 4JZ5A 2OVLA 4MTVA 4KF1A 2ZXQA 3AO0A 5H6HA 4F9JA 4GZEA 2E6FA 2Y7FA 4LB3A 2PP3A 1QNVA 4GVIA 2XJ7A 1ML1A 5I3HA 3GXNA 1RJQA 4AWSA 5HDRA 2WLZA 1R30A 3GG0A 3NQFA 1CLXA 1A5AA 1VEOA 4GINA 3UG4A 3BLOA 1EWEA 4DNMA 5DCEA 3HB9A 3BH4A 2VC6A 1U30A 3GC4A 3MSDA 1B3OA 2WJDA 3CLWA 2J4GA 3KOZA 5H1WA 4UTFA 5FJUA 4NJHA 3RMJA 2REQB 3ECQA 4L7ZA 3LENA 1LBLA 6REQB 5CAKA 4AEFA 1OK4A 4K7VA 4A8NA 4JKKA 1NOFA 5MF5A 3UP8A 3QMSA 2POTA 3MHGA 2PF0A 1O5RA 1WDRA 1PTDA 3IUDA 2WMGA 3LHZA 1XLHA 2QNEA 2X1SA 2NV2A 1E4LA 3FX4A 1OFQA 3NURA 3DI0A 1K9DA 5FJPA 4JYFA 3HMCA 5DANA 4U10A 1CLKA 2JEPA 5D30A 2GZXA 3LHTA 1SPQA 1CBGA 3LZ3A 2OXNA 3L68A 3BV4A 2ZKMX 3WLNA 3GZAA 3QR3A 1ONWA 4PUWA 4XZHA 4H1ZA 4JNYA 1XV8A 4Y9OA 3GAYA 3L2IA 1GZ1A 3FGCA 3UY7A 2GFTA 2BBFA 1QASA 4J3SA 7REQA 3CUZA 3HG2A 4YIWA 5T26A 5A6TC 1C8YA 2VWSA 1THFD 1G69A 1LYXA 1XD1A 2OT1A 1RP9A 2P5NA 1DTNA 4X9YA 2ISVA 2PC8A 4JBRA 2HWGA 3OGVA 1NARA 3VD5A 1W9BM 3O1NA 4JTFA 3QHNA 3TJIA 5FEZA 1S39A 2R91A 5C0QA 5A6MA 1LRTA 1S5WA 4IMEA 2P76A 3NZRA 3R0UA 1EJRC 4HNLA 2WJZA 4DHGA 1WX0A 2CKRA 2WMIB 1UR2A 4IJRA 4EPKA 1OFBA 1Y5XA 1CXIA 1A0EA 3OZYA 1XUZA 3WQ4A 1KFWA 1RH9A 4H9TA 1NDVA 4ZBCA 2CC0A 3M1ZA 4Z08A 1C3FA 3W7KA 3UYCA 2HVOA 5CC3A 1TRIA 3F5LA 4UMBA 2FGBA 4UC5A 4IQLA 3MKKA 3VIIA 3VAVA 4QEHA 1JPHA 3E49A 1IT7A 1E0UA 5E0KA 4LTSA 4V33A 5BU6A 2RFGA 3GQYA 4PSPA 2YCEA 4AD1A 4XAGA 1YQ2A 4JR5A 3E02A 1WZLA 1I2NA 2Y63A 4GRSA 2FZBA 4YTUA 4I5XA 1HJUA 3W1QA 5K9CA 2EAWA 3RU6A 1QNRA 2QR6A 4HKPA 4BR1A 4Z2IA 3VGFA 1IIGA 4NYYA 1FFQA 4LRTA 1KXHA 3LPPA 5CPTA 4KWOA 5BOOA 4HNTA 1YW1A 4GZ7A 3VNKA 2QUTA 2OLAA 3GVWA 1OX4B 2V68A 1UZDA 4BF9A 1WB0A 3UCCA 3T1GA 5A6JA 4PCPA 4Q4KA 3WQGA 5F4SA 3TW9A 1EGMA 3D3FA 3P2VA 4WGXA 1XIBA 4FALA 4RUBA 2ZE0A 1TCMA 4MPQA 4K6AA 4QJ4B 1JCLA 3N12A 5G2HA 1H7RA 3VNDA 2YYUA 3ZT7A 4UTTC 2WMFA 2DSWA 1TPUA 4H7VA 1CXKA 1BFNA 2FHCA 3GH7A 3NL5A 1TV5A 2OFJA 1QAPA 3KVMA 1SR0A 2VD9A 3BG3A 3L66A 1ONRA 5GNYA 1CW2A 1K9TA 3ZR5A 3N6JA 4J3ZA 3AMCA 1HKVA 3NYDA 2HK1A 5I78A 4F2UA 3H2CA 2WMJA 3SIZA 1M6JA 3QGKC 2X0SA 1HFBA 1CGYA 1Q6FA 3UGVA 3U0HA 3QY6A 2X42A 3HJEA 1W17A 2CETA 5ENLA 4QCEA 3C56A 1IXOA 1RALA 4QHRA 4RK8A 4ZB0A 2G37A 2EQDA 2JGYA 1XG3A 1DJYA 3KL5A 5EMJA 4GJJA 3D3AA 5HMFA 3HPAA 3K4DA 5BXRA 2FLIA 4X3ZA 1OWQA 2XDFA 3MO7A 3CQIA 3RCMA 3W6YA 3PB0A 4Y6GA 4GQGA 4TX6A 1QK0A 2GJPA 4S3KA 3VXGA 1C93A 4IJBA 3L5AA 1SW3A 3DU0A 1A0CA 2PDYA 5GNXA 4B5UA 2YB4A 2NXGA 3MUCA 1EQPA 3A12A 1W5OA 1RZMA 3FYOA 1XDLA 2VR4A 5TF0A 4Y8FA 1E1CA 4AXNA 3R0DA 3SY5A 2ZUSA 4HA3A 3AHXA 5KZ6A 1GQNA 1KM1A 4AD4A 3TYCA 5G1MA 5A8QA 4QSHA 3W2UA 1X98A 4DNHA 3PZNA 4B9ZA 3IVSA 4DUWA 3TC6A 4DJDA 2HDJA 3E5BA 2A7NA 4C6IA 1D3HA 2CLIA 4LUJA 4AZ5A 4ZZ9A 1VBHA 4PMNA 2YB1A 4G9PA 4ZO6A 2HQAA 2XZ9A 2VGFA 2QCEA 4XISA 2BVWA 1KB3A 4WSKA 3IV3A 3GUGA 4RDZA 2F8QA 2FZNA 4G7EB 4DQWA 4JTUA 3PZTA 4XAYA 4MG4A 3W84A 1LORA 2HJPA 4O50A 2V5KA 2F6KA 5AECA 3ARVA 4Q7BA 4QDWA 3S83A 3CU2A 1LUCA 4YHEA 1DVJA 3HOJA 4QTGA 5AVHA 3KVKA 3UPMA 2PDJA 3NO1A 1B3XA 4M6QA 4F0RA 5CGTA 2GOUA 2I7GA 3S2LA 5C2XA 4A2RA 4ZTYA 4NQ1A 1IT0A 3DGRA 1LL4A 3TR9A 2ZXBA 4I9JA 4HA0A 2JEQA 2IS7A 4RXGA 3F4NA 4GYKA 3WBAA 2WSPA 4L1WA 3M46A 3L12A 1XINA 2PLJA 3HV9A 3R4IA 3C52A 1IWPA 3DKLA 2P8CA 3ZJKA 5ABFB 4RZ4A 1VKFA 1LZOA 3OYZA 4UMCA 1QNSA 4XKYB 4RE3A 3PUEA 2Z29A 1J0YA 4WR3A 5BWFA 4HMDA 3W1TA 4OT7A 1J5SA 4NHVA 5CAHA 4FF5A 1UJPA 3QKZA 1JF6A 3EGJA 4NILA 2EO7A 2H6RA 3LD5A 2EGZA 1X39A 3U5YA 3VKBA 2C1HA 3EOUA 5C2GA 5CH9A 3II1A 3LXCA 3UXLA 5F7UA 2XGIA 1EPXA 4PN2A 3W1AA 2PWFA 3KZPA 3ITTA 3UERA 3DECA 2X2GA 4C7GA 3QY7A 4ENLA 1W3TA 4C6LA 4DZIA 3CH9A 4JTHA 4TO8A 3W7JA 2BOGX 2V3FA 5A8GA 1KGXA 1UUOA 2A3LA 5DCBA 3WLOA 3LV5A 2YDRA 4P7OA 2IW0A 2D22A 1EZWA 4AWEA 3TV8A 2VP8A 3GC5A 1H7OA 2Y88A 3U4AA 3S8HA 4PRTA 4IIBA 1DQXA 4G1NA 1TPFA 4WCJA 3V1HA 1HO4A 3FAXA 2PDWA 2YDAA 3H7RA 3ABZA 3WUEA 3T7VA 3GIPA 2BTMA 4R7OA 3SN4A 4WJEA 1QOPA 2WHKA 3OZMA 2CLFA 3VOGA 3NGFA 2DJXA 1VF8A 1BSLA 5HA7A 1BRLA 1HGYA 3QM3A 4BEUA 1Y5VA 3TDFA 5I77A 1FQ0A 4ZO7A 3RILA 3G24A 2R6OA 3W7QA 2BMBA 4IGHA 2NSOA 1XD0A 1SFJA 1ESWA 4YL2A 3B4UA 5G4EA 4IIEA 1AK5A 4IHCA 1I9CB 3TSDA 2HTMA 3TYBA 3NCOA 2P0OA 1S46A 5HJXA 4F0KA 3W1XA 1V6TA 1CPUA 3ITOA 4MNMA 3B40A 4UTTA 4DWSB 4LBUA 1Y0EA 4GC4A 2QCGA 3H2NA 3MC5A 5REQA 3UZJA 1QI2A 3RRAA 3AMGA 4D6IA 3R8GA 3OZOA 4NAEA 1ZBVA 3HG5A 1PJ9A 3W73A 4JTCA 3WYZA 5FJIA 3BXWA 2YCIX 4W84A 3SCTA 2D20A 4H9VA 1JFHA 4JN6A 1KXTA 3WF4A 4RL3A 4DJFD 1QNPA 1NIUA 4A3QA 1YTEA 4LF2A 3H12A 4NJKA 3NSXA 1T5AA 4I7UA 2V30A 4HNNA 2QF7A 1JYVA 2PTDA 5T8GA 3G1VA 3EYPA 3TTEA 3BMWA 3T09A 2NQ9A 1MVYA 2X1RA 1JZ6A 2DZAA 2HSAA 4NXSA 4N9BA 2OEMA 3LNPA 4I9AA 5LIXX 3LLDA 3W27A 5EMUA 4Z0JA 3PZIA 2ASHA 3W02A 3E6EA 3AJ7A 5DRIA 8XIMA 4J2MA 4DZ5A 3UJSA 1NFBA 3W7OA 1FX6A 4CQCA 5BMXA 3AS2A 3W7CA 3FA4A 4XKYA 4FOKA 4IGMA 1JNDA 2G4JA 4DXKA 4DF0A 3VKJA 3C86A 3O16A 2XVLA 1JCMP 3FNDA 1AJZA 4XB3A 1NU5A 5JBDA 1KFCA 2Y5SA 4FX7A 4IMDA 2DUXA 5HUOA 2WSKA 4G56A 3ANVA 1EEXA 2Z1VA 3WLRA 1OD0A 4E3VA 4NT0A 1E0WA 4MKVA 4XZNX 3ZQ9A 1IZKA 1RQHA 3NPXA 2NV1A 1LG2A 2G3NA 3ABXA 3CZEA 4YVXA 3S47A 6A3HA 1ZP4A 2ZYFA 1K9FA 4UNLA 1MSSA 5KMYA 2VR2A 5CCZA 1KM4A 1UJQA 2DZWA 4FK9A 4HK5A 1RVKA 5HWMA 3WQVA 2A0NA 2IXVA 1OYCA 1WQ5A 2DQWA 3A9BA 1RV8A 2ZDSA 1UHVA 4WZHA 2X7WA 5H2ZA 3WUGA 2QYGA 3IIVA 1QI0A 1W1B1 3WLPA 2DZPA 3M64A 2VC5A 3WD4A 4Y9NA 3L5MA 4IUGA 2C14A 3F7JA 1W9VA 3I65A 3QYQA 3VD9A 3HG3A 1EGZA 3NZ1A 2WWDA 4PRRA 2UBPC 3W01A 4X0VA 3W1RA 1QU4A 1OF8A 2WSYA 1SO6A 1DJZA 2VWTA 3CB8A 3GG7A 1OYAA 4XAFA 4B3ZA 3NOEA 5I7GA 1E6SM 1FXQA 4JFUA 3TXVA 2V38A 3POCA 2ISDA 1DJWA 3PB2A 3SQMA 1X8CA 5EA9A 2PI6A 4IQEA 2G5WA 3BG5A 2WCGA 1XIMA 4TQTA 2NLIA 1EYWA 2X16A 3MQTA 4A29A 3VFLA 1E5JA 2EJAA 3NL6A 1FP8A 2ZXAA 3LTPA 1FDYA 1ZAHA 3M7SA 3CLMA 3N1AA 1UPMB 3DIPA 3DI1A 2XG9A 4PMOA 1T7LA 3RX4A 4CNNA 1PTGA 1TPB1 3DENA 4N9EA 4QNEA 3S2NA 3C61A 2DW6A 6TIMA 1X1ZA 1Q6LA 4QJ1A 4MJZA 2VUNA 4PZVA 4HTBA 3QGAC 4O11A 4R27A 3LHUA 3QFWA 1Q6RA 2JGQA 2X05A 4Q8OA 6ENLA 4MJ4A 3CB3A 4ZENA 4M24A 3HPZA 4LV4A 5EU9A 3VDBA 2L5HA 3O6DA 3QW4B 4BFAA 1XIDA 4UCFA 2J7FA 3Q2DA 3SFWA 4JEQA 4GBUA 3WH9A 4IPLA 4U4MA 1J8VA 3EDEA 2WOQA 1YEYA 1JDEA 3N73A 2XFYA 1VJZA 4IQJA 5TBOA 2NVDA 3KDNA 5LNSA 3K4WA 1HKWA 1SJDA 1P0KA 4N0RA 1V4YA 4BQ4A 5E09A 3V0SA 3R79A 4XZBA 3RGTA 3G3DA 4UOJA 5KZMA 1FCUA 3VA8A 5E9AA 1DBTA 3CH0A 1KRMA 1R47A 4GJ1A 3SB0A 2XGBA 1OC5A 1TX2A 1VIZA 4O0KA 3EWBX 2O55A 1RJPA 3MANA 3QBUA 4GXWA 4CEUC 3TA9A 2A7PA 3WLMA 2GLKA 1ODUA 5D05A 3EDDA 3SDOA 3ITLA 1OX4A 1O1HA 2I56A 4MJMA 4L4OA 1V3HA 3WK1A 1PB0A 3G1XA 1B3ZA 4G1KA 2PSNA 1X1NA 4XK2A 3P60A 1AW1A 2XM1A 1AL8A 3GY1A 3O07A 3KBNA 4CD5A 3SN0A 2DEPA 4XAPA 4H6EA 1PWMA 1BG9A 4UOQA 1Y8BA 1HJSA 1K70A 3K5XA 3IPWA 1I2QA 3HTWA 3BAWA 4ZL1A 2Y7EA 3A22A 3EMQA 1KBJA 3OQ8A 4HK7A 1TPDA 2ZRVA 2HRWA 3IJ9A 2FZMA 5AC8A 4D6HA 1J01A 5EMLA 5D09A 1R3WA 3MA8A 1XC4A 4LS0A 4PUMA 2ON3A 2BLEA 1LL7A 4GFIA 4GWEA 2R24A 1PTAA 1AVAA 1SFTA 2X0HA 3BZJA 4DUVA 2OQHA 1F3EA 3WLIA 1IEXA 4LS2A 4YCPA 1EHNA 3W2NA 3RN6A 1AFSA 4AZBA 4PTWA 2BP1A 4HHMA 2WMIA 4ZQMA 5B80A 1OFEA 2R14A 3PUGA 4H2CA 5AZ1A 2EXOA 2A6NA 3UR5A 3PC0A 1A3WA 3C2OA 4OFCA 4WXZA 1GPFA 5AB3A 4JIPA 3THQA 4NAFA 1GQKA 1ZLPA 4LY8A 3AIRA 4RPQA 2Y7DA 2Y8VA 4WKAA 4AMAA 4K8GA 5F2GA 3CYJA 3E9AA 3TYDA 4JDYA 4E0CA 3PS7A 4E5TA 4IWWA 3KVLA 2BHUA 3P93A 4KT2A 1OB0A 4XTDA 3GXIA 1QATA 1C7SA 3UNDA 2PTWA 3MMWA 2EG6A 2I5GA 3GTNA 1TV7A 1S38A 1OIMA 1PKNA 3L0NA 1A4LA 1QW7A 3CZJA 3UYIA 1MNZA 2Z1SA 2BXZA 3BAYA 1S5VA 3EWUA 3H7UA 4LVDA 1WDDA 3MW7A 1VHNA 2VHLA 2Z0IA 3KTXA 2UY4A 1QVBA 1GVEA 4W89A 1ZB5A 3UPWA 4WLCA 1RK6A 3NQAA 3WG6A 3P74A 3W88A 4MKSA 3SUUA 1GYMA 4NRSA 1J12A 3AU6A 4GH3A 4KWSA 3GK0A 3NL2A 3M0YA 4Y9MA 2NX3A 5EB8A 4J3VA 2DUAA 3WDQA 3GUWA 1NWTA 2E4TA 7ODCA 4Q8WA 4RXFA 3OG3A 5BU9A 3MSRA 1H0IA 1OFRA 2J66A 3O9NA 3A4JA 5MKGA 2QS8A 3E1F1 2YJQA 2R1NA 3S6DA 3OGSA 4HYWA 5HR7A 1K8XA 5CZ0A 2DSKA 5FJOA 2QCNA 1GQLA 1UA7A 4HSOA 4BWLA 4JTQA 5D32A 3JU2A 3EMZA 4HYRA 3M43A 3PPCA 4H6QA 3SURA 3S1VA 1UCWA 1DYSA 1ISYA 1RA0A 3MY9A 4C6NA 3PHAA 4UTMA 4INFA 1UBSA 5ABFA 2RKXA 3P14A 3LB0A 3CUFA 2PD9A 1DWJM 9XIAA 1LBMA 1NWUA 5M3WA 1W32A 4IXXA 4DJED 3ES8A 2EEXA 3S2CA 2AMGA 4ML4A 3N6HA 3THAA 3T2PA 3R94A 4P61A 5L9FA 5HQEA 2B7QA 2Q3OA 2QF8A 4V28A 4WSHA 3EX1A 2PD5A 3SY8A 3PJUA 4E38A 3I7RA 4MM1A 1GVQA 3BMXA 4ZA0A 2PDFA 3B0YA 3HG4A 3ALGA 4HOWA 4F4RA 4JQ2A 3UW6A 4HU3A 3BLIA 4Q22A 4NY2A 3VC5A 2P53A 2QLYA 4AC7C 1XPGA 3RK8A 1XQKA 1EBGA 2Q3RA 1FWAC 2Y89A 5A6LA 3CWNA 5G5IA 4HJFA 2Q8LA 1V0LA 2ALRA 1N8IA 4KEVA 1J93A 1MWOA 4PC8A 3IVTA 4QDMA 3TAOA 3GNOA 3NDZA 4O14A 5A94A 2R1LA 4PGLA 1IT8A 3RU8X 3WH6A 3WFZA 3F03K 2VX4A 4XZLX 1YE6A 3MUIA 4MB3A 1OGBA 5JU6A 1E1CB 2E68A 2AOSA 2XIIA 7A3HA 1REQB 1QI5A 5LIYX 2HISA 3W7IA 3VNMA 1TFVA 3G0SA 2RH9A 5FKYA 4LCSA 5KSWA 1JDFA 3P5ZA 1D9EA 2G0WA 1W1IE 3VMNA 3E3HA 3NEHA 3WDRA 5AHIA 1G4PA 5TD4A 1PO9A 1BVNP 4JTSA 4LFYA 3MKCA 2PE4A 1AUSL 5T9BG 2DGAA 2DJLA 1YPFA 1JZ3A 3RG6A 1LT7A 3QV8A 4FX8A 3DEQA 2J78A 3S6OA 1KQZA 3MP5A 1O5KA 4F0LA 1F73A 4J3XA 3GH5A 2EJ1A 3W7RA 1XIJA 1LOQA 2V81A 3ARWA 3W1LA 3B0XA 4XD4A 1EP2A 3WEZA 4ZQPA 3MZ2A 4LBSA 4D2JA 5LHEA 4O28A 3S1UA 3EOEA 2Z1KA 3FJLA 3HIJA 5I3FA 1YDVA 5FF2A 3CNYA 3M5ZA 4IX2A 2FJKA 3RM8A 3JW7A 3CXOA 2VMFA 1H63A 1E4IA 2GK1A 4PB4A 3AOFA 1PHQA 2GSHA 1K4GA 2A85A 9XIMA 3TN3A 2P50A 3VKCA 3LGDA 4W85A 4KCTA 1DIOA 4DY1A 4LUSA 2NQZA 2CKSA 2PB1A 4DXXA 2QJJA 1V51A 3EB3A 3IVUA 2QJGA 3DFNA 4J3WA 1V8EA 5HK4A 1N55A 5IHRA 4F66A 3P81A 3KWSA 1UUQA 1KD0A 2O7SA 4KFNA 1K8YA 3E0FA 1OC7A 5CPQA 2FIQA 1Q6EA 1TQXA 1XGEA 1XYCA 2ZWZA 3OHMB 4KKXA 2GGGA 4XX6A 3BJSA 2C0HA 4R88A 2ATMA 3D6NA 4FIQA 2VM8A 3STFA 3AHYA 2WV8A 1NDWA 3MP4A 4DBSA 1JQVA 1G4EA 3GW3A 3WNLA 5C7HA 1TSIA 3MB9A 3ID7A 2ZZ1A 1H7XA 2V3DA 3PZQA 1IGSA 4UFLA 5A95A 3WELA 4WSJA 3SJNA 1M1BA 1O66A 4B4HA 5HQMA 3T4WA 3KBSA 3WH7A 4IMCA 3F4VA 1U5JA 3DESA 4Q8VA 3BGJA 2E6YA 2OLSA 2H8ZA 1KBIA 2QCDB 3WD3A 4GI6A 5J5DA 3TYEA 5FEXA 1B3VA 1KNWA 4Q6XA 2XIJA 4OUEA 2B7NA 3RNDA 1J79A 2DZSA 4NZ5A 2A3CA 1RA5A 1G6CA 3ZZ1A 2BY1A 4AZIA 3QJAA 1KFBA 4IX0A 1W5NA 1H4PA 2VFFA 1UKSA 3NPVA 4KGJA 3CT2A 3PZ9A 5GJMA 1FTXA 1M7OA 3WF0A 3L7RA 3PBYA 3PF3A 3T2OA 4B15A 2IPWA 1VHCA 4XIMA 2DVUA 1I0DA 4NI8A 1W37A 4XAZA 3W07A 4LEFA 4OUIA 3YPIA 4CGTA 3I6RA 4DEFA 3N2OA 4O4VA 3VI2A 2Y6ZA 3ARSA 2C0AA 4PRWA 4BHYA 1KLYA 4B3LA 1LRQA 2V3EA 4K3ZA 3CHEA 3FVMA 3LS9A 4AF0B 4IP7A 1UR4A 2QUVA 2VFGA 3G6MA 3EDJA 1V0KA 2VFHA 4NNBA 1I45A 3D5HA 3M0XA 4DO5A 2VQTA 1UP3A 3UZ5A 1BRLB 5M1TA 1YDOA 2Y61A 4M6UA 5LGXA 3IAPA 4AYSA 4AD2A 2WBGA 3GB6A 3BCDA 4FNTA 3VUPA 4IFKA 3QMTA 1N8WA 4C6EA 2YL8A 5A1AA 1AW5A 1WYIA 3MUY1 3CK5A 3OVRA 1NTHA 4QGCA 4UFIA 3PULA 5E93A 3NNTA 4HSHA 4L65A 4Q4PA 3OHIA 4HTYA 3G3MA 1E5NA 2F2KA 4QRNA 2HV5A 3P0XA 4ZB2A 3OBKA 3P5YA 5DLCA 4WK9A 4NI3A 4QE4A 1ME7A 2E1WA 3BARA 4A3YA 3S46A 3TQVA 3SJ3A 1QPKA 2GWNA 3MBDA 4MJ2A 3H4XA 4KETA 3GXFA 3DYMA 4QG9A 3LRMA 3W74A 4NNCA 1REQA 1OK6A 4O15A 2WVUA 4W9TA 3NQVA 1M7JA 3AWOA 5AC6A 1FCQA 3UWEA 5GVJA 3TIMA 3W72A 3KDOA 2DH3A 1VRDA 1K02A 1AA1B 3N9RA 3Q45A 3O6CA 3QC3A 2WCAA 1E15A 3BW2A 3S9ZA 2QMKA 4LVAA 4S1FA 1VFOA 1W1YA 3B06A 1XLCA 3QF0A 2AAMA 4XSLA 4DLMA 4H9MA 2QCLA 2OQLA 2GGHA 4RV8A 4HNVA 1JPMA 2OMAA 3QSRA 1JPKA 4U5IA 1GOWA 1FA2A 1MEHA 3GR7A 4M51A 3UWZA 5BRPA 1T0OA 2J47A 1M01A 3C0JA 1D7KA 2H3BA 1SYTA 4CCEA 2DSVA 3DFPA 3E5PA 3TCEA 1F3WA 3AS1A 3N04A 3GU2A 2QKFA 5HUPA 1TV3A 1TPC1 1EJVC 3N4AA 4QQUA 1BVWA 1E0TA 4Y90A 1D7FA 3ARRA 5C54A 1B1YA 3K8MA 4UTWC 4JFSA 2NLYA 4ILSA 2WVVA 2YFNA 3N34A 1S2UA 4H00A 3TTYA 3UZYA 3TUUA 1PDZA 1OM0A 4DVOA 4QDPA 3OVQA 1BEUA 4C6MA 1YPXA 2GDQA 1FH7A 1YXCA 4GI4A 2QEZA 5JH2A 4MWAC 3V4BA 1GNXA 4IPIA 2F6UA 1A80A 3S9IA 2XN0A 2ZRZA 3TQ0A 1XYMA 2WZMA 4YU1A 3KLKA 2W9MA 1HKIA 3DDMA 4ERIA 1RBLA 2XN2A 4YLWA 4MAZA 2JF6A 2H9AA 3P8IA 1TCDA 3DFQA 3SGZA 4CVUA 3VDAA 2ODOA 3A23A 1VP5A 4B5NA 3PTDA 3P61A 3DCPA 1LP6A 4HSNA 1W3KA 1XL9A 5EMYA 3CHFA 5FL1A 3AMLA 1O94A 3W28A 3INPA 1VBJA 1W2VA 3AQUA 3TH6A 1L2UA 3WSUA 3D46A 1HVQA 4WY0B 1OEPA 3KBMA 4UTWA 3E96A 2VFDA 3S2MA 1XW8A 1HUVA 4ZODA 3B0VC 2Y8KA 4S3GA 4FNQA 2XH2A 3ZFHA 4L4LA 4ATLA 4UIOA 4C6CA 1HKJA 4KFPA 2Z2UA 3PZOA 4MB5A 3I6EA 5FACA 2ABAA 2Y8UA 3SEPA 3UNTA 3GD6A 5AYYA 4M29A 2DZTA 1Q6CA 1KGWA 3W6MA 1OVDA 3GVRA 4XIAA 5EFDA 4MYXA 1KXVA 4TTUA 3RM9A 2BZNA 2EHHA 2R9RA 4BJHA 3T42A 2WNQA 1VEMA 1A5NC 4XBKA 5ABTA 4LCRA 1P48A 2R1PA 1BD0A 2YDSA 3QV7A 1LL6A 1V03A 1OCJA 4IL2A 2PPGA 1OY0A 1SMAA 2ZCGA 5LHFA 5J8LA 2FFCA 3VOFA 4L9ZA 1GVRA 3VGBA 2I1OA 4OV9A 3E0LA 1HP4A 1TTPA 3KEHA 5FOOA 2DQXA 2XYLA 2NSXA 1Q6GA 4TVCA 5BZAA 1L6WA 4N6EA 4WVXA 4S3BA 5AYIA 3OBEA 3V16A 4QROA 4TXEA 4CNTA 4QJ3B 1F61A 1CZ1A 3LDVA 4QLLA 3ZWTA 2DH2A 3N11A 4ZQOA 2INEA 4ADTA 4QCFA 3W38A 3CYVA 2W5FA 4PTDA 3IIXA 4BI7A 4H8NA 3AMKA 3G6LA 4D6JA 4Y7EA 3G5EA 4PUUA 3SSJA 3RXZA 4LYKA 3V0TA 4Q3MA 6REQA 3LCXA 1DXIA 3S3GA 4D8LA 3G1AA 1AD4A 2AKZA 1K77A 4H01A 4MLJA 1RPXA 3UJFA 1PWLA 1XLIA 4AX7A 1S1PA 4H6KA 5AYZA 1EZ2A 1H09A 4FLOA 3WCZA 2I16A 1P7TB 1MQRA 1H11A 1F9CA 1BGGA 1RCXB 1E0XA 3FDKA 4OOZA 4FHAA 4KRUA 1XH2A 3KRUA 3GDRA 1RQBA 4DN1A 5A6BA 3WFAA 1OGSA 2BY2A 3QVQA 5D2YA 4BKNA 1CGVA 2DIEA 4I5RA 4LRSA 1OX5A 2BGSA 3OU8A 5JXQA 2V5BA 3GHSA 3QQ1A 3RFAA 2J27A 2I17A 1QBBA 4O1BA 1U83A 2WLYA 2YDQA 3E0WA 2VEGA 3BLEA 3TYUA 5PTDA 3ARUA 3ZO9A 5U4NA 3GW0A 3BW4A 1MZHA 1Q7QA 3LNMA 4NYUA 1FWIC 1GORA 2RAGA 1FP9A 4R85A 1X6UA 1U22A 3IJQA 4LUSB 5FJRA 4B9YA 2PEVA 1GYLA 1YTKA 2Z1XA 2ZIDA 2QAPA 3FA3A 5A6AA 4LVFA 2NQHA 3V75A 1EYEA 3VKAA 4CCZA 5IFPA 1H0GA 1VCGA 2WZHA 1FWEC 1AG1O 2AGKA 3CAVA 1KFEA 2WXDM 3T0TA 5HNNA 4XZIA 2VL4A 3NL3A 3MI3A 2IMRA 4E4UA 5E70A 4D1IA 1WNOA 1YKWA 5A2AA 3URBA 3OA5A 3AC0A 5LZLA 3TTOA 4IJCA 3BGAA 4ZMGA 2BGNE 2C16A 3H2EA 1IXPA 3LBCA 3N2XA 4LANA 3GVGA 1W31A 5TQLA 3LQLA 3WQDA 4D71A 1R85A 3GLCA 2TODA 1NJJA 3MMUA 3WMBA 3ZT5A 3EB2A 3KCJA 2KX9A 3BOLA 2PAJA 5DMNA 1XX1A 1F5ZA 3SN1A 2QVHA 3PTMA 2XSXA 3KS5A 2O9OA 3SCWA 4M3PA 3S42A 3VGHA 4ZOBA 4AG0A 2CZDA 3ITVA 3GSMA 1LTDA 4U2YA 3R0KA 5DMLA 3PSWA 3G1FA 3BLKA 2HNHA 1NH6A 2YA0A 4REQA 1R38A 4DZAA 4DBUA 2DP3A 3GBDA