1WBOA

Fragment based p38 inhibitors
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
351
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Fragment-Based Lead Discovery Using X-Ray Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wboA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wboA01
3D5UA 3KXGA 3OCTA 5CSPA 4ZEGA 4QP7A 5CXZA 3L9LA 5A46A 2W5BA 2YLFA 4IJ9A 3V5WA 4C3RA 4NW6A 4E6CA 5M4UA 2BALA 5DRDA 1UVRA 1F5QA 5EQPA 5M06A 3RGFA 2WTWA 2YISA 4LRMA 4MXXA 3CR0A 2VTIA 4IB0A 4XRLA 5HNIX 2WU7A 1ZOEA 4YJTA 4IB5A 4UYAA 1RDQE 2VNWA 4FKWA 4AZFA 5AV0A 4XG2A 4EORA 3LFSA 5AUUA 4M14A 4KIKA 3ID6C 4X3FA 2WO6A 3IDPA 1OECA 3D5VA 5F9EA 3SG8A 4DFBA 1T46A 3DBQA 1CKIA 4FV4A 2C6TA 2CKEA 3BGPA 3IS5A 4GFGA 2P4IA 2OZOA 4IFGA 4LG4A 4MK0A 3BZ3A 4YJNA 2QR8A 4GW8A 5G1XA 1L8TA 2HY81 4RBLA 4APPA 2LAVA 2VTSA 2IN6A 5CNNA 3KU2A 1UNLA 3DXNA 3L8XA 3NW7A 1UU7A 4PDOA 1PYEA 4NEUA 3BPRA 2XA4A 1M2QA 4TY1A 1YHVA 4FTCA 4FSWA 3PP0A 4DEGA 4QMZA 3BCEA 5DEYA 2XK4A 3S2PA 3ZUTA 5DT4A 4O1PA 5HCZA 5M08A 1BUHA 3Q2MA 3K3JA 4EOMA 2A1AB 4L68A 4O6EA 4KSQA 2C30A 5HG7A 2GS2A 3F2AA 3AG9A 4BCJA 3P9JA 4DTBA 3DFAA 2RL5A 4FIGA 2PVHA 3MFSA 4QQJA 4QD6A 3QX2A 1AQ1A 3V5QA 4DEAA 4EYMA 4XUFA 4DA5A 4D2RA 2WMSA 4IADA 5A6OA 1OBDA 3PVUA 4TWNA 5T3QA 2E9OA 1ZMWA 1PYXA 3MH0A 2JAVA 2J50A 3MN3A 3OEZA 2W99B 3R9OA 4D5KA 2YEXA 1WAKA 4FGRA 4ZLOA 2C3JA 3QTZA 5F94A 5JFXA 5D12A 4ZSEA 4F9WA 2CMWA 4FV5A 5D11A 2UZUE 3G6HA 4IX4A 5FTQA 5KMMA 4IDTA 1XH8A 3N4TA 2WB8A 4Y73A 1QPCA 4C0TA 4M8TA 3Q52A 4WG4A 3NUNA 2NO3A 1FQ1B 3GOPA 5FTOA 4RX7A 5J1WA 4O0XA 3NW5A 3HRBA 3W2CA 3VS3A 4G31A 1ZYSA 3ORKA 2I0YA 2V55A 4EH7A 3EN6A 3QD2B 4MXYA 3LPBA 4W9WA 1JNKA 4DH8A 3SW7A 3DJ7A 2BZJA 3R28A 3Q04A 2ZV9A 3UYSA 4AZWA 3A7IA 4O38A 4ZP5A 5AV4A 1PXJA 2Z60A 4JXFA 4FSQA 4F9CA 4NFMA 2XKDA 4ASEA 4XLIA 5HCXA 5KHXA 2VTPA 5IZFA 5K5XA 2CNQA 3MWUA 3NUYA 4FTQA 4YZBA 5BVKA 4DEBA 4RJ3A 4FTUA 4F9BA 1BI7A 3ZLSA 5JFWA 3Q9ZA 4B8LA 2GMXA 4RT7A 4D1XA 4RPVA 5CAUA 3OT3A 3FI2A 3FJQE 3CEKA 2YCSA 4O2PA 2YWVA 4O7NA 3QFVA 4M68A 5GJGA 2YN8A 4M97A 4EUUA 4NSTA 5E7RA 4CYJA 2CPKE 3PXYA 3E87A 3I7BA 2XUUA 2QKRA 5M44A 2XNGA 4BCQA 3R1NA 3UGCA 1JOWB 3IGGA 2VWIA 2XYUA 4BCHA 3FQSA 3HP5A 1UV5A 3T3UA 5EQYA 3D4QA 4FIFA 2W4JA 4LGGA 3ENHA 4MKCA 5DT3A 4PDPA 2XIYA 4HVSA 2YM4A 4BY9E 3RAIA 2E9NA 3BQCA 4BF2A 2WTDA 4FVPA 1AGWA 1PKGA 3C4WA 4GJ3A 3ITZA 2GS6A 5KO1A 4TZRA 1PKDA 2GNHA 2BFYA 2GU8A 3R2BA 2Y6MA 2PL0A 5CT7A 3HDMA 3QCQA 1YXTA 3KQ7A 4ZAUA 3KXZA 3JUHA 3OCGA 2V7OA 4WG3A 5FP6A 4DTAA 3ORLA 1JKTA 3HMNA 4LM5A 3ZEWA 1FBNA 4JDKA 4JQ7A 1I44A 2JAMA 1ZY5A 3GCQA 3TKHA 3M42A 5IEYA 4WSQA 3KEXA 3Q6UA 2VTRA 3CS9A 4D1ZA 3EJ1A 3TUCA 3KXHA 4MBLA 3FQHA 1Q3DA 2XIXA 3EZRA 4FOCA 5HZNA 4JRVA 3ZS5A 1PXPA 3QA8A 3TNPC 5HLNA 3WOWA 2YAKA 3OXTA 4RWLA 4TWCA 2YDKA 4XG7A 3DKGA 1OL2A 3GT8A 2W0JA 3QTIA 2QO7A 4MNEB 4RQKA 3UE4A 5DR6A 5I5ZA 4O7YA 4FV7A 3U55A 2HZ0A 1WVWA 4U44A 1FVRA 3UQGA 3R7VA 2IZSA 5AWMA 3R8ZA 3UVRA 3C4FA 2X9FA 3BV2A 2UZVA 3VNTA 2F2CB 4M69A 3BYVA 4I94A 1NT2A 1QPJA 3OOGA 2R3JA 1XWSA 4TXCA 4J8MA 2OXXA 3KRXA 3AGLA 3VS5A 4IH8A 3R01A 2VX1A 4RIOA 5DR9A 3R1QA 2O8YA 5IUIA 4F65A 2FO0A 2QOHA 3B8QA 3RCDA 2O2UA 3ZXZA 4C4GA 3PVBA 3TTJA 2ZB1A 4MD9E 4XLVA 2XIRA 4IVDA 5IEXA 2WXVA 4AE9A 5EW3A 4J8NA 5GINE 4B4LA 4S33A 3ENMA 2YHVA 3QKKA 4FKJA 2OU7A 3COKA 4JQEA 1P5EA 4YU2A 5CEMA 3F2NA 3N4UA 2A0CX 2CNUA 2ITVA 4PTGA 5IQBA 1YVJA 5D41A 3QBNA 4NM0A 4DFNA 1IAJA 2Z02A 4CFNA 4NW5A 1YXUA 1CDKA 4ZTLA 4FYNA 3KRWA 5FEQA 4CKRA 2WEIA 4D4VA 5LVPA 4OTFA 2R0IA 4S31A 3PG1A 3Q4ZA 5CSXA 4BCGA 3JR1A 2XBAA 3GOKA 3KRJA 3E88A 3F69A 3LQ8A 3Q96A 3V5JA 4G6LA 3F5XA 3LLTA 1HCLA 5AADA 3FYJX 4RSSA 3RHKA 2BRBA 3UMWA 3V8TA 4K77A 3WZEA 4DEIA 3HAMA 3OWJA 4GSBA 4MXOA 4RIXB 3WARA 4F09A 4DBXA 2R3PA 1DI9A 1KE9A 2VX3A 5F1ZA 3DBCA 2YM8A 3ZONA 4CQEA 2X8EA 2YACA 4ZSJA 3U6IA 5ANJA 4EYJA 2VTQA 4RZWA 3ZRMA 3W2PA 5E90A 4IWOA 5T6KA 2XRUA 2VWXA 1VZOA 3P78A 3NNXA 1CSNA 4RJ7A 2R3RA 3TDVA 2VGOA 4FTJA 4XG8A 4FGBA 3SGCA 4WIHA 2UW7A 2XEZA 3DU8A 2JDVA 3PPKA 4FT5A 3OC1A 4L8MA 3HECA 4QPAA 2F49A 4U80A 3R9DA 4CZYB 2C69A 3EQBA 2Y4PA 3B8RA 4LMNA 2QKWB 4IQ6A 4PX6A 5EW8A 2WTIA 5C4KA 1H1SA 3MPAA 4Y85A 5F20A 4CRLA 5AP5A 1A06A 2XNOA 2HYYA 3GBZA 1LEWA 1Q61A 4NTTA 2OI4X 3UVQA 4YUQA 4BDAA 4QYFA 5IA2A 4DF3A 3KC3A 3C4XA 4RMZA 4JR7A 2OICA 3F9NA 5EYMA 4RWJA 4IB1A 4M3QA 4W8DA 3WZJA 3G51A 5BVWA 3ULZA 4ANMA 4CTBA 5J1VA 5HNGA 3WF5A 1DI8A 4OTPA 3AQVA 3EQGA 3ZO4A 2Y7JA 1QPEA 1AD5A 5AMNA 4DT9A 2PMOX 3KF7A 4ACCA 4BTKA 2YDIA 5J7BA 2X6DA 1SNUA 5FBOA 3I1AA 3TV7A 3DXQA 3QZGA 4CSVA 3FZSA 5JSMA 4CGAA 3LQ5A 1XBCA 5HIEA 5IQFA 5T68A 3VBVA 3NMUF 1X8BA 4CCUA 2X2LA 3BLRA 3KXNA 3UO5A 3ZLWA 2BRHA 5FEEA 3FKNA 5C01A 1OM1A 5HBJA 2XM8A 1W84A 4ANSA 3RAHA 3IW8A 2V5QA 4ERWA 2PVKA 4LUDA 5TKDA 5L2TA 1NY3A 3HA8A 4BL1A 3QD0A 2E9PA 2GSFA 4AT3A 3LFCA 5CALA 4FEVA 4C57A 2BUJA 4HGSA 5BUEA 4ZSGA 5EK7A 4K1BA 5JGDA 4CLIA 4BCKA 4WUAA 3QCXA 4J96A 3WZKA 4CVAA 4FKUA 5DRBA 3PE1A 1YHWA 3Q9YA 3O8UA 5AV2A 1GIJA 3ALNA 4WHZA 2BCJA 3O7LB 3UMXA 3MFUA 3R8LA 1Q41A 3VIDA 2BZHB 5CSVA 2X2MA 5ANKA 1JPAA 4E3CA 3QC9A 4FTKA 3CQUA 3KULB 2BHHA 4BKYA 3MS9A 2FA2A 4ACHA 4ANQA 4CMUA 4IAZA 5EG3A 2OIQA 4RC2A 4UZDA 1UU8A 5E8YA 5C27A 2SRCA 3RZBA 4CFMA 2XNNA 1WFCA 2YITA 5JZJA 3E8EA 5CAOA 4YNEA 2EVAA 3LOKA 1QCFA 3BEGA 3D2KA 4LI5A 5TE0A 4AOIA 4C4FA 2VTLA 4PDYA 3MVJA 3SXFA 4EBVA 4RIWB 3PJ1A 4KNBA 3MJ1A 4C61A 1PF8A 4KBAA 3RINA 3DOGA 1YI3A 4RX5A 4A7CA 4I3ZA 3U54A 4A9SA 2C1BA 3G90X 5FDXA 5GJFA 2WMXA 1U46A 5M07A 3CKXA 3NZ0A 2QODA 1Y8YA 2XCHA 3QQLA 4UX9A 5E92A 3FE3A 2RFSA 2UVXA 4KABA 4C8BA 4AN2A 4R78A 1YWRA 2VWUA 2Y9QA 3R7IA 5M4FA 3DGKA 2LGCA 4APCA 3LCTA 3N4VA 4UALA 2OSCA 2FSTX 4FKRA 4I4EA 1H26A 2PVJA 2Q0NA 2XZSA 3TNHA 2R3KA 4PNIA 3TT0A 3TV4A 2BROA 4K2RA 5HE1A 4OAVB 5GZ9A 3PSDA 4W4VA 1UNGA 5J9YA 4P5QA 4FTIA 2CNVA 2WOTA 2UZNA 4F7LA 2O0UA 3BYSA 5FRIA 5AP4A 5HD4A 3OUKA 5HTCA 5CQUA 4XG6A 4BZNA 2BRGA 1GNGA 3PVWA 4EOOA 1ZARA 4OTIA 4ASXA 2PUIA 4BDGA 3OEFX 1ZZ2A 1FMKA 4BR3A 4EL9A 3AMYA 3SC1A 3UP2A 4XMOA 1XR1A 4YJVA 5AP6A 3UIUA 3HVCA 4ZY5A 1U59A 3S95A 1SNXA 5DVRA 2R3FA 3RJCA 3QZHA 4WG5A 3RNYA 3S3IA 1S9IA 5A3XA 2QOLA 5BVNA 3E8CA 1QL6A 2OJIA 4X2GA 5DG5A 3VUMA 3NCZA 4EH9A 4WUNA 2R3HA 2C6MA 2Y0AA 4JAJA 4ZZOA 3DLZA 3G0EA 3E62A 4MNFA 1KV1A 5ACBC 3UPZA 2EB3A 1Q8YA 3EHAA 4NKSA 3WF7A 1J7LA 3Q4CA 2IZRA 1GIHA 2ITWA 4A4XA 1XBAA 1JQHA 1RQQA 2GNJA 3QKMA 4NH1A 3VF8A 5CI6A 2PMIA 4LUEA 3WBLA 2Q0BA 2ZV2A 3PXRA 4R3CA 4BKJA 4IBMA 4BGHA 4C36A 1GY3A 5FEDA 3JY9A 3ODYX 5I0BA 3CQWA 3L8SA 5EQEA 1KOAA 4YJRA 1R3CA 4U97A 2Y4IB 3MY0A 4U40A 3BU5A 1PY5A 2O5KA 3CLYA 3BLQA 3G15A 4FF8A 4HVIA 2ITUA 4P5ZA 4AA4A 1Y6AA 4BKZA 4L9IA 1W0XC 3DKFA 4RG0A 3RKBA 1G8SA 3LLAA 2P3GX 5CSHA 3HRCA 4RFMA 4EK6A 1VYWA 3M11A 3NAYA 5KHWA 1MUOA 5E8XA 4XV1A 3UNJA 2XYNA 2O64A 3LXLA 3IECA 5HG8A 3Q6WA 4ZTMA 5AP1A 3IW7A 4FSUA 4FUYA 1LPUA 2P55A 3VAPA 2PVLA 5HLPA 4Y83A 3TIZA 4F9YA 4EUTA 3SXRA 3SA0A 1O6KA 3QUDA 4O0VA 3U4WA 3LMHA 2O63A 4GYGA 4L43A 4NYEA 2RFDA 2W06A 3D5WA 3EQPA 4HZRA 3RCJA 4BZOA 2FSLX 5DBXA 5JEBA 3NLBA 2VV9A 3F88A 5AR4A 3LFEA 3VO3A 1PRYA 2UV2A 3ZM9A 4MWIA 3O51A 1YWNA 2BPMA 4EC9A 3MTFA 2IO6A 4A07A 3LW0A 3OUNB 4AZEA 1M7NA 2FSOX 1XH5A 3LQ3A 3S0OA 5LMKA 1WCCA 3BGZA 5KMJA 4FTLA 3FQEA 1CMKE 2B9FA 4LOQA 5FXQA 4S2ZA 4K9YA 3K54A 4CFFA 4R3PA 4D58A 5IMXA 1G8AA 4C59A 5ICPA 5JN2A 1JKKA 5KE0A 2QG5A 5E8TA 5AR8A 3C4CA 4FICA 5A4TA 2C6LA 4F64A 4II5A 4EWHA 2X39A 2IZUA 3NGAA 4LV5A 3EYHA 5M51A 4D4SA 4CEGA 2REIA 2J0MB 4K0YA 2VN9A 1TKIA 4G6OA 2CKOA 4C38A 2ZVAA 5C03A 3PXQA 2ERKA 4J99A 3ZC5A 4U42A 1M2PA 1SVHA 3ERKA 3FLNC 3D7TA 4L7FA 2BAQA 3OZ6A 4E6QA 5D10A 3FY2A 1OITA 5LMBA 4AW2A 4E4XA 2WAJA 3I5NA 4JBQA 4W8EA 3THBA 5CVGA 3FZTA 5EYDA 2PZPA 5A4QA 3PDTA 3BU6A 4DFLA 4ONAA 4FTTA 3I0QA 2V62A 4RC3A 2HENA 4X7QA 3OD6X 4F7JA 4KIKB 4AN9A 4X3FB 4ASDA 4PMMA 2ZOQA 5AUYA 3ZFXA 1IA8A 5D1JA 3HKOA 4L44A 3KF4A 4HPUE 1HOWA 1K9AA 4NZWB 4YJUA 4E4LA 4X6RA 2VWWA 4GK2A 1Q3WA 4H39A 3A7FA 1M2RA 4IXPA 4B0GA 3FMMA 1DS5A 4XV3A 2ONLC 5JQ8A 2PWLA 3VUKA 3FPMA 4GVJA 4UYNA 4QP1A 1UKIA 5CYIA 4BIBA 3KCKA 2Z7SA 2C5VA 3FI8A 4TL0A 1BKXA 2BMCA 4XBUA 1P2AA 4IZYA 2ZJWA 3HAVA 4FV0A 1BMKA 1RE8A 3E8DA 2H34A 4FG8A 4YURA 4EONA 3C4EA 3GCSA 4C2VA 3HZTA 4DLIA 4G9CA 4QO9A 5M53A 3QHWA 4EEVA 1JAMA 4QMOA 3BLHA 4D1SA 2W9ZB 3AC4A 3TI1A 4BWXA 2OH4A 3HV7A 1R0EA 4XV2A 3RI1A 4IM3A 3MFRA 2B9JA 3VN9A 2WMUA 4DAWA 2PZ5A 1XO2B 2W1HA 4L42A 4MXZA 4WA9A 5E1SA 2YDJA 3MY1A 3I60A 5KMNA 1SMHA 4OT5A 1JSVA 3O50A 4FSYA 4YLJA 2VO6A 5K4IA 1H07A 4RX9A 3QTXA 2BIKB 3P7AA 3IDBA 4PTEA 4XEYA 4D9UA 3MV5A 5J5SA 3UG1A 5C9CA 4UBAA 4G34A 3R04A 4DCEA 5FUTA 5JK3A 1OIUA 3DTWA 4O7TA 4R5YA 2A27A 4ZY6A 3ZSIA 2HOGA 5EI2A 1WBVA 3ZC6A 3FMEA 5I9ZA 4HYHA 4F6WA 4JQ8A 4FE2A 4I6QA 4FSTA 3P08A 5HIDA 1OL1A 1KUTA 3BWFA 3I6UA 2QHNA 3CSVA 4PPBA 3RALA 3RZFA 3TWJA 4BDFA 2GNGA 1FGIA 4FIHA 4IWDA 1J1CA 5H8BA 3QHRA 2GTNA 5J79A 4AP7A 5IISA 2JBOA 3TKIA 3DK7A 2EXMA 3FSKA 2WIHA 3G5DA 4FTAA 3QRTA 3CXWA 3SQQA 3SRVB 5GHVA 2C1AA 3WI6A 3AT3A 4PQNA 3HV6A 4HVDA 4A06A 1TQPA 4I4FA 4UB7A 4W4XA 3V8WA 4WD5A 3EFJA 4E20A 3A8XA 4CT1A 2IG7A 4NCTC 5E8SA 2PVMA 4DFYA 4YHFA 2CGWA 3GC8A 1IA9A 3KN5A 2QO2A 4L67A 3H9RA 3QQKA 4I21A 4G16A 4BBEA 4EHVA 5EI8A 5DEWA 1BYGA 2WD1A 3FLQA 4ZTSA 2GQRA 3OCSA 2VTTA 1YXSA 3QTSA 3A7GA 2ACXA 4GK4A 4RGJA 1OPJA 3UZRA 2CGUA 3R7YA 1LEZA 2ZB0A 2UZLA 2CGXA 3I4BA 4IZAA 5AP7A 4YC6A 5EHLA 3FMLA 1FINA 3ORPA 3QTUA 3AMBA 2AC5A 5JMSA 3OCBA 4EWQA 4F7NA 4KRDA 4BVUA 3MVMA 5CNOA 4B99A 1MP8A 2OKRA 4N70A 2R2PA 3QQGA 4ZJIA 3TCPA 4RJ5A 4DN5A 2J4ZA 4XYFA 2VO7A 4FZFB 5J8IA 2ETKA 2HZ4A 4Z9LA 3C9WA 4YZ9A 4QMQA 2QOOA 3QD3A 4AW5A 3AXWA 4D9TA 4ANNA 3R0TA 3MJ2A 4QMMA 4XHKB 5AUTA 1WBSA 3UG2A 4IAKA 4IVBA 4BFMA 1CKJA 5CQWA 2ZV8A 3TXOA 4O86A 4CCBA 4CXAA 4X2JA 2VTJA 1Q99A 2YABA 5IU2A 3OP5A 4HYUA 3UTOA 1NA7A 2JFMA 5EDQA 3EQIA 1H1QA 2XMYA 4RLKA 3R9RA 3RK7A 5I9YA 3R73A 2CLXA 3BHYA 2ZMCA 4RVLA 3GQIA 4YTIA 3E63A 3R02A 3DNEA 2C68A 5M55A 5CXHA 1Q62A 3D15A 4RA4A 5BYZA 4KKGA 5EM7A 1KV2A 3DKCA 3F3WA 3ZFYA 1VEBA 4RLLA 5IQHA 1PW2A 2RGPA 4CMTA 3UIXA 2WMVA 3T8OA 4ASZA 2F4JA 4ACGA 4DH3A 4ZZNA 2P33A 2PZIA 2GS7A 4ALWA 3OTVA 2I1MA 4Q5HA 5AR5A 5M4CA 2W5HA 3NDMA 2YM3A 3VBYA 3OT8A 5JKGA 4IDVA 1YHSA 4BHNA 5JRQA 2F7XE 1WZYA 4H36A 4IB3A 3CTHA 5EM5A 2HXQA 1U5RA 4M69B 3ODZX 4PL3A 4BIEA 1H00A 3LE6A 4L3PA 3CD3A 4USFA 2PVYA 3F3VA 3W2RA 2CLQA 3ZSGA 2ITOA 3DTCA 1WBWA 3R7UA 2J90A 3LCKA 3SKCA 4M12A 1CKPA 3I5ZA 4I6FA 3NS9A 2FUMA 3QLGA 1KE5A 5E9EA 2R0UA 2WQMA 4IAFA 2JDRA 2VUWA 4FODA 4TT7A 4YZDA 4QYHA 4OBQA 4ZS0A 4QTCA 3BELA 3C7QA 2QC6A 3MI9A 4YP8A 2H8HA 1P4FA 3C5IA 5D7VA 4FC0A 4CV9A 3KA0A 2DS1A 4QMSA 1LUFA 3GXLA 5KCVA 1Y91A 5LMAA 4ANBA 5J7HA 3PE2A 5A54A 3QQFA 5G6VA 4GKHA 1BX6A 2O3PA 3SRVA 5DWRA 1BL7A 5AR3A 2C6IA 3C13A 3ZLXA 3C4ZA 3ORTA 1DAWA 4MF1A 3EB0A 4OLIA 3HRFA 4EZ3A 5CEKA 5L8KA 2XIKA 3ZRLA 4JVGA 3MIAA 5CAQA 4RFYA 2GDOA 3O8TA 4EKKA 2EB2A 2G2FA 3B2TA 4YPDA 4EH3A 4MQ2A 2GQGA 2XNMA 3EFKA 4FKTA 4GFMA 4UZHA 5CAVA 5F4NA 5FDPA 3BQRA 5TT7A 3NX8A 3SHEA 1UWHA 3HYHA 4ALUA 5JT2A 5HU3A 3PJCA 3EQDA 1TVOA 3R9NA 1YWVA 3JPVA 5HVYA 5L2SA 3VJOA 3F5GA 4ALVA 2FGIA 5E4HA 1PMNA 1YDSE 4NWMA 4Y5QA 4ARKA 1U54B 2W1DA 3KKVA 3MW1A 4H3PA 5EOLA 4IACA 3GUBA 2XM9A 3ET7A 4JBVA 4PL4A 1GIIA 2YM7A 3FMNA 2B9IA 3FXWA 4FUXA 4DLJA 5DMZA 3PA5A 4Z3VA 5AJQA 1OL7A 5CU3A 3RP9A 2ITPA 2XNBA 4G17A 4F0GA 1WVYA 3G0FA 5AP0A 4QQCA 3ZM4A 2BAJA 4I0TA 4Y5HA 3HA6A 3NRMA 4FV8A 4OBPA 5EI6A 3VS7A 3G9NA 4IANA 4E26A 5D9HA 4I41A 4P4CA 5ETAA 3ACJA 4I92A 1YKRA 5CTPA 4BGGA 3UZTA 3WIKA 5IQAA 4YGAA 2FSMX 4FTRA 1MRUA 5HORA 4TWPA 5L3AA 3EYGA 5AIKA 4CFWA 3WZUA 2WTVA 3ULIA 2C5NA 3O8PA 3OVVA 1OKVA 2UW9A 2P2IA 3ALOA 4O0WA 4BYJA 4MF0A 4DT8A 3AD5A 3QTRA 4JDJA 4IX6A 4QMNA 3R1YA 4NT4A 4WSYA 4X21A 2NNWB 1G3NA 2XF0A 3TTIA 2J0JA 4TNBA 1J1BA 4AFEA 2QU5A 3MVLA 4RRVA 3MH2A 4M7IA 5H2UA 5JH6A 1NXKA 4BCMA 4OR5A 2DWBA 2XNEA 3KRLA 2A19B 3P7CA 5HE3A 3A99A 3NUSA 1CM8A 3EOCA 4FNXA 4LYNA 5ETFA 3V6SA 1YDRE 1W82A 2W1FA 3T9IA 1H8FA 4G6NA 5HIBA 2ITZA 3FHRA 2VWBA 5FGKA 2IZTA 3MSSA 5CT0A 5IQDA 3OFMA 4YBJA 4U9AA 2EWAA 3ZBXA 3PPJA 1PXNA 3LFNA 3CJGA 3PA3A 3EQHA 3PZHA 4IE9A 2IPXA 2WEVA 3BBWA 4QQ5A 3HMIA 4MYGA 1ZWSA 3EFWA 1GZOA 2DYLA 2GNLA 3GFEA 3R71A 3WYYA 4F08A 4ITJA 3EQFA 4YSMA 2XJ0A 5EH0A 2C3IB 2XRWA 3D2IA 4PP7A 5LOHA 3CQEA 3ZZEA 4C7TA 1Y57A 4L3JA 4V04A 3D94A 5LWMA 4O84A 1FPUA 2BZIB 5IH4A 2PUUA 3RPYA 4Z55A 2PMNX 3VJNA 1RW8A 3RTPA 3DLSA 4J53A 4IX3A 3U6HA 3FSFA 4L46A 1NVQA 2GNFA 4TYHA 5EHOA 3ZHPC 2OW3A 2P0CA 4QYYA 4TYIA 2IWIA 1XH4A 4A9UA 1GZKA 2PVRA 2G9XA 4IM2A 4V01A 3V3VA 4FV9A 2UW4A 3FAAA 3LAUA 1W83A 4E5AX 4EHGA 3UYTA 4OTWA 4PDSA 3C0GA 3MPMA 3PIXA 4C4IA 5IF1A 4NK9A 2WNTA 3GB2A 5DGZA 2KTYA 2YFXA 5AR2A 2NRUA 4RZVA 2I0EA 3BE2A 2F9GA 4EQCA 1H24A 2BDFA 3BHTA 4B6LA 2R3QA 4CG8A 4OGRA 1BLXA 1U54A 4AGCA 5I9UA 3WF8A 3IO7A 3LKMA 4OTHA 3OROA 3VUGA 1YOLA 2B53A 5I9VA 4JR3A 2X7OA 2ITNA 1XQZA 2CSNA 3IG7A 3UZPA 3Q60A 4R77A 4O7VA 3IK3A 4DFUA 1ZYJA 2X7GA 4GIHA 3OY1A 4EZ7A 5JRSA 1VJYA 4CZUA 5IUHA 3BHHA 2NP8A 4M0YA 3OWPA 2WFYA 5DPVA 5CASA 3GC9A 3P7BA 3QCYA 3IONA 4QOXA 4QMYA 1Q8WA 1S9JA 3TKUA 2F7ZE 4JS8A 1ERKA 3VBQA 3LHJA 1REKA 2NRYA 5GIOE 5A9UA 1YXVA 4XG4A 3VVHA 4OAUC 2JIIA 3PXKA 4L3LA 3VS2A 2UVYA 4L53A 4DBNA 2V0DA 4YLLA 4O7LA 2J0IA 3IW4A 4XS2A 4CKIA 4BCNA 5L8LA 4CFVA 2UZTA 2GQSA 2VTMA 4YSJA 2XCKA 3W1FA 3KMMA 1ZMVA 3PA4A 4DITA 4FR4A 4ZY4A 2C6EA 4ZTHA 3ZMMA 4FZDB 4I5PA 3JYAA 3E3PA 4J52A 4LV8A 3M1SA 3IPHA 2RFEA 3OW4A 4E5BA 5BVOA 5IDNA 4ZLYA 4M66A 4G9RA 4RC4A 4WT6A 4EOIA 3A2CA 2B55A 1V1KA 3FUPA 4QP2A 4D2WA 4UV0A 3NIEA 4HW7A 3RNIA 4L52A 3DFCB 3W10A 4EK3A 2VTOA 2UZBA 4QP9A 4KD1A 4RFZA 5C8NA 3ATTA 4ANLA 2QOIA 5DIAA 3AOXA 3TZ7A 4QTBA 4CFXA 5E8VA 3MY5A 5CEPA 2VTAA 4G3FA 3ZU7A 4IJPA 3KN6A 2YA9A 3PTGA 3VRYA 4TYJA 3SD0A 2IVSA 3FLYA 2CHLA 2YIWA 4FZ6A 2GTMA 2BKZA 3CTQA 4JRNA 3MA6A 2BKKA 4NTSA 3ROCA 3R8MA 1YOJA 4B8MA 2JDOA 3QXOA 5HBHA 3PLAE 2PK9A 5HICA 3DXPA 4YJSA 3QLFA 4UWBA 2C3LA 3WYXA 3KL8A 4QNAA 4BBFA 4BDIA 4XX9A 2P2HA 3TNWA 1V0PA 4E5WA 4BICA 4JT3A 3GENA 5CEQA 4WKQA 5BNJA 1OUYA 2OIDA 5FBNC 4AAAA 4KIOA 4HYSA 4WNPA 3PPZA 4FKSA 3ANRA 3SG9A 5HE0A 3BKBA 2JDSA 2WMRA 3HV3A 3P23A 4I5CA 4BI1A 3HMMA 4I93A 4R7BA 3NUAA 3KMWA 3P79A 1UU3A 4EH5A 5IEVA 1ATPE 3AC1A 4ANOA 5IQCA 4S30A 5ETIA 5HVKA 3ZO3A 4IAIA 4U5JA 2NPQA 3E5AA 1K2PA 2JKKA 4ORKA 3LZBA 3QWKA 3M2WA 2WTJA 3JY0A 3HEGA 3P0MA 5L8JA 5AEPA 1H0WA 2ZMDA 5BUJA 5HTBA 4PMTA 4S32A 2BR1A 2QCSA 2QO9A 3WF9A 4EC8A 2R64A 2DUVA 2X4FA 4JBPA 5IKWA 2Z7RA 4NJ3A 3ZTXA 1E1VA 3BU3A 3QQUA 4IVCA 3VHKA 5HGIA 2ERZE 3SAYA 4XOYA 5A6NA 4CKJA 2HCKA 4FEXA 2YJSA 3GU5A 3HGKA 3OWLA 4GG7A 3EN7A 3DJ5A 4BDEA 2OJFE 3CCNA 4M67A 4ZJVA 4KKEA 4IFCA 2J51A 2C5YA 4LL0A 4N4SA 4HVHA 4XG3A 5L6WL 3W8LA 4Y95A 3CY2A 3NYVA 2UVZA 3D9VA 5ANIA 4YMJA 4QMTA 2WMTA 3D7TB 3FC1X 4GT5A 4ZMFA 3D83A 4MAOA 1KOBA 5EFQA 2ESMA 3Q2JA 1A48A 5IUGA 1F3MC 3HP2A 4MX9A 4R1VA 3A8WA 4YTCA 4XG9A 5HD7A 1JLUE 5LARA 2WIPA 2WMWA 3OXIA 1OVEA 2X6EA 5EKNA 3TN8A 4FG9A 1LP4A 4AUAA 4Y46A 1YI6A 3UC3A 2H96A 3Q5ZA 4NKAA 2WGJA 4JIAA 5BX0A 5CVHA 1JSTA 2OF2A 4F70A 3ELJA 3KCFA 2J5FA 4B9DA 5IG1A 1REJA 2YIQA 4QTEA 5FLFA 3ZRKA 4NJDA 5ANDA 1PMUA 4EHZA 4BDBA 3IQ7A 4DINA 2XNPA 3OMVA 4XCUA 4DFZE 4KIQA 4FYOA 5LVNA 2BVAA 4AGDA 4GYIA 3R8VA 1M7QA 1Y6BA 1H4LA 4C33A 4RQVA 4YZNA 3FBVA 5HLWA 2WQNA 4BTMA 3GU6A 4XBRA 5KMIA 5KKRC 1YDTE 3TZMA 4AGUA 4Z7GA 3CJFA 5KNJA 1TQMA 3HNGA 4J95A 3OXZA 4FSNA 2I7QA 3F3ZA 4G3EA 2YCQA 3GVUA 4QYGA 4D4YA 5HHWA 4F4PA 4L6QA 4AXAA 4BCOA 2I0VA 3LXPA 3QAME 3FDNA 4CYIA 1H28A 3FZ1A 1GZ8A 4G1WA 4XP2A 4ZOGA 5AR7A 4FX3A 5CU4A 5H8GA 3V51A 4I0SA 3V5LA 4CLJA 3HUBA 4FL2A 4TYEA 4YZMA 5A4EA 3F66A 5EKOA 4FMQA 2O65A 3KXMA 2VU3A 1NW1A 2PULA 4DEHA 4RIYA 4GV1A 4FEQA 5I4NA 1URWA 4FK3A 3DBFA 1OIYA 4YJPA 4D0WA 3UOLA 1XJDA 3S00A 4JBOA 3H30A 3DQXA 3DZOA 4I24A 4AN3A 4A9TA 5HX8A 5B2KA 2C6OA 3R2YA 4O7ZA 5FTGA 3COMA 4H58A 1VR2A 2OFVA 4U45A 4DGNA 2B9HA 2R7BA 4ZZMA 1IEPA 1YRPA 3IW6A 3H4JA 2XK9A 3L9NA 5BQ0A 3R63A 3AC2A 2OLCA 4R1YA 5JZNA 2XBJA 1J7UA 1Q4LA 3UDBA 3BYMA 4EZ5A 2BTRA 2R4BA 4FTNA 4OT6A 4E1ZA 4TRLA 3FPQA 4BTFA 5DN3A 2IW9A 3BRBA 2X4ZA 2YZAA 3GU7A 5IQGA 4BDJA 4QNYA 5LVOA 2H6DA 3R8UA 3CP9A 1OPLA 2G15A 4R7IA 4FKPA 4TNDA 4J97A 1CTPE 4V05A 1IAHA 1OIQA 3Q9XA 2I40A 1IRKA 3CE3A 3QYZA 3FI4A 4YJQA 4YC3A 3F3UA 4EOLA 1B38A 5K5NA 4RJ6A 3SXSA 3V6RA 2RG5A 4UMTA 4RA5A 3NIZA 2QG7A 2W9FB 4DGMA 4F99A 2BIYA 3RVGA 2GHMA 5LXMA 4YO4A 3MVHA 3PFQA 4F1OA 5KUPA 3FC2A 5FXRA 3OW3A 5J9LA 1OPKA 3I79A 3TUBA 4DYMA 2WTKC 3W18A 3O17A 4O0TA 2QU6A 5BPYA 2XKFA 2R3OA 3DAKA 3C0HA 5JGBA 4OTGA 5LWNA 4G5JA 4AG8A 4KUJA 3W33A 3FL5A 3SW4A 3BYUA 2JITA 2YIRA 3MBLA 5HG5A 1OKWA 2WPAA 2Y8OA 4PRJA 3TEIA 2PUNA 1H1WA 3GCVA 4CTCA 4MH7A 3ZH8A 2QOQA 3OBJA 3DAJA 4WOVA 2HZIA 2G1TA 4C4HA 1IR3A 1H25A 3FY0A 2X7FA 2BAKA 3DKOA 3LFFA 4MQ1A 3WF6A 4IW0A 4FTOA 2OK1A 5FM3A 2X0GA 1UWJA 2HY0A 2X9EA 4KS8A 3QRKA 1R1WA 5AAGA 3WILA 4O27B 4BGQA 1J91A 5CI7A 2YM5A 1O9UA 4EH8A 5KBQA 5DH3A 4FSRA 4TW9A 3PWYA 2XK3A 4O0UA 3RAKA 3UQFA 5HBEA 5CENA 2R7IA 4JL9A 4Q2AA 5A4CA 4X3FC 4UXQA 4GFOA 3RWPA 3MA3A 4NM5A 3N51A 4D2VA 3NPCA 4DEDA 2J0KA 1Z5MA 2C6DA 3LM0A 5HI2A 3ORXA 4LOPA 4XV9A 3MGYA 3AD6A 3R21A 3PUPA 3SV0A 2WELA 4X2KA 5JGAA 4K6ZA 4RX8A 2G2HA 5D7AA 3A7HA 4R3RA 5HO7A 3ZSHA 3FXXA 3QRJA 1KE6A 5HNBA 3VQUA 3POOA 4FNYA 3WZDA 2YJRA 1ZOHA 2QQ7A 3UIMA 3UIBA 4FTMA 2ZM3A 4FK6A 2GHGA 4PP9A 3NR9A 3R7EA 2YM6A 4U8ZA 2CKPA 4LRKA 4N6YA 4QT1A 4U0IA 1EH4A 2XK8A 3EN4A 4C2WA 3GNIB 3FV8A 1U5QA 4UMQA 4AS0A 2ZM1A 3BX5A 4AX8A 3QRUA 4FKLA 5HOAA 5C8KA 1QPDA 3KK8A 4C4JA 4EOSA 2FH9A 3C1XA 3FI3A 3IOKA 3P4KA 4Q9SA 2QOBA 4QTAA 2YCFA 1MQ4A 3UNZA 3EL8A 4RJ8A 2JC6A 2PE2A 2UZEA 4XP3A 3UOKA 2RF9A 4EH2A 5IPJA 3PVGA 4HPTE 3O7LD 3QF9A 3TM0A 4GG5A 1XKKA 4C62A 3MB7A 2V22A 1FVVA 2GFSA 3PLSA 3MPTA 4IMYA 4LFIA 3QRIA 2X1NA 2OIBA 5CEOA 3BYOA 5J95A 5IA0A 1Q8UA 3EZVA 4FT7A 5ANGA 5JFVA 1UU9A 3VULA 4I0RA 2ETMA 3SVVA 3UNKA 4AA5A 4CRSA 4PNKA 4AOTA 4PMPA 1URCA 3O0GA 4D28A 2QHMA 4CZTA 1XHAA 4FA2A 3L9PA 3ROYA 5J87A 2GHLA 4YJOA 3W8QA 1V0BA 4O1OA 4F6SA 3S1HA 4GUEA 3R7OA 4EOPA 5BVFA 3VUIA 3MH1A 5AP2A 4MBJA 3CBLA 5ETCA 2BILB 4C02A 2OXDA 4BTJA 4Z7HA 3PWDA 3SOAA 3U9CA 3C5UA 3GEQA 3AT4A 2WHBA 3EMGA 2F7EE 1GOLA 1PXKA 3K5VA 2WOUA 2VO3A 4FBXA 4FT9A 3PJ2A 4J98A 4IEBA 4Y72A 3QYWA 2ONLA 5BVDA 4I1ZA 4ID7A 4O81A 2YERA 5CF5A 4ZMEA 4GJ2A 2BZKB 4QYEA 4WRGA 4PTCA 5LVMA 4P90A 3T9TA 5FG8A 5TOZA 3AD4A 2FYSA 1ZAOA 3QTQA 3F82A 3OS3A 4FVQA 4G2FA 4E4MA 2QI8A 2B54A 2Z7QA 3LCOA 1WBOA 4JOAA 5CZIA 2R3NA 2UZWE 3N9XA 2UW3A 2GPHA 4DH7A 3ANQA 1Q24A 3BWJA 1F0QA 2X2KA 4F1MA 4FIEA 3EN9A 5IA5A 3EH9A 1MRYA 2A4LA 3EQRA 3G2FA 4JDIA 3OY3A 3TNIA 4L01A 5E8WA 4XP0A 4AZSA 5KZ0A 2ZV7A 3R83A 1SVGA 1JBPE 1QMZA 5FP5A 4F0IA 3RPRA 5H9BA 3R00A 2ZAZA 4B7TA 4JAIA 4D5HA 5HO8A 5E91A 5DFPA 3VBWA 4EOKA 5AA8A 4MXAA 5TO8A 2XKCA 3A4PA 4IC8A 5EHYA 3U4UA 4XH6A 5EM8A 3VHEA 5JQ5A 1IASA 5ITAA 3PIYA 4H3QA 4EJNA 4FL1A 1DAYA 2WZJA 2E2BA 4MHAA 4EH6A 3HMPA 4HCVA 2F2UA 3TV6A 2XB7A 4O22A 3NNUA 4FKGA 4CQGA 5HQ0A 3MTLA 5HESA 4JNWA 2E9VA 2WMAA 4GRBA 3COHA 4BB4A 4AZVA 4RVTA 4RVKA 2W17A 4N6ZA 3CGFA 4JJRA 1PXMA 1R39A 3DB8A 3UO4A 4BCPA 2BFXA 5DYJA 4IWPA 1OUKA 2ZM4A 3PXFA 2J2IB 1P4OA 1Z57A 2ITQA 2OG8A 3F6XA 3GU4A 3PXZA 3QUPA 4I5HA 4F1TA 2YIXA 4QMPA 4UMRA 2GFCA 4U41A 5KMKA 3EKKA 5KX8A 1GZNA 5KBRA 4O82A 2CGVA 3G6GA 3O23A 3PRFA 3LMGA 1FMOE 3GU8A 3B2WA 3QU0A 4KINA 3W2QA 5ACKA 4BI2A 4FVRA 5FD2A 3OTUA 4DEEA 4PL5A 3WE4A 3QZFA 4NCTA 4BZDA 3II5A 4F6UA 5L4QA 3ORZA 4GIIA 3GQLA 4KWPA 4OTRA 4TYHB 3ZO2A 5DI1A 3DY7A 4CD0A 4A4LA 1SM2A 3PRIA 4AT5A 2OJJA 3TJCA 4E8AA 5K0XA 2JD5A 5AIRA 3JVSA 1KWPA 3QUEA 4EK4A 1STCE 1ZRZA 3UBDA 5EYCA 4HGTA 4I20A 2PY3A 4NUSA 2RFNA 2X8DA 1ZXEA 5TF9A 4A4OA 4DG3E 2BTSA 2JBPA 1WVXA 1Q97A 3V5TA 5BMSA 1J3HA 5AUZA 3UP7A 3W55A 2HELA 3JXWA 4M84A 4EHEA 3NUXA 3ORIA 2G01A 2J7TA 4YPSA 3KGAA 4KB8A 4WNOA 4C3PA 4XOZA 4E7WA 2OZAA 2CDZA 3PY3A 1OGUA 3H0ZA 3KVXA 1B39A 3NSZA 4CV8A 4W9XA 4KRCA 3NVKI 4GMYA 2PUPA 4AE6A 4BC6A 3HV4A 3VBTA 1ZYDA 2C0OA 3LJ0A 4O83A 4R5SA 4X0MA 1ZOGA 3TACA 3NW6A 2B4SB 3D0EA 4WBOA 1PHKA 3BBTB 4BDCA 3ATSA 5AX9A 5BYLA 3RK5A 3R9HA 5EW9A 4BCFA 3H0YA 2Z7LA 2ZDUA 2RIOA 2IW6A 4DGOA 2PZRA 4HVGA 5AFVA 2OXYA 4ZXTA 4NIFB 2YAAA 4C58A 3PJ3A 4RJ4A 2XH5A 3H9OA 3QA0A 3LFAA 3DDQA 5HKMA 2XK7A 2C3KA 1OMWA 4EK8A 3C50A 4LGHA 2GCDA 5B7VA 3RPVA 4C34A 3O71A 4QP3A 3EL7A 5HU9A 3U8WA 3ZO1A 4G3DA 3NNVA 3W2SA 2PYWA 2EXEA 4ZS4A 2A2AA 4GU9A 1DM2A 3AMAA 4KBKA 3QGWA 2JIVA 3W2OA 1KE8A 5DR2A 2W05A 5DT0A 2VO0A 3FKLA 3FMJA 2Y6OA 4UY9A 1JKSA 1OL5A 1W98A 3D7ZA 4ZIMA 2C5XA 2W1CA 4DG0E 4U43A 5CF4A 3DV3A 1H1RA 2AC3A 1Q8ZA 4IM0A 3UPXA 2UZDA 4M13A 5GZAA 5DA3A 5J5TA 5M57A 3E7VA 3U9NA 4D2SA 3S4QA 4DH1A 3FL4A 1HCKA 4GL9A 4N0SA 5CU2A 2EU9A 2VTNA 4U6RA 3COIA 3O96A 4X2FA 1UNHA 4FI1A 1Q5KA 5HCYA 2PVFA 2XEYA 4EOJA 4DG2E 4YNOA 3HX4A 5EOBA 4MD8E 2BDWA 1L3RE 3NYOA 1ZYLA 5FM2A 4XJ0A 2EXCX 3RM7A 3UO6A 3I81A 4H05A 4AU8A 3H3CA 3G33A 2JIUA 2VNYA 3VC4A 3Q4TA 2WMBA 2G2IA 5DLSA 4UN0C 3DJ6A 4F63A 5AV1A 2C47A 1KE7A 3TL8A 4USEA 3ZDIA 5L2IA 2HK5A 4BI0A 2PE0A 3DZQA 3FZRA 3QL8A 2CCHA 1R0PA 1PJKA 5C1QB 1OKYA 2YWPA 3LIJA 2OFUA 4LRJA 1Q8TA 2QONA 2YCRA 3HL7A 1M14A 4O6LA 3OHTA 3POZA 2J9MA 4QMVA 2J0LA 2W7XA 5IA1A 2F57A 3F5UA 1LR4A 2I0HA 2W1EA 3GFWA 3U87A 4PPAA 2UW0A 4EKLA 4F7SA 4USDA 4MBIA 4WRSA 4GS6A 4ERKA 4YR8A 3Q4UA 2AUHA 5DNRA 3VW6A 4O7RA 3HUCA 5M4IA 4FKVA 3MDYA 4O0YA 4O2ZA 3ZUUA 1OBGA 4AW0A 2HIWA 1APME 2E9UA 2W1GA 4NFNA 4AGWA 3FLSA 5CANA 4UWYA 3AC3A 3H9FA 2DQ7X 3CPCA 3D14A 2AYPA 3PG3A 4PWNA 2QLUA 1TQIA 1JVPP 4HNFA 1H1PA 1MQBA 3AGMA 5AM7A 4O0RA 3SDJA 2JGZA 5HTIA 5DOSA 2YIYA 4K33A 4X6QC 4AA0A 4G3GA 4QPMA 5IH6A 4KBCA 5FXSA 2W4OA 3Q9WA 4GCJA 3C51A 3PSCA 4FL3A 4R8QA 4BDKA 4ZSLA 3CGOA 5E8UA 4KA3A 3LCDA 2UW5A 2VX0A 2XJ2A 5I9XA 5CS6A 4AW1A 2CCIA 2QVSE 2PZYA 3PP1A 4NIFA 3K2LA 1M52A 1YXXA 4HOKA 2BHEA 4M15A 1ND4A 4IZ7A 1JSUA 1U4DA 4MXCA 4U3ZA 3PJ8A 4WNMA 3OOMA 3W16A 1WBNA 3NEWA 4UMPA 2XP2A 5IMEA 4YTHA 1VYZA 1W7HA 3ZEPA 2JFLA 2C6KA 4IC7A 4EOQA 2VZ6A 3AC8A 4M0ZA 5I9WA 1R78A 1NVRA 2XIZA 5E8ZA 5CVFA 4TPTA 1T45A 2OJ9A 3L1SA 4FIJA 4U7ZA 2W5AA 4NU1A 4AOJA 4E73A 4K11A 1O6YA 2JLDA 3A4OX 4O7SA 2R3MA 4JX7A 4DH5A 3ETAA 3VUHA 4H1JA 3UJGA 2OGVA 3NUPA 3R6XA 4EQMA 1OI9A 3DK3A 4ACMA 4U79A 1V0OA 2UZOA 3OWKA 3TJDA 1XBBA 1FGKA 4HCUA 3QKLA 4QMXA 5CAPA 4DFXE 5AM6A 5K9IA 2PTKA 4PF4A 3PYYA 2V7AA 2QOKA 3Q5IA 5LCKA 3TNQB 2XS0A 1NVSA 4ZSAA 2R3LA 3P1AA 4CG9A 5BUIA 3QZIA 5CEIA 4JG8A 3GGFA 3RPSA 1BL6A 4MTAA 2C0IA 3L9MA 3QC4A 4GK3A 4AF3A 2ITXA 4MNEA 2ZDTA 2VWYA 4PMSA 2HWOA 2WTCA 4LQMA 4QMUA 2JEDA 4QP6A 2H9VA 3Q32A 4RIYB 2WMQA 4UWCA 4IIRA 2C4GA 3H10A 1P14A 2IVVA 3LFDA 3IW5A 3R30A 4QTDA 3KRRA 5IDPA 1OIRA 2WQBA 3LXKA 3MH3A 4HZSA 2BRNA 2OH0E 3KMUA 3VS4A 4ITHA 5K4JA 5GIPE 2HAKA 4FZ7A 3V5PA 4BDDA 2BRMA 3EQCA 4QP8A 4Z16A 5CSWA 1M17A 4HGEA 2WU6A 1H01A 2GNIA 4FNZA 3FKOA 2YZLA 3MESA 5AA9A 3MB6A 2QD9A 1BI8A 4FEUA 5BYYA 3FMHA 3QALE 4XRJA 3DQWA 5K3YA 4EBWA 1OKZA 5L2QA 5C4LA 5M09A 2VWZA 2HW6A 3D5XA 4ZTRA 4FOBA 2JKQA 3DAEA 5EM6A 5IA3A 5AAFA 4N57A 1XH6A 3E64A 4PPCA 4D0XA 4RWKA 1ZZLA 3MYGA 4U3YA 4Q9ZA 4FT3A 5TR6A 1PXIA 4OTDA 2B52A 3QQHA 3WIGA 5IH5A 4Y8DA 3JVRA 3UC4A 5CY3A 3RMFA 3VWAA 4EH4A 3RHXA 2CKQA 2FVDA 5DE2A 3LMIA 3NNWA 2VRXA 3UQCA 4FNWA 4IHPA 3UOHA 3L8PA 2KULA 3OBGA 3QTWA 4LOOA 3EKNA 3G9LX 2Z2WA 2XKEA 1OL6A 4YC8A 3I0OA 4JI9A 3DBDA 5EDPA 4OTQA 3CY3A 2OO8X 3U51A 1B6CB 3GCUA 5H3QA 4RIXA 1JKLA 4YZCA 1PMEA 1H0VA 1ZYCA 3GC0A 4QMLA 4ENYA 4CNHA 3ZBFA 3A60A 4NM7A 4BBMA 5KZIA 3TIYA 1MRVA 3TZ9A 5LMKC 4RVMA 4YO6A 5C8MA 4FKQA 4AWIA 5A4LA 4CT2A 4ZTQA 5B2LA 5LQFA 2Q83A 1JWHA 3W32A 4DHFA 3BE9A 3DCVA 3R1SA 5FQDC 4R7HA 3NVMB 3KFAA 4FZAB 2JKMA 4X2NA 4K18A 4ZK5A 2RG6A 1UA2A 4J1RA 4DTKA 4YHJA 4C35A 4ZLZA 3DPKA 4JLCA 4GVAA 4L00A 4CFUA 1H27A 3TG1A 5F95A 5IQEA 3PY1A 3K3IA 3EN5A 3V8SA 5AUWA 5KMLA 3BEAA 1FOTA 2X81A 5HVJA 3HMOA 4P7EA 4ACDA 1XH7A 5JFSA 4HJOA 4BDHA 4NL0A 3PZEA 5L2WA 2ZYBA 3FZOA 3F7ZA 3VUTA 5CU0A 4AFJA 5KKRB 2W1ZA 1W8CA 5LJJA 4L7SA 4I23A 2VD5A 1A9UA 3NAXA 2QURA 3DB6A 4FSZA 3QQJA 5EYKA 3FXZA 3VS6A 3NCGA 1G5SA 2IVUA 5DHJA 5ANEA 3R8PA 3I6WA 3PIZA 3BIZA 3ZUVA 5CF6A 3KREA 5J9ZA 2ETRA 2R9SA 3CPBA 4S34A 3WE8A 4MWHA 4E4NA 3BHUA 4HYIA 4W4YA 4JG7A 4DGGA 4KS7A 2XK6A 4BYIA 5KMOA 3QCSA 3UOJA 5CF8A 4YHTA 4JIKA 3AT2A 4O96A 1ZLTA 3DS6A 5C26A 2HZNA 3MIYA 5IA4A 2JKOA 5IQIA 3PSBA 3FLWA 4J71A 4V0GB 4GT4A 4ITIA 4WO5A 4YTFA 5CLPA 2WQOA 4C4EA 1SYKA 4FV2A 3IKAA 4HGLA 4UEUA 2HW7A 4AQCA 4O91A 2UW6A 1YI4A 3LJ2A 5FWKK 5H8EA 3ZLYA 4CMOA 4JX3A 4O0SA 2Y4IC 1XH9A 5AV3A 2OJGA 2R5TA 4EK5A 2HXLA 5L6OA 4FT0A 2XVDA 4QP4A 3VS1A 4TKSA 4BN1A 3SX9A 3BV3A 1Y8GA 4PY1A 1YOMA 4G3CA 3QWJA 4GEOA 3KVWA 4DGLC 4FSMA 4BHZA 3U6JA 4GT3A 3EFLA 3KULA 3LXNA 3PY0A 2OBJA 3VF9A 3FLZA 5CU6A 1OB3A 3CC6A 4QPSA 3DA6A 3GCPA 1E9HA 5HE2A 2IW8A 1K3AA 4K8AA 5BVEA 3FHIA 1GJOA 4KKHA 2VGPA 4QMWA 1I09A 3R22A 4QQTA 1YQJA 3HLLA 3VS0A 4O7WA 3DT1A 3HDNA 4OBOA 5CX9A 3V04A 5I3RA 4AZTA 3SOCA 5LCJA 3KY2A 4I6BA 3CKWA 4C37A 3L8VA 4FV6A 4RIWA 4TYGA 2CN8A 3CIKA 2PE1A 3LM5A 2PVNA 4Q5EA 4R6VA 1PXOA 5AX3A 3UVPA 4EQUA 3JS2A 2CN5A 2B0QA 4IVAA 2RKUA 3NWWA 5K0KA 5GZ8A 2QOCA 3F7WA 3RK9A 5CZHA 4FKIA 2WTKB 2I6LA 3ZDUA 2J5EA 5B2MA 2R3GA 3E7OA 5L6PA 2IJMA 4EJ7A 3P5KA 3TDWA 3LCSA 5HEZA 4JDHA 4FEWA 3FMDA 1SVEA 1GAGA 2WQEA 4W4WA 4YLKA 3EIDA 2HWPA 3O2MA 3TZ8A 4A9RA 2EUFB 4OW8A 4RWIA 3FEGA 4P2KA 4GKIA 3NYXA 1WBTA 1SZMA 1H08A 3A62A 1WMKA 3QX4A 5BMMA 2ITYA 4LL5A 3E3BX 4E6DA 4FV1A 3LFBA 4HNIA 1E1XA 4ZTNA 3F5PA 4H3BA 4IZ5A 4TN6A 3RAWA 3TUDA 4NM3A 3K5UA 4OUCA 4YBKA 4D2PA 1OZ1A 2C0TA 3LJ1A 4MCVA 3RM6A 2JDTA 4X3JA 3UODA 4IX5A 4JG6A 4E6AA 4F9AA 4LGDA 1J7IA 2FB8A 5HO6A 3E92A 3GC7A 4LMUA 3RBWA 4AT4A 3VRZA 3QD4A 5A14A 4KAOA 4I22A 3BI6A 3ZCLA 3DBEA 2XJ1A 4WBBB 4GH2A 3CD8A 1RJBA 3NYNA 2OWBA 4TTHB 4O21A 2UUEA 2J6MA 2VTHA 1PMVA 5ANOA 2QR7A 5HG9A 4DCAA 2OF4A 3DNDA 3IDCA 3ZFMA 4A9YA 3VBXA 3QGYA 5HX6A 2UW8A 2YLEA 3IGOA 3ACKA 2PHKA 2B1PA 4H1MA 4FG7A 5AUXA 4FV3A 5AAEA 2VWVA 1WBPA 3Q3BA 2W4KA 2PPQA 2WKMA 3MFTA 4TWOA 3LFQA 4BRXA 5EDRA 4E93A 2PU8A 4MVFA 5CWZA 3GP0A 3DK6A 5GNKA 5M56A 3Q53A 4V0GA 4GU6A 3BHVA 3KB7A 2C5OA 3F3TA 4PUZA 1YW2A 1ZMUA 3FYKX 4UXLA 3ZYAA 3KXXA 2PSQA 4ZJJA 3VUDA 3ZOSA 3P86A 2B7AA 3BGQA 2QNJA 3RWQA 4D2TA 3KK9A 4G5PA 3A61A 4BWKA 3IOPA 3GI3A 2CJMA 3FWQA 2VAGA 1PXLA 2R3IA 2BDJA 3FMKA 4MEDA 3FZPA 3REPA 3T3VA 1Z9XA 2QOFA 3OG7A 4I6HA 4IAYA 4GUBA 4UMUA 3CTJA 3ZZWA 3F2RA 2X8IA 3F61A 5LVLA 3ZXTA 4DC2A 5B0XA 4D55A 4DE4A 3SLSA 1FVTA 3NUUA 3VW8A 4BWPA 3ORMA 5I3OA 3HV5A 4U81A 4BCIA 3E93A 4EI4A 3A7JA 4ENXA 2PMLX 3EWHA 4QRCA 3VQHA 1KSWA 3C0IA 2RSVA 3E8NA 3ORNA 4J7BA 4L45A 3LVPA 1ZY4A 4D4RA 4IWQA 4F0FA 2W96B 4IAAA 4KSPA 2ITTA 4WNKA 5E1EA 2W1IA 2Z8CA 3DDPA 2QLQA 3QXPA 4AACA 4I5MA 4FKOA 4C3FA 5AUVA 2IVTA 3RPOA 4KIPA 3I7CA 5GJDA 4PV0A 4FIIA 4BIDA 3V01A 4MD7E 1O6LA 3AC5A 4HCTA 5AP3A 1IG1A 2OZAB 1UKHA 3R7GA 3OF0A 4XNEA
chains in the Genus database with same CATH superfamily
3D5UA 3KXGA 3OCTA 5CSPA 4ZEGA 4QP7A 5CXZA 3L9LA 5A46A 2W5BA 2YLFA 4IJ9A 3V5WA 4C3RA 4NW6A 4E6CA 5M4UA 2BALA 5DRDA 1UVRA 1F5QA 5EQPA 5M06A 3RGFA 3AKLA 2WTWA 2YISA 4LRMA 4MXXA 3CR0A 2VTIA 4IB0A 4XRLA 5HNIX 2WU7A 1ZOEA 4YJTA 4IB5A 4UYAA 1RDQE 2VNWA 4FKWA 4AZFA 5AV0A 4XG2A 4EORA 3LFSA 5AUUA 4M14A 4KIKA 3ID6C 4X3FA 2WO6A 3IDPA 1OECA 3D5VA 5F9EA 3SG8A 4DFBA 1T46A 3DBQA 1CKIA 4FV4A 2C6TA 2CKEA 3BGPA 3IS5A 4GFGA 2P4IA 2OZOA 4IFGA 4LG4A 4MK0A 3BZ3A 4YJNA 2QR8A 4GW8A 5G1XA 1L8TA 2HY81 4RBLA 4APPA 2LAVA 2VTSA 2IN6A 5CNNA 3KU2A 1UNLA 3DXNA 3L8XA 3NW7A 1UU7A 4PDOA 3W0PA 1PYEA 4NEUA 3BPRA 2XA4A 1M2QA 4TY1A 1YHVA 4FTCA 4FSWA 3PP0A 4DEGA 4QMZA 3BCEA 5DEYA 2XK4A 3S2PA 3ZUTA 5DT4A 4O1PA 5HCZA 5M08A 1BUHA 3Q2MA 3K3JA 4EOMA 2A1AB 4L68A 4O6EA 4KSQA 2C30A 5HG7A 2GS2A 3F2AA 3AG9A 4BCJA 3P9JA 4DTBA 3DFAA 2RL5A 4FIGA 4QEBA 2PVHA 3MFSA 4QQJA 4QD6A 3QX2A 1AQ1A 3V5QA 4DEAA 4EYMA 4XUFA 4DA5A 4D2RA 2WMSA 4IADA 5A6OA 1OBDA 3PVUA 4TWNA 5T3QA 2E9OA 1ZMWA 1PYXA 3MH0A 2JAVA 2J50A 3MN3A 3OEZA 2W99B 3R9OA 4D5KA 2YEXA 1WAKA 4FGRA 4ZLOA 2C3JA 3QTZA 5F94A 5JFXA 5D12A 4ZSEA 4F9WA 2CMWA 4FV5A 5D11A 2UZUE 3G6HA 4IX4A 5FTQA 5KMMA 4IDTA 1XH8A 3N4TA 2WB8A 4Y73A 1QPCA 4C0TA 4M8TA 3Q52A 4WG4A 3NUNA 2NO3A 1FQ1B 3GOPA 5FTOA 4RX7A 5J1WA 4O0XA 3NW5A 3HRBA 3W2CA 3VS3A 4G31A 1ZYSA 3ORKA 1G8JA 2I0YA 2V55A 4EH7A 3EN6A 3QD2B 4MXYA 3LPBA 4W9WA 1JNKA 4DH8A 3SW7A 3DJ7A 2BZJA 3R28A 3Q04A 2ZV9A 3UYSA 4AZWA 3A7IA 4O38A 4ZP5A 5AV4A 1PXJA 2Z60A 4JXFA 4FSQA 4F9CA 4NFMA 2XKDA 4ASEA 4XLIA 5HCXA 5KHXA 2VTPA 5IZFA 5K5XA 2CNQA 3MWUA 3NUYA 4FTQA 4YZBA 5BVKA 4DEBA 4RJ3A 4FTUA 4F9BA 1BI7A 3ZLSA 5JFWA 3Q9ZA 4B8LA 2GMXA 4RT7A 4D1XA 4RPVA 5CAUA 3OT3A 3FI2A 3FJQE 3CEKA 2YCSA 4O2PA 2YWVA 4O7NA 3QFVA 4M68A 5GJGA 2YN8A 4M97A 4EUUA 4NSTA 5E7RA 4CYJA 2CPKE 3PXYA 3E87A 3I7BA 2XUUA 2QKRA 5M44A 2XNGA 4BCQA 3R1NA 3UGCA 1JOWB 3IGGA 2VWIA 2XYUA 4BCHA 3FQSA 3HP5A 1UV5A 3NFFB 3T3UA 5EQYA 3D4QA 4FIFA 2W4JA 4LGGA 3ENHA 4MKCA 5DT3A 4PDPA 2XIYA 4HVSA 2YM4A 4BY9E 3RAIA 2E9NA 3BQCA 4BF2A 2WTDA 4FVPA 1AGWA 1PKGA 3C4WA 4GJ3A 3ITZA 2GS6A 5KO1A 4TZRA 1PKDA 2GNHA 2BFYA 2GU8A 3R2BA 2Y6MA 2PL0A 5CT7A 3HDMA 3QCQA 1YXTA 3KQ7A 4ZAUA 3KXZA 3JUHA 3OCGA 2V7OA 4WG3A 5FP6A 4DTAA 3ORLA 1JKTA 3HMNA 4LM5A 3ZEWA 1FBNA 4JDKA 4JQ7A 1I44A 2JAMA 1ZY5A 3GCQA 3TKHA 3M42A 5IEYA 4WSQA 3KEXA 3Q6UA 2VTRA 3CS9A 4D1ZA 3EJ1A 3TUCA 3KXHA 4MBLA 3FQHA 1Q3DA 2XIXA 3EZRA 4FOCA 5HZNA 4AXDA 4JRVA 3ZS5A 1PXPA 3QA8A 3TNPC 5HLNA 3WOWA 2YAKA 3OXTA 4RWLA 4TWCA 2YDKA 4XG7A 3DKGA 1OL2A 3GT8A 2W0JA 3QTIA 2QO7A 4MNEB 4RQKA 3UE4A 5DR6A 5I5ZA 4O7YA 4FV7A 3U55A 2HZ0A 1WVWA 4U44A 1FVRA 3UQGA 3R7VA 2IZSA 5AWMA 3R8ZA 3UVRA 3C4FA 2X9FA 3BV2A 2UZVA 3VNTA 2F2CB 4M69A 3BYVA 4I94A 1NT2A 1QPJA 3OOGA 3BLAA 2R3JA 1XWSA 4TXCA 4J8MA 2OXXA 3KRXA 3AGLA 4DDIA 3VS5A 4IH8A 3R01A 2VX1A 4RIOA 5DR9A 3R1QA 2O8YA 5IUIA 4F65A 2FO0A 2QOHA 3B8QA 3RCDA 2O2UA 3ZXZA 4C4GA 3PVBA 3TTJA 2ZB1A 4MD9E 4XLVA 2XIRA 4IVDA 5IEXA 2WXVA 4AE9A 5EW3A 4J8NA 5GINE 4B4LA 4S33A 3ENMA 2YHVA 3QKKA 4FKJA 2OU7A 3COKA 4JQEA 1P5EA 4YU2A 5CEMA 3F2NA 3N4UA 2A0CX 2CNUA 2ITVA 4PTGA 5IQBA 1YVJA 5D41A 3QBNA 4NM0A 4DFNA 1IAJA 2Z02A 4CFNA 4NW5A 1YXUA 1CDKA 4ZTLA 4FYNA 3KRWA 5FEQA 4CKRA 2WEIA 4D4VA 5LVPA 4OTFA 2R0IA 4S31A 3PG1A 3Q4ZA 5CSXA 4BCGA 3JR1A 2XBAA 3GOKA 3KRJA 3E88A 3F69A 3LQ8A 3Q96A 3V5JA 4G6LA 3F5XA 3LLTA 1HCLA 5AADA 3FYJX 4RSSA 3RHKA 2BRBA 3UMWA 3V8TA 4K77A 3WZEA 4DEIA 3HAMA 3OWJA 4GSBA 4MXOA 4RIXB 3WARA 4F09A 4DBXA 2R3PA 1DI9A 1KE9A 2VX3A 5F1ZA 3DBCA 2YM8A 3ZONA 4CQEA 2X8EA 2YACA 4ZSJA 3U6IA 5ANJA 4EYJA 2VTQA 4RZWA 3ZRMA 3W2PA 5E90A 4IWOA 5T6KA 2XRUA 2VWXA 1VZOA 3P78A 3NNXA 1CSNA 4RJ7A 3BL7A 2R3RA 3TDVA 2VGOA 4FTJA 4XG8A 4FGBA 3SGCA 4WIHA 2UW7A 2XEZA 3DU8A 2JDVA 3PPKA 4FT5A 3OC1A 4L8MA 3HECA 4QPAA 2F49A 4U80A 3R9DA 4CZYB 2XANA 2C69A 3EQBA 2Y4PA 3B8RA 4LMNA 2QKWB 4IQ6A 4PX6A 5EW8A 2WTIA 5C4KA 1H1SA 3MPAA 4Y85A 5F20A 4CRLA 5AP5A 1A06A 2XNOA 2HYYA 3GBZA 1LEWA 1Q61A 4NTTA 2OI4X 3UVQA 4YUQA 4BDAA 4QYFA 5IA2A 4DF3A 3KC3A 3C4XA 4RMZA 4JR7A 2OICA 3F9NA 5EYMA 4RWJA 4IB1A 4M3QA 4W8DA 3WZJA 3G51A 5BVWA 3ULZA 4ANMA 4CTBA 5J1VA 5HNGA 3WF5A 1DI8A 4OTPA 3AQVA 3EQGA 3ZO4A 2Y7JA 1QPEA 1AD5A 5AMNA 4DT9A 2PMOX 3KF7A 4ACCA 4BTKA 2YDIA 5J7BA 2X6DA 1SNUA 5FBOA 3I1AA 3TV7A 3DXQA 3QZGA 4CSVA 3FZSA 5JSMA 4CGAA 3LQ5A 1XBCA 5HIEA 5IQFA 5T68A 3VBVA 3NMUF 1X8BA 4CCUA 2X2LA 3BLRA 3KXNA 3UO5A 3ZLWA 2BRHA 5FEEA 3FKNA 5C01A 1OM1A 5HBJA 2XM8A 1W84A 4ANSA 3RAHA 3IW8A 2V5QA 4ERWA 2PVKA 4LUDA 5TKDA 5L2TA 1NY3A 3HA8A 4BL1A 3QD0A 2E9PA 2GSFA 4AT3A 3LFCA 5CALA 4FEVA 4AQKA 4C57A 1W2CA 2BUJA 4HGSA 5BUEA 4ZSGA 5EK7A 4K1BA 5JGDA 4CLIA 4BCKA 4WUAA 3QCXA 4J96A 3WZKA 4CVAA 4FKUA 5DRBA 3PE1A 1YHWA 3Q9YA 3O8UA 5AV2A 1GIJA 3ALNA 4WHZA 2BCJA 3O7LB 3UMXA 3MFUA 3R8LA 1Q41A 3VIDA 2X0QA 2BZHB 5CSVA 2X2MA 5ANKA 1JPAA 4E3CA 3QC9A 4FTKA 3CQUA 3KULB 2BHHA 4BKYA 3MS9A 2FA2A 4ACHA 4ANQA 4CMUA 4IAZA 5EG3A 2OIQA 4RC2A 4UZDA 1UU8A 5E8YA 5C27A 2SRCA 3RZBA 4CFMA 2XNNA 1WFCA 2YITA 5JZJA 3E8EA 5CAOA 4YNEA 2EVAA 3LOKA 1QCFA 3BEGA 3D2KA 2IF8A 4LI5A 5TE0A 4AOIA 2VTLA 4C4FA 4PDYA 3MVJA 3SXFA 4EBVA 4RIWB 3PJ1A 4KNBA 3MJ1A 4C61A 1PF8A 4DHJA 4O4FA 4KBAA 3RINA 3DOGA 1YI3A 4RX5A 4A7CA 4I3ZA 3U54A 4A9SA 2C1BA 3G90X 5FDXA 5GJFA 2WMXA 1U46A 5M07A 3CKXA 3NZ0A 3VONA 2QODA 1Y8YA 2XCHA 3QQLA 4UX9A 5E92A 3FE3A 2RFSA 2UVXA 4KABA 4C8BA 4AN2A 4R78A 1YWRA 2VWUA 2Y9QA 3R7IA 5M4FA 3DGKA 2LGCA 4APCA 3LCTA 3N4VA 4UALA 2OSCA 2FSTX 4FKRA 4I4EA 1H26A 2PVJA 2Q0NA 2XZSA 3TNHA 2R3KA 4PNIA 3TT0A 3TV4A 2BROA 4K2RA 5HE1A 4OAVB 5GZ9A 3PSDA 4W4VA 1UNGA 5J9YA 4P5QA 4FTIA 2CNVA 2WOTA 2X0PA 2UZNA 4F7LA 2O0UA 3BYSA 5FRIA 5AP4A 5HD4A 3OUKA 5HTCA 5CQUA 4XG6A 4BZNA 2BRGA 1GNGA 3PVWA 4EOOA 1ZARA 4OTIA 4ASXA 1G8KA 2PUIA 4BDGA 3OEFX 1ZZ2A 1FMKA 4BR3A 4EL9A 3AMYA 3SC1A 3UP2A 4XMOA 1XR1A 4YJVA 5AP6A 3UIUA 3HVCA 4ZY5A 1U59A 3S95A 1SNXA 2A98A 2R3FA 5DVRA 1OGYA 3RJCA 3QZHA 4WG5A 3RNYA 3S3IA 1S9IA 5A3XA 2QOLA 5BVNA 3E8CA 1QL6A 2OJIA 4X2GA 5DG5A 3VUMA 3NCZA 4EH9A 4WUNA 2R3HA 2C6MA 2Y0AA 4JAJA 4ZZOA 3DLZA 3G0EA 3E62A 4MNFA 1KV1A 5ACBC 3UPZA 2EB3A 1Q8YA 3EHAA 4NKSA 3WF7A 1J7LA 3Q4CA 2IZRA 1GIHA 2ITWA 4A4XA 1XBAA 1JQHA 1RQQA 2GNJA 3QKMA 4NH1A 3VF8A 5CI6A 2PMIA 4LUEA 3WBLA 2Q0BA 2ZV2A 3PXRA 4R3CA 4BKJA 4IBMA 4BGHA 4C36A 1GY3A 5FEDA 3JY9A 3ODYX 5I0BA 3CQWA 3L8SA 5EQEA 1KOAA 4YJRA 1R3CA 4U97A 2Y4IB 3MY0A 4U40A 3BU5A 1PY5A 2O5KA 3CLYA 3BLQA 3G15A 4FF8A 4HVIA 2ITUA 4P5ZA 4AA4A 1Y6AA 4BKZA 4L9IA 1W0XC 3DKFA 4RG0A 3RKBA 1G8SA 3LLAA 2P3GX 5CSHA 3HRCA 4RFMA 4EK6A 1VYWA 3M11A 3NAYA 5KHWA 1MUOA 5E8XA 4XV1A 3UNJA 4LDTA 2XYNA 2O64A 3LXLA 3IECA 5HG8A 3Q6WA 4ZTMA 5AP1A 3IW7A 4FSUA 4FUYA 1LPUA 2P55A 3VAPA 2PVLA 5HLPA 4Y83A 3TIZA 4F9YA 4EUTA 3SXRA 3SA0A 1O6KA 3QUDA 4O0VA 3U4WA 3LMHA 2O63A 4GYGA 4L43A 4NYEA 2RFDA 2W06A 3D5WA 3EQPA 4HZRA 3RCJA 4BZOA 2FSLX 5DBXA 5JEBA 3NLBA 5BV3A 2VV9A 3F88A 5AR4A 3LFEA 3VO3A 1PRYA 2UV2A 3ZM9A 4MWIA 3O51A 1YWNA 2BPMA 4EC9A 3MTFA 2IO6A 4A07A 3LW0A 3OUNB 4AZEA 1M7NA 2FSOX 1XH5A 3LQ3A 3S0OA 5LMKA 1WCCA 3BGZA 5KMJA 4FTLA 3FQEA 1CMKE 2B9FA 4LOQA 5FXQA 4S2ZA 4K9YA 3K54A 4CFFA 4R3PA 4D58A 5IMXA 1G8AA 4C59A 5ICPA 5JN2A 1JKKA 5KE0A 2QG5A 5E8TA 5AR8A 3C4CA 4FICA 5A4TA 2C6LA 4F64A 4II5A 4EWHA 2X39A 2IZUA 3NGAA 4LV5A 3EYHA 5M51A 4D4SA 4CEGA 2REIA 2J0MB 3W0NA 4K0YA 2VN9A 1TKIA 4G6OA 2CKOA 4C38A 2ZVAA 5C03A 3PXQA 2ERKA 4J99A 3ZC5A 4U42A 1M2PA 1SVHA 3ERKA 3FLNC 3D7TA 4L7FA 2BAQA 3OZ6A 4E6QA 5D10A 3FY2A 1OITA 5LMBA 4AW2A 4E4XA 2WAJA 3I5NA 4JBQA 4W8EA 3THBA 5CVGA 3FZTA 1TZDA 5EYDA 2PZPA 5A4QA 3PDTA 3BU6A 4DFLA 4ONAA 4FTTA 3I0QA 2V62A 4RC3A 2HENA 4X7QA 3OD6X 4F7JA 4KIKB 4AN9A 4X3FB 4ASDA 4PMMA 2ZOQA 5AUYA 3ZFXA 1IA8A 5D1JA 3HKOA 4L44A 3KF4A 4HPUE 1HOWA 1K9AA 4NZWB 4YJUA 4E4LA 4X6RA 2VWWA 4GK2A 1Q3WA 4H39A 3A7FA 1M2RA 4IXPA 4B0GA 3FMMA 1DS5A 4XV3A 2ONLC 5JQ8A 2PWLA 3VUKA 3FPMA 4GVJA 4UYNA 4QP1A 1UKIA 5CYIA 4BIBA 3KCKA 2Z7SA 2C5VA 3FI8A 4TL0A 1BKXA 2BMCA 4XBUA 1P2AA 4IZYA 2ZJWA 3HAVA 4FV0A 1BMKA 1RE8A 3E8DA 2H34A 4FG8A 4YURA 4EONA 3C4EA 3GCSA 4C2VA 3HZTA 4DLIA 4G9CA 4QO9A 5M53A 3QHWA 4EEVA 1JAMA 4QMOA 3BLHA 4D1SA 2W9ZB 3AC4A 3TI1A 4BWXA 2OH4A 3HV7A 1R0EA 4XV2A 3RI1A 4IM3A 3MFRA 2B9JA 3W0RA 3VN9A 2WMUA 4DAWA 2PZ5A 1XO2B 2W1HA 4L42A 4MXZA 4WA9A 5E1SA 2YDJA 3MY1A 3I60A 5KMNA 4LV7A 1SMHA 4OT5A 1JSVA 3O50A 4FSYA 4YLJA 2VO6A 5K4IA 1H07A 4RX9A 3QTXA 2BIKB 3P7AA 3IDBA 4PTEA 4XEYA 4D9UA 3MV5A 3P5JC 5J5SA 3UG1A 5C9CA 4UBAA 4G34A 3R04A 4DCEA 5FUTA 5JK3A 1OIUA 3DTWA 4O7TA 4R5YA 2A27A 4ZY6A 3ZSIA 2HOGA 5EI2A 1WBVA 3ZC6A 3FMEA 5I9ZA 4HYHA 4F6WA 3BL9A 4JQ8A 4FE2A 4I6QA 4FSTA 3P08A 5HIDA 1OL1A 1KUTA 3BWFA 4AXFA 3I6UA 2QHNA 3CSVA 4PPBA 3RALA 3RZFA 3TWJA 4BDFA 2GNGA 1FGIA 4FIHA 4IWDA 1J1CA 5H8BA 3QHRA 2GTNA 4AXCA 5J79A 4AP7A 5IISA 2JBOA 3TKIA 3DK7A 2EXMA 3FSKA 2WIHA 3G5DA 4FTAA 3QRTA 3CXWA 3SQQA 3SRVB 5GHVA 2C1AA 3WI6A 3AT3A 4PQNA 3HV6A 4HVDA 4A06A 1TQPA 4I4FA 4UB7A 4W4XA 3V8WA 4WD5A 3EFJA 4E20A 3A8XA 4CT1A 2IG7A 4NCTC 5E8SA 2PVMA 4DFYA 4YHFA 2CGWA 3GC8A 1IA9A 3KN5A 2QO2A 4L67A 3H9RA 3QQKA 4I21A 4G16A 4BBEA 4EHVA 5EI8A 5DEWA 2ZFYA 1BYGA 2WD1A 3FLQA 4ZTSA 2GQRA 3OCSA 2VTTA 1YXSA 3QTSA 3A7GA 2ACXA 4GK4A 4RGJA 1OPJA 3UZRA 2CGUA 3R7YA 1LEZA 2ZB0A 2UZLA 2CGXA 3I4BA 4IZAA 5AP7A 1ST0A 4YC6A 5EHLA 3FMLA 1FINA 3ORPA 3QTUA 3AMBA 2AC5A 5JMSA 3OCBA 4EWQA 4F7NA 2AEGA 4KRDA 4BVUA 3MVMA 5CNOA 4B99A 1MP8A 2OKRA 4N70A 2R2PA 3QQGA 4ZJIA 3TCPA 4RJ5A 4DN5A 2J4ZA 4XYFA 2VO7A 4FZFB 5J8IA 2ETKA 2HZ4A 4Z9LA 3C9WA 4YZ9A 4QMQA 2QOOA 3QD3A 4AW5A 3AXWA 4D9TA 4ANNA 3R0TA 3MJ2A 4QMMA 4XHKB 5AUTA 1WBSA 3UG2A 4IAKA 4IVBA 4BFMA 1CKJA 5CQWA 2ZV8A 3TXOA 4O86A 4CCBA 4CXAA 4X2JA 2VTJA 1Q99A 2YABA 5IU2A 3OP5A 4HYUA 3UTOA 1NA7A 2JFMA 5EDQA 3EQIA 1H1QA 2XMYA 4RLKA 3R9RA 3RK7A 5I9YA 3R73A 2CLXA 3BHYA 2ZMCA 4RVLA 3GQIA 4YTIA 3E63A 3R02A 3PFYA 3DNEA 2C68A 5M55A 5CXHA 1Q62A 3D15A 4RA4A 5BYZA 4KKGA 5EM7A 1KV2A 3DKCA 3F3WA 3ZFYA 1VEBA 4RLLA 5IQHA 1PW2A 2RGPA 4CMTA 3UIXA 2WMVA 3T8OA 4ASZA 2F4JA 4ACGA 4DH3A 4ZZNA 2P33A 2PZIA 2GS7A 4ALWA 3OTVA 2I1MA 4Q5HA 5AR5A 5M4CA 2W5HA 3NDMA 2YM3A 3VBYA 3OT8A 5JKGA 4IDVA 1YHSA 4BHNA 5JRQA 2F7XE 1WZYA 4H36A 4IB3A 3CTHA 5EM5A 2HXQA 1U5RA 4M69B 3ODZX 4PL3A 4BIEA 1H00A 3LE6A 4L3PA 3CD3A 4USFA 2PVYA 3F3VA 3W2RA 2CLQA 3ZSGA 2ITOA 3DTCA 1WBWA 3R7UA 2J90A 3LCKA 3SKCA 4M12A 1CKPA 3I5ZA 4I6FA 3NS9A 2FUMA 3QLGA 1KE5A 5E9EA 2R0UA 2WQMA 4IAFA 2JDRA 2VUWA 4FODA 4TT7A 4YZDA 4QYHA 4OBQA 4ZS0A 4QTCA 3BELA 3C7QA 2QC6A 3MI9A 4YP8A 2H8HA 1P4FA 3C5IA 5D7VA 4FC0A 4CV9A 3KA0A 2DS1A 4QMSA 1LUFA 3GXLA 5KCVA 1Y91A 5LMAA 4ANBA 5J7HA 3PE2A 5A54A 3QQFA 5G6VA 4GKHA 1BX6A 2O3PA 3SRVA 5DWRA 1BL7A 5AR3A 2C6IA 3C13A 3ZLXA 3C4ZA 3ORTA 1DAWA 4MF1A 3EB0A 4OLIA 3HRFA 4EZ3A 5CEKA 5L8KA 2XIKA 3ZRLA 4JVGA 3MIAA 4BJJA 5CAQA 4RFYA 2GDOA 3O8TA 4EKKA 2EB2A 2G2FA 3B2TA 4YPDA 4EH3A 4MQ2A 2GQGA 2XNMA 3EFKA 4FKTA 4GFMA 4UZHA 5CAVA 5F4NA 5FDPA 3BQRA 5TT7A 3NX8A 3SHEA 1UWHA 3HYHA 4ALUA 5JT2A 5HU3A 3PJCA 3EQDA 1TVOA 3R9NA 1YWVA 3JPVA 5HVYA 5L2SA 3VJOA 3F5GA 4ALVA 2FGIA 5E4HA 1PMNA 1YDSE 4NWMA 4Y5QA 4ARKA 1U54B 2W1DA 3KKVA 3MW1A 4H3PA 5EOLA 4IACA 3GUBA 2XM9A 3ET7A 4AXEA 2X0OA 4JBVA 4PL4A 1GIIA 2YM7A 3FMNA 2B9IA 3FXWA 4FUXA 4DLJA 5DMZA 3PA5A 4Z3VA 5AJQA 1OL7A 5CU3A 3RP9A 2ITPA 2XNBA 4G17A 4F0GA 1WVYA 3G0FA 5AP0A 4QQCA 3ZM4A 2BAJA 4I0TA 4Y5HA 3HA6A 3NRMA 4FV8A 4OBPA 5EI6A 3VS7A 3G9NA 4IANA 4E26A 5D9HA 4I41A 4P4CA 5ETAA 3ACJA 4I92A 1YKRA 5CTPA 4BGGA 3UZTA 3WIKA 5IQAA 4YGAA 2FSMX 4FTRA 1MRUA 5HORA 4TWPA 5L3AA 3EYGA 5AIKA 4CFWA 3WZUA 2WTVA 3ULIA 2C5NA 3O8PA 3OVVA 1VLRA 1OKVA 2UW9A 2P2IA 3ALOA 4O0WA 4BYJA 4MF0A 4DT8A 3AD5A 3QTRA 4JDJA 4IX6A 4QMNA 3R1YA 4NT4A 4WSYA 4X21A 2NNWB 1G3NA 2XF0A 3TTIA 2J0JA 4TNBA 4AAYA 1J1BA 4AFEA 2QU5A 3MVLA 4RRVA 3MH2A 4M7IA 5H2UA 5JH6A 2XALA 1NXKA 3ML1A 4BCMA 4OR5A 2DWBA 2XNEA 3KRLA 2A19B 3P7CA 5HE3A 3A99A 3NUSA 1CM8A 3EOCA 4FNXA 4LYNA 5ETFA 3V6SA 1YDRE 1W82A 2W1FA 3T9IA 1H8FA 4G6NA 5HIBA 2ITZA 3FHRA 2VWBA 5FGKA 2IZTA 3MSSA 5CT0A 5IQDA 3OFMA 4YBJA 4U9AA 2EWAA 3ZBXA 3PPJA 1PXNA 3LFNA 3CJGA 3PA3A 3EQHA 3PZHA 4IE9A 2IPXA 2WEVA 3BBWA 4QQ5A 3HMIA 4MYGA 1ZWSA 3EFWA 1GZOA 2DYLA 2GNLA 3GFEA 3R71A 3WYYA 4F08A 4ITJA 3EQFA 4YSMA 2XJ0A 5EH0A 2C3IB 2XRWA 3D2IA 4PP7A 5LOHA 3CQEA 3ZZEA 4C7TA 1Y57A 4L3JA 4V04A 3D94A 5LWMA 4O84A 1FPUA 2BZIB 5IH4A 2PUUA 3RPYA 4Z55A 2PMNX 3VJNA 1RW8A 3RTPA 3DLSA 4J53A 4IX3A 3U6HA 3FSFA 4L46A 1NVQA 2GNFA 4TYHA 5EHOA 3ZHPC 2OW3A 2P0CA 4QYYA 4TYIA 2IWIA 1XH4A 4A9UA 1GZKA 2PVRA 2G9XA 4IM2A 4V01A 3V3VA 4FV9A 2UW4A 3FAAA 3LAUA 1W83A 4E5AX 4EHGA 3UYTA 4OTWA 4PDSA 3C0GA 3MPMA 3PIXA 4C4IA 5IF1A 4NK9A 2WNTA 3GB2A 5DGZA 2KTYA 2YFXA 5AR2A 2NRUA 4RZVA 2I0EA 3BE2A 2F9GA 4EQCA 1H24A 2BDFA 3BHTA 4B6LA 2R3QA 4CG8A 4OGRA 1BLXA 1U54A 4AGCA 5I9UA 3WF8A 3IO7A 3LKMA 4OTHA 3OROA 3VUGA 1YOLA 2B53A 5I9VA 4JR3A 2X7OA 2ITNA 1XQZA 2CSNA 3IG7A 3UZPA 3Q60A 4R77A 4O7VA 3IK3A 4DFUA 1ZYJA 2X7GA 4GIHA 3OY1A 4EZ7A 5JRSA 1VJYA 4CZUA 5IUHA 3BHHA 2NP8A 4M0YA 3OWPA 2WFYA 5DPVA 5CASA 3GC9A 3P7BA 3QCYA 3IONA 4QOXA 4QMYA 1Q8WA 1S9JA 3TKUA 2F7ZE 4JS8A 1ERKA 3VBQA 3LHJA 1REKA 2NRYA 5GIOE 5A9UA 1YXVA 4XG4A 3VVHA 4OAUC 2JIIA 3PXKA 4L3LA 3VS2A 2UVYA 4L53A 4DBNA 2V0DA 4YLLA 4O7LA 2J0IA 3IW4A 4XS2A 4CKIA 4BCNA 5L8LA 4CFVA 2UZTA 2GQSA 2VTMA 4YSJA 2XCKA 3W1FA 3KMMA 1ZMVA 3PA4A 4DITA 4FR4A 4ZY4A 2C6EA 4ZTHA 3ZMMA 4FZDB 4I5PA 3JYAA 3E3PA 4J52A 4LV8A 3M1SA 3IPHA 2RFEA 3OW4A 4E5BA 5BVOA 5IDNA 4ZLYA 4M66A 4G9RA 4RC4A 4WT6A 4EOIA 3A2CA 2B55A 1V1KA 3FUPA 4QP2A 4D2WA 4UV0A 3NIEA 4HW7A 3RNIA 4L52A 3DFCB 3W10A 4EK3A 2VTOA 2UZBA 4QP9A 4KD1A 4RFZA 5C8NA 3ATTA 4ANLA 2QOIA 5DIAA 3AOXA 3TZ7A 4QTBA 4CFXA 5E8VA 3MY5A 5CEPA 2VTAA 4G3FA 3ZU7A 1XMMA 4IJPA 3KN6A 2YA9A 3PTGA 3VRYA 4TYJA 3SD0A 2IVSA 3FLYA 2CHLA 2YIWA 4FZ6A 2GTMA 2BKZA 3CTQA 4JRNA