1WBOA

Fragment based p38 inhibitors
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Lead Discovery Using X-Ray Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 105
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wboA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wboA01
5A46A 3VS4A 1VYWA 4FT7A 1Y8YA 1XH6A 4TN6A 4GKHA 5LVOA 4I23A 4LOQA 4YURA 5IPJA 3BI6A 5I9XA 2QONA 2YJRA 2W06A 2Z7QA 2E2BA 2J0JA 2WTIA 2YIYA 5HG9A 2IJMA 3TTJA 5K9IA 5KBQA 3N4TA 1V0PA 4FTLA 4HYHA 2BILB 3THBA 3UIMA 5J5TA 2G2HA 1UNGA 1H01A 3EYHA 4OR5A 1OPKA 4NIFB 1CKJA 3FMLA 3ZTXA 5C03A 3F2NA 5CS6A 4CSVA 2FSTX 1GY3A 5HI2A 3VUIA 1MRVA 3ROCA 4FMQA 2F57A 3W2PA 4ZZMA 2P3GX 2UZLA 2OU7A 1KOBA 2CHLA 2VWBA 4YJTA 3NLBA 5FXRA 1CKIA 2JEDA 4F1MA 4KSPA 1JLUE 2CKQA 1YI4A 3OC1A 4NJDA 4RVMA 3KC3A 4AFEA 1DI8A 1EH4A 2R7BA 3BE2A 4IZ5A 3R8UA 1W82A 5DHJA 5HLPA 2C5VA 2O64A 4I0SA 4MEDA 4H36A 4ASEA 1H0VA 5E1EA 3V8SA 4HCTA 4BN1A 2ZM3A 2VO0A 5E8TA 4ZSJA 3G2FA 4B99A 4MXOA 4CMTA 3QZIA 4BRXA 3M11A 4OTDA 4UMQA 4AGUA 3LMIA 3CQWA 4AN3A 5HU9A 2P2HA 2JD5A 4ASZA 5IQCA 4M7IA 4RX5A 2C6DA 1JQHA 4W9WA 3LE6A 3HL7A 5AV1A 5BX0A 3DJ7A 2RG5A 5HIDA 1QPEA 3PRIA 3DY7A 3KULA 4QYEA 2X81A 4DG0E 4LRKA 4BF2A 5DLSA 3BPRA 1PXPA 1PW2A 4FTNA 4KAOA 2OIDA 4HNFA 4HGLA 1G8AA 2WD1A 3QTZA 4IADA 4CCUA 4EHGA 1SM2A 4L52A 4EH3A 4BDEA 4BTMA 5KMLA 4TRLA 2GNLA 3SOCA 3C7QA 3VBQA 5KO1A 3ZC6A 2BAQA 3MFRA 2YM8A 2XA4A 3M42A 3QTXA 3R63A 3ZBXA 4AZVA 4AZEA 3CCNA 4HYIA 4XG6A 2X9FA 3PA3A 4YTFA 4GT3A 3TNIA 4A9TA 4ANQA 4NIFA 3AC2A 1H00A 2WNTA 4TXCA 5BMSA 3SXSA 4QPAA 4RVTA 4KBCA 2HELA 3D4QA 4IAIA 4L6QA 1PMEA 3MH0A 4HZSA 4EH9A 1Q5KA 3VRYA 4FV4A 3W55A 2PVJA 4M8TA 5E92A 4EOOA 3D5UA 4ZK5A 3L9LA 4YUQA 4FV3A 3KGAA 4DEGA 2VTTA 1R3CA 3Q32A 3P23A 5LMAA 3QLFA 3UZTA 1B39A 2XVDA 5EQEA 3GUBA 3R01A 5AFVA 5A4EA 2CMWA 3QALE 5T3QA 3RTPA 3NRMA 2Z7LA 1U54B 4FNYA 4KS8A 4CMOA 4BCQA 5HBHA 4CV8A 2YWVA 4DEDA 3PVGA 2QOHA 3ZRKA 3FBVA 2X6DA 3C50A 1KOAA 3O7LB 4YZNA 3RK7A 4BFMA 4JR7A 4G5JA 2A27A 2Y4IB 2EXEA 2HOGA 5AM6A 4CRSA 4E5AX 3EN6A 4J98A 2BUJA 4ZP5A 2PK9A 3BE9A 4BDHA 1IRKA 3OFMA 4IE9A 3EZVA 4G5PA 3R9DA 3Q5ZA 3RAKA 3F3ZA 4EOSA 3RGFA 3UC4A 3ZUVA 3A8WA 2J0LA 4MD9E 4NK9A 1P4OA 4CV9A 2J0IA 5A4LA 5JEBA 5DEYA 3IDBA 4C36A 3ENHA 1H1QA 3OT8A 3QTWA 3EHAA 3MJ1A 4YJUA 5IA1A 3ZRLA 2ITXA 4WRSA 4AW1A 3WE4A 2WMUA 4D2PA 2PVYA 4F9AA 4C3FA 3F82A 2F7ZE 2VO3A 5H9BA 1BI8A 4QPSA 2YLFA 4O6LA 2XNOA 2PVFA 3P7AA 4RFMA 5FTQA 3FC1X 3GC9A 5TF9A 1YWRA 3GCPA 1X8BA 5L2WA 4QTEA 2BZJA 2B0QA 3UPXA 2IWIA 1OUKA 3E87A 2R3NA 4EHVA 2JFMA 1YXVA 4FVQA 3HP2A 4YHTA 3PXKA 5CLPA 1W8CA 1Q8UA 3F69A 3GU5A 4PUZA 4JT3A 1SNXA 4FODA 5CENA 5CALA 4PL5A 2A2AA 4YJOA 3TZMA 2UW6A 3UZRA 3RALA 4IACA 5CU2A 2ESMA 3UQCA 3ZS5A 3F7ZA 1KE5A 3QXOA 3NUAA 3FZ1A 3U9NA 3R0TA 4M0ZA 5DIAA 3UNZA 4YLKA 2W1EA 4F1TA 2FH9A 3F5UA 4QMLA 5D9HA 4ITJA 4RIYB 3RHKA 4CYIA 4BIBA 2BRHA 3DKOA 3N4UA 3PJ3A 3QA8A 3OWKA 2E9UA 5FP5A 2V62A 3ZSGA 1Y8GA 4AT5A 4S33A 4CT2A 1UWJA 2QHMA 3QTRA 1ZRZA 4J53A 5AAFA 2RGPA 1YDRE 2PSQA 2HXLA 3A99A 4N0SA 3B2TA 1YXUA 3I81A 2UVYA 3JPVA 3MPMA 3RHXA 3W2QA 2HK5A 3D5WA 4L9IA 4GT4A 1A48A 1F5QA 1ZYJA 4BGQA 2YM7A 2GNHA 5KBRA 4APCA 3QQFA 3FXWA 5J95A 4LGGA 2EUFB 2XJ2A 4C3PA 4ZTNA 4PMTA 4XEYA 3OEZA 3ZM9A 5BNJA 4P4CA 2RFNA 4OTQA 5D1JA 3VUKA 4N57A 4LUEA 3JXWA 4USFA 3PJCA 3EQRA 4G1WA 2J0KA 2XRUA 3A2CA 2OI4X 1JWHA 3K3JA 4EL9A 4FEVA 3R22A 4O7RA 1OIRA 1JKLA 2XNPA 2V7AA 4J1RA 4FUYA 4D4SA 4GFGA 2CCIA 3AT3A 4IBMA 3QTSA 4ITHA 4MBLA 3W18A 4XBUA 4OTWA 5AP6A 1H8FA 4RX9A 5KMOA 4HNIA 3HV3A 4XG9A 3N4VA 4YC8A 3OP5A 3PXRA 2NNWB 1B6CB 1GJOA 3WF9A 2OH4A 3MTLA 4FSZA 5E8VA 5J87A 4F9YA 3VUHA 1UU9A 3FDNA 4JX3A 4WHZA 3KCKA 3IW6A 2YCFA 3AC1A 4E4LA 4F6WA 2RF9A 4ENXA 3LVPA 3NYVA 4FL2A 4QMSA 2QURA 4R1VA 5EM6A 2DS1A 2XJ1A 3C9WA 4X0MA 4R6VA 2QO7A 3H4JA 4NUSA 3F88A 4O0UA 4W8EA 1YI6A 5AP1A 4ANMA 3QCSA 4KD1A 4OTHA 4ORKA 2QOCA 3E7OA 4U42A 4GK3A 1OIUA 3SXFA 3ET7A 5E1SA 3PYYA 4RIWA 1NY3A 1P5EA 4GIIA 4N6ZA 2OH0E 3OUNB 5EQYA 5EDPA 3UTOA 3R04A 3PY1A 4Y85A 2CN5A 3R7GA 4MWHA 4QYYA 3R2YA 1KWPA 2GDOA 2WMBA 2FO0A 3DB8A 3DKCA 4NT4A 5C9CA 5L2SA 1RDQE 5BVWA 3KK8A 3A4PA 4OW8A 2ETMA 4RVKA 2IZRA 5HVJA 2QOBA 4DTKA 2BAJA 5LCJA 4C4EA 3TUCA 4HPUE 1O9UA 4I6QA 4QMUA 4X2JA 2IW9A 3GU6A 3UNJA 4A4XA 4RJ6A 3FJQE 2UVXA 3PXFA 3O8TA 4O0SA 3POOA 1FMOE 2JDSA 5JMSA 2GU8A 4EJNA 5FTGA 5EM8A 3PG3A 4IX3A 3FMHA 2UW3A 3QD0A 5HQ0A 5CXHA 3EQBA 4Q5EA 2B1PA 2KULA 3NGAA 5FXQA 1P14A 4XLIA 3TV4A 1V0OA 4CZYB 1K2PA 1JSVA 2OZOA 4L7FA 3SVVA 4U7ZA 4QMZA 4EUUA 1GAGA 3C13A 4ZMEA 4DH3A 5AR3A 3RAHA 1M17A 3CJFA 3QX2A 4X2GA 3B8RA 5IA5A 5JQ5A 2XRWA 4CXAA 2GHLA 4IAFA 2RG6A 1CSNA 5AR8A 5EYKA 4KWPA 3NYXA 3NVKI 3OROA 4G16A 5T6KA 4D1ZA 3FZSA 3U55A 2XEYA 5M08A 2VN9A 4FICA 4YNOA 3WIGA 4MQ2A 4C34A 4AG8A 3OMVA 3UDBA 5LWMA 5E8YA 3UO6A 3S0OA 3IO7A 1U59A 4RX7A 3PY3A 4B4LA 4K77A 4WA9A 5CSHA 2GHGA 2J2IB 3EN7A 3P7CA 3QAME 2HW6A 3RM6A 3GQIA 4IJ9A 3VF9A 4EH6A 2ITQA 3BWJA 2WIPA 4FTKA 2OWBA 3F2AA 3T9TA 3SC1A 3DBCA 4FKLA 1UNLA 3QWKA 3OXZA 4FL3A 4FTIA 4PDOA 2W1HA 3LCSA 5H2UA 4W8DA 3ZZEA 3U6JA 4MKCA 4NYEA 3S1HA 2X7FA 2R3GA 4JBVA 2JBPA 3T3UA 4I24A 4DF3A 4F65A 2PPQA 2XK6A 4IDTA 5GJDA 2G01A 2NRYA 3O96A 4JRNA 4ZJJA 4A07A 4D5KA 3CP9A 3HUCA 5TT7A 4EOKA 5C8NA 3SRVA 2ERZE 1OITA 3NMUF 4NTTA 5C01A 4EK6A 1PMNA 2PE2A 4PPCA 1KE7A 1PF8A 4JR3A 4JBPA 2VX0A 4RIOA 2R3QA 3HRBA 3IK3A 5BQ0A 4PP9A 4E6AA 5I9VA 4DGGA 3D94A 3FXXA 2VU3A 3ZLXA 4CKIA 2C1AA 4OUCA 4DGMA 5HG5A 5KMIA 3QL8A 4YZDA 2X7OA 1MRUA 3C51A 3QC9A 4II5A 3FHIA 3Q2JA 4RJ5A 4HGTA 4TTHB 3UMWA 5D41A 4O22A 5AUZA 5I9UA 2OFUA 2JITA 3LJ2A 3UP2A 1PKGA 1J7IA 3CGOA 2CNUA 4L00A 5AUVA 5DPVA 3ZCLA 4O7WA 4O96A 2P0CA 3BYSA 4C8BA 4DEBA 5CXZA 4IEBA 3K5UA 3EH9A 2NPQA 2XZSA 5L6PA 3SDJA 4GKIA 5DE2A 4ZTMA 5CT0A 4DH7A 3FHRA 3AD6A 4ASXA 2W4JA 2CLXA 3FMMA 4KIKB 4QYHA 4V01A 2G15A 4FVPA 1GZ8A 5D12A 4ALVA 4DEAA 4KIQA 4IAZA 4LRJA 1SVEA 3PIYA 2R4BA 2AC3A 4X3FB 2W7XA 3FZRA 1SNUA 4MXAA 5AJQA 4FG9A 3E8NA 2W96B 3EQDA 4TWPA 2X8IA 5LARA 2AYPA 3Q4ZA 2RSVA 2CGUA 3KVXA 4PTGA 2FSMX 3UYSA 1LUFA 4CNHA 5K4IA 4MF1A 3O8PA 3P86A 5HLNA 3AGLA 3PJ1A 4XP3A 2QOFA 5CASA 2WTVA 4APPA 4CKJA 3ZFMA 1ZMWA 4V04A 4EK3A 4J71A 2YDKA 4K33A 4K11A 4U3ZA 4TNBA 4E5BA 5EYMA 1VEBA 2A19B 5IQEA 1LPUA 1YQJA 4FV5A 3DK7A 3ZMMA 4BCPA 4DFNA 1Q4LA 4M14A 5H8EA 4L46A 3ZM4A 4E26A 2WMAA 4FSMA 4J7BA 2O8YA 5JRSA 5KE0A 4XOZA 2VTMA 3RK9A 1Q99A 3V6SA 5C1QB 5M56A 2FYSA 2PHKA 4XV9A 5A3XA 4B6LA 2YJSA 4ZOGA 4EI4A 4DCAA 3PPZA 4C61A 3R28A 5IQHA 4TPTA 2PVKA 3KA0A 5AV4A 3UOKA 4XLVA 4FIIA 3SAYA 3WOWA 3IECA 4YZBA 3R7UA 4BY9E 4E3CA 4ZTSA 4E8AA 2OICA 5CF5A 4X3FA 2R9SA 2Y9QA 5J79A 4FTCA 4I4EA 5BVKA 1KV1A 1MUOA 3OZ6A 1OKVA 4FSYA 3K3IA 3O71A 3RK5A 4E4NA 1BMKA 3HMIA 5IQBA 2JKMA 3H3CA 3C0IA 3QLGA 4EKKA 3MESA 4L3JA 2XKCA 4AF3A 2IN6A 3ERKA 4R8QA 4OBOA 2WTKB 4QYGA 5ETCA 4QMMA 4Y73A 3PG1A 3W32A 2ITUA 4XP0A 4AACA 1PXNA 4AGDA 2OGVA 4C7TA 3U6IA 2PVRA 4FK6A 4G3DA 4F6UA 4IZ7A 3LZBA 3AT2A 3ZYAA 5HBJA 5C8KA 3MA3A 1R39A 4MAOA 5KUPA 4EOIA 2YCSA 4WSYA 3PIZA 4NM0A 2AUHA 3DTWA 3ITZA 4BHNA 2BFYA 2CLQA 3FL5A 3A62A 2AC5A 3AQVA 3GCSA 4O0YA 4FVRA 5FGKA 2VWWA 5CAQA 4WSQA 2EXMA 3LFBA 2XYNA 3COHA 3CE3A 3FLNC 2C6KA 3VQHA 2C5NA 5HTCA 3H0ZA 1H07A 4RJ4A 1WCCA 4TYHA 4Y95A 4MVFA 5E8WA 2QOKA 2UZEA 3T8OA 4EZ5A 5LVPA 4IJPA 1RQQA 5AMNA 3T9IA 4K8AA 3IW8A 2XJ0A 4IB5A 1CKPA 3MIYA 4I3ZA 3NIZA 3CGFA 3COIA 2P33A 3PSBA 2C4GA 2XIZA 3PZEA 3UBDA 4BDGA 1M2PA 2WEVA 4U3YA 4W4YA 2B7AA 3AD4A 5EW8A 4A7CA 4QMNA 4L53A 4PV0A 4XV2A 2G1TA 3G0FA 4AT4A 2ITYA 3IG7A 2J5EA 3RPRA 4WNOA 4ZAUA 1XJDA 2I1MA 4Z55A 1BKXA 1E1VA 2F2CB 2Z2WA 2ETKA 5AP2A 1J7UA 4GMYA 4Y8DA 3HV5A 3ZXZA 5B2LA 2B4SB 1XBBA 3H9RA 4Y5QA 4FV7A 3GGFA 3HA8A 4IHPA 2P4IA 5AV2A 1ZZLA 2C69A 4WT6A 5CSVA 1Q41A 2VRXA 4NCTC 5L8JA 4YBKA 3WF5A 3ZH8A 4AAAA 4F0IA 4KKEA 4F7NA 4F70A 5B0XA 1XKKA 1W98A 5CI7A 3KXGA 3UOHA 5L6OA 2VX3A 4FSUA 4F99A 3Q53A 4FOBA 4QTCA 5TKDA 2WU7A 3KMUA 2C6MA 3FLSA 4FIFA 4YPSA 2R3JA 4LRMA 4AE9A 4ARKA 3TJCA 3JVSA 3R7OA 3VHKA 2R3IA 2HWPA 5GZ9A 3A60A 3KRLA 2P2IA 3NCGA 3EKKA 3W8LA 4UZHA 2YM6A 4ZY6A 2YIQA 4XG7A 3DQXA 5GHVA 3PLSA 3P9JA 2WQOA 5HO8A 4AZFA 2FSLX 4XYFA 3DJ5A 2UW8A 4EOLA 4PP7A 3AOXA 3K54A 4W4XA 4O38A 1H26A 2BZKB 2WIHA 3MTFA 4R7HA 2IPXA 2Y8OA 4CLJA 3BBTB 1SYKA 4RWKA 1SVGA 3F66A 3MDYA 4AUAA 2X2LA 3SXRA 3PTGA 1YXXA 4IM0A 4FG7A 3R6XA 5LCKA 2GMXA 3H9OA 5DT3A 2B52A 2HZNA 2Z7RA 5L6WL 2CNVA 5BPYA 1H28A 1IEPA 2X4ZA 3GNIB 3ATTA 1OZ1A 5AR4A 5CWZA 5IQFA 3L9PA 5HG7A 4BIDA 1H1RA 4AGWA 4G9RA 2YA9A 3KXZA 4E4XA 3TKIA 5EDRA 3I7CA 1BX6A 3NUNA 3E88A 3LCDA 4BL1A 4DN5A 3ID6C 1OL2A 2ITWA 1UNHA 4YTHA 2JDVA 3DB6A 3BHUA 1OUYA 5CZIA 3S3IA 3AMYA 3DQWA 2ONLA 2R2PA 3DFAA 4YO4A 2WMQA 2ETRA 3H9FA 5DOSA 3E92A 3IW4A 3O2MA 2GS2A 5F95A 2W1IA 3MWUA 3QKKA 1Q8TA 1OBGA 2R3PA 2G9XA 3HRCA 2I40A 2RFDA 3VS2A 1ZARA 2VTNA 5HIEA 4TYIA 1U5RA 4DLIA 4XHKB 2I0YA 3EQCA 3VVHA 4FTJA 3ZEPA 4DFXE 4QNYA 4LV5A 5GJGA 4H3QA 5AUXA 4DG3E 1Q61A 4RRVA 3QU0A 3OVVA 3D15A 3EMGA 4IVCA 3VS7A 5AP3A 1XH8A 4AX8A 1YHVA 3UE4A 3ORPA 4J95A 4RWJA 3Q9YA 2QG7A 3BCEA 4FV6A 3LFDA 4WKQA 1PYXA 4MXYA 4PMPA 4H1JA 4BDJA 5FEEA 4CG9A 1JAMA 3E8EA 3C1XA 3RPVA 3DBFA 4GL9A 3F2RA 5CEQA 4FEXA 3E8CA 4K6ZA 2YISA 4BHZA 5FP6A 2BDFA 3VQUA 3AXWA 4DFBA 4IDVA 5JGDA 3WF8A 4JAIA 3KULB 5AIKA 3TUDA 1V0BA 1YVJA 3JUHA 4I92A 2XNNA 4QP2A 4AGCA 1S9JA 3FI4A 3KXNA 1NXKA 4FKSA 4M69B 4I1ZA 2B54A 4YC6A 3TI1A 3TZ8A 1WVXA 1OPLA 4GV1A 4HCVA 4CQGA 4RVLA 4Q9ZA 2Z02A 4EBVA 3DAKA 3BHVA 3EFKA 3EQIA 2HZIA 3V5LA 4IAKA 4O7VA 3SV0A 1Z5MA 3NX8A 2WFYA 3R7YA 3PSCA 3VUMA 5HTBA 3QTQA 3F3UA 5H8GA 4DYMA 4XUFA 2ITOA 3MVHA 4QP7A 2WTKC 3MY1A 3ROYA 4EWHA 5ANKA 3RWPA 3Q4TA 4FL1A 3TWJA 1M7NA 3BYOA 3LJ0A 3OBJA 4FV2A 3GFEA 3ZRMA 1OL1A 2ITNA 1XR1A 1G8SA 5EFQA 5DFPA 1Q3DA 2VNWA 3OY3A 4QP4A 2ZMCA 3F6XA 3P79A 3HA6A 3IS5A 4UXQA 5HHWA 3ZDIA 4U40A 3R7EA 2OJGA 3OCBA 4D0XA 5I9ZA 5K0XA 1YHWA 2BDJA 2G2FA 2O65A 3HLLA 4NZWB 4FIHA 5CI6A 4EZ7A 5B2MA 4PQNA 4PMMA 4BWKA 4EONA 3BX5A 4O86A 3R9NA 2PUNA 5M51A 4GCJA 3BELA 3R21A 5CT7A 4ACDA 5JFWA 4NL0A 2RKUA 3FI3A 3LAUA 5IEVA 1H25A 4V0GA 3EB0A 4CTCA 2OBJA 4D2RA 4Z16A 2UZDA 1ZYLA 2UUEA 3UQGA 4F0GA 2GNFA 2PMOX 2JGZA 4JDIA 3GI3A 4NW5A 4RC4A 5BVFA 4P7EA 5CQUA 3TKUA 2PUIA 4QOXA 4C35A 1M14A 3CKWA 3P7BA 4QMOA 4QMWA 3BQCA 4BCGA 3KREA 3MY0A 1M2RA 3FYJX 4XJ0A 2WAJA 4I6BA 2C5YA 1OPJA 2VGPA 3I0OA 4RA4A 5EI6A 3HUBA 4IZYA 5DEWA 4RQKA 3UIXA 5CEPA 1MP8A 5LVLA 3O50A 4MBIA 1SZMA 3WYXA 5FUTA 2C30A 3TNWA 2YDIA 2GQRA 2XCKA 3SQQA 5CSWA 4AWIA 4USEA 4FI1A 5CEOA 2R3FA 3BV2A 4EH4A 3E63A 2R3KA 4FV1A 5IQDA 4FNZA 5CU4A 4DFUA 2OW3A 4KRDA 4YJQA 2BTRA 4XOYA 2GFSA 3QUEA 3EOCA 4GU6A 2V55A 4KBKA 4WNMA 4CVAA 5IUHA 4EC8A 4YJRA 4L7SA 4EQCA 1GZOA 3JYAA 5EOLA 3VJOA 2BCJA 2PE1A 2VTLA 3LFAA 4FV8A 4O1OA 1JKKA 4DEIA 4F9CA 3RNIA 3LFCA 3VUGA 5CAUA 3IGOA 3PJ2A 4FKPA 5IMXA 2CGXA 3R7IA 3A7HA 2XM8A 5HLWA 2WOUA 1CMKE 1OL6A 1P2AA 2OKRA 4QP1A 4DCEA 4BBEA 2Z8CA 5HE3A 3I1AA 4EOMA 3QRJA 2VTPA 5KKRC 3D7TB 3P4KA 3BV3A 5KHWA 4O84A 4GG7A 4S34A 1S9IA 3ACKA 4GFMA 2CSNA 3TG1A 1WBTA 1YDSE 5BVEA 4M69A 3NYNA 4A9YA 4DFZE 3QHRA 5IQGA 4NEUA 2ZV8A 4DTBA 1AGWA 4O0RA 4TWOA 4C62A 4TYHB 2XKEA 1PJKA 2W05A 2YABA 3OWJA 3PDTA 2YM4A 1ZAOA 2ZDUA 4F6SA 3PXYA 4K9YA 4FSQA 4H1MA 4R78A 4RC3A 5E7RA 5L3AA 5M06A 3R02A 2CDZA 4X21A 4J8NA 4F4PA 2FB8A 2R0UA 4WNKA 3MH2A 4GJ3A 4UYAA 5HE1A 4BCOA 5M4IA 1IAJA 5B7VA 1FOTA 2C5XA 2QG5A 3RINA 3W10A 5BYZA 3I6UA 3TTIA 4XNEA 4QT1A 1BI7A 3NS9A 2C68A 2QCSA 3TNQB 3KB7A 1RW8A 5HOAA 5L2IA 4YTIA 2XP2A 5KMJA 3Q3BA 2UZVA 4IX6A 4UV0A 3UNKA 3TNHA 3HMPA 2R3RA 2XKFA 1WZYA 2W1DA 4FKWA 3UP7A 4BWPA 3HV4A 3I0QA 4ITIA 4JG7A 4WG4A 5EW9A 5ACBC 3Q4CA 3BYUA 2YAAA 3CD3A 1A06A 3A7FA 4BGHA 4U43A 4BTJA 4F0FA 4Z7GA 3RWQA 5HVKA 4LOPA 4RIXB 2OZAA 3VS3A 4ZLOA 3LFFA 4LQMA 3O7LD 4XG4A 4LUDA 4P2KA 5EQPA 3C5UA 3DLZA 3EIDA 3FSKA 4MYGA 4FZAB 4EUTA 3ORTA 4YR8A 3G90X 1GOLA 4JIKA 4BDAA 2UW4A 3NVMB 3NUXA 3HMOA 4C2VA 4X2NA 3NUSA 4JOAA 2W1GA 3FYKX 4D0WA 5AUUA 2OIBA 2QNJA 4MH7A 5JFXA 3NW6A 5CU3A 4AQCA 3HMMA 4IC8A 4ZLYA 3BYMA 5CY3A 4MCVA 3C4FA 5AM7A 3W2SA 3Q9WA 5T68A 3DKFA 1Z9XA 4I21A 3P08A 3FLQA 3WZUA 3HZTA 4IFCA 3ZLWA 3L1SA 4KUJA 4O7NA 5HO7A 1PHKA 3ENMA 4AW5A 1UVRA 4Y46A 2GS7A 2XH5A 3PP1A 1Q8WA 2ZAZA 2C0IA 2W4KA 4KNBA 5IH6A 3UO5A 3R73A 4QMTA 4PNIA 3ORLA 3ULIA 4U9AA 5HNGA 4CQEA 3V6RA 5EG3A 4TT7A 3V8WA 3EWHA 3NUUA 5FM3A 5G6VA 2VD5A 3PWDA 4K0YA 3IW7A 3NUPA 2BPMA 5G1XA 4BDCA 5J5SA 2XKDA 2WMTA 3I4BA 5LVMA 4WD5A 2C6TA 3ORNA 3FC2A 4B8MA 3NNXA 1PY5A 4DH5A 4HYSA 4BGGA 4ZLZA 3VS0A 4F64A 2R3HA 5F4NA 2DYLA 1FVTA 1NVRA 4D55A 4H05A 4USDA 4QP6A 5CEMA 2PZYA 5FDXA 4M66A 4MD8E 4QMXA 3RAIA 3U8WA 2PU8A 4GIHA 4WUNA 3ZHPC 5AP4A 1GNGA 3PZHA 2R3MA 3JY9A 4K18A 3VUTA 3JR1A 3LQ5A 3E62A 3PE2A 4FOCA 5ITAA 4KIPA 2XNBA 4DA5A 2EWAA 4YGAA 5IMEA 3UQFA 1Q97A 3QQGA 2REIA 2LAVA 1O6LA 3VUDA 3FY0A 3LM5A 2ZOQA 5LWNA 4PTCA 5DR6A 1UKIA 4FYOA 2BIYA 3KQ7A 3PLAE 3F3VA 2F2UA 3QZFA 3ZLSA 2WMXA 2F49A 2VZ6A 3UVRA 3KFAA 2HZ0A 5DG5A 3FPQA 3QRUA 5DH3A 4BDDA 3OXIA 1UV5A 2UW9A 2PYWA 5HICA 1WBNA 5K0KA 2F7EE 3Q6UA 3NUYA 5GZAA 1ZLTA 1OIYA 4TY1A 5CTPA 5E8UA 4UXLA 5AWMA 4OTPA 3MW1A 3DDQA 2XK9A 1OKYA 3U9CA 4S31A 3FMEA 1LP4A 4M12A 2F9GA 3R2BA 3VJNA 3W2CA 4E6CA 2QODA 3PVUA 4GVJA 4XG3A 3D9VA 2WMVA 4DLJA 3LXPA 5EOBA 2ZM4A 4O0TA 4U8ZA 4EH5A 1XH5A 5CVFA 4RIXA 4NW6A 4DINA 3VULA 4R7IA 4D4RA 3UODA 4FIJA 3L8VA 4PRJA 5FBOA 3OCTA 1WVYA 2YM3A 4XRJA 3I5NA 3N51A 5DT0A 3WF6A 5J7BA 2WHBA 2IW8A 3AMAA 4DT8A 3OCGA 4FX3A 3QFVA 2J90A 3KVWA 3QRIA 2QKRA 5AIRA 1OL5A 2PVLA 4CFFA 4KIOA 4JBOA 3QYZA 3IKAA 3QD4A 3FE3A 4TZRA 3ACJA 4FSTA 4TKSA 4DGNA 5CVGA 1OVEA 3R1NA 4EHZA 3GXLA 2H9VA 5I5ZA 2WELA 2CKEA 2I0VA 2PUPA 2OJ9A 5CANA 5IH5A 2WPAA 5ETFA 4O82A 4G34A 3HRFA 4LGHA 3RAWA 4S2ZA 4U41A 3ULZA 5DN3A 3CTJA 3CS9A 1MRYA 2CGWA 2X7GA 5M4UA 4NKSA 1OI9A 2OK1A 3IW5A 4OLIA 3DZOA 4YHJA 3ZFXA 2QLQA 1JKTA 3QYWA 4QP9A 4MNFA 2JDTA 2UZUE 4R1YA 2WU6A 3FUPA 3ORIA 4O7TA 1STCE 2UZTA 4LV8A 2X2KA 4RLKA 3FZOA 4XS2A 3UVQA 4CFVA 4D28A 1FGKA 3I7BA 2VAGA 2XF0A 4C38A 4IIRA 3DLSA 3R1SA 4RT7A 4BTFA 2OFVA 4P90A 3E64A 5C27A 3WIKA 2QR7A 1OL7A 2PVHA 2ITTA 5IISA 5AX3A 4K1BA 4NFNA 1NVSA 3II5A 4RPVA 3SW4A 2ZV2A 5HGIA 2VWIA 4ACGA 5E9EA 2YDJA 4OTFA 3LFQA 3R8MA 3AGMA 4FKTA 3OW3A 3MSSA 4ZIMA 2BMCA 1GZKA 2XIRA 4EKLA 5IH4A 4AZWA 3PP0A 4IB0A 5J9ZA 1JSUA 4O7ZA 5DBXA 4L3LA 4PDSA 3F5GA 3BBWA 3LPBA 4ANLA 3GT8A 2E9VA 3FZTA 4IX5A 4FGBA 3RM7A 2DQ7X 5E8ZA 4IVBA 2E9NA 1GZNA 2RIOA 1LEWA 3R9HA 3D14A 3NR9A 3FQEA 1Q8YA 1KE8A 2OF2A 3Q04A 5KZIA 4ACHA 1M52A 4X6RA 3SX9A 5B2KA 1ZYSA 3QQUA 1PXJA 5LQFA 3W1FA 3POZA 2QVSE 4FTTA 2ZMDA 1CTPE 4OT5A 2JDOA 2X4FA 2ONLC 3FQHA 1AD5A 4FR4A 2QO9A 1NA7A 4L67A 5HKMA 3S4QA 2NP8A 2EB3A 3C4EA 4CFNA 4EYMA 3ATSA 2CN8A 5I9YA 4FT0A 4HJOA 3ANRA 1KE6A 2ZV7A 3R8ZA 4CD0A 3RP9A 4O7LA 4BI1A 4D4YA 4EWQA 3DK6A 4M84A 3F3WA 4QQTA 4EK5A 2YLEA 4KRCA 2R5TA 4QQCA 1WBOA 2GTMA 4JDKA 4TL0A 2IG7A 2ITPA 4ID7A 3ODYX 4I0TA 2PWLA 5FM2A 3PWYA 4BCHA 4YNEA 3DT1A 3QF9A 5JFVA 3IQ7A 4DT9A 5F20A 3ZUTA 1ZMVA 3VS1A 3S2PA 5EKNA 4X3FC 2W0JA 3RPYA 3VC4A 2PZRA 3Q2MA 4RIWB 4QMYA 2PE0A 5AUWA 4E7WA 4HVGA 2YIRA 5DNRA 1XBCA 4DGLC 4E4MA 1YXSA 4I5CA 5CQWA 5A4TA 5K4JA 2YIXA 4GYIA 4EH7A 5I9WA 3TDWA 4YTCA 2JKOA 3NCZA 3DZQA 2HY0A 5FD2A 4R77A 3TEIA 2ZM1A 3OS3A 4AN9A 3VS6A 3LMHA 2BAKA 2PL0A 4RFZA 2UVZA 2OXDA 4TWNA 1VR2A 3W33A 1JBPE 5ANGA 1U46A 4BB4A 2YACA 4YMJA 5L2QA 4QP3A 3S00A 5M44A 2CKOA 5EHOA 4TYJA 5K3YA 4CCBA 4XCUA 4LOOA 3LQ8A 3AC3A 3GCVA 1Q62A 4O0VA 4IXPA 1OB3A 2YHVA 5BUIA 4TNDA 4O27B 5FG8A 2YZAA 4YSJA 4GSBA 4TYEA 4YZ9A 2QLUA 2VTJA 3ZO4A 4UMPA 5DVRA 4FUXA 4LM5A 1LEZA 3LFNA 3MB7A 2GQSA 2PMLX 4FYNA 3RZFA 3OXTA 5HE0A 3NNVA 2BVAA 4FV0A 3R71A 2FUMA 3AT4A 5C4LA 3NZ0A 4I5HA 4X2KA 5DWRA 2EXCX 1VJYA 2Z60A 4HGSA 5FEDA 4LFIA 3GC7A 1OBDA 5IUGA 4ZEGA 4DH1A 4JAJA 1UU3A 3IPHA 4MTAA 2Y6MA 3VBYA 2W4OA 3KY2A 4ANBA 4DGOA 4F9BA 2VWXA 4B0GA 2E9PA 4F7JA 2XK7A 3L8XA 4FTOA 3UG1A 3I6WA 4KBAA 5AX9A 3EQHA 1YRPA 5M07A 4DEEA 2VTSA 5I4NA 3PA4A 5CNNA 3FMDA 1QL6A 5FDPA 2NRUA 3VIDA 3O0GA 3I5ZA 4AOJA 1G5SA 3EN4A 2O63A 3SA0A 5AA9A 3SLSA 3DPKA 1OECA 4UMRA 5K5XA 5M09A 4Q9SA 5HE2A 5HIBA 3W2RA 3GU8A 4EHEA 1ZZ2A 3BGPA 4G17A 4TWCA 5KZ0A 1YOMA 1LR4A 3M1SA 3SHEA 2CNQA 2VTQA 1APME 4G3GA 3W16A 3K5VA 4BC6A 3ORZA 4G6OA 1U4DA 4HVDA 3DXNA 3KEXA 3BEAA 4Y83A 4W4WA 1UU7A 5KHXA 4I6HA 3UMXA 1XHAA 2IZTA 3TL8A 3AD5A 4UYNA 4DE4A 3MVMA 4GVAA 3ALNA 4FEUA 3COKA 3PVBA 3M2WA 3LXKA 2OLCA 4E93A 2QI8A 5KCVA 4FKUA 5K5NA 3FY2A 2IVUA 3GC8A 5DR2A 2QC6A 4G3FA 2UW5A 4GT5A 5CNOA 1WBPA 3VBWA 3IDCA 4QTBA 4UZDA 5JH6A 5JN2A 4YLJA 1QPCA 1H1WA 2BRMA 2XK4A 3PJ8A 3DAJA 3QC4A 5TR6A 3ZUUA 3MVJA 3OD6X 2ACXA 1HOWA 5AP5A 2B9FA 4CFMA 4YJSA 4F7SA 4C37A 2IZSA 4H3PA 5KMMA 3U54A 3LXNA 4IM2A 5DGZA 3V8TA 3ZO3A 3GP0A 2C47A 1PXMA 2DUVA 3SG9A 4RGJA 4LGDA 2HIWA 2VWZA 3TV7A 3UYTA 4AN2A 4M3QA 4D2VA 3K2LA 3UG2A 5C4KA 4WBOA 3SOAA 1PMUA 2WTDA 2PZIA 4ZZOA 4MXXA 1TVOA 3QD2B 1OMWA 3V3VA 5CEKA 2VTRA 3MFSA 2QU6A 3CIKA 4WO5A 5FQDC 4CZUA 4YU2A 4DBXA 3EJ1A 3G6GA 4R3CA 3UZPA 2G2IA 3FWQA 4UWCA 4FEWA 1IR3A 3FKOA 4O1PA 3E8DA 3KN5A 2YCRA 3V5TA 3EFWA 3QX4A 4JG6A 4CFWA 3ETAA 5JRQA 3QZHA 1PXKA 2OIQA 1YOLA 1U54A 2JKQA 4B9DA 3CR0A 3H10A 2UV2A 4C4GA 1U5QA 1FGIA 3ORXA 4I20A 3EN5A 4M15A 5DT4A 2GS6A 3CY3A 3EL7A 4FC0A 1IASA 1XH7A 1BYGA 5I3RA 1J1CA 2YFXA 3LM0A 4V0GB 2PZ5A 4G6NA 4P5ZA 2V0DA 5JGAA 3BLQA 2PULA 4XG8A 3CC6A 2FVDA 4D1SA 3LOKA 3ZC5A 3VWAA 2B9IA 3I60A 5A4CA 4CZTA 4CTBA 2IZUA 1XQZA 1W0XC 5CSPA 3V01A 5BVDA 2BZIB 2H6DA 3D5VA 3TNPC 3UPZA 5LOHA 1W7HA 2VWUA 4I5PA 3FL4A 4WNPA 4BZDA 4ANNA 5LXMA 5D11A 4FZDB 5M4FA 4MD7E 4RZWA 3FQSA 2C5OA 4OAVB 1PRYA 4UB7A 1OKZA 3WZDA 2QHNA 3C0HA 3V5QA 2XB7A 4GRBA 3TCPA 3ZU7A 1PMVA 2W5HA 3HMNA 4ZJIA 4EZ3A 2QOIA 3OWPA 3PVWA 3PSDA 1XBAA 1MQ4A 1YHSA 3OG7A 4JDHA 2FA2A 5CAOA 3O23A 3E93A 3EN9A 2C6IA 5D7AA 1BL7A 5LVNA 3KF7A 3KRWA 2QOLA 4S30A 4I6FA 4FKIA 2VTOA 1FVRA 3DNDA 4F1OA 3MS9A 3JVRA 5IKWA 3DA6A 1B38A 5EM7A 3MH1A 4W4VA 5IU2A 4JQEA 5IEYA 3QKMA 3U4UA 4LYNA 3QWJA 2GHMA 5AV0A 1Y6AA 4CGAA 1ZY5A 2HXQA 2VTIA 3KCFA 2YAKA 3AC4A 4PMSA 3ZO1A 2C3IB 4YPDA 3R00A 4KABA 4BTKA 4BYIA 3D83A 5IA4A 2PZPA 5EK7A 4E6QA 3OUKA 5KX8A 3MV5A 3NAXA 3E5AA 4FTAA 3D7TA 3O17A 1I44A 2EU9A 1URWA 1A9UA 5M4CA 3QQKA 4NM7A 5ANJA 1FVVA 4D2WA 2HZ4A 4EK4A 4PNKA 3UGCA 2YERA 1WBSA 4K2RA 1NT2A 2I0HA 2VTHA 2WTCA 3LLAA 5HD4A 4GUEA 4CKRA 4ZS4A 3Q60A 3Q52A 4O2PA 3RJCA 2XIKA 4ALWA 1UU8A 3G6HA 2PMIA 4F63A 3R8VA 4OTRA 1JNKA 4S32A 3RPSA 4PDYA 4QD6A 3FSFA 4E73A 2UZNA 2XYUA 4QRCA 2OXYA 5E8SA 2HW7A 5TE0A 4H3BA 4UMTA 3P0MA 3R1QA 3GQLA 3KL8A 2QKWB 4KS7A 2GSFA 4MWIA 2UZWE 3NIEA 4BDIA 2BR1A 5H3QA 2JAVA 3GU7A 4OTGA 2WOTA 3RPOA 2A4LA 2WZJA 1YKRA 4XP2A 3U6HA 4HGEA 4PL3A 1NVQA 3QBNA 4UX9A 1XO2B 4AU8A 3LQ3A 4EBWA 1DI9A 4PWNA 4CG8A 4A9RA 4U79A 1DAWA 5HESA 2W5AA 3VW6A 1T45A 5HORA 4TYGA 2FSOX 5EH0A 3F3TA 4UBAA 4FTRA 3UIUA 3WE8A 4JI9A 4FZ6A 3BU6A 4WIHA 1H24A 2Q0NA 5L2TA 3O8UA 1CDKA 3CD8A 2BIKB 5KNJA 4JIAA 3GENA 4IM3A 3D7ZA 4DFYA 1H27A 3OTUA 4JL9A 4QNAA 4QPMA 3OY1A 3D2IA 3OTVA 4Y5HA 5AP7A 3E3PA 5I0BA 2ERKA 2Z7SA 3CBLA 3G9LX 4IVAA 4BZOA 5M53A 5IF1A 3P5KA 3BEGA 4FKJA 1ZWSA 2W17A 5IG1A 4BCMA 1SVHA 4EQMA 2XMYA 4BICA 1ZOEA 4KINA 5C8MA 5JKGA 5BYLA 5CF4A 1KUTA 3FLWA 3L9NA 4G6LA 4JXFA 1H08A 1ATPE 4HVIA 4JG8A 3KXXA 4OTIA 4IVDA 1ZMUA 5HD7A 2B9JA 2OJIA 4XG2A 3RKBA 3DV3A 2ZV9A 3HVCA 3MPTA 3CKXA 4KIKA 3CQEA 4DITA 4XMOA 3QRTA 4XX9A 3VRZA 3GB2A 3BHYA 5EM5A 3AC8A 3DCVA 4CT1A 5J1WA 2BROA 4D2TA 3ZOSA 4G2FA 3BQRA 3A7IA 5FWKK 5AP0A 2VWVA 3LJ1A 4JX7A 3QKLA 4C4IA 4MNEB 4ZXTA 2BRNA 3RCJA 4GU9A 2YCQA 4RQVA 1SMHA 4IB1A 2X9EA 4LI5A 1RE8A 2WQNA 1J3HA 1WBVA 3B2WA 2IW6A 4KB8A 1M7QA 2J7TA 4CEGA 3HAMA 3DBQA 4ZSEA 2BZHB 4AE6A 3H0YA 4WRGA 4C2WA 4EOQA 3CEKA 4Z7HA 2R64A 3CTQA 4YZCA 4MXZA 2VWYA 4I0RA 4BR3A 2Q83A 4I94A 2ITVA 2JIVA 3L8SA 2J5FA 4BCNA 4IW0A 3A61A 2O3PA 3HNGA 3VAPA 1WMKA 2WQBA 3BLHA 4FSRA 2JBOA 4O2ZA 3U87A 2VV9A 4WOVA 3REPA 4A9SA 1DM2A 4MHAA 3R9OA 5TOZA 4AT3A 2NO3A 4M68A 5ANEA 3ZLYA 4MNEA 4JLCA 1NW1A 4KKHA 5BYYA 3FKNA 3Q9ZA 3DJ6A 4L43A 4UWYA 4E20A 3CSVA 2IVVA 1ND4A 3G51A 3DOGA 1Z57A 4WG3A 3WZJA 4R3RA 4U45A 4RC2A 3ZBFA 3ZXTA 5LJJA 2Y4PA 5CAVA 1XH9A 3HX4A 3MJ2A 4YHFA 3RMFA 4O7YA 3NW5A 5IQAA 3QUDA 4IX4A 4OT6A 2ZYBA 5L8KA 5CX9A 2Y0AA 1Q24A 2VNYA 4G31A 4PY1A 4D2SA 1IG1A 1TQIA 5CEIA 2WEIA 4AZSA 3LIJA 2JFLA 5DRDA 4V05A 1PYEA 3Q6WA 4BKZA 2DWBA 2ZDTA 2XUUA 3HEGA 2C0TA 3KXHA 4FBXA 4Q5HA 3VN9A 4BCIA 4XV3A 4BCFA 3UOLA 4IFGA 2PVNA 1W84A 2HCKA 4N4SA 4YC3A 4JJRA 1T46A 5HBEA 3R8LA 2X39A 3RVGA 4U44A 2BDWA 2XIXA 3ANQA 2RL5A 2OO8X 1P4FA 3DKGA 1HCKA 3MH3A 4JVGA 4TW9A 2RFSA 3KMMA 5EHYA 4CMUA 2C6EA 4JQ7A 2PVMA 2XEZA 2XBAA 4GYGA 3WZEA 4IQ6A 5IQIA 4BVUA 3QQJA 2X8EA 2UW7A 5L8LA 3ORKA 3LW0A 5E90A 3LMGA 4FTQA 4FSNA 4FIGA 4NM5A 4N70A 2JKKA 4AA0A 1YOJA 3A7JA 3BHTA 4NWMA 4F9WA 2X8DA 3MFTA 4GFOA 3R8PA 1VZOA 4QMQA 3HYHA 1FINA 4UALA 2ZB0A 4O83A 4PL4A 4B7TA 4B8LA 5J9LA 3RBWA 4DTAA 3QZGA 1FQ1B 4U6RA 2ITZA 3C0GA 4C57A 3L9MA 4X6QC 3KN6A 4G3EA 3NNWA 1REJA 2WO6A 3U51A 5HU3A 1TQPA 5KMNA 4AFJA 3DTCA 3EKNA 1K9AA 3IGGA 2C3LA 1KV2A 2B55A 3OOGA 3PPJA 5ETAA 5HO6A 4YP8A 3MI9A 3TV6A 4U81A 2B53A 4BDBA 4HPTE 4RJ3A 3V51A 2WQEA 1XWSA 5E91A 4AS0A 2RFEA 2F4JA 2PMNX 4NU1A 4EOJA 3EL8A 2J0MB 4FV9A 2WTWA 5GNKA 3IONA 5JZNA 4ZSAA 4O6EA 4YJVA 1I09A 4P5QA 3BGQA 2F7XE 3NSZA 4IB3A 5DMZA 4O81A 3TJDA 2GCDA 5A6OA 4GK2A 1QPJA 2JIIA 4LMNA 5BVOA 3HAVA 3IOKA 5E4HA 4M0YA 3EFJA 5CZHA 2V5QA 3COMA 1R0EA 4O91A 5JGBA 2R7IA 4H39A 4RIYA 2I0EA 4NSTA 3VBXA 3GVUA 5HNBA 4C0TA 4G3CA 3LFSA 1K3AA 4L42A 4M97A 4BI2A 3NWWA 1V1KA 3A7GA 2H8HA 2XNMA 3KRRA 4ZTRA 1FBNA 4X2FA 1JKSA 3DDPA 4FKVA 4D4VA 1IA9A 4J96A 1FPUA 4L44A 3UIBA 3F61A 4IC7A 2OG8A 4YO6A 4AXAA 3G9NA 3C4CA 5JSMA 4ZY4A 4FKOA 3ZFYA 3JS2A 3G33A 2W1FA 2W99B 4ACCA 4EH8A 5TO8A 2OZAB 3NW7A 5D10A 4ZTHA 4FT9A 3MGYA 5DYJA 3CJGA 4GJ2A 4DBNA 5EHLA 4XBRA 4DFLA 3DXPA 3NEWA 4L01A 5ANIA 2WKMA 5AR7A 4XH6A 3GOPA 1IAHA 3HDMA 4MK0A 4I5MA 2VX1A 1JPAA 5IUIA 3TXOA 5IDNA 3R30A 3TZ9A 3HDNA 5ACKA 5CU0A 5F9EA 2C1BA 3TN8A 2QQ7A 1HCLA 4ZMFA 3L8PA 2O5KA 2O2UA 4D9UA 5HCYA 3AC5A 4UMUA 4RZVA 3SGCA 4KSQA 5AA8A 2EVAA 1L3RE 3HV6A 3HGKA 1WAKA 4O21A 1W83A 3D2KA 2J50A 3UOJA 1RJBA 3GC0A 4ONAA 3G15A 2OJFE 3FKLA 5CF6A 2BKKA 5GINE 5GIPE 2WTJA 2W9FB 1R1WA 3KU2A 1Q8ZA 4NH1A 4RSSA 4ZSGA 3EFLA 3QHWA 4I93A 3FI2A 3PIXA 3DXQA 1GIJA 2GTNA 3GEQA 4QTAA 1IA8A 4RBLA 5IDPA 5JZJA 2H96A 1KE9A 3ZDUA 3T3VA 3TM0A 1F3MC 3ORMA 4GK4A 4JBQA 4GG5A 2WGJA 2KTYA 1FMKA 3BHHA 3KK9A 4I4FA 3ZZWA 4LL0A 4J99A 2YEXA 3NDMA 2Y4IC 4AZTA 4C33A 1H1SA 4IAYA 3WILA 5CYIA 4CFXA 4BKYA 4CFUA 5FBNC 4BCJA 4MF0A 2X6EA 5HCZA 3JY0A 3N9XA 4UEUA 1YWNA 1L8TA 5F94A 2HAKA 4IWQA 5AAGA 4XV1A 2A1AB 4WBBB 4J97A 4Z9LA 5ICPA 1UKHA 5AV3A 2X1NA 4AW0A 4QO9A 1WFCA 5FXSA 5AR5A 1REKA 4DH8A 4ALUA 3QA0A 3DBEA 5LMKC 1YDTE 2GQGA 2YM5A 3DGKA 3HP5A 4MBJA 1TQMA 1GIIA 2W1ZA 1WVWA 1KSWA 3LCTA 1JVPP 4BI0A 1ZY4A 3BZ3A 3QCYA 5CAPA 4C4FA 1MQBA 4ACMA 2ZJWA 1PXIA 2QR8A 2ZB1A 4JS8A 5IA2A 4IMYA 3A8XA 3LKMA 1H0WA 4BCKA 3FXZA 4IAAA 3PE1A 4BBFA 2VO6A 5HG8A 2IO6A 3ODZX 4GUBA 1E9HA 3VBTA 4Z3VA 3HV7A 3UVPA 1UWHA 1XH4A 4NTSA 5A54A 5M57A 2PTKA 4QTDA 3R83A 4A4OA 2UW0A 3KRJA 4ZTQA 3F5PA 3EQFA 1E1XA 2WMWA 5DRBA 4PPAA 3AG9A 4NKAA 2XBJA 3BGZA 4BIEA 5J8IA 2X2MA 2X0GA 3KF4A 1URCA 2FGIA 2HWOA 4AOTA 1DAYA 5C26A 3ZSIA 4ZY5A 2WMSA 3LCOA 1Y6BA 3WARA 3MIAA 2WMRA 3Q96A 4QQ5A 4EEVA 1CM8A 3Q4UA 5HTIA 4L68A 1DS5A 1F0QA 2V7OA 2QOOA 4FF8A 4IZAA 5DA3A 2BRBA 3KXMA 5HEZA 3RI1A 4YBJA 3CQUA 3SKCA 3VF8A 4FGRA 3LLTA 3FAAA 4NCTA 3D0EA 2CPKE 2GNGA 2O0UA 3GFWA 5HVYA 4U97A 4F7LA 3QRKA 4ERWA 4IWOA 5IEXA 1PXOA 4D9TA 3G0EA 4L3PA 2OF4A 3E7VA 5CSXA 4C59A 3PFQA 3GOKA 5I3OA 3F7WA 3V04A 5JK3A 4E1ZA 1OGUA 2PUUA 4U0IA 5HZNA 4MQ1A 3A4OX 3BU5A 2YN8A 2XNGA 2QD9A 3MN3A 4IWPA 1ZYDA 2VUWA 3C4ZA 2R3OA 4F08A 5LMBA 3OHTA 4M67A 4U5JA 3OF0A 2C6LA 5IA3A 5FTOA 4YLLA 3UC3A 4NM3A 5FRIA 2OSCA 3PA5A 3GBZA 4J8MA 3MA6A 4R5YA 2Y6OA 4O0XA 3SRVB 3DNEA 3WI6A 4PPBA 1ZYCA 5A6NA 3QGYA 2JDRA 3FZPA 4QQJA 1YI3A 5CVHA 3O51A 4M13A 5F1ZA 5HX8A 3QUPA 3DK3A 4DAWA 4FA2A 4FTUA 1R78A 3MYGA 5HNIX 1BL6A 4X7QA 2VGOA 5HCXA 4YJNA 1YXTA 4QMPA 2IVTA 3P1AA 1OM1A 3NPCA 4EJ7A 2BRGA 4YZMA 2CCHA 3TIZA 2E9OA 5FEQA 3PXZA 5EYDA 4PTEA 2CGVA 3KRXA 2CJMA 2W1CA 4PX6A 4FG8A 2HY81 5CU6A 3NAYA 3KKVA 3PUPA 2WXVA 3RNYA 4LMUA 1TKIA 3FMNA 2CKPA 1GIHA 4WG5A 5FLFA 4OGRA 4O0WA 2H34A 2QO2A 4KKGA 4CLIA 1UA2A 4O7SA 4BBMA 3B8QA 2SRCA 3NNUA 4AOIA 3WF7A 1J7LA 2Y7JA 4FZ7A 2C6OA 4FIEA 2XK3A 1OIQA 4D58A 1J1BA 4QP8A 4DEHA 2BHHA 3V5PA 3R9RA 3BIZA 3GCUA 4X3JA 5AADA 4ANSA 3LHJA 3QCXA 3TKHA 3QD3A 3I79A 4UN0C 3UO4A 5KMKA 4FKGA 3RCDA 4RLLA 4GS6A 1VYZA 3SD0A 4C4HA 3BLRA 1YWVA 3PXQA 4D5HA 3QQLA 3TZ7A 5CF8A 4EYJA 2OXXA 3UJGA 4OBQA 4OAUC 4FE2A 4XRLA 3GCQA 4J52A 4ERKA 4JNWA 2C3KA 3C4WA 2R0IA 3RZBA 3ELJA 2W9ZB 3QQHA 2XK8A 4BWXA 2ZVAA 3MPAA 4R3PA 3VO3A 4ZJVA 2VO7A 3MVLA 4RJ8A 3V5WA 4HOKA 4GEOA 4BDKA 3V5JA 4BZNA 4JRVA 3ZSHA 5A9UA 4LL5A 4BYJA 5EI8A 3NYOA 3ZEWA 4RMZA 3CTHA 5AUYA 2I6LA 3OOMA 2C3JA 4L45A 3WYYA 1AQ1A 4AA4A 3MB6A 4UWBA 5E8XA 2OJJA 3QCQA 4GH2A 4WUAA 5EW3A 1H4LA 3HKOA 4GW8A 2UZOA 5J7HA 4YSMA 1PKDA 4H58A 4IWDA 4JQ8A 3LFEA 4C4JA 4FT5A 4U80A 5EI2A 5BMMA 4KA3A 4A4LA 1BLXA 4ANOA 4BDFA 1O6YA 2BALA 2J6MA 2B9HA 2EB2A 5ANOA 1ERKA 2YWPA 5DI1A 4LG4A 4RWIA 1YW2A 4MXCA 5J9YA 1O6KA 5HX6A 4HYUA 2YITA 5JT2A 3DFCB 3F5XA 2XNEA 3CY2A 3AMBA 1M2QA 4R5SA 5IZFA 4HVHA 4PF4A 3CPCA 4HW7A 2XCHA 5AEPA 2I7QA 2BTSA 5EDQA 2YZLA 3W2OA 3BU3A 3H30A 5GZ8A 4RA5A 3OBGA 4NJ3A 4FSWA 4FZFB 3SG8A 1JOWB 3ALOA 5BUJA 4ASDA 3BWFA 4IH8A 3D5XA 4FKQA 2GPHA 3WBLA 4NFMA 3TT0A 5A14A 3BKBA 3CXWA 2LGCA 1R0PA 3Q5IA 4EC9A 4MX9A 3PPKA 2J9MA 3EZRA 3F9NA 4QYFA 4A06A 4F09A 2BFXA 4AW2A 4IANA 3G5DA 4JDJA 3FEGA 3C4XA 2GNJA 2UZBA 3EQGA 3QTUA 3PY0A 3VS5A 3LCKA 4DHFA 4DC2A 4ENYA 3VBVA 5A4QA 4YJPA 5ANDA 3IOPA 5AR2A 3FLYA 4HCUA 3QTIA 2C0OA 4Q2AA 2GNIA 4C58A 4CRLA 3MBLA 2JLDA 3FMJA 3FV8A 3Q9XA 4FEQA 2HYYA 5LMKA 1BUHA 5BVNA 1Q3WA 1ZOHA 5H8BA 1PXLA 5DR9A 3C5IA 3ZONA 4UY9A 4RX8A 2Q0BA 4G9CA 1Y91A 5EKOA 3R7VA 4AP7A 5GJFA 1H1PA 4L8MA 3EQPA 3BRBA 3E3BX 3OWLA 3TACA 3U4WA 3ZO2A 3TUBA 3IDPA 4RJ7A 3CPBA 3DS6A 4I22A 3FLZA 1Y57A 4ZSLA 3FMKA 2WB8A 5GIOE 3FPMA 2J4ZA 3LXLA 3OW4A 4HZRA 5ETIA 2P55A 3VNTA 4A9UA 3GU4A 2WQMA 2BKZA 5L4QA 1QPDA 2IVSA 4C3RA 5IA0A 1QMZA 3EYGA 4EOPA 3KMWA 4FT3A 4FNWA 4E6DA 5JQ8A 2J51A 4ZZNA 4FKRA 3TDVA 2A0CX 2PY3A 1JSTA 4CYJA 3DBDA 4QMVA 3TIYA 3MFUA 4I41A 5AAEA 3SW7A 4RWLA 2HENA 2GFCA 3S95A 5AUTA 2JAMA 4EK8A 3MY5A 1ZOGA 2YIWA 4DG2E 5J1VA 1OKWA 2JC6A 1QCFA 3DU8A 3OT3A 4PDPA 4RFYA 4C02A 5BUEA 5M55A 2XM9A 3W8QA 4ZTLA 4EH2A 1ZXEA 4W9XA 3OCSA 3WZKA 2V22A 5JFSA 4FTMA 4HVSA 4EORA 2XS0A 2BHEA 4AA5A 3HECA 3FI8A 3CLYA 4E5WA 4ZS0A 4R7BA 4OBPA 3QGWA 4FNXA 2R3LA 2VTAA 3VHEA 3QXPA 3VW8A 3P78A 1G3NA 3OEFX 1J91A 2QOQA 5EYCA 4D1XA 3BYVA 3DAEA 2QU5A 4BKJA 4FK3A 3PRFA 1WBWA 5KKRB 2W5BA 3R1YA 4EQUA 4RG0A 5D7VA 4N6YA 4Y72A 2JIUA 2XIYA
chains in the Genus database with same CATH superfamily
5A46A 3VS4A 1VYWA 4FT7A 1Y8YA 1XH6A 4TN6A 4GKHA 5LVOA 4I23A 4LOQA 4YURA 5IPJA 3BI6A 5I9XA 2QONA 2YJRA 2W06A 2Z7QA 2E2BA 2J0JA 2WTIA 2YIYA 5HG9A 2IJMA 3TTJA 5K9IA 5KBQA 3N4TA 1V0PA 4FTLA 4HYHA 2BILB 3THBA 3UIMA 5J5TA 2G2HA 1UNGA 1H01A 3EYHA 4OR5A 1OPKA 4NIFB 1CKJA 3FMLA 3ZTXA 5C03A 3F2NA 5CS6A 4CSVA 2FSTX 1GY3A 5HI2A 3VUIA 1MRVA 3ROCA 4FMQA 2F57A 4O4DA 4ZZMA 2P3GX 3W2PA 2UZLA 2OU7A 1KOBA 2CHLA 2VWBA 4YJTA 3NLBA 5FXRA 1CKIA 2JEDA 4F1MA 4KSPA 1JLUE 2CKQA 1YI4A 3OC1A 4NJDA 4RVMA 3KC3A 4AFEA 1DI8A 1EH4A 2R7BA 3BE2A 4IZ5A 3R8UA 1W82A 5DHJA 5HLPA 2C5VA 2O64A 4I0SA 4MEDA 4H36A 4ASEA 1H0VA 5E1EA 3V8SA 4HCTA 4BN1A 2ZM3A 2VO0A 5E8TA 4ZSJA 3G2FA 4B99A 4MXOA 4CMTA 3QZIA 4BRXA 3M11A 4OTDA 4UMQA 4AGUA 3LMIA 3CQWA 4AN3A 5HU9A 2P2HA 2JD5A 4ASZA 5IQCA 4M7IA 4RX5A 2C6DA 1JQHA 4W9WA 3LE6A 3HL7A 5AV1A 5BX0A 3DJ7A 2RG5A 5HIDA 1QPEA 3PRIA 3DY7A 3KULA 4QYEA 2X81A 4DG0E 4LRKA 4BF2A 5DLSA 3W0SA 3BPRA 1PXPA 1PW2A 4FTNA 4KAOA 2OIDA 4HNFA 4HGLA 1G8AA 2WD1A 3QTZA 4IADA 4CCUA 4EHGA 1SM2A 4L52A 4EH3A 4BDEA 4BTMA 5KMLA 4TRLA 2GNLA 3SOCA 3C7QA 3VBQA 5KO1A 3ZC6A 2BAQA 3MFRA 2YM8A 2XA4A 3M42A 3QTXA 3R63A 3ZBXA 4AZVA 4AZEA 3CCNA 4HYIA 4XG6A 2X9FA 3PA3A 4YTFA 4GT3A 3TNIA 4A9TA 4ANQA 4NIFA 3AC2A 1H00A 2WNTA 4TXCA 5BMSA 3SXSA 4QPAA 4RVTA 4KBCA 3W0RA 2HELA 3D4QA 4IAIA 4L6QA 1PMEA 3MH0A 4HZSA 4EH9A 1Q5KA 3VRYA 4FV4A 3W55A 2PVJA 4M8TA 5E92A 4EOOA 3D5UA 4ZK5A 3L9LA 4YUQA 4FV3A 3KGAA 2X0QA 4DEGA 2VTTA 1R3CA 3Q32A 3P23A 5LMAA 3QLFA 3UZTA 1B39A 2XVDA 5EQEA 3GUBA 3R01A 5AFVA 5A4EA 2CMWA 3QALE 5T3QA 3RTPA 3NRMA 2Z7LA 1U54B 4FNYA 4KS8A 4CMOA 4BCQA 5HBHA 4CV8A 2YWVA 4DEDA 3PVGA 2QOHA 3ZRKA 3FBVA 2X6DA 3C50A 1KOAA 3O7LB 4YZNA 3RK7A 4BFMA 4JR7A 4G5JA 2A27A 2Y4IB 2EXEA 2HOGA 5AM6A 4CRSA 4E5AX 3EN6A 4J98A 2BUJA 4ZP5A 2PK9A 3BE9A 4BDHA 1IRKA 3OFMA 4IE9A 3EZVA 4G5PA 3R9DA 3Q5ZA 3RAKA 3F3ZA 4EOSA 3RGFA 3UC4A 3ZUVA 3A8WA 2J0LA 4MD9E 4NK9A 1P4OA 4CV9A 2J0IA 5A4LA 5JEBA 5DEYA 3IDBA 4C36A 3ENHA 1H1QA 3OT8A 3QTWA 3EHAA 3MJ1A 4YJUA 5IA1A 3ZRLA 2ITXA 4WRSA 4AW1A 3WE4A 2WMUA 4D2PA 2PVYA 4F9AA 4C3FA 3F82A 2F7ZE 2VO3A 5H9BA 1BI8A 4QPSA 2YLFA 4O6LA 2XNOA 2PVFA 3P7AA 4RFMA 5FTQA 3FC1X 3GC9A 5TF9A 1YWRA 3GCPA 1X8BA 5L2WA 4QTEA 2BZJA 2B0QA 3UPXA 2IWIA 1OUKA 3E87A 2R3NA 4EHVA 2JFMA 1YXVA 4FVQA 3HP2A 4YHTA 3PXKA 5CLPA 1W8CA 1Q8UA 3F69A 3GU5A 4PUZA 4JT3A 1SNXA 4FODA 5CENA 5CALA 4PL5A 2A2AA 4YJOA 3TZMA 2UW6A 3UZRA 3RALA 4IACA 5CU2A 2ESMA 3UQCA 3ZS5A 3F7ZA 1KE5A 3QXOA 3NUAA 3FZ1A 3U9NA 3R0TA 4M0ZA 5DIAA 3UNZA 4YLKA 2W1EA 4F1TA 2FH9A 3F5UA 4QMLA 5D9HA 4ITJA 4RIYB 3RHKA 4CYIA 4BIBA 2BRHA 3DKOA 3N4UA 3UDZA 3PJ3A 3QA8A 3OWKA 2E9UA 5FP5A 2V62A 3ZSGA 1Y8GA 4AT5A 4S33A 4CT2A 1UWJA 2QHMA 3QTRA 1ZRZA 4J53A 5AAFA 3W0NA 2RGPA 1YDRE 2PSQA 2HXLA 3A99A 4N0SA 3B2TA 1YXUA 3I81A 2UVYA 3JPVA 3MPMA 3RHXA 3W2QA 2HK5A 3D5WA 4L9IA 4GT4A 1A48A 1F5QA 1ZYJA 4BGQA 2YM7A 2GNHA 5KBRA 4APCA 3QQFA 3FXWA 5J95A 4LGGA 2EUFB 2XJ2A 4C3PA 4ZTNA 4PMTA 4XEYA 3OEZA 3ZM9A 5BNJA 4P4CA 2RFNA 4OTQA 5D1JA 3VUKA 4N57A 4LUEA 3JXWA 4USFA 3PJCA 3EQRA 4G1WA 2J0KA 2XRUA 3A2CA 2OI4X 1JWHA 3K3JA 4EL9A 4FEVA 3R22A 4O7RA 1OIRA 1JKLA 2XNPA 2V7AA 4J1RA 4FUYA 4D4SA 4GFGA 2CCIA 3AT3A 4IBMA 3QTSA 4ITHA 4MBLA 3W18A 3BL9A 4XBUA 4OTWA 5AP6A 1H8FA 4RX9A 5KMOA 4HNIA 3HV3A 4XG9A 3N4VA 4YC8A 3OP5A 3PXRA 2NNWB 1B6CB 1GJOA 3WF9A 2OH4A 3MTLA 4FSZA 5E8VA 5J87A 4F9YA 3VUHA 1UU9A 3FDNA 4JX3A 4WHZA 3KCKA 4DDGA 3IW6A 2YCFA 3AC1A 4E4LA 2XANA 4F6WA 2RF9A 4ENXA 3LVPA 3P5JC 3NYVA 4FL2A 4QMSA 2QURA 4R1VA 5EM6A 2DS1A 2XJ1A 3C9WA 4X0MA 3TYKA 4R6VA 2QO7A 3H4JA 4NUSA 3F88A 4O0UA 4W8EA 1YI6A 5AP1A 4ANMA 3QCSA 4KD1A 4OTHA 4ORKA 2QOCA 3E7OA 4U42A 4GK3A 1OIUA 3SXFA 3ET7A 5E1SA 3PYYA 1XMLA 4RIWA 1NY3A 1P5EA 4GIIA 4N6ZA 2OH0E 3OUNB 5EQYA 5EDPA 3UTOA 3R04A 3PY1A 4Y85A 2CN5A 3R7GA 4MWHA 4QYYA 3R2YA 1KWPA 2GDOA 2WMBA 2FO0A 3DB8A 3DKCA 4NT4A 5C9CA 5L2SA 1RDQE 5BVWA 3KK8A 3A4PA 4OW8A 2ETMA 4RVKA 2IZRA 5HVJA 2QOBA 4DTKA 2BAJA 5LCJA 4C4EA 3TUCA 4HPUE 1O9UA 4I6QA 4QMUA 4X2JA 2IW9A 3GU6A 3UNJA 4A4XA 4RJ6A 3FJQE 2UVXA 3PXFA 3O8TA 4O0SA 3POOA 1FMOE 2JDSA 5JMSA 2GU8A 4EJNA 5FTGA 5EM8A 3PG3A 4IX3A 3FMHA 2UW3A 3QD0A 5HQ0A 5CXHA 3EQBA 4Q5EA 2B1PA 2KULA 3NGAA 5FXQA 1P14A 4XLIA 3TV4A 1V0OA 4CZYB 1K2PA 1JSVA 2OZOA 4L7FA 3SVVA 4U7ZA 4QMZA 4EUUA 1GAGA 3C13A 4ZMEA 4DH3A 5AR3A 3RAHA 4QEBA 1M17A 3CJFA 3QX2A 4X2GA 3B8RA 5IA5A 5JQ5A 2XRWA 4CXAA 2GHLA 4IAFA 2RG6A 1CSNA 5AR8A 5EYKA 4KWPA 3NYXA 3NVKI 4BJJA 3OROA 4G16A 5T6KA 4D1ZA 3FZSA 3U55A 2XEYA 5M08A 2VN9A 4FICA 4YNOA 3WIGA 4MQ2A 4C34A 4AG8A 3OMVA 3UDBA 5LWMA 5E8YA 3UO6A 3S0OA 3IO7A 1U59A 4RX7A 3PY3A 4B4LA 4K77A 4WA9A 5CSHA 2GHGA 2J2IB 3EN7A 3P7CA 3QAME 2HW6A 3RM6A 3GQIA 4IJ9A 3VF9A 4EH6A 2ITQA 2X0OA 3BWJA 2WIPA 4FTKA 2OWBA 3F2AA 3T9TA 3SC1A 3DBCA 4FKLA 1UNLA 3QWKA 3OXZA 4FL3A 4FTIA 4PDOA 2W1HA 3LCSA 5H2UA 4W8DA 3ZZEA 3U6JA 4MKCA 4NYEA 3S1HA 2X7FA 2R3GA 4JBVA 2JBPA 3T3UA 4I24A 4DF3A 4F65A 2PPQA 2XK6A 4IDTA 5GJDA 2G01A 2NRYA 3O96A 4JRNA 4ZJJA 4A07A 4D5KA 3CP9A 3HUCA 5TT7A 4EOKA 5C8NA 3SRVA 2ERZE 1OITA 3NMUF 4NTTA 5C01A 4EK6A 1PMNA 2PE2A 4PPCA 1KE7A 1PF8A 4JR3A 4JBPA 2VX0A 4RIOA 2R3QA 3HRBA 3IK3A 5BQ0A 4PP9A 4E6AA 5I9VA 4DGGA 3D94A 3FXXA 2VU3A 3ZLXA 4CKIA 2C1AA 4OUCA 4DGMA 5HG5A 5KMIA 3QL8A 4YZDA 2X7OA 1MRUA 3C51A 3QC9A 4II5A 3FHIA 3Q2JA 4RJ5A 4HGTA 4TTHB 3UMWA 5D41A 4O22A 5AUZA 5I9UA 2OFUA 2JITA 3LJ2A 3UP2A 1PKGA 1J7IA 3CGOA 2CNUA 4L00A 5AUVA 5DPVA 3ZCLA 4O7WA 4O96A 2P0CA 3BYSA 4C8BA 4DEBA 5CXZA 4IEBA 3K5UA 3EH9A 2NPQA 2XZSA 5L6PA 3SDJA 4GKIA 5DE2A 4ZTMA 5CT0A 4DH7A 3FHRA 3AD6A 4ASXA 2W4JA 2CLXA 3FMMA 4KIKB 4QYHA 4V01A 2G15A 4FVPA 1GZ8A 5D12A 4ALVA 4DEAA 3UDTA 4KIQA 1TZDA 4IAZA 4LRJA 1SVEA 3PIYA 2R4BA 2AC3A 4X3FB 2W7XA 3FZRA 1SNUA 4MXAA 5AJQA 4FG9A 3E8NA 2W96B 3EQDA 4TWPA 2X8IA 5LARA 2AYPA 3Q4ZA 2RSVA 2CGUA 3KVXA 4PTGA 2FSMX 3UYSA 1LUFA 4CNHA 5K4IA 4MF1A 3O8PA 3P86A 5HLNA 3AGLA 3PJ1A 4XP3A 2QOFA 5CASA 2WTVA 2XALA 4APPA 4CKJA 3ZFMA 1ZMWA 4V04A 4EK3A 4J71A 2YDKA 4K33A 4K11A 4U3ZA 4TNBA 4E5BA 5EYMA 1VEBA 2A19B 5IQEA 1LPUA 1YQJA 4FV5A 3DK7A 3ZMMA 4BCPA 4DFNA 1Q4LA 4M14A 5H8EA 4L46A 3ZM4A 4E26A 2WMAA 4FSMA 4J7BA 2O8YA 5JRSA 5KE0A 4XOZA 2VTMA 3RK9A 1Q99A 3V6SA 5C1QB 5M56A 2FYSA 2PHKA 4XV9A 5A3XA 4B6LA 2YJSA 4ZOGA 4EI4A 4DCAA 3PPZA 4C61A 3R28A 5IQHA 4TPTA 2PVKA 3KA0A 5AV4A 3UOKA 4XLVA 4FIIA 3SAYA 3WOWA 3IECA 4YZBA 3R7UA 4BY9E 4E3CA 4ZTSA 4E8AA 2OICA 5CF5A 4X3FA 2R9SA 2Y9QA 5J79A 4FTCA 4I4EA 5BVKA 1KV1A 1MUOA 3OZ6A 1OKVA 4FSYA 3K3IA 3O71A 3RK5A 4E4NA 1BMKA 3HMIA 5IQBA 2JKMA 3PFYA 3H3CA 3C0IA 3QLGA 4EKKA 3MESA 4L3JA 2XKCA 4AF3A 2IN6A 3ERKA 4R8QA 4OBOA 2WTKB 4QYGA 5ETCA 4QMMA 4Y73A 3PG1A 3W32A 2ITUA 4XP0A 4AACA 1PXNA 4AGDA 2OGVA 4C7TA 3U6IA 2PVRA 4FK6A 4G3DA 4F6UA 4IZ7A 3LZBA 3AT2A 3ZYAA 5HBJA 5C8KA 3MA3A 1R39A 4MAOA 5KUPA 4EOIA 2YCSA 4WSYA 3PIZA 4NM0A 2AUHA 3DTWA 3ITZA 4BHNA 2BFYA 2CLQA 3FL5A 3A62A 2AC5A 3AQVA 3GCSA 4O0YA 4FVRA 5FGKA 2VWWA 5CAQA 4WSQA 2EXMA 3LFBA 2XYNA 3COHA 3CE3A 3FLNC 2C6KA 3VQHA 2C5NA 5HTCA 3H0ZA 1H07A 4RJ4A 1WCCA 4TYHA 4Y95A 4MVFA 5E8WA 2QOKA 2UZEA 3T8OA 4EZ5A 5LVPA 4IJPA 1RQQA 5AMNA 3T9IA 4K8AA 3IW8A 2XJ0A 4IB5A 1CKPA 3MIYA 4I3ZA 3NIZA 3CGFA 3COIA 2P33A 3PSBA 2C4GA 2XIZA 3PZEA 3UBDA 4BDGA 1M2PA 2WEVA 4U3YA 4W4YA 2B7AA 3AD4A 5EW8A 4A7CA 4QMNA 4L53A 4PV0A 4XV2A 2G1TA 3G0FA 4AT4A 2ITYA 3IG7A 2J5EA 3RPRA 4WNOA 4ZAUA 1XJDA 2I1MA 4Z55A 1BKXA 1E1VA 2F2CB 2Z2WA 2ETKA 5AP2A 1J7UA 4GMYA 4Y8DA 3HV5A 3ZXZA 5B2LA 2B4SB 1XBBA 3H9RA 4Y5QA 4FV7A 3GGFA 3HA8A 4IHPA 2P4IA 5AV2A 1ZZLA 2C69A 4WT6A 5CSVA 1Q41A 2VRXA 4NCTC 5L8JA 2IEWA 4YBKA 3WF5A 3ZH8A 4AAAA 4F0IA 4KKEA 4F7NA 4F70A 5B0XA 1XKKA 1W98A 5CI7A 3KXGA 3UOHA 5L6OA 2VX3A 4FSUA 4F99A 3Q53A 4FOBA 4QTCA 5TKDA 2WU7A 3KMUA 2C6MA 3FLSA 4FIFA 4YPSA 2R3JA 4LRMA 4AE9A 4ARKA 3TJCA 3JVSA 3R7OA 3VHKA 2R3IA 2HWPA 5GZ9A 3A60A 3KRLA 2P2IA 3NCGA 3EKKA 3W8LA 4UZHA 2YM6A 4ZY6A 2YIQA 4XG7A 3DQXA 5GHVA 3PLSA 3P9JA 2WQOA 5HO8A 4AZFA 2FSLX 4XYFA 3DJ5A 2UW8A 4EOLA 4PP7A 3AOXA 3K54A 4W4XA 4O38A 1H26A 2BZKB 2WIHA 3MTFA 4R7HA 2IPXA 2Y8OA 4CLJA 3BBTB 1SYKA 4RWKA 1SVGA 3F66A 3MDYA 4AUAA 2X2LA 3SXRA 3PTGA 1YXXA 4IM0A 4FG7A 3R6XA 5LCKA 2GMXA 3H9OA 5DT3A 2B52A 2HZNA 2Z7RA 5L6WL 2CNVA 5BPYA 1H28A 1IEPA 2X4ZA 3GNIB 3ATTA 1OZ1A 5AR4A 5CWZA 5IQFA 3L9PA 5HG7A 4BIDA 1H1RA 4AGWA 4G9RA 2YA9A 3KXZA 4E4XA 3TKIA 5EDRA 3I7CA 1BX6A 3NUNA 3E88A 3LCDA 4BL1A 4DN5A 3ID6C 1OL2A 2ITWA 1UNHA 4YTHA 2JDVA 3DB6A 3BHUA 1OUYA 5CZIA 3S3IA 3AMYA 3DQWA 2ONLA 2R2PA 3DFAA 4YO4A 2WMQA 2ETRA 3H9FA 5DOSA 3E92A 3IW4A 3O2MA 2GS2A 5F95A 2W1IA 3MWUA 3QKKA 1Q8TA 1OBGA 2R3PA 2G9XA 3HRCA 2I40A 2RFDA 3VS2A 1ZARA 2VTNA 5HIEA 4TYIA 1U5RA 4DLIA 4XHKB 2I0YA 3EQCA 3VVHA 4FTJA 3ZEPA 4DFXE 4QNYA 4LV5A 5GJGA 4H3QA 5AUXA 3NFFB 4DG3E 1Q61A 4RRVA 3QU0A 3AKJA 3OVVA 3D15A 3EMGA 4IVCA 3VS7A 5AP3A 1XH8A 4AX8A 1YHVA 3UE4A 3ORPA 4J95A 4RWJA 3Q9YA 2QG7A 3BCEA 4FV6A 3LFDA 4WKQA 1PYXA 4MXYA 4PMPA 4H1JA 4BDJA 5FEEA 4CG9A 1JAMA 3E8EA 3C1XA 3RPVA 3DBFA 4GL9A 3F2RA 5CEQA 4FEXA 3E8CA 4K6ZA 2YISA 4BHZA 5FP6A 2BDFA 3VQUA 3AXWA 4DFBA 4IDVA 5JGDA 3WF8A 4JAIA 4JMQA 3KULB 5AIKA 3TUDA 1V0BA 1YVJA 3JUHA 4I92A 2XNNA 4QP2A 4AGCA 1S9JA 3FI4A 3KXNA 1NXKA 4FKSA 4M69B 4I1ZA 2B54A 4YC6A 3TI1A 3TZ8A 1WVXA 1OPLA 4GV1A 4HCVA 4CQGA 4RVLA 4Q9ZA 2Z02A 4EBVA 3DAKA 3BHVA 3EFKA 3EQIA 2HZIA 3V5LA 4IAKA 4O7VA 3SV0A 1Z5MA 3NX8A 2WFYA 3R7YA 3PSCA 3VUMA 5HTBA 3QTQA 3F3UA 5H8GA 4DYMA 4XUFA 2ITOA 3MVHA 4QP7A 2WTKC 3MY1A 3ROYA 4EWHA 5ANKA 3RWPA 3Q4TA 4FL1A 3TWJA 1M7NA 3BYOA 3LJ0A 3OBJA 4FV2A 3GFEA 3ZRMA 1OL1A 2ITNA 1XR1A 1G8SA 5EFQA 5DFPA 1Q3DA 2VNWA 3OY3A 4QP4A 2ZMCA 3F6XA 1W2DA 3HA6A 3IS5A 3P79A 4UXQA 5HHWA 4U40A 3R7EA 2OJGA 3OCBA 3ZDIA 5I9ZA 5K0XA 1YHWA 2BDJA 2G2FA 2O65A 3HLLA 4NZWB 4FIHA 5CI6A 3VONA 4EZ7A 5B2MA 4PQNA 1OGYA 4PMMA 4BWKA 4EONA 3BX5A 4O86A 3R9NA 2PUNA 5M51A 4GCJA 3BELA 3R21A 5CT7A 4ACDA 5JFWA 4NL0A 2RKUA 3FI3A 3LAUA 4D0XA 1H25A 4V0GA 3EB0A 4CTCA 5IEVA 2OBJA 4D2RA 4Z16A 2UZDA 1ZYLA 2UUEA 3UQGA 4F0GA 2GNFA 2PMOX 2JGZA 4JDIA 3GI3A 4NW5A 4RC4A 5BVFA 4P7EA 5CQUA 3TKUA 2PUIA 4QDVA 4QOXA 4C35A 1M14A 3CKWA 3P7BA 4QMOA 4QMWA 3BQCA 4BCGA 3KREA 3MY0A 1M2RA 3FYJX 4XJ0A 2WAJA 4I6BA 2C5YA 1OPJA 2VGPA 3I0OA 4RA4A 5EI6A 3HUBA 4IZYA 5DEWA 4RQKA 3UIXA 5CEPA 1MP8A 5LVLA 3O50A 3O5AA 4MBIA 1SZMA 3WYXA 5FUTA 4DDIA 2C30A 3TNWA 2YDIA 2GQRA 2XCKA 3SQQA 5CSWA 4AWIA 4USEA 4FI1A 5CEOA 2R3FA 3BV2A 4EH4A 3E63A 2R3KA 4FV1A 5IQDA 4FNZA 5CU4A 4DFUA 2OW3A 4KRDA 4YJQA 2BTRA 4XOYA 2GFSA 3QUEA 3EOCA 4GU6A 2V55A 4KBKA 4WNMA 4CVAA 5IUHA 4EC8A 4YJRA 4L7SA 4EQCA 1GZOA 3JYAA 5EOLA 3VJOA 2BCJA 2PE1A 2VTLA 3LFAA 4FV8A 4O1OA 1JKKA 4DEIA 4F9CA 3RNIA 3LFCA 3VUGA 5CAUA 3IGOA 3PJ2A 4FKPA 5IMXA 2CGXA 3R7IA 3A7HA 2XM8A 5HLWA 2WOUA 1CMKE 1OL6A 1P2AA 2OKRA 4QP1A 4DCEA 4BBEA 2Z8CA 5HE3A 3I1AA 4EOMA 3QRJA 2VTPA 5KKRC 3D7TB 3P4KA 3BV3A 5KHWA 1G8JA 4GG7A 4S34A 4O84A 1S9IA 3ACKA 4GFMA 2CSNA 3TG1A 1WBTA 1YDSE 5BVEA 4M69A 3NYNA 4A9YA 4DFZE 3QHRA 5IQGA 4NEUA 2ZV8A 4DTBA 1AGWA 4O0RA 4TWOA 4C62A 4TYHB 2XKEA 1PJKA 2W05A 2YABA 3OWJA 3PDTA 2YM4A 1ZAOA 3ML1A 4AXDA 2ZDUA 4F6SA 3PXYA 4K9YA 4FSQA 4H1MA 4R78A 4RC3A 5E7RA 5L3AA 5M06A 3R02A 2CDZA 4X21A 4J8NA 4F4PA 2FB8A 2R0UA 4WNKA 3MH2A 4GJ3A 4UYAA 5HE1A 4BCOA 5M4IA 1IAJA 5B7VA 1FOTA 2C5XA 2QG5A 3RINA 3W10A 5BYZA 3I6UA 3TTIA 4XNEA 4QT1A 1BI7A 3NS9A 2C68A 2QCSA 3TNQB 3KB7A 1RW8A 5HOAA 5L2IA 4YTIA 2XP2A 5KMJA 3Q3BA 2UZVA 4IX6A 4UV0A 3UNKA 3TNHA 3HMPA 2R3RA 2XKFA 1WZYA 2W1DA 4FKWA 3UP7A 4BWPA 3HV4A 3I0QA 4ITIA 4JG7A 4WG4A 5EW9A 3BLAA 5ACBC 3Q4CA 3BYUA 2YAAA 3CD3A 1A06A 3A7FA 4BGHA 4U43A 4BTJA 4F0FA 4Z7GA 3RWQA 5HVKA 4LOPA 4RIXB 2OZAA 3VS3A 4ZLOA 3LFFA 4LQMA 3O7LD 4XG4A 4LUDA 4P2KA 5EQPA 3C5UA 3DLZA 3EIDA 3FSKA 4MYGA 4FZAB 4EUTA 3ORTA 4YR8A 3G90X 1GOLA 4JIKA 4BDAA 2UW4A 3NVMB 3NUXA 3HMOA 4C2VA 4X2NA 3NUSA 4JOAA 2W1GA 3FYKX 4D0WA 5AUUA 2OIBA 2QNJA 4MH7A 5JFXA 3NW6A 5CU3A 4AQCA 3HMMA 4IC8A 4ZLYA 3BYMA 5CY3A 4MCVA 3C4FA 5AM7A 3W2SA 3Q9WA 5T68A 3DKFA 1Z9XA 4I21A 3P08A 3FLQA 3WZUA 3HZTA 4IFCA 4O4FA 3ZLWA 3L1SA 4KUJA 4O7NA 5HO7A 1PHKA 3ENMA 4AW5A 1UVRA 4Y46A 2GS7A 2XH5A 3PP1A 1Q8WA 2ZAZA 3W0PA 2C0IA 2W4KA 4KNBA 5IH6A 3UO5A 3R73A 4QMTA 4PNIA 3ORLA 3ULIA 4U9AA 5HNGA 4CQEA 3V6RA 5EG3A 4TT7A 3V8WA 3EWHA 3NUUA 5FM3A 5G6VA 2VD5A 3PWDA 4K0YA 3IW7A 3NUPA 2BPMA 5G1XA 4BDCA 5J5SA 2XKDA 2WMTA 3I4BA 5LVMA 4WD5A 2C6TA 3ORNA 3FC2A 4B8MA 3NNXA 1PY5A 4DH5A 3AKLA 4HYSA 4BGGA 5BV3A 4ZLZA 3VS0A 4F64A 2R3HA 5F4NA 2DYLA 1FVTA 1NVRA 4D55A 4H05A 4USDA 4QP6A 5CEMA 2PZYA 5FDXA 4M66A 4MD8E 4QMXA 3RAIA 3U8WA 2PU8A 4GIHA 4WUNA 3ZHPC 5AP4A 1GNGA 3PZHA 2R3MA 3JY9A 4K18A 3VUTA 3JR1A 3LQ5A 3E62A 3PE2A 4FOCA 5ITAA 4KIPA 2XNBA 4DA5A 2EWAA 4YGAA 5IMEA 3UQFA 1Q97A 3QQGA 2REIA 2LAVA 1O6LA 3VUDA 3FY0A 3LM5A 2ZOQA 5LWNA 4PTCA 5DR6A 1UKIA 4FYOA 2BIYA 3KQ7A 3PLAE 3F3VA 2F2UA 3QZFA 3ZLSA 2WMXA 2F49A 2VZ6A 3UVRA 3KFAA 2HZ0A 5DG5A 3FPQA 3QRUA 5DH3A 4BDDA 3OXIA 1UV5A 2UW9A 2PYWA 5HICA 1WBNA 5K0KA 2F7EE 3Q6UA 3NUYA 5GZAA 1ZLTA 1OIYA 4TY1A 5CTPA 5E8UA 4UXLA 5AWMA 4OTPA 3MW1A 3DDQA 2XK9A 1OKYA 3U9CA 4S31A 3FMEA 1LP4A 4M12A 2F9GA 3R2BA 3VJNA 3W2CA 4E6CA 2QODA 3PVUA 4GVJA 4XG3A 3D9VA 2WMVA 4DLJA 3LXPA 4FRFA 5EOBA 2ZM4A 4O0TA 4U8ZA 4EH5A 1XH5A 5CVFA 4RIXA 4NW6A 4DINA 3VULA 4R7IA 4D4RA 3UODA 4FIJA 3L8VA 4PRJA 5FBOA 3OCTA 1WVYA 2YM3A 4XRJA 3I5NA 3N51A 5DT0A 3WF6A 5J7BA 2WHBA 2IW8A 3AMAA 4DT8A 3OCGA 4FX3A 3QFVA 2J90A 3KVWA 3QRIA 2QKRA 5AIRA 1OL5A 2PVLA 4CFFA 4KIOA 4JBOA 3QYZA 3IKAA 3QD4A 3FE3A 4TZRA 3ACJA 4FSTA 4TKSA 4DGNA 5CVGA 1OVEA 3R1NA 4EHZA 3GXLA 2H9VA 5I5ZA 2WELA 2CKEA 2I0VA 2PUPA 2OJ9A 5CANA 5IH5A 2WPAA 5ETFA 4O82A 4G34A 3HRFA 4LGHA 3RAWA 4S2ZA 4U41A 3ULZA 5DN3A 3CTJA 3CS9A 1MRYA 2CGWA 2X7GA 5M4UA 1ST4A 4NKSA 1OI9A 2OK1A 3IW5A 4OLIA 3DZOA 4YHJA 3ZFXA 2QLQA 1JKTA 3QYWA 4QP9A 4MNFA 2JDTA