1WBOA

Fragment based p38 inhibitors
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Fragment-Based Lead Discovery Using X-Ray Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wboA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wboA01
2JDVA 4BBMA 4CTBA 5I9WA 4KBCA 2VD5A 2W9FB 5AA9A 4K9YA 4X6RA 5EYCA 4UB7A 2CGUA 3FXXA 1TQPA 3S00A 4FKOA 2W06A 4TWPA 5A4TA 2BVAA 4NUSA 2PVNA 3QX2A 4CQGA 4CMTA 4CKRA 5BNJA 3HL7A 2QVSE 4AN2A 2QOOA 5CAVA 3PP0A 3UOKA 1DS5A 4JBPA 4DG2E 3SGCA 5KMKA 3BCEA 4XBRA 2OFUA 2XK3A 3C1XA 3F82A 3DXNA 5A3XA 3ZDIA 3LCTA 4XUFA 1CTPE 4QQTA 5LMBA 5A9UA 2R3MA 3E93A 2WB8A 3NYNA 5KMJA 4A4LA 5DHJA 3A4PA 3QAME 5GZ8A 3WOWA 2VWWA 4E5AX 3E7VA 3Q96A 3BEGA 4NU1A 4CG8A 3ZRKA 3RBWA 1G8AA 3PJ1A 5M53A 5EW3A 4FZ7A 4JX3A 3QF9A 2UW3A 3AQVA 3R02A 4MVFA 5CEIA 4I92A 4FV3A 4B9DA 2JDRA 3FJQE 3LXKA 3R8MA 1UU9A 3EYHA 4I6QA 4ZTMA 2VGPA 3OZ6A 1JPAA 2HAKA 2HZ0A 3A8XA 4MBIA 4J71A 4UWBA 4YGAA 5IEVA 4FTQA 4M15A 4NT4A 5L4QA 3FLWA 3LFQA 3QHWA 4I41A 4P4CA 4ZS4A 3BGQA 3GEQA 2BRBA 4O7ZA 4C35A 5KHXA 4K1BA 2ITPA 5DR6A 3FQSA 3IONA 4UXQA 3A7FA 3BYVA 3FI4A 5CNOA 4ZTRA 1OBDA 3VRZA 2J0KA 3LLTA 4BCKA 5AFVA 4H36A 3W18A 4X3FB 4DEDA 3VULA 3FLNC 1Q24A 5H8GA 1M17A 4GRBA 3TV7A 4F1TA 2CCHA 3FZSA 3KXMA 4LOPA 3G51A 1NT2A 2W1GA 2P0CA 3DBEA 2VWXA 4Q2AA 2B9HA 4XP0A 5J95A 1XO2B 4PV0A 3UNZA 3VJNA 3RPYA 4BI0A 4R7BA 1R78A 2DYLA 3GNIB 5AM7A 3LQ8A 4KAOA 1UKHA 4CRSA 2YAKA 1YKRA 3Q4CA 1ZYSA 3K5UA 3G90X 5CS6A 3A2CA 4W9WA 4B8MA 4CT2A 3T9IA 4DBNA 5AR8A 1AD5A 3QC9A 4YZ9A 4JDHA 4F4PA 3P23A 5BYZA 4KIKB 4AOIA 2HK5A 4Q5EA 4EBWA 4LGHA 4TPTA 4EH4A 3M11A 4BDFA 3DGKA 4EUUA 3NZ0A 1REKA 1KV1A 3FLQA 1BYGA 2Q0NA 3TUDA 3W2QA 3RVGA 2BDJA 2BKZA 1B38A 1FBNA 5K4JA 3OCSA 1OKYA 1G3NA 2HIWA 3IW6A 4J52A 3HDNA 4KIOA 4QQ5A 4AZFA 4APPA 4DN5A 5HVKA 5J1VA 5G6VA 4L7SA 3QD3A 3I1AA 2R3GA 4L68A 1ZY5A 1G8SA 3PLAE 5JFWA 2XK8A 4P90A 3KRLA 3QQKA 5DN3A 5TE0A 2PE2A 1MRYA 3OY3A 3U4UA 3SC1A 3C50A 5GNKA 2YDIA 4QYHA 3REPA 2HELA 4UXLA 3VN9A 3CQUA 1OKVA 2F4JA 3BI6A 3PIZA 4FODA 4KRCA 3C0IA 5AP3A 4QP9A 4BTFA 2WQOA 3FAAA 4F1MA 1T46A 3Q4UA 2VWYA 1XJDA 2R0IA 4GIIA 2G2IA 3QTQA 4M13A 3GCUA 3UIXA 5K5NA 4H05A 1Y8YA 1J1CA 4TWNA 1NVRA 1PY5A 4YURA 5E8VA 2JITA 2PVLA 2X8EA 3SW7A 3E8EA 2OGVA 4E4NA 4AFEA 4I23A 3UP7A 4GL9A 3IQ7A 4ZP5A 3ORXA 3WF8A 4RFMA 4AW5A 3A61A 4ZTLA 4L44A 2VTIA 3QHRA 1UVRA 3O7LD 4MD8E 5M51A 5EQYA 4PL3A 5AIRA 5ANOA 5DI1A 3PXZA 3OD6X 3RK9A 4M69B 5IQCA 2E9PA 5BVDA 2QOQA 4KSPA 5L3AA 3S3IA 5IH4A 3BLHA 3FZRA 2OF4A 2ITZA 2DQ7X 2BILB 1G5SA 5CSHA 2BTRA 2WMRA 3UOHA 4YC3A 3HV6A 4YBKA 5JQ8A 5K9IA 3AC2A 3HRFA 2QOCA 3HAMA 4CV9A 2Y9QA 5GJFA 5AV2A 4U41A 2W1HA 3LHJA 2XZSA 3G33A 4JOAA 4U80A 5FWKK 4BZNA 3TUBA 3HMPA 3RZBA 4DH1A 5H8EA 3GVUA 5CXHA 5BVOA 1Q8WA 3C0HA 3KXZA 4R3RA 4CYJA 2O0UA 1W84A 4FVRA 4FZFB 2R5TA 1BI7A 4J98A 5BUEA 1I44A 2XCKA 5KBQA 4WUNA 4I94A 2IZUA 2GNGA 3H30A 5LMKA 1GY3A 3QTXA 5GIPE 2JAMA 4P2KA 5C8MA 1SM2A 2ZJWA 3G9NA 4CEGA 4C02A 2I0HA 4IACA 5CT7A 5J5TA 4QTBA 4RC2A 4O7SA 4ASZA 4X2JA 4I93A 5EH0A 4F0IA 2UV2A 2BRMA 3VS2A 1SVGA 2VWVA 4IX6A 4L8MA 4N4SA 5IEXA 4FEXA 5TT7A 4LV8A 4LQMA 3UG1A 3HX4A 1HCLA 4AQCA 3AMYA 4DEHA 1UA2A 3OUKA 3TZ8A 4EH6A 2X6EA 2WTKC 4GFGA 4O1PA 4O0RA 3CE3A 1W98A 4D4VA 4YPDA 4MCVA 3AT3A 3HLLA 2IPXA 4H1MA 4IZ5A 2AC3A 1OPLA 4WA9A 3KK8A 3PY0A 2GHGA 4BCMA 1GZ8A 2CGVA 5J9ZA 3CP9A 2YIQA 5E8SA 2IO6A 3VAPA 2OJ9A 5HI2A 4GMYA 4HJOA 4BTJA 2ERKA 1S9IA 3PY3A 3QQFA 3NW7A 1O9UA 1Q41A 4FIHA 4FTKA 5FM2A 3W32A 4HVDA 2ZV7A 3AD4A 1L3RE 4ERWA 2CJMA 2EWAA 4FIFA 4MXXA 4PX6A 4F0FA 4GVAA 4IWQA 4YSMA 1J3HA 4GIHA 2GCDA 5JRQA 4U6RA 2QOLA 2GS2A 4AX8A 2VU3A 2W1DA 3F9NA 3VO3A 5D12A 4FGRA 4U40A 4GKIA 2VTTA 4AN3A 3QUEA 4QPAA 4DT9A 4G34A 1UKIA 4FOBA 4BCJA 1F0QA 4S30A 2ITNA 5KKRB 4EH3A 3ULZA 4I0RA 1J7LA 3R9HA 2WGJA 2WOUA 3ELJA 4DH7A 4EL9A 4U8ZA 4QMZA 3OROA 4UWCA 4O2PA 4NWMA 4H3PA 4F6SA 4A4XA 4HNFA 3BU3A 4FOCA 3SOCA 5ETAA 2PULA 4ZXTA 4HCUA 4FNYA 5AUTA 4FV5A 4O82A 3D7ZA 5LARA 4F6UA 4UN0C 4KNBA 4JR3A 2C6DA 4IVCA 4MAOA 3IOKA 4BI1A 2PVRA 3BYUA 2RGPA 3C4FA 3COHA 3KEXA 4FK6A 3W2OA 3GC7A 2J0LA 4XG7A 4EH9A 3C5IA 2EU9A 5KMLA 3OS3A 3QQLA 1OL7A 1OMWA 5JKGA 4RWKA 1XH9A 3THBA 4E6AA 2FSTX 4Y73A 4N70A 1M2QA 4L42A 2PVJA 3EZRA 1A06A 2C0OA 3DTWA 3GT8A 4ZTSA 3WZUA 4RX5A 5J5SA 5JT2A 3LLAA 2HOGA 4RIXA 5KMMA 4EKKA 4ZZOA 4S2ZA 3QZGA 4D1SA 1QCFA 4RIWB 4BTKA 1WBWA 2C3LA 3FBVA 4D2PA 4EYJA 5HCYA 4BDJA 3RK7A 3BBWA 5EOLA 5DGZA 5AA8A 3JVSA 3QQUA 3RAHA 5KX8A 3D2KA 5LMAA 1KV2A 5E8TA 4ZK5A 4EONA 3OXIA 3TZMA 3PDTA 3QTIA 2XIXA 4RIYB 1YXXA 3U54A 5HIDA 5L6WL 4AZTA 2W05A 3CJGA 3W33A 2G2HA 3UDBA 1LR4A 5HU3A 2B52A 4DTKA 1FQ1B 2Y0AA 4V0GB 4Y8DA 5CU2A 3RNYA 4GJ3A 1EH4A 3TNQB 1GNGA 3MVLA 2BTSA 2P2HA 2WIHA 3IGGA 4OT5A 3V8WA 1Q8TA 5AR3A 4EKLA 5HLNA 1YXUA 3DS6A 2XCHA 1JNKA 2IG7A 3NWWA 1WBPA 2X7GA 4II5A 3HRBA 1WVXA 5IQEA 3HV5A 4IMYA 4BRXA 3H9FA 5DR2A 3ZLYA 5L2IA 3WZEA 5IDNA 5CU0A 5HESA 3R1YA 4G3FA 4TYJA 3ZM4A 3RHKA 2OH0E 1UU8A 5DT4A 2IZRA 3QRIA 4XYFA 2A0CX 1J7UA 3G6HA 2NP8A 5L6PA 3DKFA 2GTMA 4KS7A 1WBNA 1H01A 3OTVA 1M2RA 5CAUA 4KB8A 2XJ2A 3GC8A 4FZ6A 4V05A 4F6WA 5DEWA 3DKCA 4MHAA 3UPZA 2YJSA 4XX9A 3UTOA 3COIA 2JKOA 2J0IA 3R21A 3ZMMA 4BR3A 1GJOA 1OL5A 1IRKA 2CHLA 2HY81 2R9SA 4JAIA 4RPVA 4RVKA 4ANMA 1JQHA 5FBOA 2UZDA 2J51A 4O86A 4X2KA 3W8QA 5TF9A 2QG7A 1YW2A 2XIZA 2UZOA 4U43A 1KSWA 5EM6A 4HGLA 4S32A 4XLVA 3W2SA 1Q3WA 1Y6BA 2WU7A 3QX4A 4Z7HA 1OGUA 2OW3A 4U42A 2OZAA 1KE8A 1XBAA 1M14A 4MQ1A 3V6RA 3QKMA 4YZMA 2ITVA 3MH1A 4K18A 5IA3A 3TDWA 3NCZA 2C1AA 5F20A 3BIZA 3FMDA 1FVTA 2X2KA 3HYHA 3ALNA 4M68A 3I0OA 3ACKA 2RFEA 4JIKA 3TL8A 3KULB 4LYNA 1RDQE 2VTRA 3L8XA 1NVSA 2WMAA 4EH8A 2PMLX 3E87A 5BVEA 3I7CA 4A9YA 1MQBA 3FSKA 2J5FA 3DBQA 3ZEPA 3PRFA 4C0TA 2VO7A 4DFXE 2EXCX 3RKBA 5AX3A 3BX5A 2EB2A 3K3JA 4MQ2A 4KUJA 1CM8A 3FY2A 2PVKA 4CRLA 5FTGA 2Q0BA 5LWMA 2OICA 4IADA 3O8TA 4WOVA 4YTCA 5BVNA 5TR6A 3OCTA 2ESMA 2C5OA 4FV9A 4K0YA 3SRVA 3KN5A 1XH7A 4RWLA 3C4CA 4FTJA 2BKKA 4BKYA 3A7JA 4O21A 2LAVA 5EQEA 4RJ4A 2QG5A 2FSMX 4IVDA 4A9UA 5FG8A 4BDEA 4UX9A 5FGKA 3F6XA 3UE4A 4MXYA 2ZVAA 4DH5A 2G1TA 5GZAA 3R71A 4ZTHA 3IS5A 3R2BA 2J6MA 3SLSA 5CASA 4IH8A 5AR5A 5J8IA 3TV4A 3VW6A 4USFA 1WCCA 3NUXA 2W4JA 4O0XA 2BROA 3B8QA 2WTDA 3ANQA 5TKDA 3ZC6A 2PVFA 4EHVA 1S9JA 4QRCA 2GS6A 3P7AA 4PL5A 4KINA 4C3FA 2ZMDA 4HNIA 1H1RA 2C47A 2PUUA 3AOXA 2I0EA 3MIYA 3ZC5A 2QOBA 4CTCA 5I5ZA 3ZOSA 4BDKA 2XIKA 4NL0A 1YWVA 3JY9A 4RZVA 2YDJA 3Q2MA 4GU6A 4BN1A 3BYOA 3GU5A 4RC4A 4F9BA 4G1WA 3MTLA 5DLSA 2QO2A 3Q4TA 3V04A 2B9JA 3QL8A 4BKJA 4FTIA 4QP7A 3UYSA 1OIQA 4I20A 3N4VA 3O50A 5BUIA 5IUIA 5LQFA 5EYKA 2C0TA 3Q9ZA 3LQ3A 1XR1A 3CS9A 4RX9A 4U3ZA 3N51A 4PUZA 1Q99A 2W1EA 4C36A 5LWNA 4ERKA 2PZRA 3P7CA 3GXLA 4ZLYA 2A4LA 2BR1A 3BRBA 4D1ZA 4ACCA 1UNGA 3OCGA 3U9NA 4F7NA 4E4MA 4HCVA 2IVUA 5EI8A 5FTOA 4TRLA 4XG9A 5AV0A 3CGOA 4DFLA 3P79A 2PYWA 3OW4A 1KE6A 4I4FA 3ENMA 2WQMA 3KVWA 3GP0A 4QP6A 2YLFA 4TYIA 2OXDA 2CKQA 4XBUA 4XOYA 5E1SA 1SMHA 3AMBA 3KXHA 1K3AA 3RWPA 4IXPA 4D2SA 4X3JA 3E92A 4AFJA 4U5JA 2PPQA 4Q9SA 2Z8CA 3W8LA 4O0UA 2YWPA 2RG5A 3TEIA 4JVGA 4FIIA 2PK9A 2PHKA 3IO7A 3K5VA 2YERA 3BBTB 3ZUVA 3SVVA 4FTLA 1OBGA 5A14A 4UMTA 4DT8A 4ALVA 5HBHA 4FKSA 3N4TA 3H4JA 4TYGA 3DAJA 3MPMA 4DGOA 2CGXA 2CNQA 5EM8A 3KRWA 4UV0A 3QBNA 3CPCA 4YZBA 4BWKA 4IC7A 5FUTA 4MNEA 5DBXA 2PUNA 2CLXA 1DI8A 3MPAA 5AAEA 2Y7JA 3IW7A 4L6QA 5HE3A 2OK1A 3FLZA 2X9EA 4FTMA 4EBVA 3TXOA 4CFUA 3A62A 3EB0A 4FIEA 3TJDA 3A99A 3W2RA 4D5HA 1CMKE 2QHMA 2PMIA 1XH8A 3FYKX 1GZNA 4EHEA 4PP7A 4QNYA 3VWAA 4BCPA 3RMFA 4HGEA 3D0EA 4OBOA 4GS6A 4YR8A 5IA1A 4CFMA 3D5VA 2UW4A 2YACA 3R8VA 5KCVA 5LOHA 3TTIA 1PXPA 1VR2A 3NVKI 2OWBA 5IUGA 5FEQA 4ZZMA 4JLCA 5HTBA 4EJNA 3ZYAA 4FKLA 4D9UA 4RFYA 3L8VA 4F9CA 5D11A 3VF8A 4IEBA 3R04A 4LV5A 3NNUA 4I21A 1OL6A 3GB2A 3PVWA 3VUKA 4FV4A 4RJ8A 3PJ8A 4XEYA 4FV0A 4O7NA 4XG3A 2W4OA 4QTEA 2HZ4A 2W1IA 3R00A 3SKCA 4DGMA 3EQGA 3WIGA 5L2WA 4YHFA 2DUVA 3AG9A 5EYMA 3R01A 4GYIA 5HKMA 4ZY6A 5CVGA 3E62A 4DEAA 4LMNA 2UW8A 2ETKA 3CR0A 4ITIA 4C8BA 4D4RA 1JKSA 3QQHA 5HD4A 4YC8A 3KC3A 5HGIA 2W5AA 2VV9A 3OEZA 4U45A 2NRYA 4HCTA 1WBTA 3DY7A 2W96B 5H3QA 4KRDA 4D2WA 2B53A 2OIQA 1YDRE 2XK6A 3LM5A 3EIDA 3OTUA 1LEWA 2X0GA 4I4EA 4J97A 5FP5A 4C2WA 4EOLA 1PXKA 3ZHPC 3KRXA 5IQHA 3R8ZA 1CSNA 2V0DA 5AUZA 1X8BA 2WEIA 3LXNA 4NCTA 4OTHA 3UC4A 5FLFA 4HYIA 4FMQA 2GTNA 3QYZA 4G3EA 4ZZNA 3PA5A 4FR4A 4HPUE 3RM7A 4A9SA 4DG0E 5CEPA 3V5PA 4B7TA 2CGWA 3LCKA 4R7IA 3DU8A 3LIJA 1U46A 4J8NA 4ONAA 4A4OA 2R3FA 3S95A 1UWHA 2R2PA 3AT4A 5HNBA 5JFSA 4EK4A 4ZMEA 3ZLXA 4AP7A 4FV8A 2UW5A 2YLEA 3PXQA 4EC8A 4BDBA 3O51A 4LL0A 1YHVA 4A07A 3VS6A 5J79A 2X2LA 3HP2A 2OF2A 4DLJA 2YM3A 4M84A 3PXRA 4FTUA 1CKPA 4NJDA 4FYNA 2B55A 2ITTA 3MN3A 3QTUA 4O6EA 3PUPA 5CF8A 2WKMA 2PZYA 2YCRA 4LFIA 3VNTA 3ZTXA 4DGGA 4RVTA 2OIDA 3W2PA 2WMTA 3R6XA 1QPEA 3OWKA 3ZFMA 4ZMFA 4X21A 3FI3A 4Y46A 2YEXA 4ARKA 1Y57A 1FINA 4QMLA 5HCXA 4ZJIA 5C01A 5IH5A 3OWPA 4AA4A 3CTQA 4JQ7A 2PVHA 3L8SA 1P4FA 2R3OA 3UP2A 4C4FA 4MF0A 3DXQA 1YI3A 4KWPA 2PSQA 3QCXA 2C30A 4OAVB 2QC6A 3UO6A 3MW1A 3HDMA 2BAQA 4FT3A 3LKMA 3UPXA 3NW5A 3MFTA 5C8KA 3NIEA 3EN9A 2VWIA 3P86A 1WVYA 4I0SA 2PUIA 4UZHA 4O7WA 5M09A 4JRNA 3LFNA 1IEPA 2VUWA 4N6ZA 5FRIA 3ODYX 4XV2A 1FPUA 2ZB0A 5ACKA 2HY0A 3P5KA 3Q32A 4OBQA 3NUYA 3QD2B 5AP7A 5E8YA 3TJCA 3P9JA 5BYLA 5EKOA 2BRNA 5FBNC 3OWJA 3QYWA 3OCBA 4V01A 5BMMA 5T6KA 2JDTA 4AOTA 3FPMA 4AN9A 3LQ5A 2BIYA 4MNFA 4RWJA 4U97A 3V8SA 4C59A 3FDNA 2BZJA 1R1WA 1ZOGA 1LPUA 3TNPC 4AZVA 2W1FA 5ETFA 3JS2A 4MD7E 4FGBA 3MVHA 1PF8A 3GFWA 1U4DA 3MFRA 5HD7A 3DOGA 5BVWA 4ZS0A 4A9TA 4MYGA 1IA8A 3QC4A 4Y83A 4PL4A 4ZSLA 4E93A 4EORA 2UW0A 4QMUA 3T9TA 1GIIA 1OB3A 2YM5A 4RWIA 5EDPA 4U0IA 3DNEA 3DK6A 5AAGA 4DA5A 2I0VA 4BCIA 2Q83A 3DXPA 4RMZA 3TZ7A 4NKAA 1OL2A 3PZEA 4FZDB 3D15A 1YDTE 2VTSA 3FL4A 3MH2A 4FSZA 3VW8A 5D1JA 4FKTA 4EOOA 3TT0A 4AOJA 5DRBA 1H8FA 5K3YA 2XBAA 2ERZE 3LCSA 3I4BA 3NPCA 4JDIA 1PYEA 3GGFA 4HYHA 4R1VA 1WBVA 3W2CA 3ZZWA 2QI8A 3DPKA 5HX6A 3GENA 2O8YA 5DPVA 5A54A 4J95A 4J8MA 1Q97A 3FMLA 4FIGA 3AGLA 3PG1A 4K8AA 5J7BA 2Z02A 3KGAA 3KRRA 3PXFA 4M3QA 4IFGA 4L3LA 4N6YA 3DZQA 2BRGA 3CJFA 4F99A 2GS7A 1URCA 3WF5A 4CKJA 4QMNA 3RHXA 1AGWA 4FVPA 3ZO1A 3NMUF 1U5RA 5JH6A 3NUAA 4O22A 1ZYJA 4CNHA 1XQZA 3BLRA 4QTAA 4D28A 2WHBA 1YOMA 4BZDA 2A2AA 3ORZA 3QUDA 4BYIA 2OI4X 2J2IB 4IX5A 4IX3A 4OTIA 4X2FA 3F2RA 1QMZA 3DV3A 4MXAA 2PUPA 4RQKA 4APCA 3BHYA 4PDPA 3F5UA 5B2KA 2ZV2A 4KKHA 5ANJA 2DS1A 4MKCA 4ASEA 4K33A 1JSVA 2WQEA 3UVQA 1DAWA 3KCKA 3OY1A 3TWJA 3QALE 3VHKA 4DH3A 2C5VA 4GT4A 4UYNA 2R3NA 1APME 2ZM3A 3FKOA 3GU8A 4S34A 3Q3BA 1FOTA 4YHJA 3E3PA 2R64A 2XF0A 3QQGA 4LOOA 3PSDA 1J1BA 4AWIA 3H0ZA 4I3ZA 2XEZA 5CX9A 1W0XC 2V55A 4YLKA 1IASA 2JIUA 5EKNA 4IW0A 4E1ZA 3U8WA 2WXVA 4YO6A 5AP0A 3OVVA 4C3PA 5C4LA 4FTOA 4IX4A 3UO5A 2X9FA 3F5GA 3DCVA 1OM1A 2RF9A 4D2VA 3PIXA 2W17A 3V5LA 4ZTNA 2YDKA 3KXNA 3NR9A 1PXLA 2WTWA 5J1WA 3R63A 3OXZA 1ERKA 4FG8A 5HLPA 3RWQA 4PF4A 2WO6A 5ANGA 4PMPA 4BDIA 4KBKA 5ANKA 4FV6A 2P4IA 1OI9A 3HMOA 4WG3A 2WELA 4M67A 2XRWA 3RP9A 3WE8A 4WBOA 5DOSA 2C6MA 3EKNA 4U9AA 5AIKA 3V5WA 4CFVA 3UJGA 3HRCA 4IAKA 4DEGA 1P4OA 1HCKA 2HYYA 1ZMUA 2BAKA 2F2CB 4EOKA 5CEKA 3QTWA 2VO6A 2ETMA 4W9XA 2JD5A 5CVHA 4FTRA 5E4HA 2OLCA 5T3QA 2BHHA 2Y4IC 3ZDUA 5M55A 3IDPA 3Q6UA 4JQ8A 5JMSA 3L1SA 2V22A 3BU5A 3OBJA 2OBJA 2CNVA 4R77A 1R0PA 4IHPA 4BDAA 5LVOA 1M2PA 2B9IA 4QOXA 1DAYA 5DFPA 4WRSA 2IVVA 1U5QA 1Y91A 2YJRA 3UIUA 3MI9A 2HZIA 3OW3A 4CMUA 4IZ7A 3QGWA 4IDTA 5EDRA 4YSJA 5HU9A 4IDVA 3TIZA 1H4LA 3PA3A 1YOLA 4YHTA 2FVDA 5L2SA 2J9MA 3MPTA 5I3RA 4IAAA 4RLKA 3VS0A 5AUVA 3DT1A 3GC0A 2XA4A 2QQ7A 3Q04A 2OSCA 4JG7A 4LM5A 4YJSA 4IWPA 4RJ7A 4MBJA 2WNTA 4AS0A 3UQGA 4I6HA 1M52A 2GU8A 3L9LA 4NKSA 4TZRA 4U7ZA 3QCSA 4L9IA 3KVXA 2W1CA 3HUBA 3O2MA 3V5TA 1STCE 5AUWA 2GQRA 3MA3A 4ORKA 4CZUA 1PMUA 2PY3A 3G0FA 4EK6A 3CSVA 3FWQA 3ZFYA 3U6HA 4L3JA 1JWHA 5BMSA 3ATTA 4DCEA 2B0QA 5EQPA 3TN8A 2QCSA 4ACGA 5CAPA 3JYAA 1PMEA 3FMEA 3ERKA 3UQFA 2QD9A 3OT3A 5HE2A 4GYGA 3FPQA 5IG1A 5C9CA 3WILA 4D4YA 3NUPA 4PP9A 3TNHA 5IUHA 2XK4A 4RFZA 4JBVA 1NW1A 1PXNA 1OZ1A 3JPVA 4DFUA 4AT4A 3EMGA 4CZYB 2WMQA 5CQUA 1URWA 1TQMA 4C33A 1R3CA 4F7SA 4S33A 3IDCA 2ZYBA 3GCSA 4FKIA 4NCTC 2QU5A 2X81A 5D7VA 3ZH8A 4IBMA 3RPRA 4GCJA 4BWPA 4PNKA 4BHNA 4Y72A 4NYEA 4FT5A 2GHMA 4TYEA 4YJVA 4EK8A 2FA2A 2VTLA 4K2RA 2HCKA 5K0KA 5I0BA 2XS0A 4DGLC 3QRUA 2BFYA 2PMOX 2FYSA 2VZ6A 3FI8A 2W7XA 1UNHA 4J53A 4BHZA 4FUYA 5AR7A 1U54A 5AUXA 4DFNA 3Q60A 1VYZA 1GZKA 4DCAA 1JLUE 1Q5KA 5KUPA 1TQIA 2RSVA 4FTAA 1OPJA 5ACBC 5HTCA 3WYYA 1VEBA 5KO1A 3L8PA 3TTJA 2V7OA 3O8UA 3QRTA 3HGKA 3IOPA 4NJ3A 5IA5A 3WF9A 4C4IA 3ZBXA 3LJ2A 2YABA 3RM6A 3IKAA 3MH0A 4GT3A 2E2BA 3QTRA 3FHIA 2YFXA 3ROYA 2UZWE 4OW8A 4EQUA 5C1QB 3CLYA 5D41A 4QMMA 5I9VA 4EYMA 4OAUC 3HMIA 3E7OA 4PMTA 4D1XA 3ORKA 5EK7A 2J0JA 3NS9A 4ASDA 2XKFA 3PXKA 2GNIA 2XJ1A 3BGPA 5CQWA 4C38A 5E8WA 3MESA 2YM4A 2R7BA 2PMNX 4G5JA 4NM7A 2YIYA 5D9HA 4UMPA 4FEUA 2R3RA 3VUTA 3UIMA 1U59A 1OUYA 4RGJA 3ZM9A 4W4WA 5H8BA 1MRVA 4MEDA 4ANNA 3CQEA 5M4FA 1ZAOA 3JVRA 3PLSA 3MJ1A 4D4SA 2C6LA 3DDPA 3D9VA 4CCUA 3UMWA 2P3GX 4KSQA 4GG5A 4F9WA 3SG9A 4O0TA 2FSLX 3LFFA 3Q2JA 5ITAA 4XV9A 2W0JA 4NFNA 5IPJA 5IQIA 5IQGA 1XH4A 4AZWA 3DDQA 3JXWA 4Y5HA 2W4KA 3W10A 4BCNA 3C9WA 3ORIA 1H24A 3POOA 4JNWA 5IZFA 2XH5A 2CDZA 4PNIA 3R8PA 4BC6A 5AADA 4UMUA 5AP2A 2QO9A 4CD0A 4E4XA 3G15A 5D7AA 3PVGA 3E63A 5FEDA 3MY0A 4D0WA 4IM2A 4XG4A 3ACJA 3I5NA 3HV4A 1Z57A 1UU7A 4R6VA 4UALA 3GCPA 2OXYA 1H1PA 4TTHB 3GCVA 4EEVA 3Q9XA 4H39A 3BHVA 3GU4A 2JIIA 2F7XE 3FKLA 4GH2A 3OOGA 4ZJVA 3MYGA 5CF6A 4ANLA 4AGDA 3LCDA 4TYHA 4EUTA 1TVOA 3ZBFA 4AE6A 2YIRA 4RIXB 1FMOE 3FI2A 4BCHA 3VRYA 2BMCA 2I0YA 5E7RA 3QLFA 2YZAA 3IW5A 2C6OA 3VVHA 3D7TA 4YZNA 1YDSE 2UZLA 5B2LA 3H9OA 5E8UA 4AT5A 2GFSA 4M8TA 5M06A 3D4QA 2G15A 2PE0A 3PG3A 3B8RA 1FGKA 4Z16A 2C6KA 4IWDA 3R7VA 3EYGA 5DA3A 4KA3A 5LVLA 5KHWA 1J91A 4HYUA 3RINA 4GSBA 4Y5QA 5LXMA 5DWRA 3FQHA 3LJ1A 2RKUA 4FYOA 4HZRA 1YVJA 3AC1A 4FL3A 2GHLA 3F2NA 5A4CA 4A7CA 1XBBA 2C3JA 1REJA 3M1SA 3RAKA 4XRLA 3PVBA 4HGSA 2IW8A 4WD5A 3NYVA 4CLJA 2J7TA 5JGAA 4BIBA 4D58A 1T45A 3IECA 4FT7A 5I3OA 3LOKA 1M7QA 1NXKA 4A06A 3PP1A 4MTAA 2QR8A 4FICA 5CI7A 4RT7A 2ONLA 3I6WA 2VTOA 4IE9A 3L9PA 4GK3A 4BI2A 4BWXA 2VTJA 2R3KA 2OJIA 3PYYA 5J9YA 3U6IA 4GT5A 3EKKA 4IB3A 4QMOA 2C5NA 2F7ZE 3C13A 3I0QA 4XRJA 4ASXA 1OIRA 5HNIX 2C5YA 1BL7A 1UU3A 4OUCA 4QP1A 4L3PA 4XH6A 2C5XA 3G2FA 4KS8A 1OIYA 3VQUA 2XKDA 1W7HA 2VTMA 3LXPA 4DITA 2QR7A 5KMOA 4FTNA 4GVJA 4LUEA 2QOIA 3H9RA 2CPKE 4EWQA 5GIOE 5EHOA 2ITQA 3VS4A 5HG5A 2FB8A 2W9ZB 3ZO2A 5IMXA 4LGDA 3VBXA 1O6LA 3IDBA 5M44A 2UVZA 4FT9A 1WBSA 4PPCA 3M2WA 2JDSA 2XNOA 3HMMA 4ITJA 2A1AB 3E5AA 5AUUA 5HX8A 2LGCA 2OZAB 4BCQA 5HTIA 1ZARA 3AT2A 4YZCA 4RVMA 5M4CA 3G0EA 1YHWA 3EFKA 5ANEA 5TO8A 3NUNA 4HVHA 2WMUA 3I6UA 4W8DA 3EHAA 3EQDA 3D2IA 3NCGA 3ENHA 3QD0A 2CKOA 1UV5A 3M42A 5GJDA 2UVXA 3MV5A 4ANOA 4AW1A 3NUSA 3PE2A 4FSWA 4XG2A 1P14A 3C7QA 5E8ZA 4F08A 1KOAA 4WKQA 3HAVA 3IG7A 2GQGA 4FSMA 5CXZA 4LRKA 1F5QA 4FIJA 3Q9YA 3A8WA 4EH2A 5HEZA 2O3PA 3QUPA 4NIFA 4RIOA 5EW9A 5JRSA 2IW9A 3R7EA 2ETRA 4FZAB 4ZSGA 3SAYA 4BCOA 3Q52A 3AC8A 4BTMA 4YU2A 4G3CA 5JK3A 2G01A 5M4IA 4H3BA 3EJ1A 4WHZA 5DNRA 3ZRLA 4YUQA 3EQRA 4L7FA 4D2RA 3EZVA 4HGTA 4NK9A 4CG9A 5DEYA 3EQFA 1V1KA 3QRKA 3SRVB 3OUNB 2UZEA 2J5EA 3SW4A 2JGZA 3LMHA 1H08A 2FH9A 4QTDA 3GBZA 4W8EA 3EQPA 5L8KA 1ZWSA 1KE9A 5AR4A 2XM8A 4QD6A 2JDOA 2CNUA 3WF7A 3PRIA 2CN5A 3I7BA 3DK3A 4YJRA 3ZO3A 3K3IA 4K6ZA 3EH9A 4QNAA 1JKTA 2C6TA 1GIHA 2QNJA 3NNXA 2YM7A 1H28A 1Z5MA 4G6OA 4M97A 4DINA 4CFFA 2WEVA 3FSFA 4R5SA 2E9OA 5HBEA 5G1XA 3R8LA 3SDJA 2B54A 3PWYA 2VTHA 2JLDA 2XKEA 1KE7A 2R3PA 1ZOEA 3EOCA 3F5XA 3F3VA 4WNMA 3TDVA 4UY9A 4LMUA 5K5XA 2F49A 5FD2A 4FA2A 4LOQA 3ZXTA 4FNWA 4BYJA 3D83A 3EFLA 2ZM4A 4AA5A 4AXAA 4OLIA 4CKIA 4D5KA 5IA2A 4USEA 5HOAA 1W82A 5IU2A 4KIPA 4QMYA 2JAVA 1MRUA 2XP2A 2UUEA 3BWJA 4M0ZA 3SG8A 4J1RA 5M4UA 2X7OA 4WNOA 3ZSHA 2O63A 3GI3A 2YCSA 3OT8A 5KMIA 1BL6A 3Q4ZA 4Y85A 3RPVA 4ZLOA 3FZOA 1ZZ2A 3KU2A 2SRCA 3SQQA 2WZJA 3HMNA 5BX0A 4XG8A 3HZTA 3V3VA 3UQCA 2GNLA 5AX9A 1JSUA 2BHEA 4QMTA 3LE6A 4FG9A 4YTIA 3P7BA 4IANA 4B6LA 5C03A 2X4FA 3VS3A 4BDCA 4MH7A 5CZIA 2J4ZA 2WMWA 3D5UA 4EH5A 5M08A 2XVDA 3L9MA 3DFAA 3R9OA 2R7IA 5CVFA 1JVPP 4ZAUA 4EJ7A 3P78A 4F9AA 4GV1A 3CCNA 5CEQA 3BZ3A 4XP2A 3UBDA 2H34A 4FNZA 5AJQA 3W1FA 2PZ5A 4O7YA 5AV4A 3O0GA 4QMPA 3R2YA 4ZOGA 3HKOA 4FBXA 4Y95A 4DYMA 5EFQA 3KKVA 4W4VA 4EQCA 4JI9A 2UVYA 3PA4A 2QOKA 2OXXA 4FC0A 4NZWB 4RJ3A 5HVJA 4YMJA 2HW7A 5L2QA 4O0YA 3V5JA 4JL9A 4GKHA 2EVAA 3IW8A 1OKWA 3CQWA 5F95A 5LCKA 4I6FA 4PDOA 2HXLA 4JT3A 3HVCA 3FC2A 3VS1A 4BY9E 2XUUA 5AUYA 3R73A 3AXWA 2X6DA 3F7ZA 2R3LA 3R1SA 4MNEB 4QYEA 4AUAA 2FSOX 3LFEA 3DJ7A 3QWKA 4F09A 4GUBA 5E9EA 1P2AA 4FSRA 4UYAA 3CEKA 3OEFX 4BCFA 4NTTA 2XBJA 3T3UA 2JKQA 2XNGA 3ITZA 4EC9A 4FKWA 2Y4IB 4BDHA 3UZTA 4IAYA 4DTAA 2RFDA 4PTGA 2G9XA 1H00A 4RA5A 3V6SA 4B4LA 4DFYA 4C4EA 3GQIA 3O8PA 4IVAA 3FXWA 3C0GA 3CGFA 2VWBA 4YJOA 5JN2A 4UEUA 5EG3A 2GDOA 3NNWA 3EWHA 5IMEA 3G9LX 2R3IA 2VO0A 4HOKA 4J96A 4O6LA 4F9YA 3CBLA 3R0TA 3UZPA 3NAYA 4FK3A 4BGGA 1PRYA 3TI1A 3TG1A 5CLPA 5FEEA 4C34A 3FLSA 2EXEA 3CXWA 5HZNA 2BALA 1PKDA 2ITYA 2WD1A 4RX8A 4XV1A 5AMNA 2WMBA 2ZDUA 2WTKB 2WFYA 4AW0A 5M56A 3TCPA 3NEWA 3VIDA 3OOMA 4X6QC 3FUPA 5AV1A 2R3JA 4A9RA 3ALOA 5F94A 3O23A 5E8XA 2QLQA 4ACDA 3MSSA 3AC5A 3ZRMA 4WNPA 3T8OA 4XJ0A 3GU7A 3ULIA 1R39A 2C68A 4H3QA 3PFQA 2EXMA 5E92A 2AC5A 5JGBA 3PSCA 4YO4A 3PIYA 5I9UA 2B7AA 4ZTQA 2ITOA 3U4WA 5A4EA 3E8CA 5HICA 4ZY4A 2FO0A 1MP8A 3KMWA 2KTYA 5KE0A 2BZHB 4JBOA 4AZEA 4EOJA 1WAKA 5DIAA 2YHVA 3QCYA 4DG3E 2V5QA 3WZKA 2XM9A 3JY0A 4RJ6A 4EHGA 4X2GA 4EOIA 5EM5A 2VAGA 1YXTA 3NRMA 3BWFA 2I1MA 5M57A 1VZOA 4FE2A 3LZBA 3R30A 5ETIA 4X3FA 4HVGA 3VUMA 3QRJA 4ANSA 4B99A 2R4BA 4RJ5A 4CT1A 3EN7A 4M0YA 3BHUA 4O0SA 3ANRA 4XG6A 2PTKA 2ITXA 1LUFA 2ZMCA 1H1SA 4WUAA 4EZ5A 5B2MA 3ORNA 4KIQA 4O0WA 3QTSA 3DZOA 5GINE 2AUHA 5BUJA 2PWLA 4Z55A 1ZY4A 3F69A 3BELA 5HE1A 1O6KA 3C4ZA 2ZOQA 4I5PA 3PWDA 4PTCA 3OF0A 3WF6A 4XHKB 1PXOA 2OU7A 3HP5A 3PTGA 3QZHA 4KIKA 3RJCA 4C7TA 1PXJA 4ANQA 2JKKA 4R1YA 4QQCA 4DEEA 2X39A 2J0MB 2VRXA 4QP2A 5EI2A 3PSBA 3QKKA 3NGAA 1YXVA 2VX0A 3EQBA 3MFUA 1NY3A 3WARA 3N4UA 5IDPA 2ONLC 1JOWB 4KBAA 4LRJA 4YZDA 4YPSA 5IA0A 2YIWA 3HA6A 1XH5A 5F9EA 3U55A 1Y8GA 3ZZEA 1E1VA 3MVMA 3S2PA 1XHAA 4E26A 3LMGA 4JJRA 5B0XA 2W99B 2I40A 2REIA 4M12A 4YTHA 4EI4A 5HIEA 2P55A 4G31A 4QO9A 3WZDA 2VTAA 2OJGA 3II5A 3DQXA 5H2UA 5A6NA 4K11A 4Q9ZA 4XMOA 4G16A 4FV1A 3MB6A 5HORA 4RA4A 1TKIA 3TKUA 3EL8A 2B9FA 3MY1A 5CSVA 3NNVA 5CU6A 3WZJA 4D9TA 2WTVA 1SZMA 5BVFA 2VNYA 3C4XA 2RG6A 2BIKB 1K2PA 3NDMA 4HW7A 3MDYA 3R1NA 5CF5A 3FMHA 3MH3A 4JAJA 4JDJA 2H6DA 1Q8YA 2X2MA 4G3DA 3COKA 3H0YA 4O83A 2UW7A 1KOBA 2R3QA 4O91A 4EZ7A 4ZIMA 5HE0A 5CSPA 4JIAA 4LG4A 3WYXA 3JUHA 4U81A 4AE9A 1ZZLA 3SHEA 5JGDA 3PJCA 2O2UA 3PPZA 1L8TA 4O7VA 3PY1A 5I9XA 3GUBA 3AC4A 4PRJA 4BIDA 4JDKA 4M69A 4F1OA 2VNWA 2VTQA 3RI1A 3KA0A 1Q3DA 2RFNA 2JFMA 4YLLA 3NSZA 4YJQA 5C8NA 4CCBA 3H10A 3PXYA 5E1EA 1CKIA 4MXOA 4NSTA 4GFOA 3C5UA 4YTFA 1ATPE 4GJ2A 3DJ6A 3DQWA 5BYYA 5IA4A 2WU6A 4FKQA 2QOFA 1BX6A 2A27A 5T68A 3ZO4A 4XP3A 3TKHA 3GOPA 5LCJA 3BQRA 3KF4A 1CKJA 4MXZA 2XIRA 2ITUA 4CSVA 3UGCA 3LFSA 5AR2A 4ANBA 4L46A 1RJBA 2A19B 5AWMA 1ZRZA 5C27A 3SXRA 3VJOA 4QMVA 4OBPA 4L01A 3BPRA 1F3MC 2GPHA 3LW0A 4R7HA 3GU6A 3R7YA 4BGQA 4BDDA 3CIKA 4UWYA 4QPMA 3UVRA 3ZSIA 1H27A 5L2TA 2QURA 2YITA 2GSFA 2VX1A 2XNPA 3LFAA 4FEVA 4RX7A 4DGNA 4E6QA 4I5CA 3R1QA 4NW5A 2OKRA 4ITHA 5E90A 3P08A 4D2TA 4O2ZA 1J7IA 1OIUA 4AU8A 3C4WA 3F66A 2ZDTA 5JFXA 2VWUA 3R7UA 4EOPA 4DTBA 4XOZA 4E5WA 4TN6A 1MQ4A 4M7IA 1UWJA 2UZNA 1PW2A 5FQDC 5FXRA 3LAUA 5CAQA 1DI9A 3CD8A 3QTZA 3ZCLA 3I60A 4CFWA 2OH4A 4EZ3A 4QYFA 3E88A 3R7IA 3IPHA 1BMKA 4EQMA 3FMJA 5IEYA 3FMNA 4OGRA 2HW6A 1YHSA 2WIPA 3R7GA 1FMKA 3VC4A 3UODA 5M07A 4QP8A 4D0XA 4IAFA 1PMVA 3U87A 3QZFA 3BV2A 1RQQA 3OFMA 4C4JA 3Q53A 2VWZA 5CSWA 3TNIA 5HBJA 5LVMA 3MS9A 3IGOA 3D5WA 4QMQA 2ZM1A 2ITWA 3R28A 4PTEA 4C57A 2CKPA 3G6GA 3LXLA 1IR3A 2Z7SA 1WFCA 3NLBA 3UO4A 3UG2A 4BIEA 2C6EA 4TT7A 5GJGA 3FKNA 3O71A 4CFNA 1I09A 5BQ0A 3BHHA 3OP5A 4PQNA 1GAGA 4X7QA 5DE2A 1B6CB 4OTDA 3EL7A 4ENYA 4HVIA 4QPSA 1YRPA 2R0UA 3A4OX 3RPSA 1H1WA 4CVAA 4F7JA 2YM6A 2QKWB 4F64A 4FV7A 1OL1A 2C3IB 4FKRA 2B4SB 2J50A 2YISA 4HZSA 3QA8A 4B8LA 2BUJA 2ZB1A 2JEDA 4TXCA 5BPYA 5HQ0A 3CY2A 5L8LA 4GUEA 1WMKA 2H9VA 2HXQA 4GW8A 5J9LA 2IW6A 3MB7A 4PY1A 3LCOA 3KL8A 3BU6A 1BKXA 3ZLSA 4UZDA 1H07A 5CTPA 5E91A 4G2FA 3D94A 4CFXA 2NNWB 2BZIB 4W4XA 5FDXA 5JZNA 1ZXEA 3VBQA 3B2TA 3NAXA 4L43A 4J7BA 3TACA 1YXSA 2YIXA 3KMUA 3R8UA 4JG6A 5FP6A 3UNKA 4QP3A 4JR7A 3FMKA 3QKLA 4OTGA 2BFXA 4O96A 5ETCA 3MTFA 5CI6A 1VYWA 1YQJA 5DRDA 4PWNA 3FXZA 4IJ9A 5HG8A 2F2UA 4KKGA 4OR5A 3DBFA 2FUMA 3VQHA 3KXGA 2XJ0A 3NUUA 4V04A 4NEUA 1A48A 3QD4A 2Y6MA 4ZJJA 2OO8X 3ZEWA 4Z3VA 2V62A 2X4ZA 4CXAA 5CU3A 4MWHA 3FZ1A 5EHYA 5CENA 4E6DA 4I24A 2WMSA 4G3GA 4RIWA 3P1AA 4FSQA 4FSUA 1Q62A 4TNBA 3A7HA 1OPKA 2OG8A 3LPBA 3VBTA 3HECA 5HG9A 1VJYA 5KBRA 3O7LB 4USDA 3EFWA 5EM7A 4PMMA 2I6LA 5CAOA 3BQCA 2XNBA 3F3ZA 2FGIA 2HWPA 1QL6A 2PL0A 2H8HA 2PE1A 3DBCA 3GQLA 3PJ3A 2GMXA 4FTTA 3EFJA 2XRUA 4C2VA 1RE8A 3LM0A 1E1XA 4RIYA 1B39A 4ZLZA 4O7RA 2OZOA 2XYUA 1OVEA 2WOTA 2O65A 4AACA 4U44A 5AM6A 3F61A 3CD3A 3F3WA 2WQBA 3F3TA 2CCIA 5FXQA 3MJ2A 2R3HA 4ZSJA 2QODA 4JG8A 4V0GA 2XNMA 2Z2WA 4ZSAA 1PXIA 4GFMA 4XS2A 1AQ1A 3BE2A 3MGYA 4IQ6A 2QU6A 4H1JA 3OWLA 4FEWA 3ETAA 2WTCA 4BL1A 3BYMA 3N9XA 4PMSA 5IQFA 2BAJA 2YA9A 3SOAA 4EHZA 1O6YA 4X0MA 1ZMVA 2UW9A 1OECA 1NA7A 4WO5A 3RAIA 3EN4A 2F7EE 4CQEA 3E8DA 1W83A 3QXPA 3P0MA 3SX9A 4FI1A 4MBLA 4NM3A 5K0XA 4FKJA 3S0OA 2PVYA 1IAJA 4TWOA 5TOZA 1FVVA 4R3CA 3R7OA 3DK7A 3F5PA 4E6CA 2BPMA 4QYGA 1PYXA 2Y4PA 2Z7LA 4AGUA 4N0SA 3FL5A 3HV7A 4IAIA 4BBEA 4X3FC 3BHTA 5I9ZA 1ZYCA 3F88A 4FL1A 4EOSA 1JKLA 4IM0A 2XK7A 1WVWA 3KFAA 4I0TA 4XLIA 5CY3A 5HVYA 2BRHA 4KABA 2ZV9A 2DWBA 4C61A 5LJJA 2VX3A 3T3VA 4FNXA 2EUFB 4ID7A 2GNHA 2UW6A 1FVRA 4YC6A 3R9NA 1KWPA 2HZNA 4PPAA 4RVLA 5DR9A 3VHEA 4CYIA 4TY1A 3FC1X 3QZIA 2NPQA 1OUKA 2IZSA 2YAAA 4NTSA 2YCFA 5AV3A 3V51A 4EOQA 3FEGA 1GIJA 4PDYA 1U54B 1XH6A 4FL2A 2KULA 3RPOA 4QYYA 3ATSA 4G17A 2Z7RA 2CLQA 4FKUA 5JSMA 4AF3A 2BZKB 3F7WA 4GK4A 1HOWA 4C62A 4AT3A 4WG5A 4E4LA 4EK5A 4EK3A 4BBFA 3EQCA 3MVJA 4KD1A 4I5MA 4C3RA 4AAAA 2VTPA 3K2LA 3VBWA 4W4YA 3E64A 3DB6A 5HLWA 1KUTA 3D14A 1IA9A 4L52A 3FZTA 4DEBA 1JKKA 1H0VA 5AP1A 3U9CA 3KULA 4GG7A 2Z7QA 4WIHA 2UZTA 1Y6AA 4EWHA 4AGWA 2BDFA 4UMQA 3FZPA 5CEMA 5JFVA 4LGGA 4NM5A 4IAZA 3RK5A 3DKGA 3A7IA 5HG7A 2YCQA 4E7WA 4NFMA 2WQNA 1SNXA 2OJJA 4QMXA 1XWSA 2ZV8A 4MWIA 1V0OA 2ACXA 1H0WA 2C0IA 4RG0A 3UVPA 3HV3A 3HNGA 2YN8A 3OMVA 2CKEA 2NO3A 3DBDA 3WE4A 2QO7A 4J99A 5A6OA 4E3CA 3AD5A 3BKBA 1FGIA 2C4GA 4QT1A 2JKMA 2QKRA 5CT0A 5C4KA 2WPAA 5A4LA 1Q8UA 2HWOA 3I79A 2X8IA 3W55A 4NH1A 2B1PA 4X2NA 3OBGA 1OITA 4FKPA 4ACHA 4WSYA 3RALA 4F7LA 4P5ZA 5A46A 4RC3A 2XIYA 3PE1A 4U79A 5FTQA 4RQVA 3WI6A 2W1ZA 4O27B 3U51A 2UZBA 3OG7A 1V0BA 3QU0A 4DFBA 3QA0A 4E8AA 2YZLA 4UBAA 5DH3A 5KNJA 3O17A 1MUOA 3IK3A 4F63A 4IB5A 4G9RA 5LVPA 4O81A 3UMXA 3FY0A 5HO8A 2PZPA 4O38A 2I7QA 4E73A 5JQ5A 4FVQA 5GZ9A 3RTPA 3E3BX 3BE9A 3FLYA 3VS5A 5IH6A 3FMMA 3MFSA 4BFMA 5L8JA 5CALA 4FT0A 4QP4A 3U6JA 3RZFA 4TYHB 3UOLA 2WMVA 3Q9WA 2IVTA 1PJKA 5CU4A 3PPKA 4LRMA 4G9CA 4K77A 3VUDA 4AGCA 5CF4A 2O64A 5CWZA 1P5EA 2E9VA 3A60A 4WBBB 2GNFA 4I5HA 2NRUA 3KB7A 1RW8A 3D7TB 5KZIA 2PU8A 3CPBA 3E8NA 4FSNA 5EI6A 3RAWA 3C51A 4FTCA 3LMIA 3SD0A 4PDSA 4XV3A 4IZAA 1OKZA 3ID6C 2JC6A 2H96A 4IIRA 1NVQA 5F1ZA 4BDGA 3UOJA 3PPJA 3DTCA 4I22A 3NVMB 3QCQA 4F0GA 3C4EA 4RBLA 5DVRA 2GFCA 1ZLTA 3IW4A 2XYNA 2ZAZA 3DNDA 4U3YA 3RNIA 5C26A 3AGMA 4S31A 4AG8A 4OT6A 5HO7A 4YJTA 3L9NA 4FUXA 3K54A 3ZU7A 3Q5IA 1PKGA 4ALUA 2F9GA 5AP4A 4DC2A 2C69A 4FKVA 4F70A 3UC3A 4ZY5A 3SXSA 3TV6A 1H1QA 4C4GA 5AP5A 3DLZA 2VGOA 3DJ5A 3EQHA 1WZYA 4M66A 3TNWA 4HYSA 4P7EA 4NM0A 2V7AA 1LEZA 3CY3A 5AAFA 1Q8ZA 3F3UA 5IQAA 3WBLA 3AC3A 2GNJA 5DT0A 3S4QA 4RSSA 4OTFA 4KKEA 4MX9A 4YBJA 5EW8A 3ZUTA 2QLUA 2UZVA 2QOHA 4HPTE 3EN5A 5HCZA 4C37A 3Q5ZA 3VBYA 3DB8A 1XKKA 4WRGA 4I1ZA 3QWJA 4IJPA 3QLGA 3UIBA 1IG1A 4DHFA 1JBPE 4BF2A 2GQSA 4LUDA 4JQEA 2XNNA 4MD9E 4QTCA 4DFZE 1ND4A 2VN9A 2JIVA 4MK0A 3G5DA 4O1OA 5EDQA 3AD6A 3KN6A 5CEOA 3DA6A 2IVSA 4FF8A 3ZLWA 4N57A 3DFCB 3VUIA 2XKCA 4DF3A 4IVBA 5KZ0A 2JBOA 2IWIA 3ZUUA 4WG4A 1CDKA 4FSTA 4TKSA 3TIYA 4CGAA 5J7HA 2P33A 1YWNA 3ORMA 3KXXA 3UNJA 2JBPA 4IZYA 5DYJA 5F4NA 1BUHA 4FV2A 4O84A 5BVKA 3HA8A 4JS8A 4YJUA 2F57A 3BYSA 3RGFA 5LMKC 4DBXA 5KKRC 4GK2A 3LFBA 4LL5A 5HIBA 3MA6A 2IZTA 3LFCA 4JBQA 2RL5A 1IAHA 5HHWA 1GZOA 1W8CA 3JR1A 4IC8A 3NYOA 1ZYLA 5LVNA 3OHTA 3MY5A 3SV0A 4ZEGA 2IN6A 1SVEA 4B0GA 3S1HA 3D5XA 3BEAA 3CTJA 1H25A 2E9UA 1QPCA 4I6BA 1Z9XA 4IB0A 5DT3A 1GOLA 2OFVA 3LFDA 4AA0A 2IJMA 4AZSA 1A9UA 3P4KA 4IWOA 4ACMA 2OJFE 1WBOA 4O7LA 3COMA 3NYXA 5IQBA 2Y6OA 3R83A 3VF9A 3V5QA 2WMXA 3I5ZA 3MWUA 2X8DA 4C4HA 1K9AA 5J87A 2P2IA 3ZFXA 4BVUA 1JSTA 3ODZX 3VUGA 4BB4A 4BCGA 5DMZA 2UZUE 3KRJA 1ZMWA 4NIFB 5IKWA 3BGZA 2O5KA 3FE3A 3HEGA 5CSXA 3CKWA 3VUHA 3PJ2A 4IB1A 3ZS5A 4L67A 3V01A 4DH8A 5GHVA 4P5QA 5K4IA 4ALWA 4LI5A 4L45A 2OIBA 4CMOA 1LP4A 3PVUA 5FM3A 5I4NA 4RZWA 2VTNA 4JX7A 3DAKA 5EHLA 3V8TA 4EH7A 5HNGA 5CANA 5FDPA 3FYJX 4RRVA 1Q61A 5I9YA 4L53A 2BDWA 2C3KA 3QQJA 1PMNA 4YJPA 4Z9LA 3UYTA 3NIZA 2E9NA 3ORLA 4WT6A 5FXSA 4TWCA 3GCQA 5CYIA 5D10A 3W16A 3GFEA 3WIKA 3BLQA 4OTQA 4EOMA 1H26A 1BI8A 4QQJA 1PHKA 3KF7A 3QFVA 5A4QA 4DLIA 4IFCA 4QMWA 4R8QA 4CV8A 1KE5A 2XK9A 4OTRA 2QHNA 3ZONA 3TM0A 5JZJA 1YI4A 3KK9A 4XCUA 3TZ9A 4O0VA 4ENXA 2BCJA 1DM2A 4BZOA 3NX8A 3KREA 2CSNA 4G5PA 5IQDA 3F2AA 4E5BA 4TW9A 3OC1A 2PZIA 1V0PA 2EB3A 3EQIA 4R3PA 4OTPA 2X7FA 4QMSA 3MIAA 5EYDA 3TKIA 1SNUA 4YLJA 4DEIA 3LJ0A 3ZXZA 2HENA 3LVPA 2G2FA 4FKGA 4MXCA 3QGYA 4CZTA 3HUCA 4FEQA 4RLLA 4BGHA 4BKZA 4XNEA 4E20A 3I81A 4FSYA 4FX3A 4UMRA 3KY2A 5IF1A 4ZSEA 3B2WA 1R0EA 3NW6A 2C6IA 3SXFA 5H9BA 1YOJA 4G6LA 3ROCA 2XNEA 3KQ7A 2PVMA 1XBCA 3CC6A 1ZYDA 2XMYA 5CZHA 3PZHA 2W5HA 3FQEA 4YNEA 2Y8OA 1YWRA 3RCDA 1M7NA 4C58A 3FV8A 3R9DA 5AEPA 3CTHA 1SYKA 4IM3A 5JEBA 3MBLA 3R22A 4WSQA 5CNNA 2AYPA 2WTJA 3R9RA 3SA0A 1Q4LA 3CKXA 4PPBA 2CMWA 2W5BA 4MF1A 1QPDA 4G6NA 3A7GA 3KMMA 2XEYA 2YM8A 3DLSA 2QONA 3FHRA 2RIOA 3ORTA 4O7TA 2C1BA 4L00A 5DG5A 3QXOA 4Q5HA 3EN6A 3GC9A 2YWVA 5IISA 1BLXA 3OXTA 3DAEA 4FG7A 4TL0A 4WNKA 5EOBA 3TUCA 3ZSGA 1SVHA 2X1NA 2RFSA 4OTWA 4R5YA 3UZRA 1YI6A 1QPJA 4DAWA 1E9HA 5ANIA 4GEOA 4H58A 5AP6A 1JAMA 4JRVA 4YJNA 1PXMA 4R78A 2CN8A 3POZA 2VO3A 4M14A 3DKOA 1UNLA 2WTIA 3KCFA 4YNOA 3BV3A 1ZOHA 5KMNA 4HVSA 4GU9A 5ICPA 4DE4A 4JXFA 4BICA 3ORPA 5ANDA 5B7VA 4D55A 3AMAA 2Z60A 3VS7A 3H3CA 4NW6A 3VBVA 4AW2A 2J90A 5L6OA 2XB7A 4YP8A 4CLIA 2WAJA 2JFLA 4F65A 4TNDA 3ET7A 4Z7GA 3RCJA 3GOKA 5HO6A 3O96A 3Q6WA
chains in the Genus database with same CATH superfamily
2JDVA 4BBMA 4CTBA 5I9WA 4KBCA 2VD5A 2W9FB 5AA9A 4K9YA 4X6RA 5EYCA 4UB7A 2CGUA 3FXXA 1TQPA 3S00A 4FKOA 1XMLA 2W06A 4TWPA 5A4TA 2BVAA 4NUSA 2PVNA 3QX2A 4CQGA 4CMTA 4CKRA 5BNJA 3HL7A 2QVSE 4AN2A 2QOOA 5CAVA 2NYAA 3PP0A 3UOKA 1DS5A 4JBPA 4DG2E 3SGCA 5KMKA 3BCEA 4XBRA 2OFUA 2XK3A 3C1XA 3F82A 3DXNA 5A3XA 3ZDIA 3LCTA 4XUFA 1CTPE 4QQTA 5LMBA 5A9UA 2R3MA 3E93A 2WB8A 3NYNA 5KMJA 4A4LA 5DHJA 3A4PA 3QAME 5GZ8A 3WOWA 2VWWA 4E5AX 3E7VA 3Q96A 3BEGA 4NU1A 4CG8A 3ZRKA 3RBWA 1G8AA 3PJ1A 5M53A 5EW3A 4FZ7A 4JX3A 3QF9A 2UW3A 3AQVA 3R02A 4MVFA 5CEIA 4I92A 4FV3A 4B9DA 2JDRA 3FJQE 3LXKA 3R8MA 1UU9A 3EYHA 4I6QA 4ZTMA 1XMMA 2VGPA 3OZ6A 1JPAA 2HAKA 2HZ0A 3A8XA 4MBIA 4J71A 4UWBA 4YGAA 5IEVA 4FTQA 4M15A 4NT4A 5L4QA 3FLWA 3LFQA 3QHWA 4I41A 4P4CA 4ZS4A 3BGQA 3GEQA 2BRBA 4O7ZA 4C35A 5KHXA 4K1BA 2ITPA 5DR6A 3FQSA 3IONA 4UXQA 3A7FA 3BYVA 3FI4A 5CNOA 4ZTRA 1OBDA 3VRZA 2J0KA 3LLTA 4BCKA 5AFVA 4H36A 3W18A 4X3FB 4DEDA 3VULA 3FLNC 1Q24A 5H8GA 1M17A 4GRBA 3TV7A 4F1TA 2CCHA 3FZSA 3KXMA 4LOPA 3G51A 1NT2A 2W1GA 2P0CA 3DBEA 2VWXA 4Q2AA 2B9HA 4XP0A 5J95A 1XO2B 4PV0A 2IF8A 3UNZA 3RPYA 3VJNA 4BI0A 4R7BA 1R78A 2DYLA 3GNIB 5AM7A 3LQ8A 4KAOA 1UKHA 4CRSA 2YAKA 1YKRA 3Q4CA 1ZYSA 3K5UA 3G90X 5CS6A 3A2CA 4W9WA 4B8MA 4CT2A 3T9IA 4DBNA 3W0NA 5AR8A 1AD5A 3QC9A 4YZ9A 4JDHA 4F4PA 3P23A 5BYZA 4KIKB 4AOIA 4QDVA 2HK5A 4Q5EA 4EBWA 4LGHA 4TPTA 4EH4A 3M11A 4BDFA 3DGKA 4EUUA 3NZ0A 1REKA 1KV1A 3FLQA 1BYGA 2Q0NA 3TUDA 3W2QA 3RVGA 2BDJA 2BKZA 1B38A 1FBNA 5K4JA 3OCSA 1OKYA 1G3NA 2HIWA 3IW6A 4J52A 3HDNA 4KIOA 4QQ5A 4AZFA 4APPA 4DN5A 5HVKA 5J1VA 5G6VA 4L7SA 3QD3A 3I1AA 2R3GA 4L68A 1ZY5A 1G8SA 3PLAE 5JFWA 2XK8A 4P90A 3KRLA 3QQKA 5DN3A 5TE0A 2PE2A 1MRYA 3OY3A 3U4UA 3W0MA 3SC1A 3C50A 3AKJA 5GNKA 2YDIA 4O4FA 4QYHA 2HELA 4UXLA 3REPA 3CQUA 1OKVA 2F4JA 3BI6A 3PIZA 4FODA 4KRCA 3C0IA 5AP3A 4QP9A 4BTFA 2WQOA 3FAAA 4F1MA 1T46A 3Q4UA 2VWYA 1XJDA 2R0IA 4GIIA 2G2IA 3QTQA 4M13A 3GCUA 3UIXA 5K5NA 4H05A 1Y8YA 1J1CA 4TWNA 1NVRA 1PY5A 4YURA 5E8VA 2JITA 2PVLA 2X8EA 3SW7A 3E8EA 2OGVA 4E4NA 4AFEA 4I23A 3UP7A 4GL9A 3IQ7A 4ZP5A 3ORXA 3WF8A 4RFMA 4AW5A 3A61A 4ZTLA 4L44A 2VTIA 3QHRA 1UVRA 3O7LD 4MD8E 5M51A 5EQYA 4PL3A 5AIRA 5ANOA 5DI1A 3PXZA 3OD6X 3RK9A 4M69B 5IQCA 2E9PA 5BVDA 2QOQA 4KSPA 5L3AA 3S3IA 5IH4A 3BLHA 3FZRA 2OF4A 2ITZA 2DQ7X 2BILB 1G5SA 5CSHA 2BTRA 2WMRA 3UOHA 4YC3A 3HV6A 4YBKA 5JQ8A 5K9IA 3AC2A 3HRFA 2QOCA 3HAMA 4CV9A 2Y9QA 5GJFA 5AV2A 4U41A 2W1HA 3LHJA 2XZSA 3G33A 4JOAA 4U80A 5FWKK 4BZNA 3TUBA 3HMPA 3RZBA 4DH1A 5H8EA 3GVUA 5CXHA 5BVOA 1Q8WA 3C0HA 3KXZA 4R3RA 4CYJA 2O0UA 1W84A 4FVRA 4FZFB 2R5TA 1BI7A 4J98A 5BUEA 1I44A 2XCKA 5KBQA 4WUNA 4I94A 2IZUA 2GNGA 3H30A 5LMKA 1GY3A 3QTXA 5GIPE 2JAMA 4P2KA 5C8MA 4FJVA 1SM2A 2ZJWA 3G9NA 4CEGA 4C02A 2I0HA 4IACA 5CT7A 5J5TA 4QTBA 4RC2A 4O7SA 4ASZA 4X2JA 4I93A 5EH0A 4F0IA 2UV2A 2BRMA 4QDEA 3VS2A 1SVGA 2VWVA 4IX6A 4L8MA 4N4SA 4LDTA 5IEXA 4FEXA 5TT7A 4LV8A 4LQMA 3UG1A 3HX4A 1HCLA 4AQCA 3AMYA 4DEHA 1UA2A 3OUKA 3TZ8A 4EH6A 2X6EA 2WTKC 4GFGA 4O1PA 4O0RA 3CE3A 1W98A 4D4VA 4YPDA 4MCVA 3AT3A 3HLLA 2IPXA 4H1MA 4IZ5A 2AC3A 1OPLA 4WA9A 4DHZA 3KK8A 3PY0A 2GHGA 4BCMA 4F78A 1GZ8A 2CGVA 5J9ZA 3CP9A 2YIQA 5E8SA 2IO6A 3VAPA 4DDGA 2OJ9A 5HI2A 4GMYA 4HJOA 4BTJA 2ERKA 1S9IA 3PY3A 3QQFA 3NW7A 1O9UA 1Q41A 4FIHA 4FTKA 5FM2A 3W32A 4HVDA 2ZV7A 3AD4A 1L3RE 4ERWA 2CJMA 2EWAA 4FIFA 4MXXA 4PX6A 4F0FA 4GVAA 4IWQA 4YSMA 1J3HA 4GIHA 2GCDA 5JRQA 4U6RA 2QOLA 2GS2A 4AX8A 2VU3A 2W1DA 3F9NA 3VO3A 5D12A 4FGRA 4U40A 4GKIA 2VTTA 4AN3A 3QUEA 4QPAA 4DT9A 4G34A 3O5AA 1UKIA 4FOBA 4BCJA 1F0QA 4S30A 2ITNA 5KKRB 4EH3A 3ULZA 4I0RA 1J7LA 3R9HA 2WGJA 2WOUA 3ELJA 4DH7A 4EL9A 4U8ZA 4QMZA 3OROA 4UWCA 4O2PA 4NWMA 4H3PA 4F6SA 4A4XA 4HNFA 3BU3A 4FOCA 3SOCA 5ETAA 2PULA 4ZXTA 4HCUA 4FNYA 5AUTA 4FV5A 4O82A 3D7ZA 5LARA 4F6UA 4UN0C 4KNBA 4JR3A 2C6DA 4IVCA 4MAOA 3IOKA 4BI1A 3UDTA 2PVRA 3BYUA 2RGPA 3C4FA 3COHA 3KEXA 4FK6A 3W2OA 3GC7A 2J0LA 4XG7A 4EH9A 3C5IA 4AAYA 2EU9A 4DDIA 5KMLA 3OS3A 3QQLA 1OL7A 1OMWA 5JKGA 4RWKA 1XH9A 3THBA 4E6AA 2FSTX 4Y73A 4N70A 1M2QA 4L42A 2PVJA 3EZRA 1A06A 4QEBA 2C0OA 3DTWA 3GT8A 4ZTSA 3WZUA 4RX5A 5J5SA 5JT2A 3LLAA 2HOGA 4RIXA 5KMMA 4EKKA 4ZZOA 4S2ZA 3QZGA 4D1SA 1QCFA 4RIWB 4BTKA 2XANA 1WBWA 2C3LA 3FBVA 4D2PA 4EYJA 5HCYA 4BDJA 3RK7A 3BBWA 5EOLA 5DGZA 5AA8A 3JVSA 3QQUA 3RAHA 5KX8A 3D2KA 5LMAA 4AXFA 1KV2A 5E8TA 4ZK5A 4EONA 3OXIA 3TZMA 3PDTA 3QTIA 2XIXA 4RIYB 1YXXA 3U54A 5HIDA 5L6WL 4AZTA 3NFFB 2W05A 3CJGA 3W33A 2G2HA 3UDBA 1LR4A 5HU3A 2B52A 4DTKA 1FQ1B 2Y0AA 4V0GB 4Y8DA 5CU2A 3RNYA 4GJ3A 1EH4A 3TNQB 1GNGA 3MVLA 2BTSA 2P2HA 2WIHA 3IGGA 4OT5A 3V8WA 1Q8TA 5AR3A 4EKLA 5HLNA 1YXUA 3DS6A 2XCHA 1JNKA 2IG7A 3NWWA 1WBPA 2X7GA 4II5A 3HRBA 1WVXA 5IQEA 3HV5A 4IMYA 4BRXA 3H9FA 5DR2A 3ZLYA 5L2IA 3WZEA 5IDNA 5CU0A 5HESA 3R1YA 4G3FA 4TYJA 3ZM4A 3RHKA 2OH0E 1UU8A 5DT4A 2IZRA 3QRIA 4XYFA 2A0CX 1J7UA 3G6HA 2NP8A 5L6PA 3DKFA 2GTMA 4KS7A 1WBNA 1H01A 3OTVA 1M2RA 5CAUA 4KB8A 2XJ2A 3GC8A 4FZ6A 4V05A 4F6WA 5DEWA 3DKCA 4MHAA 3UPZA 2YJSA 4XX9A 3UTOA 3COIA 2JKOA 2J0IA 3R21A 3ZMMA 4BR3A 1GJOA 1OL5A 1IRKA 2CHLA 2HY81 2R9SA 4JAIA 4RPVA 4RVKA 4ANMA 1JQHA 5FBOA 2UZDA 2J51A 4O86A 4X2KA 3W8QA 5TF9A 2QG7A 1YW2A 2XIZA 2UZOA 4U43A 1KSWA 5EM6A 4HGLA 4S32A 4XLVA 3W2SA 1Q3WA 1Y6BA 2WU7A 3QX4A 4Z7HA 1OGUA 2OW3A 4U42A 2OZAA 1KE8A 1XBAA 1M14A 4MQ1A 3V6RA 3QKMA 4YZMA 2ITVA 3MH1A 4K18A 5IA3A 3TDWA 3NCZA 2C1AA 5F20A 3BIZA 3FMDA 1FVTA 2X2KA 3HYHA 3ALNA 4M68A 3I0OA 3ACKA 2RFEA 4JIKA 3TL8A 3KULB 4LYNA 1RDQE 2VTRA 3L8XA 1NVSA 2WMAA 4EH8A 2PMLX 3E87A 5BVEA 3I7CA 4A9YA 1MQBA 3FSKA 2J5FA 3DBQA 3ZEPA 3PRFA 4C0TA 2VO7A 4DFXE 2EXCX 3RKBA 5AX3A 3BX5A 2EB2A 3K3JA 4MQ2A 3BL7A 4KUJA 1CM8A 3FY2A 2PVKA 4CRLA 5FTGA 2Q0BA 5LWMA 2OICA 4IADA 3O8TA 4WOVA 4YTCA 5BVNA 5TR6A 3OCTA 2ESMA 3BLAA 2C5OA 4FV9A 4K0YA 3SRVA 3KN5A 1XH7A 4RWLA 1VLRA 3C4CA 4FTJA 2BKKA 4BKYA 3A7JA 4O21A 2LAVA 5EQEA 4RJ4A 2QG5A 2FSMX 4IVDA 4A9UA 5FG8A 4BDEA 4UX9A 4AXDA 5FGKA 3F6XA 3UE4A 4MXYA 2ZVAA 4DH5A 2G1TA 5GZAA 3R71A 4ZTHA 3IS5A 3R2BA 2J6MA 3SLSA 5CASA 4IH8A 5AR5A 5J8IA 3TV4A 3VW6A 4USFA 1WCCA 3NUXA 2W4JA 4O0XA 2BROA 3B8QA 2WTDA 3ANQA 5TKDA 3ZC6A 2PVFA 4EHVA 1S9JA 4QRCA 2GS6A 3P7AA 4PL5A 4KINA 4C3FA 2ZMDA 4HNIA 1H1RA 2C47A 2PUUA 3AOXA 2I0EA 3MIYA 3ZC5A 2QOBA 4CTCA 5I5ZA 3ZOSA 4BDKA 2XIKA 4NL0A 1YWVA 3JY9A 4RZVA 2YDJA 3Q2MA 4GU6A 4BN1A 3BYOA 3GU5A 4RC4A 4F9BA 4G1WA 3MTLA 5DLSA 2QO2A 3Q4TA 3V04A 2B9JA 3QL8A 4BKJA 4FTIA 4QP7A 3UYSA 1OIQA 4I20A 3N4VA 3O50A 5BUIA 5IUIA 5LQFA 5EYKA 2C0TA 3Q9ZA 3LQ3A 1XR1A 3CS9A 4RX9A 4U3ZA 3N51A 4PUZA 1Q99A 2W1EA 4C36A 5LWNA 4ERKA 2PZRA 3P7CA 3GXLA 4ZLYA 2A4LA 2BR1A 3BRBA 4D1ZA 4ACCA 1UNGA 3OCGA 3U9NA 4F7NA 2AEGA 4E4MA 4HCVA 2IVUA 5EI8A 5FTOA 4TRLA 4XG9A 5AV0A 3CGOA 4DFLA 3P79A 2PYWA 3OW4A 1KE6A 4I4FA 3ENMA 2WQMA 3KVWA 3GP0A 4QP6A 2YLFA 4TYIA 2OXDA 2CKQA 4XBUA 4XOYA 5E1SA 1SMHA 3AMBA 3KXHA 1K3AA 3RWPA 4IXPA 4D2SA 4X3JA 3E92A 4AFJA 3NFGB 4U5JA 2PPQA 4Q9SA 2Z8CA 3W8LA 4O0UA 2YWPA 2RG5A 3TEIA 4JVGA 4FIIA 2PK9A 2PHKA 3IO7A 3K5VA 2YERA 3BBTB 3ZUVA 3SVVA 4FTLA 1OBGA 5A14A 4UMTA 4DT8A 4ALVA 3W0QA 5HBHA 4FKSA 3N4TA 3H4JA 4TYGA 3DAJA 3MPMA 4DGOA 2CGXA 2CNQA 5EM8A 3KRWA 4UV0A 3QBNA 3CPCA 4YZBA 4BWKA 4IC7A 4O4CA 5FUTA 4MNEA 5DBXA 2PUNA 2CLXA 1DI8A 3MPAA 5AAEA 2Y7JA 3IW7A 4L6QA 5HE3A 2OK1A 3FLZA 2X9EA 4FTMA 4EBVA 3TXOA 4CFUA 3A62A 3EB0A 4FIEA 3TJDA 3A99A 3W2RA 4D5HA 1CMKE 2QHMA 2PMIA 1XH8A 3FYKX 1GZNA 4EHEA 4PP7A 4QNYA 3VWAA 4BCPA 3RMFA 4HGEA 3D0EA 4OBOA 4GS6A 4YR8A 5IA1A 4CFMA 3D5VA 2UW4A 2YACA 3R8VA 5KCVA 5LOHA 3TTIA 1PXPA 1VR2A 3NVKI 2OWBA 5IUGA 5FEQA 4ZZMA 4JLCA 5HTBA 4EJNA 3ZYAA 4FKLA 4D9UA 4RFYA 3L8VA 4F9CA 5D11A 4O4DA 3VF8A 4IEBA 3R04A 4LV5A 3NNUA 4I21A 1OL6A 3GB2A 3PVWA 3VUKA 4FV4A 4RJ8A 3PJ8A 4XEYA 4FV0A 4O7NA 4XG3A 2W4OA 4QTEA 2HZ4A 2W1IA 3R00A 3SKCA 4DGMA 3EQGA 3WIGA 5L2WA 4YHFA 2DUVA 3AG9A 5EYMA 3R01A 4GYIA 5HKMA 4ZY6A 5CVGA 3E62A 4DEAA 4LMNA 2UW8A 2ETKA 3CR0A 4ITIA 4C8BA 4D4RA 1JKSA 3QQHA 5HD4A 4YC8A 3KC3A 5HGIA 2W5AA 2VV9A 3OEZA 4U45A 2NRYA 4HCTA 1WBTA 3DY7A 2W96B 5H3QA 4KRDA 4D2WA 1G8KA 2ZFYA 2B53A 2OIQA 1YDRE 2XK6A 3LM5A 3EIDA 3OTUA 1LEWA 2X0GA 4I4EA 4J97A 5FP5A 4C2WA 4EOLA 1PXKA 3ZHPC 3KRXA 5IQHA 3R8ZA 1CSNA 2V0DA 5AUZA 1X8BA 2WEIA 3LXNA 4NCTA 4OTHA 3UC4A 5FLFA 4HYIA 4FMQA 2GTNA 3QYZA 4G3EA 4ZZNA 3PA5A 4FR4A 4HPUE 3RM7A 4A9SA 4DG0E 5CEPA 3V5PA 4B7TA 2CGWA 3LCKA 4R7IA 3DU8A 3LIJA 1U46A 4J8NA 4ONAA 4A4OA 2R3FA 3S95A 1UWHA 2R2PA 3AT4A 5HNBA 5JFSA 4EK4A 4ZMEA 3ZLXA 4AP7A 4FV8A 2UW5A 2YLEA 3PXQA 4EC8A 4BDBA 3O51A 4LL0A 1YHVA 4A07A 3VS6A 5J79A 2X2LA 3HP2A 2OF2A 4DLJA 2YM3A 4M84A 3PXRA 4FTUA 1CKPA 4NJDA 4FYNA 2B55A 2ITTA 3MN3A 3QTUA 4O6EA 3PUPA 5CF8A 2WKMA 2PZYA 2YCRA 4LFIA 3VNTA 3ZTXA 4DGGA 4RVTA 2OIDA 3W2PA 2WMTA 3R6XA 1QPEA 3OWKA 3ZFMA 4ZMFA 4X21A 3FI3A 4Y46A 2YEXA 4ARKA 1Y57A 1FINA 4QMLA 5HCXA 4ZJIA 5C01A 5IH5A 3OWPA 4AA4A 3CTQA 4JQ7A 2PVHA 3L8SA 1P4FA 2R3OA 3UP2A 4C4FA 4MF0A 3DXQA 1YI3A 4KWPA 2PSQA 3QCXA 2C30A 4OAVB 2QC6A 3UO6A 3MW1A 3HDMA 2BAQA 4FT3A 3LKMA 4JMQA 3UPXA 3NW5A 3MFTA 5C8KA 3NIEA 3EN9A 2VWIA 3P86A 1WVYA 4I0SA 2PUIA 4UZHA 4O7WA 5M09A 4JRNA 3LFNA 1IEPA 2VUWA 4N6ZA 5FRIA 3ODYX 4XV2A 1FPUA 2ZB0A 5ACKA 2HY0A 3P5KA 3Q32A 4OBQA 3NUYA 3QD2B 5AP7A 3TYKA 5E8YA 3TJCA 3P9JA 5BYLA 5EKOA 2BRNA 5FBNC 3OWJA 3QYWA 3OCBA 4V01A 5BMMA 5T6KA 2JDTA 4AOTA 3FPMA 4AN9A 3LQ5A 2BIYA 4MNFA 4RWJA 4U97A 3V8SA 4C59A 3FDNA 2BZJA 1R1WA 1ZOGA 1LPUA 3TNPC 4AZVA 2W1FA 5ETFA 3JS2A 4MD7E 4FGBA 3MVHA 1PF8A 3GFWA 1U4DA 3MFRA 5HD7A 3DOGA 5BVWA 4ZS0A 4A9TA 4MYGA 1IA8A 3QC4A 4Y83A 4PL4A 4ZSLA 4E93A 4EORA 2UW0A 4QMUA 3T9TA 1GIIA 1OB3A 2YM5A 4RWIA 5EDPA 4U0IA 3DNEA 3DK6A 5AAGA 4DA5A 2I0VA 4BCIA 2Q83A 3DXPA 4RMZA 3TZ7A 4NKAA 1OL2A 3PZEA 4FZDB 3D15A 1YDTE 2VTSA 3FL4A 3MH2A 4FSZA 3VW8A 5D1JA 4FKTA 4EOOA 3TT0A 4AOJA 5DRBA 1H8FA 5K3YA 2XBAA 2ERZE 3LCSA 3I4BA 3NPCA 4JDIA 1PYEA 3GGFA 4HYHA 4R1VA 1WBVA 3W2CA 3ZZWA 2QI8A 3DPKA 5HX6A 3GENA 2O8YA 5DPVA 5A54A 4J95A 4J8MA 1Q97A 3FMLA 4FIGA 3AGLA 3PG1A 4K8AA 5J7BA 2Z02A 3KGAA 3KRRA 3PXFA 4M3QA 4IFGA 4L3LA 4N6YA 3DZQA 2BRGA 3CJFA 4F99A 2GS7A 1URCA 3WF5A 4CKJA 4QMNA 3RHXA 1AGWA 4FVPA 3ZO1A 3NMUF 1U5RA 5JH6A 3NUAA 4O22A 1ZYJA 4CNHA 1XQZA 3BLRA 4QTAA 4D28A 2WHBA 1YOMA 4BZDA 2A2AA 3ORZA 3QUDA 4BYIA 2OI4X 2J2IB 4IX5A 4IX3A 4OTIA 4X2FA 3F2RA 4LV7A 1QMZA 3DV3A 4MXAA 2PUPA 4RQKA 4APCA 3BHYA 4PDPA 3F5UA 5B2KA 2ZV2A 4AXEA 4KKHA 5ANJA 2DS1A 4MKCA 4ASEA 4K33A 1JSVA 2WQEA 3UVQA 1DAWA 3KCKA 3OY1A 3TWJA 3QALE 3VHKA 4DH3A 2C5VA 4GT4A 4UYNA 2R3NA 1APME 2ZM3A 3FKOA 3GU8A 4S34A 3Q3BA 1FOTA 4YHJA 3E3PA 2R64A 2XF0A 3QQGA 4LOOA 3PSDA 1J1BA 4AWIA 3H0ZA 4I3ZA 2XEZA 2XAMA 5CX9A 1W0XC 2V55A 4YLKA 1IASA 2JIUA 5EKNA 4IW0A 4E1ZA 3U8WA 2WXVA 4YO6A 5AP0A 3OVVA 4C3PA 5C4LA 4FTOA 4IX4A 3UO5A 2X9FA 3F5GA 3DCVA 1OM1A 2RF9A 4D2VA 3PIXA 2W17A 3V5LA 4ZTNA 2YDKA 3KXNA 3NR9A 1PXLA 2WTWA 5J1WA 3R63A 3OXZA 1ERKA 4FG8A 5HLPA 3RWQA 4PF4A 2WO6A 5ANGA 4PMPA 4BDIA 4KBKA 5ANKA 4FV6A 2P4IA 1OI9A 3HMOA 4WG3A 2WELA 4M67A 2XRWA 3RP9A 3WE8A 4WBOA 5DOSA 2C6MA 3EKNA 4U9AA 5AIKA 3V5WA 4CFVA 3UJGA 3HRCA 4IAKA 4DEGA 1P4OA 1HCKA 2HYYA 1ZMUA 2BAKA 2F2CB 4EOKA 5CEKA 3AKKA 4FRFA 3QTWA 2VO6A 2ETMA 4W9XA 2JD5A 5CVHA 4FTRA 5E4HA 2OLCA 5T3QA 2BHHA 2Y4IC 3ZDUA 5M55A 3IDPA 3Q6UA 4JQ8A 5JMSA 3L1SA 2V22A 3BU5A 3OBJA 2OBJA 2CNVA 4R77A 1R0PA 4IHPA 4BDAA 5LVOA 1M2PA 2B9IA 4QOXA 1DAYA 5DFPA 4WRSA 2IVVA 1U5QA 1Y91A 2YJRA 3UIUA 3MI9A 2HZIA 3OW3A 4CMUA 4IZ7A 3QGWA 4IDTA 5EDRA 4YSJA 5HU9A 4IDVA 3TIZA 1H4LA 3PA3A 1YOLA 4YHTA 2FVDA 5L2SA 2J9MA 3MPTA 5I3RA 4IAAA 4RLKA 3VS0A 5AUVA 3DT1A 3GC0A 2XA4A 2QQ7A 3Q04A 2OSCA 4JG7A 4LM5A 1TFFA 4YJSA 4IWPA 4RJ7A 4MBJA 2WNTA 4AS0A 3UQGA 4I6HA 1M52A 2GU8A 3L9LA 4NKSA 4TZRA 4U7ZA 3QCSA 4L9IA 3KVXA 2W1CA 3HUBA 3O2MA 3V5TA 1STCE 5AUWA 2GQRA 3MA3A 4ORKA 4CZUA 1PMUA 2PY3A 3G0FA 4EK6A 3CSVA 3FWQA 3ZFYA 3U6HA 4L3JA 1JWHA 5BMSA 3ATTA 4DCEA 2B0QA 5EQPA 3TN8A 2QCSA 4ACGA 5CAPA 3JYAA 1PMEA 3FMEA 3ERKA 3UQFA 2QD9A 3OT3A 5HE2A 4GYGA 3FPQA 5IG1A 5C9CA 3WILA 4D4YA 3NUPA 4PP9A 3TNHA 5IUHA 2XK4A 4RFZA 4JBVA 1NW1A 1PXNA 1OZ1A 3JPVA 4DFUA 4AT4A 3EMGA 4CZYB 2WMQA 5CQUA 1URWA 1TQMA 4C33A 1R3CA 4F7SA 4S33A 3IDCA 2ZYBA 3GCSA 4FKIA 4NCTC 2QU5A 2X81A 5D7VA 3ZH8A 4IBMA 3RPRA 4GCJA 4BWPA 4PNKA 4BHNA 4Y72A 4NYEA 4FT5A 2GHMA 4TYEA 4YJVA 4EK8A 2FA2A 2VTLA 4K2RA 2HCKA 5K0KA 5I0BA 2XS0A 4DGLC 3QRUA 2BFYA 2PMOX 2FYSA 2VZ6A 3FI8A 2W7XA 1UNHA 4J53A 4BHZA 4FUYA 5AR7A 1U54A 5AUXA 4DFNA 3Q60A 1VYZA 1GZKA 4DCAA 1JLUE 1Q5KA 5KUPA 1TQIA 2RSVA 4FTAA 1OPJA 5ACBC 5HTCA 3WYYA 1VEBA 5KO1A 3L8PA 3TTJA 2V7OA 3O8UA 3QRTA 3HGKA 3IOPA 4NJ3A 5IA5A 3WF9A 4C4IA 3ZBXA 3LJ2A 2YABA 3RM6A 3IKAA 3MH0A 4GT3A 2E2BA 3QTRA 3FHIA 2YFXA 3ROYA 2UZWE 4OW8A 4EQUA 5C1QB 3CLYA 5D41A 4QMMA 5I9VA 4EYMA 4OAUC 3HMIA 3E7OA 4PMTA 4D1XA 5BV3A 3ORKA 5EK7A 2J0JA 3NS9A 4ASDA 2XKFA 3PXKA 2GNIA 2XJ1A 3BGPA 5CQWA 4C38A 5E8WA 3MESA 2YM4A 2R7BA 3TMOA 2PMNX 4G5JA 4NM7A 2YIYA 5D9HA 4UMPA 4FEUA 2R3RA 3VUTA 3UIMA 1U59A 1OUYA 4RGJA 3ZM9A 4W4WA 5H8BA 1MRVA 4MEDA 4ANNA 3CQEA 5M4FA 1ZAOA 3JVRA 3PLSA 3MJ1A 4D4SA 2C6LA 3DDPA 3D9VA 4CCUA 3UMWA 2P3GX 4KSQA 4GG5A 4F9WA 3SG9A 4O0TA 2FSLX 3LFFA 3Q2JA 5ITAA 4XV9A 2W0JA 4NFNA 5IPJA 5IQIA 5IQGA 1XH4A 4AZWA 3DDQA 3JXWA 4Y5HA 2W4KA 3W10A 4BCNA 3C9WA 3ORIA 1H24A 3POOA 4JNWA 5IZFA 2XH5A 2CDZA 4PNIA 3UDSA 3R8PA 4BC6A 5AADA 4UMUA 5AP2A 2QO9A 4CD0A 4E4XA 3G15A 5D7AA 3PVGA 3E63A 5FEDA 3MY0A 4D0WA 4IM2A 4BJJA 4XG4A 3ACJA 3I5NA 3HV4A 1Z57A 1UU7A 4O4EA 4R6VA 3GCPA 4UALA 3UZRA 2OXYA 1H1PA 4TTHB 3VONA 3GCVA 4EEVA 3Q9XA 4H39A 3BHVA 3GU4A 2JIIA 2F7XE 3FKLA 4GH2A 3OOGA 4ZJVA 3MYGA 5CF6A 4ANLA 4AGDA 3LCDA 4TYHA 4EUTA 1TVOA 3ZBFA 4AE6A 2YIRA 4RIXB 1FMOE 3FI2A 4BCHA 3VRYA 2BMCA 2I0YA 5E7RA 3QLFA 2YZAA 3IW5A 2C6OA 3VVHA 3ML1A 3D7TA 4YZNA 1YDSE 2UZLA 2XAOA 5B2LA 3AKLA 3H9OA