1WC4A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and europium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
199
Chain Sequence
b'SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 59
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc4A00
2BW7A 2GVZA 3C15A 4OYZA 1U0HB 4USVA 3UVJA 1AZSB 1FX4A 1AZSA 1CJUA 4CLSA 1WC3A 4OYXA 1TL7A 3MR7A 2WZ1A 2W01A 1YBUA 2GVDB 5D0EA 2GVDA 4OYIA 4OYOA 4OYAA 4NI2B 5D15A 1U0HA 4CM0A 4USUA 3C14B 5D0GA 3G82B 4P2FA 4CLKA 4CLYA 3G82A 4USTA 1WC1A 1WC4A 1CJTB 1CJVB 4OZ3A 1CS4B 5D0RA 1CS4A 1AB8A 4OYWA 4CLUA 5D0HA 1CULB 4OYMA 4USWA 1YBTA 4WP3A 1CULA 1WC6A 2QV6A 1WC5A 1Y10A 4NI2A 4P2XA 4CM2A 1FX2A 5IV3A 4CLZA 1CJKB 3C14A 4OYPA 4CLPA 3MAAB 4CLTA 3MAAA 3C16B 1CJTA 1CJVA 4CLLA 3C16A 2GVZB 3C15B 1WC0A 3UVJB 3ET6B 4CLFA 3ET6A 1CJUB 4OYBA 4WPAA 1YK9A 4WP9A 1TL7B 4WP8A 4P2MA 4CLWA 4OZ2A 1CJKA 1Y11A 5IV4A 3R5GA
chains in the Genus database with same CATH superfamily
3QT5A 2MQMA 2ZC3A 3IR5B 1AZSA 3AA9A 4UOCA 3PO5A 1Y7PA 4OJ3A 2O3DA 2AX0A 3EUNA 2BV3A 1XNQF 2GVDB 1WEZA 2QFJA 1DHMA 1S1VB 4B9NA 2AWZA 3KK1B 2HHTA 4OYIA 3PW0A 5F8MA 3CMAS 1S57A 3K58A 4W98A 1OQ3A 3TZYA 2VICA 2DHXA 4AUKA 1UFKA 3CO9A 3DLBA 1QD1A 2H4WB 1GXTA 3WQPA 3K5LA 3MMJA 1BE4A 4DQPA 1LK7A 3N01A 4DR1F 1CS4B 3J7YI 3RUBL 2QJ3A 3ADAC 2XY5A 1HQUA 4B17A 2MHNA 1YJ7A 4ELUA 3BYPA 2UVVA 1TTHB 3H98A 4HH1A 1UPPA 1WHXA 3UVJB 1T02A 3FRYA 2XMVA 1R8AA 1LWCA 2XMMA 3R3TA 1RBLA 3C6TA 2HQFA 2C2OB 1LOUA 5L9NA 5GMDA 3QIPA 1SB6A 3FC9A 3DLEB 1LFPA 4O0IA 4J9VA 4NEYA 2H9ZA 2VH7A 4CH1A 3MEGA 4DR1J 3DGVA 3UPFA 3JQJA 1T8EA 4F26A 4WFNQ 4GVBA 4QIGA 2VBXA 3H25A 3AOAA 2J9CA 3MR6A 4USUA 4RLEA 1HWIA 4CLYA 3ILIA 4MK9A 3EICA 1FT8A 1I1GA 1X5SA 4YP3A 4JI5J 4DV5J 4RU9A 3HP6A 3CCES 2CJXB 5KG0A 3Q89A 1ZA2B 1X60A 3W62A 1VQ8S 2ROPA 1TKXB 3CGIA 2OTJS 1LW0B 2WOMB 5HMZA 1YHQS 2R7OA 3PFOA 1BLUA 5HANA 3OL8A 3PX6A 1IJEB 3M9OB 3MFHA 4F04B 2LMIA 3BR8A 3RTVA 1KLNA 2E1AA 5CQGA 1AT1B 4DSFA 3DNCA 3SBMA 1RWWB 4I2PB 1XEZA 2HNYB 1JJ2R 2KDOA 2FGOA 4ZJLA 2OLWA 3L3CA 4E8UA 1TKTA 2CQ3A 3ETMA 1Y5NB 5L8RC 2DGOA 4C8MA 4JI0F 2J6SA 1S49A 3GMGA 3HKZD 4YN3B 1KTVA 4OHWA 9RUBA 1Q4RA 5DQGA 1HW8A 3QSYB 3B4DA 2KFNA 3JYTA 2ILYA 5BYRA 3HVRA 5JXSA 3DRXA 4NI2B 3M8YA 4FN5A 3NCPA 2P5VA 3H40A 1FFWB 2CJAA 2QG9B 4OMFG 3HX9A 3VGUA 1G2EA 2QEXS 4M5GA 2F63A 2FLOA 1OY8A 2HYIB 2I2YA 2RD5C 2C2NA 1R0AB 5E3QA 1SL2A 1LWFA 3WIVA 2FJDB 1MWYA 2CADA 4NLQA 1RCXB 2QLFB 4OZ1A 4HHUA 2YQ3A 3OVBA 1VRTA 2E1RA 1PJ7A 1SKWA 2CQCA 4D3GA 1NDKA 3PYGA 4DLEA 1SH2A 1FWPA 3HSDA 1F5AA 3FBFA 4BLGA 2E5HA 4GKKF 2H1YA 1UEUA 3G8TA 1AYEA 3AHPA 5KFBA 3JXOA 3S6EA 5K8NA 1WG4A 2WRMA 4WTYA 2HBZB 1NZ8A 1V3ZA 2RU3A 1SIWB 4WCEQ 4LFBF 2P6SA 4CLKA 3DOLB 2LA6A 1N0UA 4KYZA 3DDIA 1Y4ZB 2X3GA 3FMBA 4RW4A 1OSCA 1HA1A 2OMOA 4OZJA 2R8IA 2GA7A 3J7Z5 2UP1A 2MGZA 1N36J 1NO8A 2GHWA 4TVAB 4GKKJ 4ZVOB 3KK2B 3Q22A 3OL9A 4QIFA 4DV7F 3DDKA 3LP2B 4FS1A 2UUBJ 4K0KJ 2ALZA 2BZ2A 2J8AA 3D6MB 3ENVA 5CZXA 3PW7A 1FERA 4EZ6A 2AJFE 2H65B 5KFIA 2A6OA 2AJ0A 2LQJA 2YBVA 4I56A 2ZBRA 4MH8A 1SC1B 4ZHRA 2KKHA 3BJYA 2ZH7A 5K5MA 3TZWA 4KKOB 3CJSA 4CM0A 3PYEA 1LV5A 3SEOA 1YRUA 2ZHOA 4RUAA 4QU7A 2D3UA 4LFAJ 3R7BB 4GC7A 1UEVA 2BYCA 4J9QA 3L95X 1CULB 1YBTA 3C6UA 1T0TV 2CA9A 5SUHA 4YY3J 2HHWA 5FIIA 1RTIA 3AB2B 3D7SB 1MN9A 2QFIA 2VDHA 2I0XA 1KLMA 4PG4A 5HP1B 1FK9A 2J6TA 3W63A 2GGPA 3PW2A 3CDWA 3CNQP 2V2ZA 5KOWA 3PJXA 4DPWA 3NCQA 2RE1A 2XB2D 3M2UA 2L9DA 2BJ8A 1U0HB 3HPOA 1S1UB 4DG1A 1XMQJ 4NLOA 1QM9A 1TL7A 5KT6A 4DL2A 1DBDA 1KDNA 3H2UB 1NMEB 1YG0A 4ZITA 4LRDA 3GV7B 2D69A 2ZKUA 1F2HA 2Q66A 2W8KA 2VHGA 3CJQA 2J7UA 4NYZA 2DCLA 4OI1A 2ASYA 2F40A 2ROEA 3OV7A 3FRZA 1LK5A 1U45A 5FLXU 5H9FJ 4K2JA 1NK6A 1CJKB 1UJ5A 3MURP 4LSLB 4IOCQ 3BBCA 3CCQS 3KNGA 3FSXA 1KVKA 5HJYA 2XULA 2IIHA 1S76D 3H2LA 4FXDA 2EPIA 3CJ2A 2YKAA 5KFDA 3DYAB 2BDPA 2QA2A 1Q53A 4I69A 5DGAA 2UUAF 4P10A 2FHOB 2D9PA 1VS3A 2D7SA 1XERA 2B0GA 1U1KA 2MZSA 2N7CA 1WTFA 1NHUA 1AFIA 5IQQA 2ERRA 5D0GA 3TZXA 1YBAA 2O66A 2OEKA 1LW2B 2O67A 5IC6B 3M1VB 1RACB 4PKDB 1D9FA 3JQMA 2B4OA 2ZH5A 1HBMB 1QUVA 3HSZA 5DDPC 1RT6B 3H8YA 2HURA 4PQUB 2CJ9A 2CWKA 4EMDA 3IN5A 3KOAA 3OTOF 3TAMB 4OX9F 4WZQA 2R8GA 4ED5A 4YHHJ 5F8NA 3LOUA 2UUAJ 3OL6A 2YNIB 5HI7A 4H4MA 5B0AA 4DUTA 3IM8A 2GMHA 2QN6B 2YKPA 3NNHA 2V4QA 3QGGA 2CWXA 3ZZOA 3B78A 4ZVQB 1JJCB 4B9UA 4RX6A 2Y1LB 2H54B 5FDLA 1S77D 2XSJB 3DMJB 5GMEA 3CXCR 4RW7A 3DLLQ 2R7WA 2HHQA 3QJJA 1KONA 3MR7A 1EETA 3IM9A 3MM6B 2ADCA 3D1OA 1EQMA 4MTPA 1OQ6A 4PG6A 1HYSA 3CCTA 3HZEA 2EC0A 1I3OB 2HNZA 1K0VA 1U1LA 1HMVB 4L6V3 4CYUA 4OX9J 2FHJA 4KTQA 2IPOB 2DNLA 5CAAA 2Y8WA 1G3OA 3LO3A 4JYAJ 4UUWA 4M5HA 4OYWA 1Q95G 3JQKA 4ZPVR 4LF1A 1WC5A 3Q8QB 2ZOMA 1XJWB 3SFUA 2EFVA 2B9EA 1U6ZA 4ITSA 2EK1A 3C16A 2HFOA 1NDCA 1R43A 3D68A 2AJ2A 3W2VB 1X4EA 3U1NA 3C46A 4M5IA 1QUPA 3Q8VA 2EFPA 4HHJA 4KV8A 1J2VA 2W7PA 1G7CB 3GLJA 3N5FA 2HWTA 1XN9A 3UD3P 4B9LA 1VQ9S 2ZM6F 9ATCB 3V81A 1FF2A 1WOPA 1HHTP 1VHIA 4LSNB 5BYQA 1RSCA 4PYAA 2DHHA 1SL1A 3MCNA 3WHIA 3GFYA 4NZ0A 2DR5A 3C2PA 2ZUGA 2R8JA 4OI4A 3MFIA 1WELA 2ZFHA 4EK2A 5D4LA 3OUYA 4Y3CA 4P52A 3MOZA 4LQ9A 2YPZA 5GAEI 3EGNA 4Y65A 5D0RA 2DXFA 4I0WA 3CD0A 1FX2A 2PE8A 2DH8A 3N9UC 3WX8A 1S1XB 1P1TA 4DV1J 2ZH9A 1XR5A 1H2TZ 1YKWA 3Q24A 1MROB 1KQGB 4FP9A 1FTRA 1NK9A 4I64A 2ZWPA 4FYXB 1N52B 5AXLA 2ZM6J 2IM3A 4Q0BA 2W24A 1PSDA 4UY85 2HK3A 3NGUA 2RIJA 1YLXA 2F8EX 2IAJB 5B0BA 4TYBA 1RBOB 3BBBA 4MMOA 4LVNP 1HQ2A 4QQBA 1WSRA 2FHKA 1A9NB 2XGPA 3TA2A 3CIMA 5HK4A 4U95A 3TP2A 5DM7Q 3TNVA 3DC2A 3AB4B 2FVPA 3IP0A 1RYSA 4PUOA 2HNDA 3SQGB 1NJYA 1I51B 3MUMP 2NPFA 2YKMB 4RJVA 1NAQA 2POKA 1F9EB 3OXGA 4DV0F 3NMRA 1FRXA 4MJKA 4IRKA 1H2VZ 2CZVC 3VF0B 1IBKF 3H42A 2JVRA 3CDBA 3DRRB 2K06A 4ILMA 4NX9A 3GE9A 1P9QC 1ZPWX 2D3ZA 4QR0A 4OZ5A 1CEZA 2KT2A 1REVA 4LF7F 1S12A 2JC1A 2MQ8A 1HNWF 3HSGA 1D8ZA 3ZZZA 4O3SA 3W2WB 2YTCA 1R3NA 1CJTA 1N5VA 2V8PA 1HWLA 1P8GA 1LFWA 3ET6B 4TKTA 2LCWA 3I82A 5J1PA 2OPQA 3P96A 2DPJA 1X4CA 3GU0A 4M5NA 2HQGA 4RU2A 3TA0A 3IS9A 4LR9A 1M0SA 3GIKA 2MY7A 3V6DB 3BPSP 5L46A 4M5LA 2AP6A 2HPUA 2HMIB 2U1AA 4F0MA 3GV8B 3HZGA 2IMOA 2F3JA 2DNRA 4C0BA 4IFVB 3UDCA 1IBKJ 2MZJA 4O44B 2VG7A 3LWMA 1S9GB 2Q43A 2AHOB 4K50A 3VAKA 1QAIA 1XC9A 3KKFA 3CIZA 4J37A 2QA1A 5HMYA 1VQYA 2DRDA 2DKOB 5ADZA 1K8AT 2YNFB 2XQCA 3QO9B 5D0HA 2LFVA 4W4MA 2Y0BB 4LT6A 2RT3A 4I7FA 2MPUA 2N7YA 3FSYA 2FVCA 5H9EK 2H5JB 2IC3A 1D3WA 4C8YA 2GQCA 1T3NA 4M5DB 4QW8A 3M8ZA 3JS9A 2ZJPQ 2DHSA 5DRKA 1Q8IA 2ZE2B 1RHKB 1KFDA 4N77A 4OZ2A 4HT7A 5IT9U 1FDDA 3FCVA 3X1LB 1NXIA 2VZ9A 2CDRB 4JI1F 3K5MA 3R5GA 4K4TA 1P9YA 1N32F 1NK7A 2BW7A 2GVZA 4OYZA 4Y2KA 2J9EA 1Q8LA 1RAGB 1RTZA 2HS4A 4P73A 4ECZA 4JI7F 5KG3A 2QYGA 1S6QB 2C2KB 4NMXA 2BUNA 4KC5A 1DQ8A 4GKJJ 3BS9A 1EIYB 3HI9A 2YX7A 1S72S 3FDSA 2AGQA 1AUDA 2GO8A 4HDGA 2XYHB 3GJSB 4TQSA 2K3IA 4WE1A 4CLPA 1VJWA 1QE1A 4ECQA 3TOQA 5A0YA 3SYZA 1N32J 2RF2A 3I4PA 3LP0B 5KG5A 1HBOB 2CPYA 2QGFB 2EFGA 3TJ9A 4U7CA 2PA8D 2WB4A 1JLCB 1NUEA 1NPKA 4W90B 1J5OA 4OLOA 4JI7J 2Y9HA 1S1TA 2NUHA 4TNOA 2WVCA 4OZNA 1RI7A 4O3OA 4TXSA 3MD1A 1UW9A 3R9LA 4HI1A 1ZH5A 4LUBA 2YWFA 2VKRA 2MQLA 3GR1A 1J5EF 5F9LA 3SSSA 2GAHC 3C66A 1ACMB 3ISZA 1PKUA 4L3KA 2OPRB 3GONA 3ZTOA 1XQIA 3DDNA 1UVNA 2M8HA 1TKDA 2BKNA 3BEGB 4CLUA 2RDDA 2IVFB 4AL7A 4OV1A 1YJNS 1HNZF 4M5JA 3HVAA 5KFGA 4IH7A 3OTDA 1ZS6A 2FC8A 2KL8A 5CYMB 3FBEA 3HHNB 3WIUA 3I55S 4EEYA 3MTKA 2BBEA 1LXNA 1SJ1A 1WC0A 4GRSA 2DH9A 2WVDA 3DI6B 2KRBA 1TL1B 4DLGA 4DR2J 1HHQA 5C25B 2MKCA 2B6AB 1FFSB 4IH5A 4O23A 2FLNA 2UUTA 1J27A 2KJVA 3M30A 5I42A 1SUQB 2VQEF 2YX4A 1LEOA 2ATCB 2R7SA 1VDHA 1GK8A 3BM7A 3DRPB 3QGHA 3W5YA 4PYDA 4IRDA 1QSLA 3PW4A 3I32A 4EGLA 1VC5A 5KFPA 1HNZJ 2E1MC 4R8UA 2HFSA 2IHR1 3VGSA 2K2PA 3V6KA 2ABYA 3IWNC 1Q8KA 4RPFA 4U7UK 1Q81T 5D4PA 2ILZA 5K9FA 3R1LA 1Q16B 3TVKA 3QNWB 2ACMA 5KFNA 2J0QD 1WDTA 4UOFA 3BO4A 5IS2A 2CUYA 1YIJS 3NY0A 3P5TL 3GV5B 5DGBA 2VQEJ 1FJGF 2D9OA 2KT5A 2IDLA 4RWXA 2R7XA 2GFFA 4RNHA 6FDRA 3PY8A 4ES2A 2HBYB 1B0VA 3H2VE 4Y2MA 1D8YA 2XWYA 3VQTA 2XNQA 2CJBA 3DFEA 3JTNA 3G87A 1ZOTA 2RJZA 2JZ5A 2RNEA 2N82B 5CXTA 1GTHA 3FQKA 5CCMA 5LMNJ 1N6QB 3MEDA 2GIQA 1JLBA 3MAQA 1NDPA 2PO4A 3U1LA 2EXUA 3OR1A 1HI1A 4P6QA 2F4VJ 2ZC4A 4DWIA 4ED8A 4CP5A 1SKRA 1E6YA 2V4RA 2HFUA 1WHWA 1X5PA 1HBNA 1IR1A 2KVIA 4AL6A 2LQ8A 1BC6A 4WYLA 2BABA 1FTCA 2VPZB 2KO1A 5HATA 4ZDNA 1C1CB 2WB1D 4CO2A 1ZAXA 1URNA 3DLKB 2L9NA 3M8RA 1BUXA 2V8HA 4NYPA 3C14A 1XK8A 2HWIA 1FEHA 2GMLA 2WBRA 5L1IA 2IA0A 2Y8YA 2FHJD 1ZTWA 5BR8F 1ZM4A 4NLUA 4A8XA 3K17A 1TVRA 3QLHB 1JLAB 1XR7A 4LR8A 5HBMB 3D54A 4A4JA 4NXNF 4L74A 1GX6A 4HR2A 1SKUB 4H4OB 4OQJA 1AUSL 2EI5A 3J80U 4ZVSB 3AD9C 4A8OA 1IBCB 4ES3A 1L3VA 2MSTA 8ATCB 4DX6A 5D6GA 4DV6J 2XY6A 4K4YA 2ZH6A 5J2QB 4NZ6A 3TUJC 1K1QA 3LA0A 3KLGA 1R27B 1H72C 2ZJRQ 1U2FA 3PM9A 5KFFA 1WSVA 2DGQA 4USTA 2IJRA 5MLCV 3UDLA 4MYTA 4C8ZA 5BR8J 3MI7X 3LPYA 1NK8A 3O8WA 2KI2A 2QC3A 1D1UA 2FJBB 2A3JA 2J6UA 3RW6A 4X4UA 4URQU 1Z2LA 4NXNJ 3EXYA 4YMEA 3DLJA 3QPIA 2W4CA 4CLLA 1XWLA 3BR9A 2FD2A 1ZTTA 1M5VC 1YWXA 3KG1A 2MKYA 2CJYB 3NLCA 3IMQJ 1UWBB 5DDQC 2D3O1 4OJ1A 4WKYA 1EQ0A 4EFAC 4LBHA 4ECSA 1B7FA 3PW5A 2XM3A 2B4UA 2NR0A 3Q2SC 4NLVA 1D9DA 3I6PA 1F0XA 3NEKA 4P7VA 5KFLA 1BQMB 3AH6A 3PIOQ 2JL9A 2I6WA 1PG5B 2C2ZB 5JMNA 1TL3A 3V5RA 1RTHA 1JQGA 1XBWA 2VL1A 4FVCA 4ID8A 2HRTA 5IM0A 1WC1A 1N5YB 4J9SA 3DLGA 4Q2MA 2WVBA 4C9DA 3KHHA 3M6WA 4MK7A 1N48A 4O4RA 3CMQA 1AFJA 5ETKA 1HBUA 1VLOA 2DNZA 3ITHA 4KHPF 5F9NA 3MMAB 1C0TA 4FYWB 3THTA 2R8HA 1N34J 2JRSA 2M52A 5F41A 2HFVA 5ETVA 2HHSA 1KKHA 2W9BA 3A3OB 3DOKA 1VQ4S 1V5VA 1S4FA 4PXBA 5DETA 1RT3A 5ETNA 1I94F 2UV8G 2MKHA 4AXIA 3OTEA 2JVOA 1QSSA 2IBOA 3OPKA 4Q8FA 3QWPA 4BCAA 2RRBA 5DLGA 1TUVA 1FRHA 3EVOA 2XO6A 1SBRA 1VRQC 3UCGA 4DSKA 4X4VA 4DHVA 4F3MA 2ZWOA 3AJ2A 5E3PA 3H20A 1GNKA 3MMCB 2ZHBA 1UA1A 3R5CA 4NL5A 3RBEA 3KJVB 1NLKL 1NSKL 4ZPCA 1S1VA 5KAKA 1RDRA 3JSMB 5B7WA 2HZVA 1QAXA 1OSDA 4KBIA 4DSEA 3T3FA 2BW2A 4WFZA 4ED3A 3POTA 1NK4A 4L75A 2FDNA 3H5XA 4C3KA 5FLXY 3PJWA 2C2DA 2AYEA 2FC9A 1GAOA 4N47A 3R2CJ 3A1YG 3MEKA 4UOGA 2HHHF 1H3DA 4KRWA 4B3OA 1IQTA 3BGRB 3OXLA 1HARA 5IC4B 3UVJA 4OFZA 2J5AA 5J1EB 1BQNB 1WI6A 3ENAA 1MMDA 2OPSB 4JI2F 2UVWA 1PO6A 1YZ6A 1CLFA 4CDIA 3OSNA 4K4VA 3OFEA 1VOMA 4U8VA 4TU8A 2Y1JA 1U02A 4X4RA 4DPTA 3HXMA 3DLEA 3ZTRA 4DCPB 1JIHA 4BC7A 3KUGA 4ZIVA 1HHSA 3BSNA 1GT8A 2I5JB 1IKXA 1RP5A 2QV6A 3OHBA 1S6UA 2XSFA 3ILOA 3M9NB 4KPYA 2IM1A 2LECA 1JLFB 4OYPA 2K1RA 2YQ0A 5GAHI 2LA4A 2VASA 2V6AA 1IBLJ 2D1CA 2R3VA 4OV6A 2XYGB 2V67A 2V8VA 4UQTA 4WP9A 1TKXA 3NAIA 1LW0A 3NGKA 4IRCA 4JI2J 3S7RA 3P6YC 2R42A 1QJHA 2WVFA 3HHLA 1EJ7L 2WVEA 2AEMA 3V4IB 1HW9A 3VV2B 4I2PA 1IWAA 3FKBA 4C7QA 4TQRA 3A8KA 3SCIE 2YNGB 1DJ0A 3TUZC 1XMBA 1FRMA 3SMZA 4DUYF 3G86A 1YZ7A 2HBQB 3EVWA 4F4WA 3MOJB 4TY8B 1HFEL 2FLPA 1S6PB 2KHDA 4ECYA 3KTQA 1HWKA 3ILJA 2DNHA 2QTWA 5FJ4A 4CTAB 2PDAA 1X4BA 3A13A 4X4OA 3A3PB 4NI2A 1NSQA 4LF4F 1V9OA 5KTQA 2JNJA 2VC0A 3E01A 3ICLA 5KFQA 4MIWA 1ICEB 1FO1A 2ZH2A 4TU7A 1FCAA 2B9XA 3M6XA 2G4BA 5B0CA 1T03B 2YXLA 1G1XA 1HWUA 4PAAA 2EKNA 2MLXA 1R0AA 2VQFF 3SCKE 2DRAA 3RR7A 3GIJA 1UMJA 4FVMA 3LW5C 5HN0A 3BN4A 4DUYJ 1PC5A 5T41A 1AZSB 3TX8A 2LU1A 3NS5A 3W9JA 2VU5A 4FF3A 4OHVA 2CQHA 3US5A 1FRKA 4PQAA 2DR7A 1VIXA 4X65J 1U0SA 3GFXA 2XMJA 2APOA 2ZDOA 2HIQA 2DK2A 2DBBA 4KAIA 1IJFB 4QR2A 2VC1A 2R7UA 5HQMA 4JI8J 4RUHA 1HQUB 5ETQA 2PFFB 3MPYA 1PJ5A 2FJVA 1RTJB 1XTZA 5L1KA 3DOLA 3R6LB 2ZZMA 1HIYA 5I3PA 2CVEA 4B3TJ 3C15B 3SDEB 2Y0SD 4GMKA 3SI8A 1T9TA 1KNZA 5F8JA 1S9EA 2MMYA 3AA8A 1CVJA 1IR2A 5KG7A 2YKOA 4H54A 1APSA 4MIBA 2V5HG 1JK9B 3NNCA 1RU2A 3PVXA 1X5OA 5LSRA 4F02A 2C2MB 2MZ1A 3QQCD 3F56A 3FJ2A 3IBFB 4ER8A 1M5HA 2NPIA 4U96A 2ZHAA 4ID5B 2CQ4A 3MEGB 1RA7A 3HM9A 4JB8B 2RUGA 3CSKA 4UOHA 4MYUA 3O1LA 1PAUB 1T3OA 5IFMA 5HAOA 1HI8A 4NWBA 1L5UA 4CO3A 4LF6J 3MF5A 4P2FA 1NEEA 3PFEA 4L72B 2LDIA 4CO5A 4N8NA 4AL5A 1RHUB 1F60B 1JLEA 4KKOA 3C3LA 1YITS 5D3GB 3M2RB 2CQGA 2HVEA 3W64A 2CQDA 1HKAA 2RH3A 1UL3A 4R5PA 1W25A 3R5AA 4I1TA 1YK9A 1WHVA 1WNEA 1WHYA 1W26A 2MSSA 5HQLA 1XMOF 2RAQA 3HCXA 3VALA 1TKTB 1SC6A 2HQ3A 2W9AA 2CPDA 3KNAA 3PHTA 1U1PA 3PDNA 1WDDA 4QU6A 1IKWA 1TP7A 1S0OA 4DSIA 6FD1A 5HP1A 3LAKA 4YR2A 1WF0A 4PR6A 4F50A 2HVIA 5E5NA 1U0HA 3ZTSA 5A8KB 2FQQB 8RUCA 4YR3A 4N7TA 3T9NA 1HD1A 5F8HA 3WX4A 4ED4A 5K8OA 5DQIA 4X66F 3VCDA 4RNFA 3V6HA 3EXCX 2DNOA 4OX7A 2OSRA 5IV3A 1LWFB 3NBPA 4UZCA 4K4WA 2BJ1A 1RHJB 3M4XA 3N6MA 1UAWA 2G2ZA 4LFCF 2VG5A 1R0BG 2QZ8A 1UJ6A 4YS2A 1JXLA 5KG2A 3LAMA 3I5AA 3E8OA 1CJKA 1PC4A 3D2WA 3H5YA 2V69A 5KFTA 3D9BA 1DFDA 5HROA 2VA2A 3PTWA 2V9KA 1NH8A 3OXFA 1EX8A 4U7UD 3OLBA 3EX7B 4X62J 4G1QB 3DYAA 3TW0A 1ZAVA 2LDYA 3W3SA 1WF1A 4ECRA 3UFCX 4DXLA 2E5LF 4M95A 3OLAA 4LF9F 3BH7B 4IUFA 2HQIA 3F73A 2DEJA 1NJZA 1Y9OA 2XWXA 3J7ZT 1MNEA 5KT4A 5DJBA 2K3KA 1VJQA 2M7SA 1N33J 4LFCJ 3MCOA 4C6AA 4CM2A 3TJ8A 5C2CA 3H0PA 2MGZB 2ZEJA 3CD7A 4OI6A 4PRFA 1LW2A 3M1VA 2Z56B 3OJSA 2B4PA 2IDEA 1HBMA 2XLJA 2N3LA 3ZNUA 3TYTA 4B9SA 3EVMA 1HNXF 3D0HE 2V50A 3TAMA 1DTQB 5KT3A 2WAQD 4JUZA 3I0RB 1G6BA 2AJ1A 2YNHA 2V8GA 3VGVA 2KU7A 1WC3A 2HRUA 4HHHA 1S97A 4WFAQ 1FKOB 4ZHRB 3P49B 1S10A 4GVLA 3N0VA 4FNHA 3PHEA 2XNRA 2GMJA 3GFZA 4DSJA 4OYAA 2NREA 1K1SA 1B4SA 1OPIA 4QYZJ 2ROGA 2XSJA 3D5MA 4EI2A 1SJ3P 4KFBB 3EZUA 3KJFB 1T7PA 2UXDF 7FD1A 3M8QA 1S4EA 4ZVHA 2F4FA 2AD9A 3C6UB 4KH0B 3IWXA 3G6ES 3G96A 1S48A 2NUUG 2RRAA 1NKBA 2G0CA 3GJRB 4CLTA 3I87A 2J0SD 3MAAA 1RTIB 1ZM2A 2PMHA 1NSAA 2IVMA 3PEJA 4FDFA 4M8LA 2IFXA 4OYBA 1BGXT 1DLOB 1BWVA 5KFRA 5KG1A 1FK9B 1JJ4A 2N3OA 2PI4A 2L3MA 3DXSX 3KJNB 4USKA 3T6JA 4DV2F 1WJ9A 3CDAA 4QBUA 3LH2S 4WXWA 3M2UB 2R2SA 3CCUS 4CO4A 3HMJG 4DG1B 5GAEU 3ZFVA 3FFIA 4ZLPA 2M9KA 3W2VA 3B82A 2RU9A 2XS2A 1T94A 2UXDJ 1FKPA 4C98A 4DQQA 3AODA 2MKSA 5HLFB 2KFYA 2JFKA 2FZKB 2V4JB 3LGNA 2G1DA 2G2YA 4DR3F 3K5NA 3NG8A 2DHGA 1F3FA 4WXOA 4DZDA 2JEFA 2ZITA 1MW7A 4LSNA 1O0PA 1OJ4A 2P2CB 2AGOA 2JHEA 5EN1A 1TK0A 3CJRA 2J0WA 3H7HB 4LRAA 2I8EA 2EC2A 3ZZ0A 1VBKA 2EK6A 1FKAF 2RRNA 2PEBA 3BGFA 4NASA 2HFZA 2DNNA 1IKYA 1FJ7A 1S1XA 2PGCA 2ZVIA 3Q83A 2HEKA 4J90A 2OUGA 5ETLA 3RAQA 4QWDA 2HLUA 4USVA 2VBZA 3MHYA 1OMSA 1T9VA 2LXUA 2H5EA 5KFHA 4QPXA 2IAJA 3BDPA 2C22A 1QLNA 3MTJA 3MPVA 4OIXA 1KFSA 2DITA 3HHLD 3KYLA 3K0JA 1K47A 3Q8PB 1R7IA 2E44A 3P45B 1RWMB 1FEEA 3P4UB 3NWGA 3SQGA 4Q45A 3CE8A 3VWSA 3EMTA 2J76E 3QT7A 1XIQA 2QSWA 1YTYA 1X7VA 3D3BJ 3B8HA 2WSCC 1T05A 4YR0A 3PX4A 4LVOP 4ZP8A 2BX6A 1ZM3A 3DRRA 2X1AA 4JOUA 1QVFR 4H4MB 3UWTA 4I2QA 4NCAA 4P72A 1R8CA 2RS8A 3GQCA 1C4AA 3GCXP 4ECUA 5DS7A 1FNOA 3RZAA 4USIA 5CZVA 3PNIA 2WK4A 4UF4A 5FDLB 3QJLA 4M94A 1P27B 1DRZA 1OY6A 3Q8YA 5MAOA 5JVGQ 2GJ2A 3KDOA 2EG1A 2VKZG 2EBEA 3EJMA 3TUIC 3VAHA 2FY1A 3CJKA 3AQPA 2L48A 2Q79A 2HNZB 3ZC4A 3OVAA 3UN2A 4EU0A 3UD4P 4ANEA 2XS7A 2E9RX 1ITPA 4XDCA 2QT7A 3J80Y 1VIOA 4IFVA 1URRA 1X0PA 4ALZA 4PXEA 2DNKA 2B56A 2C3UA 1FXRA 2C2EA 2HGNA 1P6TA 5I3QA 3N6LA 4AE5A 2WCXA 2VFVA 2HIYA 5HVFA 1Y10A 3IGNA 1XNQJ 5H1SV 2VDIA 3T6BA 1KOHA 2J0XA 4F0HA 3MM8A 4DBQA 1YI2S 3VAIA 3C16B 3FNNA 1SH3A 1JKHB 1P1LA 4XPEA 3QO9A 3OBIA 2J7KA 2KJWA 5B0DA 2DHAA 1NNDA 1AW0A 3IRXA 5GMKa 3GJQB 1HI0P 2KVQE 4KHMA 4KV8B 1B0PA 1UVMA 4U9RA 2QSFA 1R8BA 3EPGA 5J2PB 2GAGC 3IG1B 2HKEA 3WZ0A 4CIOA 1VK3A 2A1BA 4OI3A 1C1BA 3FZ2A 1PYTA 2ZE2A 1N5QA 2W9CB 3L4BC 4LBIA 1OYDA 3LANA 1SJFA 5CYQB 1Q7LB 1Z4UA 1H0HB 3DLHA 1CQNA 4ENOA 2JEIA 1V3RA 3K8WA 4DV3F 3H59A 5KFWA 3OUYB 5M2PA 1N5SA 2NXUA 2EVZA 1X4HA 2E1PA 1DQAA 4F2SA 4UY8T 3CCVS 3IBCB 1BD6A 3VAMA 4URSA 4J9OA 4CT9A 2Z58B 2R7TA 2JH3A 1WEYA 3JTPA 2CFXA 1F5BA 3W9HA 2BOAA 3K89A 2QL5B 2KYZA 2M2BA 4CLWA 1GMWA 3BSCA 4PXDA 2CNOB 1Y0HA 1VMBA 3SIPB 3LP0A 4USJC 2C3PA 1C0UB 1HNVB 1FWLA 4DV3J 2MJNA 3O44A 2BACA 2YWKA 5C2GA 3SFGA 4IOBA 3W5XA 4IG0B 1BHNA 1FA0A 3JB9k 4QCLA 3ENQA 2DY1A 4DV4F 1B3TA 1LWEA 1FD2A 2OHDA 1NZAA 3M2VA 3RJMB 3NS7B 4KGZB 1T11A 1T9YA 5GAGI 3RRHA 3RYLA 1Z1ZA 4HVZA 5KG4A 3GYXB 4P2XA 4JI0J 5GADI 1OS5A 2RKIB 1KN6A 3IAS9 3HSJA 2OPRA 3NS6A 1M1HA 1QDUB 3RW7A 1KWMA 4HTIA 4NCBA 1AXQA 4FZVA 5J2NB 3OQ2A 3M32A 1YJRA 2XLKA 5CYMA 4PZVA 4F4AA 3U27A 2AYMA 4P74A 4C3LA 2OH2A 2AIRB 5E41A 3RAMA 3D4JA 2KB2A 1MN7A 4CLSA 1IN0A 5KFVA 4EBCA 1PIEA 4I68A 1VHFA 5C25A 3QWUA 2B6AA 3OFGA 2BOPA 2RS2A 2PSZA 4OYOA 2V8DA 1SUQA 3VTIA 4RBVA 2Q3PA 4DPUA 2HHPA 1R6VA 2NXCA 3R97A 2A0FB 2B8PA 3R5BA 4UW2A 3FGVA 4L73A 3CJ4A 3GZ7A 5DG7A 1SL0A 4FF1A 3UO0A 1VYAA 2HZCA 2L9WA 5A2QU 4ED0A 2ZBCA 1RCOB 2IC3B 1CBKA 4ED6A 1RT2B 5DO2A 1HLWA 3MM7B 1HWJA 1JXVA 2BRKA 2XTJP 3UR0A 4LFBJ 1M5OC 3OD2A 3HLUA 3PKYA 4A48A 3G8QA 4WIQA 4J9RA 4OZ0A 3MXHP 3DRSB 2CNKB 4DFPA 1KRPA 1NK5A 3RRKA 4ECWA 3RB4A 4Q5VA 2CQPA 3Q8SB 5D4OA 1N5TA 4D3HA 3QRRA 2V2VA 4B3SF 1SQFA 1V3SA 1WEXA 3AD7C 1N6QA 3V4MA 4DV7J 1IXKA 4F8RA 2Q6BA 2EWHA 5KFUA 4B02A 4LRFA 4DS5A 3T5JA 4DN9A 4NMLA 3TA1A 2F5GA 1YQHA 3MCSA 2UUWA 5LM7E 3TUPA 2YQ1A 3E51A 1QE1B 5A0YB 2RF2B 3KJQB 4N41A 3MUVP 2R2TA 2BM1A 3GB0A 2Z2ZA 2I1RA 3WC0A 1R31A 3W1YC 2OPPA 1S1TB 3CWJA 3W60A 1A6LA 2HAFA 3CDUA 4EYHB 1RU1A 2ADBA 2AW0A 4J9NA 3D28A 3UDVA 5M2RA 3QLHA 4RZRA 2GQ2A 3CO0P 5AXNA 3SCJE 2FJWA 3D6FB 1GMVA 4DUZF 3OFHA 4H4OA 1GMUA 2EEYA 1RWOB 4S0MA 1ZM9A 2OI2A 3KXDA 3PXGa 4KB7A 4WYWA 4LIRA 4IDKB 2RVJA 4N76A 2GNKA 2DPIA 3MR5A 4NRTA 2W2PP 3PZPA 2AU0A 4X64F 2OFGX 2OSQA 3K7RA 2XS5A 2XEXA 1KQSR 3G4SS 4NA2A 4RNNA 2EBGA 4IOAQ 3CJ8A 3FEZA 5EX3A 2NS1B 4F3OA 4NEZA 5AE3A 1FRIA 2DEIA 5CHCB 1NB7A 1TR0A 3ENWA 1MWZA 4NA1A 2VFUA 2JDJA 2MQNA 2RQCA 5EWEA 4WF9Q 3M30B 1SJQA 5DZ6A 1HR0F 2D41A 5I42B 2VA3A 3L7UA 1MU2A 4KGMA 4FNIA 1DAXA 1VQNS 4OI2A 2RHSB 4R25A 4ECXA 5ETRA 3SQOP 4EZ9A 1SQEA 2AMCB 1UWBA 2DR8A 2CAJA 5L9XA 1KVIA 2DGUA 1RHRB 3BQ2A 3L09A 4R8UB 2B4VA 1KP6A 3J7AN 1H98A 4Z37A 1NSPA 4LF8F 1BQMA 4B9MA 3TRGA 2OP5A 1B7YB 2MLYA 4FYYB 3GIIA 3UCZP 2CDQA 4NYOA 5CD4H 2DRBA 2DT9A 1RLCL 4Y0FA 3HF5A 3NNAA 3A8IA 4OJGA 2IRXA 1T95A 4JBCA 2MKIA 1LXJA 1S5ZA 4CLFA 3KK3B 2BQ3A 4MKBA 3OJUA 2PA3A 3FBCA 3DHWC 1RQ0A 4HKQA 3LP1B 4R0EA 2AEFA 2SXLA 1O51A 2ZVSA 4WBFA 4WJBA 2RQ4A 3NKYA 5IV4A 1U1OA 4C11B 3UN3A 3KLVA 2X1GA 4X84A 2JFDA 3OR2A 4B3RF 4PG8A 3BKUA 4X4PA 3OTOJ 2AYBA 1JXEA 2IJFA 1Y3JA 2DISA 2G2OA 3X3UA 1VRUB 4LF8J 3THPA 4K5RA 4KSEB 3MM5A 1LKZA 1UZHA 5CH7B 5EDWA 1E6YB 2J7WA 3VVTA 3ETOA 4IR9A 4KY3A 5HO4A 4PG7A 4C8OA 2AQ4A 4DOZA 1S9FA 4DQRA 4EWTA 3SV3A 1SCJB 2BJEA 2KRRA 2ZBQA 5AXMA 2VG6A 2OGUA 4CLZA 3KMQA 3B54A 1RT4A 1F5CA 4B3RJ 1TVRB 3JSBA 1KC8T 1MMNA 3JSMA 1U09A 4RW6B 3ZZUA 5KFEA 4ZCIA 2MZTA 3MECA 2UXBF 1DZ5A 1RT7B 3CULA 4OJHA 4JV5F 3CCMS 1UCNA 2DO0A 2ZD1B 2MZQA 4A8QA 7FDRA 1PAEX 3PRVA 5HL7Q 3TR5A 1U48A 2JLFA 3IXQA 1D09B 4KPCA 1FWKA 3MDFA 4AD6A 5HVGA 1WKKA 1DURA 3BGRA 5GAHU 1RT5B 1F3VA 4ED1A 5EGYA 5J1EA 2OPSA 3T5LA 3EYZA 1KOOA 1WI8A 5EHHA 3DM2A 4BDPA 1SC3B 1EAYC 3GP9A 3P8BB 4KO0B 3QBCA 2QA4S 3GSIA 5M2UA 4NPOA 3CCZA 1RGVA 2F9JA 4NXMF 1U1MA 3LTOA 4IG3B 4E0DA 3KFWX 5G0RB 1S1WB 4JV5J 2CQIA 4DR7F 4DR6F 3TARA 2GO9A 3OFFA 4JV2A 2DGVA 4JI6F 4O3NA 5E0OA 3QIDA 4AQYF 4OHZA 3I0SA 1QY7A 3DKDA 4NLGA 4Z2XA 2O1PA 1O5JA 2BE2B 4U67Q 3Q86A 5KFSA 4Y34A 4C2MA 2DNPA 4WIIA 3D0IE 1UFWA 3ZZRA 3TEHB 5C42B 1GMWD 4LRCA 3Q8UA 4UUXA 3I4HX 5L39A 1RTHB 2OEMA 5GVQA 5DM6Q 4NXMJ 1GH8A 5IM0B 3SZ2A 2YKNA 2QLJB 3SCLE 3V4IA 3DLGB 2IYGA 4RBUA 1RAIB 1M5KC 4DR7J 4Y00A 2W2OP 4QWAA 2OO4A 3WDOA 3LWLA 1X0FA 1QAYA 4MT1A 3R6GB 1TK5A 3FCWA 3LF0A 1MSWD 3PKMA 4ELTA 2HAIA 4OHXA 2E9TA 2WONB 3VZIA 1C0TB 3KLFA 3CJ0A 4TY8A 2CNLB 2KT3A 5EWFA 5CYJA 5C24B 1S6PA 4DV0J 1YVFA 3IGVA 4P2SA 1FDBA 4EBEA 2J9DA 4LBPA 4G1PA 1L3KA 3N5BA 5F3ZA 4J9UE 4DL3A 2NXNA 1RT3B 1U49A 4DS4A 3KLIB 4EUVA 2D3OR 2VOPA 3F0NA 4LF7J 4OI0A 2Z8QA 2VIHA 1HNWJ 1T03A 1HL6A 1U26A 4ZVEA 1ROFA 4O3QA 3NGDA 2B5JB 4WZMA 3CTRA 4DDFA 3BGUA 3UR3C 1GFWB 1LNQA 2QE5A 3WBZA 5LL6d 5A8WB 3FSIA 3CUNA 2PFDA 4OX8A 3W8PA 2XMTA 4F25A 4A8KA 2QO3A 2MQPA 1WTBA 2ZNZA 2L41A 1NHKL 3D67A 4TU9A 2V2KA 5F8LA 2KM8C 1TAQA 4DQSA 5CA5A 1L3SA 3POTB 3FMWA 4JV0A 3UNGC 2N4DA 2CXEA 4ANCA 4NLWA 3JAMU 2X1FA 5A76A 1E6VB 4ZK7M 1HPZA 2E5JA 2P6TA 3E3XA 1RTJA 1YJUA 1MMLA 5KFYA 3W9IA 3ZXWA 2C28A 4F2RA 4B3OB 5T7LB 4JI5F 2MJUA 2UUCF 4DV5F 2E7XA 3ILLA 3C15A 2YVSA 3SDEA 4KIAA 3L9ZA 3G9CA 2DD8S 3FK4A 2FUG9 2G9OA 3NOGA 1GQEA 3M05A 1S79A 2FB0A 2YWWA 1D9AA 1FI4A 1U1NA 2HS3A 2EKYA 4CZCA 3HHLC 1R8HA 1MLAA 3LALA 4R0JA 4LJMA 1MWQA 2KM8B 2CRLA 2XG8A 1D0EA 1ZYQA 1VQLS 3J81Y 3GIRA 5DLFA 1X8DA 1SI9A 2KYXA 4ID5A 4JI1J 3TQEA 3UDEA 4RW9A 1IKXB 2G0JA 4ATNA 4NLDA 5KFAA 1KQKA 1JB0C 1RKIA 2CPEA 2K1RB 2RILA 5B0EA 1VISA 4WU3A 1M1GA 3MWBA 5ETOA 2OJ3A 2UUCJ 4G1IA 1REGX 3VZHA 1Q86T 2VOOA 2LLZA 4ZVTB 2RDIA 2Y3YA 2CPFA 3ELHA 5D3GA 1T9XA 2HW3A 3I9ZA 1RHQB 3M2RA 3RU0A 3HHLB 4O4GA 5HSPA 2COLA 5THWA 2LYVA 3FQLA 1X4FA 2OAUA 4ANDA 4KR0B 1TKZB 2Y1IA 2WZ1A 1TFWA 4OLPA 3J81j 4DF8A 2ZKTA 5JVHQ 4Q2LA 2BQRA 1IBMF 2CYYA 2FY8A 4O3PA 1GXLA 2BMBA 1JLGA 4UZBA 2M70A 3F41A 4FS2A 3D6TB 4AXJA 1WC4A 4ZCLA 3RBDA 3MPWA 2M0GB 2KG1A 1Q0NA 4F67A 3MD3A 2HVHA 2P9GA 4RNOA 1YDLA 3C19A 4ZP9A 1S6OA 5A8KA 3E01B 4P75A 3HULA 2W1BA 4XTTA 2R9LA 1H7WA 2DVIA 1K0TA 4CH0S 2ZOFA 4ZJQA 4ZIWA 1RBAA 1J5EJ 1I5OB 3MR3A 1JJHA 5ETPA 2M3DA 3PR5B 2DB1A 2W2NP 3JTOA 4ERDA 3HFKA 3NP5A 4N8OA 1QTNB 1R6YA 3K5OA 3ISND 1TMMA 2IM0A 2UU9F 1IBMJ 2V9WA 2PEHA 4C8KA 2XMWA 4J9KA 1FX4A 4DL5A 2Z57B 3JSRA 5DDOC 4KHRA 1N36F 1EKSA 1FRLA 3G71S 1WKLA 4PEOA 1FJEB 4FXWA 1RWXB 2CQ0A 1SJRA 1I6JA 4LF5F 1VI7A 3G82A 2G1HA 4JI3F 4ZMMA 2NZCA 3DU6A 3QGPA 1RTDB 4DPYA 2UUBF 4K0KF 4G1QA 5IQ6A 5G4DA 2HQCA 5KT7A 3HT3A 5I3UB 1KTQA 2AX1A 4NLSA 3TANA 4WK3A 1X9MA 5L38A 1QTMA 2UU9J 3T1HF 1S9EB 4J9PA 2LEPA 4WPAA 4IO1A 1RAHB 5KFZA 2R2UA 4FKYA 4NOHA 2F7VA 2BA9A 5A6WA 3RAXA 4MKVA 3I31A 2VFTA 4LFAF 1NKEA 2YWHA 1EP4B 3QSIA 4RL1A 5KG6A 4LF5J 3PACA 2GIRA 4YY3F 3THVA 4YDDB 4JI3J 4CWBA 2HS0A 3KG4A 1FVSA 4TLQA 2E7VA 3S8SA 2V94A 1DTQA 5E3RA 1FJGJ 3I0RA 5LJ5Y 4CNYA 3AY0A 2XMKA 1RE1B 4YB7A 4Q43A 3CB4A 1XNRF 2QIFA 1CJVB 4ZJOA 1FKOA 3KLEB 1YJVA 1UVKA 3T1HJ 2Q6CA 3TZZA 4YB5A 1O6XA 1JLEB 8AT1B 4OX6A 1XMQF 2DR6A 3GR0A 4KFBA 4PWDA 2FJXA 2JX2A 1K9MT 4H4KC 4I4BA 1VGYA 1DTTA 4R5PB 3EZOA 3QJPA 4ZPTR 3EDRB 1JMTA 2QA4G 2GW8A 4K4ZA 2OD4A 3BO3A 2DCUB 3NGSA 1IKWB 3MM9A 3BYRA 1B0TA 2V2QA 4JV1A 1DLOA 4USHA 1U1QA 2PMZD 4ZVRB 2DGWA 2BE7D 2DH7A 1YBUA 5ITHA 1XNRJ 4CQ1A 1RK8A 2IMWP 2A6MA 4DX5A 2A18A 2UVUA 4V19J 1WOOA 3V6JA 3IAM9 2RMLA 3HT0A 3DN9A 2C3OA 4F4XA 4QW9A 3TAQA 1VQOS 5K20B 2VONA 1WC6A 3A8JA 5HLFA 4NCGA 3NBPB 2CJQA 2V4JA 2CPHA 3BQ1A 2UV8A 4YUDA 1X4GA 2VG5B 2FZCB 3EE3A 4JI4F 4GC6A 1RUSA 4J9MA 1TL4A 1X4DA 4ICLA 5A2QY 3OTBA 2CG4A 3NGTA 2HGLA 4ZS6A 4Y2AA 5HROB 3AJ1A 2VPXB 1WWHA 2XMUA 4N56A 3I5CA 4EYIB 1SJ4P 2KZMA 4OYXA 2HBRB 1NDLA 3HHKA 4MK8A 1JLQB 2RQMA 4P71A 2DTJA 3M8PB 2M5YA 3IWLA 4ZCMA 1N0VC 1IM6A 4YHHF 3HVTA 5C5JA 1PYSB 1RLDA 4J91A 2K8GA 2QRRA 2GCFA 5HMWA 1UEKA 2ATLA 3DXBA 4U6PA 1NM2A 2IBKA 4CH7A 4QYRA 1IKVB 2W4DA 2Q1LA 4JI4J 6AT1B 3VR1A 4HLBA 3TO8A 3PX0A 4DI6A 2FHMA 3CCWA 1SV5A 1JWWA 2FLLA 4L76A 3H5SA 3BGLA 2X3DA 3MMBB 2OFHX 3D3CJ 2RHQB 5F8GA 4ETZA 3O3LA 1W2BR 3RB6A 5J2MB 4N5SA 2CKWA 2G0IA 3PEHA 2CQ2A 3PRDA 2CPZA 1VBYA 4WFBQ 5K14B 4X2BA 4JYAF 2MHEA 1OWXA 5LMUF 2YNHB 2JWNA 2GJFA 4FPRA 3AOCA 4DFKA 4KHPJ 4AFFA 2V0NA 4QWEA 3KUEA 2HVZA 1HNIB 4ECVA 2PMWA 3G6YA 1S0NA 5KFKA 2GVDA 1IQZA 4PPDA 3Q8RB 3KK1A 1YRXA 2CPJA 1UWAA 2XGQA 5E7OB 5FD1A 3TEGA 1RISA 2CIMA 3P5BP 5CCLA 5LXYA 4FYDA 1WG1A 3M8QB 1I94J 2EG2A 3L7OA 3EGVA 1CS4A 4M5MA 1GXUA 1RXOB 1Y5LB 2Y1RI 2HZAA 1U8WA 2VB6A 2DY9A 2EFQA 4QZVB 3OL7A 5A6PA 1NCLA 3MAAB 2R7RA 1BMQB 2YY3A 1FDAA 2Z30B 4RUBA 2VJVA 5LMUJ 4Q44A 3KLHB 1VQ5S 1CJUB 2FZGB 3T19A 4DPXA 2XZDB 1T9WA 3MEEB 1K73T 1TZ0A 2NCKL 5LOQA 2EW9A 4BC9A 2ZZTA 2IVYA 3T5HA 3FUYA 1JKHA 3DOMB 3CEDA 3FFIB 4HT5A 4C48A 4ZP6A 4V1Ak 2B8QA 5E3AA 2B7CB 2OTLS 4DF4A 1IR0A 4DV1F 2DGSA 4I6YA 1FKPB 4HACB 4X4SA 1RZMA 4ZPBA 2XY7A 5J2PA 3IG1A 2BANB 4ZVGA 4QYZK 1HQEB 2PIIA 1RT1B 2AZ1A 3K5PA 2QL9B 1TAUA 1DARA 3DGPB 4PABA 2HHHJ 4WU2A 4EBDA 4FF2A 2W9CA 2JSXA 4IFYB 5EWGA 5ETSA 4FYVB 2ZJQQ 2BKOA 3CT9A 4KGVB 4ED7A 5A8RB 5CYQA 4DU7A 4G3IA 3A8EA 4K59A 3U7JA 2WOMA 1VQ6S 2B3TB 1VQMS 4NRUA 2I38A 1PYOB 1KVJA 3ONQA 2LQ5A 4ZVUB 4E2FB 2VBWA 2CPXA 1IKYB 4Y6IA 4IR1A 5B09A 2HNYA 2DJWA 1F6TA 3VQSA 2HGMA 5CD4A 4ZA1A 4F4ZA 3EGZA 4B9TA 1GTEA 2NSBA 5GAGU 1YX2A 2GX8A 5DDRC 1O8BA 3UW1A 5E2QA 5GADU 3T1YF 5LSLA 2AT1B 4RW8B 1SKSA 3AQOA 2IRYA 2YX1A 1EZZB 1CG2A 5IZHA 1NPPA 4ETXA 2F65A 4DL7A 1C0UA 1HNVA 1TV6B 1Y00A 5B0GA 5K8MA 2LVWA 3LUYA 1S7HA 2FVSA 4ZLJA 3IO1A 3GTYX 1U8SA 4NLYA 3QGIA 4IG0A 1RWKB 1EARA 4MFBB 3PCOB 4NLXA 4Q7AA 4USWA 2IY5B 2AYGA 1T05B 3CW2C 2CPIA 3OSPA 1Z2ZA 4ZPDA 2BRLA 3V2UC 3ZNJ1 1KEKA 4I2QB 4A8YA 4DPOA 4RWWA 2E29A 1TUGB 5HMXA 3UD5A 2RDJA 4FXVA 2KXNB 3M8WA 2RKIA 3AOBA 3T1YJ 3JSYA 2AV5A 2LU2A 3L7PA 3OW2R 1FDNA 4CNZA 3S1TA 5J2NA 4LF4J 1WKJA 4CT8A 3EPIA 1EB0A 2HQDA 3CJKB 2KHCA 3QRPA 4RR5A 3CCJS 3FBBA 1BQXA 5D15A 1B99A 1Y5IB 1RB0A 4WKRA 2VQFJ 1FE0A 1X9SA 3UQSA 2QLXA 3VGTA 1N88A 2A2CA 1N54B 2ZZNA 4FBTA 5AE1A 3FVYA 3BREA 2BJDA 3CD5A 4KE5A 4URGA 1Q1KA 2KXHA 1LWCB 2R4FA 3C6TB 3MM8B 1FRJA 2I9SA 5ETTA 5AT1B 3IR6B 1DQ9A 2A2DA 1NJIT 3BDEA 1LQ9A 2F1FA 4DFMA 2VFRA 3QIPB 1BWEA 2YH0A 3IRXB 4ZOSA 3HFZB 3KK2A 1KHWA 5F0WA 3RGIA 1VQ7S 4QIWD 3AXMA 3LP2A 4GKJF 4GVBB 3IA0A 3OHAA 1RT2A 4RBTA 3IR7B 1S0MA 3QT6A 3MM7A 1C1BB 4TY9A 3VAGA 2P8IA 3W66A 1L3TA 3ZO7A 3AFGA 1UPMB 3DHXA 1TUWA 3DRSA 2IYIA 3N79A 4ECTA 2PC6A 3BB5A 5AE2A 1RWUA 2W25A 3CCLS 1TQLA 1RJJA 2R7QA 3NAHA 4IO9Q 1AA1B 2E5IA 1CULA 1M5PC 3QMQA 2EFOA 4O0NA 4IKAA 5L1LA 4QWBA 1VFJA 2FIUA 2FVRA 2R8KA 4LIWA 2ZBIA 3QT8A 4LMZA 2P9EA 3K2YA 1NBEB 1KBRA 3JYTB 2BQUA 4B08A 1ZZNA 3T1AA 4QIVA 3BGOP 1H7XA 1S1UA 4HEA9 3N4WA 3Q23A 3DCAA 2K7JA 2DNQA 2GV1A 5KFMA 2PI5A 4ZN3A 4HH0A 3NRBA 5KOXA 1LWEB 2HHVA 1XMOJ 3OT9A 4DR2F 3FZBA 3M2VB 2XZWA 4BHQA 3G8SA 2PN6A 1VRTB 2BE9B 3OTCA 2X7IA 2CNNB 1CPZA 1UETA 2VPWB 2Z2MA 1FJCA 2JJ4D 2N4CA 4LSLA 2GJIA 5JJBA 1WG5A 4FPIA 3VHQA 1NU4A 2GIFA 4IDKA 1U25A 2FPHX 3M32B 4F4YA 1NK0A 4C0OC 5IT9Y 1YSJA 4Y2CA 4I6WA 2L08A 2Z2YB 4X66J 5BXIA 1FNXH 4K8RA 1Q5YA 4YB1P 3CC4S 2OIHA 2BJ7A 3RB0A 2CJKA 3JAMY 3O6QA 4RO0A 3VAFA 3TAPA 1H73A 3BV8A 1UVIA 3HJFA 3BSAA 2MQQA 2WSFC 4Z7CA 1JX4A 4JP8A 4RW4B 5DG9A 3G6XA 2H4YB 2VD3A 4PG5A 2DO4A 2MXYA 3B4MA 3VVUA 1YJWS 3GIMA 7AT1B 2K7KA 4TN2A 4ED2A 1RT6A 3OVSA 5AXKA 3MR2A 4PQUA 1SPBP 5LMNF 2BJ9A 5F0UA 3CC2S 4DL6A 2CVIA 1TU0B 3NXZA 5C7PA 1SQGA 4ILRA 2E5LJ 4LF9J 2YNIA 2F4VF 2JEJA 1CC7A 3BZQA 5J1NA 3KG0A 3BBFA 2MDAA 1S59A 1Y11A 4OZLA 1EHWA 3VAJA 4WK1A 4DZ6A 4ZVPB 4DR4F 1IUJA 2C3YA 5U47A 4WTOB 3Q2TC 3SSRA 4IH6A 1FE4A 1JNZB 5HJXA 1X9WA 3KK3A 2XMAA 3DMJA 3SXLA 3LP1A 2HWHA 4HI2A 3MM6A 1UFLA 3UN5A 4YEAA 3A4TA 2KFZA 1UTAA 4C11A 3LPEA 2R7VA 4CO1A 2CZ9A 2YPYA 3D66A 3RBXA 1HNXJ 2FVQA 1HMVA 1PBUA 2ASJA 1FD8A 5F8IA 1RAOA 4AT1B 3R5JB 1VRUA 4UQGA 5LXRA 2LEBA 1KLMB 5KT5A 4WP3A 2GZOA 1GEHA 4C3MA 2GGPB 3ULHA 5EUHA 3W5ZA 3ZZPA 3HHEA 2KN4A 5LJ3Y 5DZ7A 4DR4J 3T5KA 4DV6F 1M1KT 3BQ0A 2F8MA 1A7GE 2NSCA 2XHWA 1VQPS 1TL7B 3BH6B 2ASDA 2OPPB 1WOSA 2GS8A 3ISNC 3D1QA 5HVHA 3M6UA 4K5SA 3E2EA 1NJXA 3QZ7A 3BKTA 3BKFA 3EGWB 3TX0A 4RW6A 5D8HB 4UTGA 2MTLA 1TL5A 1RT7A 2FJAB 4BWMA 2ZD1A 3HD2A 2OELA 5AJ3F 5KFOA 4DV2J 1TELA 1NKCA 1H74A 2B43A 2LEAA 2Z4PA 4DFJA 1ELOA 1RABB 1RT5A 1X4AA 1U6FA 1GX5A 2XYPB 2PD1A 4HL9A 1KR4A 1MROA 3NWRA 1RADB 4KO0A 2IM2A 4A8SA 4DX8H 3C8YA 2W4PA 1SIZA 3O2IA 4DR3J 2OMLA 2E66A 4IG3A 2JEGA 4PWWA 2W7OA 5G0RA 1S1WA 4A8FA 1MU2B 5AJ3J 3TI0A 2E9ZA 1MG7A 5D78A 1RWPB 4DEZA 4ZLLA 4XIUA 3HHDA 2YKMA 5H9FK 1N34F 4X4QA 3QRQA 3G2XA 2BE2A 4C4WA 4LRBA 2XC9A 4GO5X 4X4TA 3A3NB 3MAHA 2NLWA 3AT1B 2ZUAA 5C42A 1UJ4A 2YKQA 3GJTB 1AB8A 3IC1A 4K7QA 2DR9A 3UI3A 2ZH4A 3Q0AA 2ZH8A 3M8SA 2M88A 2NQPA 2O01C 3M9MB 2HRYA 2E5GA 3CF5Q 5H9EJ 4CCHA 3W2WA 1OO0B 1FESA 4NA3A 3ET6A 4RW7B 3D6HB 3DRYA 1EETB 3O5TB 3HK2A 3QYYA 2E1CA 4LREA 4K4XA 1F2GA 4EO8A 4QJVA 1HYSB 2WONA 5IXUA 3V6DA 1VLYA 2IJNA 3HDSA 3CJ5A 5C24A 3OR2B 2HK2A 4XAKA 2A10A 2HMIA 2UXCF 4BBYA 3BO2A 4DQIA 3NCRA 2DXEA 4FF4A 4CYUB 1CSJA 4UT4A 3LGHA 3KUHA 1U47A 2CQBA 2VBYA 1RWNB 1YRTA 3KLIA 4O44A 1RAFB 3MM5B 4A8MP 1S9GA 2FYXA 1NRKA 4QIEA 3RBZA 3J7YU 3K59A 2RQKA 4KQZA 4QWCA 3H4DA 2ZH1A 4DU8A 5SZTA 2PT0A 1RAAB 4A8WA 2B5JA 3BF4A 2YNFA 3GG0A 3KWMA 3GPAA 1YJ9S 2OD6A 1QAJA 2AF6A 1VC0A 2VG6B 5A8WA 5LSOA 3K57A 4P9SA 5IT0A 2VODA 1RT4B 3GSDA 2W7AA 4M5DA 2UXCJ 3V81B 2M8DB 3KDNA 1PBAA 3BPDA 3MECB 3QFHA 1HD0A 2H5IB 1U7LA 3AJDA 1KD1T 1SVDA 2P9CA 3K8VA 2VF3A 4HTJA 1RYRA 2HG4A 1S99A 2OEJA 3RRGA 1VR6A 2B9YA 1E6VA 3ZZYA 5KFCA 4WFXA 2AJ4A 5T7LA 2YWEA 4DL0C 1IBLF 1S6QA 4RNMA 2HFNA 2H48B 5LT5A 3M6VA 2VFSA 1R89A 2ZH3A 3I96A 3DM2B 3ZTPA 1BXNA 2FTRA 1S0VA 4Q0BB 4ZKAA 2V68A 4CRJA 2ZBPA 3UCUP 2XO7A 1BY9A 3N28A 3CD6S 2HHUA 3R1HA 4NLTA 1C2PA 3SV4A 2DNMA 3NGRA 2XHCA 1IWGA 4F4KA 1RA6A 1HBOA 2B7BB 2NXEA 1UA0A 3I0SB 3U1MA 4PUOB 3I9V9 3QAEA 1JLCA 3AAWB 2M4MA 4J7CA 2HNDB 4Y2IA 3NMAA 4KH1B 4M63A 1WORA 4J9LA 3MUTP 1JNRB 2KZZA 2EFNA 2JLGA 3QZ8A 4F3QA 2UVRA 2X1BA 1NHVA 2RSQA 3IRWP 5B0FA 3EZ5A 1UVLA 2BR0A 1U2CA 1REVB 3GWCA 3MZIA 4PXCA 2YKNB 1PGZA 3UE2A 4XO0A 2IRUA 1TKZA 1CJTB 3HFVA 4U8YA 2QX0A 2D74B 3QFWA 2HHXA 4F0KA 3BN7A 2AGPA 2H51B 2OPQB 4OYMA 3HJVA 1VBXA 3R27A 4MIAA 2DIVA 3IS9B 3PO4A 5BJRA 3KLFB 4V19X 2B9WA 5L1JA 1KHVA 2CQ1A 1KSPA 1K44A 1Q78A 4DMZA 3DU5A 4C8NA 1WD6A 4ZP7A 4DV4J 4Q8EA 4X65F 3DI6A 1U1RA 1TL1A 1Q8BA 2KXFA 4DL4A 3G6VA 4BS2A 2MZRA 2VG7B 2O5DA 5EX0A 1UW4A 2YH1A 2ASLA 4A46A 1ZAWA 2J8SA 4JI8F 4PPZA 5ETMA 1OIAA 1PILA 4DR5F 1SH0A 2QYCA 2W01A 1Q82T 3DRPA 2C42A 2KH9A 4HDHA 4B3TF 5F3TA 4C0HA 4I7FB 1R8PA 2ALYB 5IWAF 1F9HA 4C8LA 4IQMA 3GFHA 4XK8C 4K4SA 4OZ3A 4J5OA 3PIPQ 1IM4A 2W2QP 4B9VA 1U6BA 1T9UA 3LGMA 5HQ8A 1U2RA 2MB0B 2GVZB 3A12A 1RTDA 2DXDA 4LF2A 1NH7A 1OYEA 3U02A 4QPTA 3I5BA 1HPZB 5I3UA 4G65A 4DR5J 5B08A 4LF6F 3UNYA 4NZ7A 5IOLA 3D1HA 3FEXB 2KTQA 3F44A 4Y28C 5IWAJ 1RAEB 2VV5A 1R0CB 3MGJA 2BXJA 3ZZTA 3RG6A 4AYBD 2XBPA 4TYAA 1H2UX 2QL7B 4P7TA 2MKJA 1Q7YT 1A0OB 1VQSA 1ULRA 2NYHA 2XCAA 3M7VA 1EP4A 2MEWA 1CQMA 4WE1B 3PV8A 2DNYA 1NJWA 4F36A 4WFYA 4ZLNA 3CMES 4RW9B 4YFUA 3CCSS 3W7BA 4FKXA 1J5OB 1VQKS 1C1CA 2AZ3A 2Z0GA 3DLKA 4NLRA 3PRBA 2NZ4A 5RUBA 3GCWP 1CJVA 4MKAA 3MCMA 3KLEA 1SXLA 4B3SJ 1F1BB 4I6AA 3HO1A 1JLAA 4YB6A 3R8YA 3KMSA 5HBMA 2GHVC 3AXKA 3R5DA 4O4GB 4LR7A 5E3CA 1Y3KA 2KG0A 4NE9C 3P3DA 2MKKA 1ZPVA 1H6KX 3PYDA 2LQ9A 1U4BA 3RB3A 4CO0A 3CPWR 5D0EA 2VPYB 2J9DE 1N56A 2QMUB 3W61A 5J2QA 1JLGB 2QLWA 1FHTA 2XLIA 4Z7YA 3FCHA 3T9ZA 3R7NB 4DJBA 1NPRA 2GC8A 1Q79A 1ZETA 4FBUA 4KGKA 3CJTA 1RWVB 2HLTA 5CABA 3S01A 3T41A 3H4BA 4G6VB 3TQ1A 2F9DA 2LXIA 4BWJA 5KT2A 2IA6A 4DUZJ 1ZBTA 4X62F 5E33A 4H4KA 2QMWA 2WTFA 1ZZFA 4IYQA 5IT4A 4KGXB 3TWZA 1XR6A 2XI3A 2X51A 2GQQA 4USMA 1V6HA 4KJIA 1N33F 4DCOB 2NXJA 3EWGA 3BSOA 4M1KA 3FEYB 4TLRA 5DQHA 4I67A 1M5SA 4X64J 2LKZA 2U2FA 2B51A 1YJTA 5KFXA 4A47A 4ILLA 2JC0A 4MAKA 3IBWA 3GYGA 3H5UA 1UKUA 3CVKA 3KHGA 1UP1A 2E7WA 3G82B 1Q5VA 5I4MA 3CC7S 1UVJA 1HR0J 1N5YA 4RKUC 1JLQA 3M8PA 1TK8A 4K2XA 3NL0A 2BM0A 4ZPAA 4OL8A 3W8GA 3KHRA 3AD8C 2C1EB 5KFJA 1RHMB 1AROP 2RUSA 3PYFA 3MPDA 2XCPA 3CCRS 1QSYA 3R2DJ 3MMAA 4YDXA 1N4LA 5T14A 1CC8A 1ZA1B 2DIUA 1IKVA 4M5KA 2UZAA 1KQFB 4HYKA 3MEDB 1H38A 1JLBB 2Z2LA 1VCTA 2LQBA 4P2MA 3OR1B 1G4CA 2NYIA 2VUGA 4E98A 3HKWA 3MMBA 1VBZA 5DG8A 3RR8A 4O3RA 1HBNB 2FJEB 3NOCA 5J2MA 1WACA 4YOEA 1LWXA 2AKWB 1WF2A 1UZDA 1RAJA 2QLBB 4NLPA 2V63A 1X31C 3LQVA 5K14A 3EM1A 3H90A 3MMCA 4W92B 3TVYA 4YQWA 2MQOA 3C14B 2HSEB 2ZOGA 1L3UA 1HNIA 1WUUA 2DGXA 3N6NA 4QOTA 3J7A1 1OPZA 2AEJA 3KJVA 2W2MP 4PWUA 1TFYA 2BEFA 1N8RT 1FXLA 4C97A 2V34A 5BYSA 3HVWA 1QVGR 2XZTB 2F8HA 4B3MF 4LSZB 1FNMA 4PWDB 1SC4B 3EDQB 2XI2A 1DTTB 2VJUA 3PJ9A 3QAUA 4ES1A 4XPCA 2JLEA 3GILA 4CI0B 3IFEA 1PCAA 1DY3A 4L3NA 2LXFA 3KLGB 2DNGA 1W7WA 3MM9B 2YWGA 5JUMA 3TJAA 3KLHA 4F7VA 1CJUA 1BQNA 5D77A 3GYNA 4QR1A 2ACYA 3MEEA 4EO6A 4KT0C 1YGYA 1TMJA 3CDEA 2CG8A 3MPUB 3GG1A 1NB2A 3CJ3A 3HD1A 4DCJB 3SSQA 3DOMA 4X4NA 2LP4A 4WWSA 4B3MJ 2UXBJ 4IQXA 4ZPWR 2C2RA 1IVZA 4HACA 2FGCA 4ZVFA 3QATA 2I5JA 2BANA 1HQEA 4NCGB 1RT1A 3PR4A 3DGPA 1JLFA 3D0GE 1VC6A 4IFYA 2ZNYA 4DX7A 2RB7A 4GO7X 4ZN1A 5A8RA 1FXDA 2AJQA 4WP8A 5D4NA 4ELVA 2MLZA 4ICLB 1C4CA 2HVDA 1B70B 1U24A 4RUCA 2GHPA 3ZTQA 2W8LA 1TL3B 4DSLA 3W65A 1KS2A 1B64A 2CZ4A 2WHOA 4ZCKA 1X5TA 2G13A 2WBMA 3WC2A 4DR6J 2MY8A 2YNGA 3HVTB 4JI6J 1HBUB 1RKJA 1PJ6A 4LQ3A 4AQYJ 2WW8A 3ITHB 3R7SB 3J81U 1F9FA 2WSEC 2BVZA 3TVZA 4DN0A 2DGTA 2JOQA 4OHYA 5K8PA 2QMXA 2ZDPA 1M90T 2MYFA 4XDDA 4RW8A 2C3MA 4CTAA 3PG9A 1OY9A 2W9BB 3DOKB 1SV5B 2OKQA 1V5IB 2H3EB 1TV6A 1FFGB 4PCQA 2BKPA 1VK8A 4MFBA 2BJ3A 3I56S 3KHLA 2DYAA 1FVQA 2R2RA 3B6BA 1W2IA 4K4UA 1S7IA 1EKRA 4MKYA 2WW4A
chains in the Genus database with same CATH topology
2BW7A 2GVZA 3C15A 4OYZA 1U0HB 4USVA 3UVJA 1AZSB 1FX4A 1AZSA 1CJUA 4CLSA 1WC3A 4OYXA 1TL7A 3MR7A 2WZ1A 2W01A 1YBUA 2GVDB 5D0EA 2GVDA 4OYIA 4OYOA 4OYAA 4NI2B 5D15A 1U0HA 4CM0A 4USUA 3C14B 5D0GA 3G82B 4P2FA 4CLKA 4CLYA 3G82A 4USTA 1WC1A 1WC4A 1CJTB 1CJVB 4OZ3A 1CS4B 5D0RA 1CS4A 1AB8A 4OYWA 4CLUA 5D0HA 1CULB 4OYMA 4USWA 1YBTA 4WP3A 1CULA 1WC6A 2QV6A 1WC5A 1Y10A 4NI2A 4P2XA 4CM2A 1FX2A 5IV3A 4CLZA 1CJKB 3C14A 4OYPA 4CLPA 3MAAB 4CLTA 3MAAA 3C16B 1CJTA 1CJVA 4CLLA 3C16A 2GVZB 3C15B 1WC0A 3UVJB 3ET6B 4CLFA 3ET6A 1CJUB 4OYBA 4WPAA 1YK9A 4WP9A 1TL7B 4WP8A 4P2MA 4CLWA 4OZ2A 1CJKA 1Y11A 5IV4A 3R5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BW7 A;  2GVZ A;  3C15 A;  4OYZ A;  1U0H B;  4USV A;  3UVJ A;  1AZS B;  1FX4 A;  1AZS A;  1CJU A;  4CLS A;  1WC3 A;  4OYX A;  1TL7 A;  3MR7 A;  2WZ1 A;  2W01 A;  1YBU A;  2GVD B;  5D0E A;  2GVD A;  4OYI A;  4OYO A;  4OYA A;  4NI2 B;  5D15 A;  1U0H A;  4CM0 A;  4USU A;  3C14 B;  5D0G A;  3G82 B;  4P2F A;  4CLK A;  4CLY A;  3G82 A;  4UST A;  1WC1 A;  1WC4 A;  1CJT B;  1CJV B;  4OZ3 A;  1CS4 B;  5D0R A;  1CS4 A;  1AB8 A;  4OYW A;  4CLU A;  5D0H A;  1CUL B;  4OYM A;  4USW A;  1YBT A;  4WP3 A;  1CUL A;  1WC6 A;  2QV6 A;  1WC5 A;  1Y10 A;  4NI2 A;  4P2X A;  4CM2 A;  1FX2 A;  5IV3 A;  4CLZ A;  1CJK B;  3C14 A;  4OYP A;  4CLP A;  3MAA B;  4CLT A;  3MAA A;  3C16 B;  1CJT A;  1CJV A;  4CLL A;  3C16 A;  2GVZ B;  3C15 B;  1WC0 A;  3UVJ B;  3ET6 B;  4CLF A;  3ET6 A;  1CJU B;  4OYB A;  4WPA A;  1YK9 A;  4WP9 A;  1TL7 B;  4WP8 A;  4P2M A;  4CLW A;  4OZ2 A;  1CJK A;  1Y11 A;  5IV4 A;  3R5G A; 
#chains in the Genus database with same CATH topology
 3QT5 A;  2MQM A;  2ZC3 A;  3IR5 B;  1AZS A;  3AA9 A;  4UOC A;  3PO5 A;  1Y7P A;  4OJ3 A;  2O3D A;  2AX0 A;  3EUN A;  2BV3 A;  1XNQ F;  2GVD B;  1WEZ A;  2QFJ A;  1DHM A;  1S1V B;  4B9N A;  2AWZ A;  3KK1 B;  2HHT A;  4OYI A;  3PW0 A;  5F8M A;  3CMA S;  1S57 A;  3K58 A;  4W98 A;  1OQ3 A;  3TZY A;  2VIC A;  2DHX A;  4AUK A;  1UFK A;  3CO9 A;  3DLB A;  1QD1 A;  2H4W B;  1GXT A;  3WQP A;  3K5L A;  3MMJ A;  1BE4 A;  4DQP A;  1LK7 A;  3N01 A;  4DR1 F;  1CS4 B;  3J7Y I;  3RUB L;  2QJ3 A;  3ADA C;  2XY5 A;  1HQU A;  4B17 A;  2MHN A;  1YJ7 A;  4ELU A;  3BYP A;  2UVV A;  1TTH B;  3H98 A;  4HH1 A;  1UPP A;  1WHX A;  3UVJ B;  1T02 A;  3FRY A;  2XMV A;  1R8A A;  1LWC A;  2XMM A;  3R3T A;  1RBL A;  3C6T A;  2HQF A;  2C2O B;  1LOU A;  5L9N A;  5GMD A;  3QIP A;  1SB6 A;  3FC9 A;  3DLE B;  1LFP A;  4O0I A;  4J9V A;  4NEY A;  2H9Z A;  2VH7 A;  4CH1 A;  3MEG A;  4DR1 J;  3DGV A;  3UPF A;  3JQJ A;  1T8E A;  4F26 A;  4WFN Q;  4GVB A;  4QIG A;  2VBX A;  3H25 A;  3AOA A;  2J9C A;  3MR6 A;  4USU A;  4RLE A;  1HWI A;  4CLY A;  3ILI A;  4MK9 A;  3EIC A;  1FT8 A;  1I1G A;  1X5S A;  4YP3 A;  4JI5 J;  4DV5 J;  4RU9 A;  3HP6 A;  3CCE S;  2CJX B;  5KG0 A;  3Q89 A;  1ZA2 B;  1X60 A;  3W62 A;  1VQ8 S;  2ROP A;  1TKX B;  3CGI A;  2OTJ S;  1LW0 B;  2WOM B;  5HMZ A;  1YHQ S;  2R7O A;  3PFO A;  1BLU A;  5HAN A;  3OL8 A;  3PX6 A;  1IJE B;  3M9O B;  3MFH A;  4F04 B;  2LMI A;  3BR8 A;  3RTV A;  1KLN A;  2E1A A;  5CQG A;  1AT1 B;  4DSF A;  3DNC A;  3SBM A;  1RWW B;  4I2P B;  1XEZ A;  2HNY B;  1JJ2 R;  2KDO A;  2FGO A;  4ZJL A;  2OLW A;  3L3C A;  4E8U A;  1TKT A;  2CQ3 A;  3ETM A;  1Y5N B;  5L8R C;  2DGO A;  4C8M A;  4JI0 F;  2J6S A;  1S49 A;  3GMG A;  3HKZ D;  4YN3 B;  1KTV A;  4OHW A;  9RUB A;  1Q4R A;  5DQG A;  1HW8 A;  3QSY B;  3B4D A;  2KFN A;  3JYT A;  2ILY A;  5BYR A;  3HVR A;  5JXS A;  3DRX A;  4NI2 B;  3M8Y A;  4FN5 A;  3NCP A;  2P5V A;  3H40 A;  1FFW B;  2CJA A;  2QG9 B;  4OMF G;  3HX9 A;  3VGU A;  1G2E A;  2QEX S;  4M5G A;  2F63 A;  2FLO A;  1OY8 A;  2HYI B;  2I2Y A;  2RD5 C;  2C2N A;  1R0A B;  5E3Q A;  1SL2 A;  1LWF A;  3WIV A;  2FJD B;  1MWY A;  2CAD A;  4NLQ A;  1RCX B;  2QLF B;  4OZ1 A;  4HHU A;  2YQ3 A;  3OVB A;  1VRT A;  2E1R A;  1PJ7 A;  1SKW A;  2CQC A;  4D3G A;  1NDK A;  3PYG A;  4DLE A;  1SH2 A;  1FWP A;  3HSD A;  1F5A A;  3FBF A;  4BLG A;  2E5H A;  4GKK F;  2H1Y A;  1UEU A;  3G8T A;  1AYE A;  3AHP A;  5KFB A;  3JXO A;  3S6E A;  5K8N A;  1WG4 A;  2WRM A;  4WTY A;  2HBZ B;  1NZ8 A;  1V3Z A;  2RU3 A;  1SIW B;  4WCE Q;  4LFB F;  2P6S A;  4CLK A;  3DOL B;  2LA6 A;  1N0U A;  4KYZ A;  3DDI A;  1Y4Z B;  2X3G A;  3FMB A;  4RW4 A;  1OSC A;  1HA1 A;  2OMO A;  4OZJ A;  2R8I A;  2GA7 A;  3J7Z 5;  2UP1 A;  2MGZ A;  1N36 J;  1NO8 A;  2GHW A;  4TVA B;  4GKK J;  4ZVO B;  3KK2 B;  3Q22 A;  3OL9 A;  4QIF A;  4DV7 F;  3DDK A;  3LP2 B;  4FS1 A;  2UUB J;  4K0K J;  2ALZ A;  2BZ2 A;  2J8A A;  3D6M B;  3ENV A;  5CZX A;  3PW7 A;  1FER A;  4EZ6 A;  2AJF E;  2H65 B;  5KFI A;  2A6O A;  2AJ0 A;  2LQJ A;  2YBV A;  4I56 A;  2ZBR A;  4MH8 A;  1SC1 B;  4ZHR A;  2KKH A;  3BJY A;  2ZH7 A;  5K5M A;  3TZW A;  4KKO B;  3CJS A;  4CM0 A;  3PYE A;  1LV5 A;  3SEO A;  1YRU A;  2ZHO A;  4RUA A;  4QU7 A;  2D3U A;  4LFA J;  3R7B B;  4GC7 A;  1UEV A;  2BYC A;  4J9Q A;  3L95 X;  1CUL B;  1YBT A;  3C6U A;  1T0T V;  2CA9 A;  5SUH A;  4YY3 J;  2HHW A;  5FII A;  1RTI A;  3AB2 B;  3D7S B;  1MN9 A;  2QFI A;  2VDH A;  2I0X A;  1KLM A;  4PG4 A;  5HP1 B;  1FK9 A;  2J6T A;  3W63 A;  2GGP A;  3PW2 A;  3CDW A;  3CNQ P;  2V2Z A;  5KOW A;  3PJX A;  4DPW A;  3NCQ A;  2RE1 A;  2XB2 D;  3M2U A;  2L9D A;  2BJ8 A;  1U0H B;  3HPO A;  1S1U B;  4DG1 A;  1XMQ J;  4NLO A;  1QM9 A;  1TL7 A;  5KT6 A;  4DL2 A;  1DBD A;  1KDN A;  3H2U B;  1NME B;  1YG0 A;  4ZIT A;  4LRD A;  3GV7 B;  2D69 A;  2ZKU A;  1F2H A;  2Q66 A;  2W8K A;  2VHG A;  3CJQ A;  2J7U A;  4NYZ A;  2DCL A;  4OI1 A;  2ASY A;  2F40 A;  2ROE A;  3OV7 A;  3FRZ A;  1LK5 A;  1U45 A;  5FLX U;  5H9F J;  4K2J A;  1NK6 A;  1CJK B;  1UJ5 A;  3MUR P;  4LSL B;  4IOC Q;  3BBC A;  3CCQ S;  3KNG A;  3FSX A;  1KVK A;  5HJY A;  2XUL A;  2IIH A;  1S76 D;  3H2L A;  4FXD A;  2EPI A;  3CJ2 A;  2YKA A;  5KFD A;  3DYA B;  2BDP A;  2QA2 A;  1Q53 A;  4I69 A;  5DGA A;  2UUA F;  4P10 A;  2FHO B;  2D9P A;  1VS3 A;  2D7S A;  1XER A;  2B0G A;  1U1K A;  2MZS A;  2N7C A;  1WTF A;  1NHU A;  1AFI A;  5IQQ A;  2ERR A;  5D0G A;  3TZX A;  1YBA A;  2O66 A;  2OEK A;  1LW2 B;  2O67 A;  5IC6 B;  3M1V B;  1RAC B;  4PKD B;  1D9F A;  3JQM A;  2B4O A;  2ZH5 A;  1HBM B;  1QUV A;  3HSZ A;  5DDP C;  1RT6 B;  3H8Y A;  2HUR A;  4PQU B;  2CJ9 A;  2CWK A;  4EMD A;  3IN5 A;  3KOA A;  3OTO F;  3TAM B;  4OX9 F;  4WZQ A;  2R8G A;  4ED5 A;  4YHH J;  5F8N A;  3LOU A;  2UUA J;  3OL6 A;  2YNI B;  5HI7 A;  4H4M A;  5B0A A;  4DUT A;  3IM8 A;  2GMH A;  2QN6 B;  2YKP A;  3NNH A;  2V4Q A;  3QGG A;  2CWX A;  3ZZO A;  3B78 A;  4ZVQ B;  1JJC B;  4B9U A;  4RX6 A;  2Y1L B;  2H54 B;  5FDL A;  1S77 D;  2XSJ B;  3DMJ B;  5GME A;  3CXC R;  4RW7 A;  3DLL Q;  2R7W A;  2HHQ A;  3QJJ A;  1KON A;  3MR7 A;  1EET A;  3IM9 A;  3MM6 B;  2ADC A;  3D1O A;  1EQM A;  4MTP A;  1OQ6 A;  4PG6 A;  1HYS A;  3CCT A;  3HZE A;  2EC0 A;  1I3O B;  2HNZ A;  1K0V A;  1U1L A;  1HMV B;  4L6V 3;  4CYU A;  4OX9 J;  2FHJ A;  4KTQ A;  2IPO B;  2DNL A;  5CAA A;  2Y8W A;  1G3O A;  3LO3 A;  4JYA J;  4UUW A;  4M5H A;  4OYW A;  1Q95 G;  3JQK A;  4ZPV R;  4LF1 A;  1WC5 A;  3Q8Q B;  2ZOM A;  1XJW B;  3SFU A;  2EFV A;  2B9E A;  1U6Z A;  4ITS A;  2EK1 A;  3C16 A;  2HFO A;  1NDC A;  1R43 A;  3D68 A;  2AJ2 A;  3W2V B;  1X4E A;  3U1N A;  3C46 A;  4M5I A;  1QUP A;  3Q8V A;  2EFP A;  4HHJ A;  4KV8 A;  1J2V A;  2W7P A;  1G7C B;  3GLJ A;  3N5F A;  2HWT A;  1XN9 A;  3UD3 P;  4B9L A;  1VQ9 S;  2ZM6 F;  9ATC B;  3V81 A;  1FF2 A;  1WOP A;  1HHT P;  1VHI A;  4LSN B;  5BYQ A;  1RSC A;  4PYA A;  2DHH A;  1SL1 A;  3MCN A;  3WHI A;  3GFY A;  4NZ0 A;  2DR5 A;  3C2P A;  2ZUG A;  2R8J A;  4OI4 A;  3MFI A;  1WEL A;  2ZFH A;  4EK2 A;  5D4L A;  3OUY A;  4Y3C A;  4P52 A;  3MOZ A;  4LQ9 A;  2YPZ A;  5GAE I;  3EGN A;  4Y65 A;  5D0R A;  2DXF A;  4I0W A;  3CD0 A;  1FX2 A;  2PE8 A;  2DH8 A;  3N9U C;  3WX8 A;  1S1X B;  1P1T A;  4DV1 J;  2ZH9 A;  1XR5 A;  1H2T Z;  1YKW A;  3Q24 A;  1MRO B;  1KQG B;  4FP9 A;  1FTR A;  1NK9 A;  4I64 A;  2ZWP A;  4FYX B;  1N52 B;  5AXL A;  2ZM6 J;  2IM3 A;  4Q0B A;  2W24 A;  1PSD A;  4UY8 5;  2HK3 A;  3NGU A;  2RIJ A;  1YLX A;  2F8E X;  2IAJ B;  5B0B A;  4TYB A;  1RBO B;  3BBB A;  4MMO A;  4LVN P;  1HQ2 A;  4QQB A;  1WSR A;  2FHK A;  1A9N B;  2XGP A;  3TA2 A;  3CIM A;  5HK4 A;  4U95 A;  3TP2 A;  5DM7 Q;  3TNV A;  3DC2 A;  3AB4 B;  2FVP A;  3IP0 A;  1RYS A;  4PUO A;  2HND A;  3SQG B;  1NJY A;  1I51 B;  3MUM P;  2NPF A;  2YKM B;  4RJV A;  1NAQ A;  2POK A;  1F9E B;  3OXG A;  4DV0 F;  3NMR A;  1FRX A;  4MJK A;  4IRK A;  1H2V Z;  2CZV C;  3VF0 B;  1IBK F;  3H42 A;  2JVR A;  3CDB A;  3DRR B;  2K06 A;  4ILM A;  4NX9 A;  3GE9 A;  1P9Q C;  1ZPW X;  2D3Z A;  4QR0 A;  4OZ5 A;  1CEZ A;  2KT2 A;  1REV A;  4LF7 F;  1S12 A;  2JC1 A;  2MQ8 A;  1HNW F;  3HSG A;  1D8Z A;  3ZZZ A;  4O3S A;  3W2W B;  2YTC A;  1R3N A;  1CJT A;  1N5V A;  2V8P A;  1HWL A;  1P8G A;  1LFW A;  3ET6 B;  4TKT A;  2LCW A;  3I82 A;  5J1P A;  2OPQ A;  3P96 A;  2DPJ A;  1X4C A;  3GU0 A;  4M5N A;  2HQG A;  4RU2 A;  3TA0 A;  3IS9 A;  4LR9 A;  1M0S A;  3GIK A;  2MY7 A;  3V6D B;  3BPS P;  5L46 A;  4M5L A;  2AP6 A;  2HPU A;  2HMI B;  2U1A A;  4F0M A;  3GV8 B;  3HZG A;  2IMO A;  2F3J A;  2DNR A;  4C0B A;  4IFV B;  3UDC A;  1IBK J;  2MZJ A;  4O44 B;  2VG7 A;  3LWM A;  1S9G B;  2Q43 A;  2AHO B;  4K50 A;  3VAK A;  1QAI A;  1XC9 A;  3KKF A;  3CIZ A;  4J37 A;  2QA1 A;  5HMY A;  1VQY A;  2DRD A;  2DKO B;  5ADZ A;  1K8A T;  2YNF B;  2XQC A;  3QO9 B;  5D0H A;  2LFV A;  4W4M A;  2Y0B B;  4LT6 A;  2RT3 A;  4I7F A;  2MPU A;  2N7Y A;  3FSY A;  2FVC A;  5H9E K;  2H5J B;  2IC3 A;  1D3W A;  4C8Y A;  2GQC A;  1T3N A;  4M5D B;  4QW8 A;  3M8Z A;  3JS9 A;  2ZJP Q;  2DHS A;  5DRK A;  1Q8I A;  2ZE2 B;  1RHK B;  1KFD A;  4N77 A;  4OZ2 A;  4HT7 A;  5IT9 U;  1FDD A;  3FCV A;  3X1L B;  1NXI A;  2VZ9 A;  2CDR B;  4JI1 F;  3K5M A;  3R5G A;  4K4T A;  1P9Y A;  1N32 F;  1NK7 A;  2BW7 A;  2GVZ A;  4OYZ A;  4Y2K A;  2J9E A;  1Q8L A;  1RAG B;  1RTZ A;  2HS4 A;  4P73 A;  4ECZ A;  4JI7 F;  5KG3 A;  2QYG A;  1S6Q B;  2C2K B;  4NMX A;  2BUN A;  4KC5 A;  1DQ8 A;  4GKJ J;  3BS9 A;  1EIY B;  3HI9 A;  2YX7 A;  1S72 S;  3FDS A;  2AGQ A;  1AUD A;  2GO8 A;  4HDG A;  2XYH B;  3GJS B;  4TQS A;  2K3I A;  4WE1 A;  4CLP A;  1VJW A;  1QE1 A;  4ECQ A;  3TOQ A;  5A0Y A;  3SYZ A;  1N32 J;  2RF2 A;  3I4P A;  3LP0 B;  5KG5 A;  1HBO B;  2CPY A;  2QGF B;  2EFG A;  3TJ9 A;  4U7C A;  2PA8 D;  2WB4 A;  1JLC B;  1NUE A;  1NPK A;  4W90 B;  1J5O A;  4OLO A;  4JI7 J;  2Y9H A;  1S1T A;  2NUH A;  4TNO A;  2WVC A;  4OZN A;  1RI7 A;  4O3O A;  4TXS A;  3MD1 A;  1UW9 A;  3R9L A;  4HI1 A;  1ZH5 A;  4LUB A;  2YWF A;  2VKR A;  2MQL A;  3GR1 A;  1J5E F;  5F9L A;  3SSS A;  2GAH C;  3C66 A;  1ACM B;  3ISZ A;  1PKU A;  4L3K A;  2OPR B;  3GON A;  3ZTO A;  1XQI A;  3DDN A;  1UVN A;  2M8H A;  1TKD A;  2BKN A;  3BEG B;  4CLU A;  2RDD A;  2IVF B;  4AL7 A;  4OV1 A;  1YJN S;  1HNZ F;  4M5J A;  3HVA A;  5KFG A;  4IH7 A;  3OTD A;  1ZS6 A;  2FC8 A;  2KL8 A;  5CYM B;  3FBE A;  3HHN B;  3WIU A;  3I55 S;  4EEY A;  3MTK A;  2BBE A;  1LXN A;  1SJ1 A;  1WC0 A;  4GRS A;  2DH9 A;  2WVD A;  3DI6 B;  2KRB A;  1TL1 B;  4DLG A;  4DR2 J;  1HHQ A;  5C25 B;  2MKC A;  2B6A B;  1FFS B;  4IH5 A;  4O23 A;  2FLN A;  2UUT A;  1J27 A;  2KJV A;  3M30 A;  5I42 A;  1SUQ B;  2VQE F;  2YX4 A;  1LEO A;  2ATC B;  2R7S A;  1VDH A;  1GK8 A;  3BM7 A;  3DRP B;  3QGH A;  3W5Y A;  4PYD A;  4IRD A;  1QSL A;  3PW4 A;  3I32 A;  4EGL A;  1VC5 A;  5KFP A;  1HNZ J;  2E1M C;  4R8U A;  2HFS A;  2IHR 1;  3VGS A;  2K2P A;  3V6K A;  2ABY A;  3IWN C;  1Q8K A;  4RPF A;  4U7U K;  1Q81 T;  5D4P A;  2ILZ A;  5K9F A;  3R1L A;  1Q16 B;  3TVK A;  3QNW B;  2ACM A;  5KFN A;  2J0Q D;  1WDT A;  4UOF A;  3BO4 A;  5IS2 A;  2CUY A;  1YIJ S;  3NY0 A;  3P5T L;  3GV5 B;  5DGB A;  2VQE J;  1FJG F;  2D9O A;  2KT5 A;  2IDL A;  4RWX A;  2R7X A;  2GFF A;  4RNH A;  6FDR A;  3PY8 A;  4ES2 A;  2HBY B;  1B0V A;  3H2V E;  4Y2M A;  1D8Y A;  2XWY A;  3VQT A;  2XNQ A;  2CJB A;  3DFE A;  3JTN A;  3G87 A;  1ZOT A;  2RJZ A;  2JZ5 A;  2RNE A;  2N82 B;  5CXT A;  1GTH A;  3FQK A;  5CCM A;  5LMN J;  1N6Q B;  3MED A;  2GIQ A;  1JLB A;  3MAQ A;  1NDP A;  2PO4 A;  3U1L A;  2EXU A;  3OR1 A;  1HI1 A;  4P6Q A;  2F4V J;  2ZC4 A;  4DWI A;  4ED8 A;  4CP5 A;  1SKR A;  1E6Y A;  2V4R A;  2HFU A;  1WHW A;  1X5P A;  1HBN A;  1IR1 A;  2KVI A;  4AL6 A;  2LQ8 A;  1BC6 A;  4WYL A;  2BAB A;  1FTC A;  2VPZ B;  2KO1 A;  5HAT A;  4ZDN A;  1C1C B;  2WB1 D;  4CO2 A;  1ZAX A;  1URN A;  3DLK B;  2L9N A;  3M8R A;  1BUX A;  2V8H A;  4NYP A;  3C14 A;  1XK8 A;  2HWI A;  1FEH A;  2GML A;  2WBR A;  5L1I A;  2IA0 A;  2Y8Y A;  2FHJ D;  1ZTW A;  5BR8 F;  1ZM4 A;  4NLU A;  4A8X A;  3K17 A;  1TVR A;  3QLH B;  1JLA B;  1XR7 A;  4LR8 A;  5HBM B;  3D54 A;  4A4J A;  4NXN F;  4L74 A;  1GX6 A;  4HR2 A;  1SKU B;  4H4O B;  4OQJ A;  1AUS L;  2EI5 A;  3J80 U;  4ZVS B;  3AD9 C;  4A8O A;  1IBC B;  4ES3 A;  1L3V A;  2MST A;  8ATC B;  4DX6 A;  5D6G A;  4DV6 J;  2XY6 A;  4K4Y A;  2ZH6 A;  5J2Q B;  4NZ6 A;  3TUJ C;  1K1Q A;  3LA0 A;  3KLG A;  1R27 B;  1H72 C;  2ZJR Q;  1U2F A;  3PM9 A;  5KFF A;  1WSV A;  2DGQ A;  4UST A;  2IJR A;  5MLC V;  3UDL A;  4MYT A;  4C8Z A;  5BR8 J;  3MI7 X;  3LPY A;  1NK8 A;  3O8W A;  2KI2 A;  2QC3 A;  1D1U A;  2FJB B;  2A3J A;  2J6U A;  3RW6 A;  4X4U A;  4URQ U;  1Z2L A;  4NXN J;  3EXY A;  4YME A;  3DLJ A;  3QPI A;  2W4C A;  4CLL A;  1XWL A;  3BR9 A;  2FD2 A;  1ZTT A;  1M5V C;  1YWX A;  3KG1 A;  2MKY A;  2CJY B;  3NLC A;  3IMQ J;  1UWB B;  5DDQ C;  2D3O 1;  4OJ1 A;  4WKY A;  1EQ0 A;  4EFA C;  4LBH A;  4ECS A;  1B7F A;  3PW5 A;  2XM3 A;  2B4U A;  2NR0 A;  3Q2S C;  4NLV A;  1D9D A;  3I6P A;  1F0X A;  3NEK A;  4P7V A;  5KFL A;  1BQM B;  3AH6 A;  3PIO Q;  2JL9 A;  2I6W A;  1PG5 B;  2C2Z B;  5JMN A;  1TL3 A;  3V5R A;  1RTH A;  1JQG A;  1XBW A;  2VL1 A;  4FVC A;  4ID8 A;  2HRT A;  5IM0 A;  1WC1 A;  1N5Y B;  4J9S A;  3DLG A;  4Q2M A;  2WVB A;  4C9D A;  3KHH A;  3M6W A;  4MK7 A;  1N48 A;  4O4R A;  3CMQ A;  1AFJ A;  5ETK A;  1HBU A;  1VLO A;  2DNZ A;  3ITH A;  4KHP F;  5F9N A;  3MMA B;  1C0T A;  4FYW B;  3THT A;  2R8H A;  1N34 J;  2JRS A;  2M52 A;  5F41 A;  2HFV A;  5ETV A;  2HHS A;  1KKH A;  2W9B A;  3A3O B;  3DOK A;  1VQ4 S;  1V5V A;  1S4F A;  4PXB A;  5DET A;  1RT3 A;  5ETN A;  1I94 F;  2UV8 G;  2MKH A;  4AXI A;  3OTE A;  2JVO A;  1QSS A;  2IBO A;  3OPK A;  4Q8F A;  3QWP A;  4BCA A;  2RRB A;  5DLG A;  1TUV A;  1FRH A;  3EVO A;  2XO6 A;  1SBR A;  1VRQ C;  3UCG A;  4DSK A;  4X4V A;  4DHV A;  4F3M A;  2ZWO A;  3AJ2 A;  5E3P A;  3H20 A;  1GNK A;  3MMC B;  2ZHB A;  1UA1 A;  3R5C A;  4NL5 A;  3RBE A;  3KJV B;  1NLK L;  1NSK L;  4ZPC A;  1S1V A;  5KAK A;  1RDR A;  3JSM B;  5B7W A;  2HZV A;  1QAX A;  1OSD A;  4KBI A;  4DSE A;  3T3F A;  2BW2 A;  4WFZ A;  4ED3 A;  3POT A;  1NK4 A;  4L75 A;  2FDN A;  3H5X A;  4C3K A;  5FLX Y;  3PJW A;  2C2D A;  2AYE A;  2FC9 A;  1GAO A;  4N47 A;  3R2C J;  3A1Y G;  3MEK A;  4UOG A;  2HHH F;  1H3D A;  4KRW A;  4B3O A;  1IQT A;  3BGR B;  3OXL A;  1HAR A;  5IC4 B;  3UVJ A;  4OFZ A;  2J5A A;  5J1E B;  1BQN B;  1WI6 A;  3ENA A;  1MMD A;  2OPS B;  4JI2 F;  2UVW A;  1PO6 A;  1YZ6 A;  1CLF A;  4CDI A;  3OSN A;  4K4V A;  3OFE A;  1VOM A;  4U8V A;  4TU8 A;  2Y1J A;  1U02 A;  4X4R A;  4DPT A;  3HXM A;  3DLE A;  3ZTR A;  4DCP B;  1JIH A;  4BC7 A;  3KUG A;  4ZIV A;  1HHS A;  3BSN A;  1GT8 A;  2I5J B;  1IKX A;  1RP5 A;  2QV6 A;  3OHB A;  1S6U A;  2XSF A;  3ILO A;  3M9N B;  4KPY A;  2IM1 A;  2LEC A;  1JLF B;  4OYP A;  2K1R A;  2YQ0 A;  5GAH I;  2LA4 A;  2VAS A;  2V6A A;  1IBL J;  2D1C A;  2R3V A;  4OV6 A;  2XYG B;  2V67 A;  2V8V A;  4UQT A;  4WP9 A;  1TKX A;  3NAI A;  1LW0 A;  3NGK A;  4IRC A;  4JI2 J;  3S7R A;  3P6Y C;  2R42 A;  1QJH A;  2WVF A;  3HHL A;  1EJ7 L;  2WVE A;  2AEM A;  3V4I B;  1HW9 A;  3VV2 B;  4I2P A;  1IWA A;  3FKB A;  4C7Q A;  4TQR A;  3A8K A;  3SCI E;  2YNG B;  1DJ0 A;  3TUZ C;  1XMB A;  1FRM A;  3SMZ A;  4DUY F;  3G86 A;  1YZ7 A;  2HBQ B;  3EVW A;  4F4W A;  3MOJ B;  4TY8 B;  1HFE L;  2FLP A;  1S6P B;  2KHD A;  4ECY A;  3KTQ A;  1HWK A;  3ILJ A;  2DNH A;  2QTW A;  5FJ4 A;  4CTA B;  2PDA A;  1X4B A;  3A13 A;  4X4O A;  3A3P B;  4NI2 A;  1NSQ A;  4LF4 F;  1V9O A;  5KTQ A;  2JNJ A;  2VC0 A;  3E01 A;  3ICL A;  5KFQ A;  4MIW A;  1ICE B;  1FO1 A;  2ZH2 A;  4TU7 A;  1FCA A;  2B9X A;  3M6X A;  2G4B A;  5B0C A;  1T03 B;  2YXL A;  1G1X A;  1HWU A;  4PAA A;  2EKN A;  2MLX A;  1R0A A;  2VQF F;  3SCK E;  2DRA A;  3RR7 A;  3GIJ A;  1UMJ A;  4FVM A;  3LW5 C;  5HN0 A;  3BN4 A;  4DUY J;  1PC5 A;  5T41 A;  1AZS B;  3TX8 A;  2LU1 A;  3NS5 A;  3W9J A;  2VU5 A;  4FF3 A;  4OHV A;  2CQH A;  3US5 A;  1FRK A;  4PQA A;  2DR7 A;  1VIX A;  4X65 J;  1U0S A;  3GFX A;  2XMJ A;  2APO A;  2ZDO A;  2HIQ A;  2DK2 A;  2DBB A;  4KAI A;  1IJF B;  4QR2 A;  2VC1 A;  2R7U A;  5HQM A;  4JI8 J;  4RUH A;  1HQU B;  5ETQ A;  2PFF B;  3MPY A;  1PJ5 A;  2FJV A;  1RTJ B;  1XTZ A;  5L1K A;  3DOL A;  3R6L B;  2ZZM A;  1HIY A;  5I3P A;  2CVE A;  4B3T J;  3C15 B;  3SDE B;  2Y0S D;  4GMK A;  3SI8 A;  1T9T A;  1KNZ A;  5F8J A;  1S9E A;  2MMY A;  3AA8 A;  1CVJ A;  1IR2 A;  5KG7 A;  2YKO A;  4H54 A;  1APS A;  4MIB A;  2V5H G;  1JK9 B;  3NNC A;  1RU2 A;  3PVX A;  1X5O A;  5LSR A;  4F02 A;  2C2M B;  2MZ1 A;  3QQC D;  3F56 A;  3FJ2 A;  3IBF B;  4ER8 A;  1M5H A;  2NPI A;  4U96 A;  2ZHA A;  4ID5 B;  2CQ4 A;  3MEG B;  1RA7 A;  3HM9 A;  4JB8 B;  2RUG A;  3CSK A;  4UOH A;  4MYU A;  3O1L A;  1PAU B;  1T3O A;  5IFM A;  5HAO A;  1HI8 A;  4NWB A;  1L5U A;  4CO3 A;  4LF6 J;  3MF5 A;  4P2F A;  1NEE A;  3PFE A;  4L72 B;  2LDI A;  4CO5 A;  4N8N A;  4AL5 A;  1RHU B;  1F60 B;  1JLE A;  4KKO A;  3C3L A;  1YIT S;  5D3G B;  3M2R B;  2CQG A;  2HVE A;  3W64 A;  2CQD A;  1HKA A;  2RH3 A;  1UL3 A;  4R5P A;  1W25 A;  3R5A A;  4I1T A;  1YK9 A;  1WHV A;  1WNE A;  1WHY A;  1W26 A;  2MSS A;  5HQL A;  1XMO F;  2RAQ A;  3HCX A;  3VAL A;  1TKT B;  1SC6 A;  2HQ3 A;  2W9A A;  2CPD A;  3KNA A;  3PHT A;  1U1P A;  3PDN A;  1WDD A;  4QU6 A;  1IKW A;  1TP7 A;  1S0O A;  4DSI A;  6FD1 A;  5HP1 A;  3LAK A;  4YR2 A;  1WF0 A;  4PR6 A;  4F50 A;  2HVI A;  5E5N A;  1U0H A;  3ZTS A;  5A8K B;  2FQQ B;  8RUC A;  4YR3 A;  4N7T A;  3T9N A;  1HD1 A;  5F8H A;  3WX4 A;  4ED4 A;  5K8O A;  5DQI A;  4X66 F;  3VCD A;  4RNF A;  3V6H A;  3EXC X;  2DNO A;  4OX7 A;  2OSR A;  5IV3 A;  1LWF B;  3NBP A;  4UZC A;  4K4W A;  2BJ1 A;  1RHJ B;  3M4X A;  3N6M A;  1UAW A;  2G2Z A;  4LFC F;  2VG5 A;  1R0B G;  2QZ8 A;  1UJ6 A;  4YS2 A;  1JXL A;  5KG2 A;  3LAM A;  3I5A A;  3E8O A;  1CJK A;  1PC4 A;  3D2W A;  3H5Y A;  2V69 A;  5KFT A;  3D9B A;  1DFD A;  5HRO A;  2VA2 A;  3PTW A;  2V9K A;  1NH8 A;  3OXF A;  1EX8 A;  4U7U D;  3OLB A;  3EX7 B;  4X62 J;  4G1Q B;  3DYA A;  3TW0 A;  1ZAV A;  2LDY A;  3W3S A;  1WF1 A;  4ECR A;  3UFC X;  4DXL A;  2E5L F;  4M95 A;  3OLA A;  4LF9 F;  3BH7 B;  4IUF A;  2HQI A;  3F73 A;  2DEJ A;  1NJZ A;  1Y9O A;  2XWX A;  3J7Z T;  1MNE A;  5KT4 A;  5DJB A;  2K3K A;  1VJQ A;  2M7S A;  1N33 J;  4LFC J;  3MCO A;  4C6A A;  4CM2 A;  3TJ8 A;  5C2C A;  3H0P A;  2MGZ B;  2ZEJ A;  3CD7 A;  4OI6 A;  4PRF A;  1LW2 A;  3M1V A;  2Z56 B;  3OJS A;  2B4P A;  2IDE A;  1HBM A;  2XLJ A;  2N3L A;  3ZNU A;  3TYT A;  4B9S A;  3EVM A;  1HNX F;  3D0H E;  2V50 A;  3TAM A;  1DTQ B;  5KT3 A;  2WAQ D;  4JUZ A;  3I0R B;  1G6B A;  2AJ1 A;  2YNH A;  2V8G A;  3VGV A;  2KU7 A;  1WC3 A;  2HRU A;  4HHH A;  1S97 A;  4WFA Q;  1FKO B;  4ZHR B;  3P49 B;  1S10 A;  4GVL A;  3N0V A;  4FNH A;  3PHE A;  2XNR A;  2GMJ A;  3GFZ A;  4DSJ A;  4OYA A;  2NRE A;  1K1S A;  1B4S A;  1OPI A;  4QYZ J;  2ROG A;  2XSJ A;  3D5M A;  4EI2 A;  1SJ3 P;  4KFB B;  3EZU A;  3KJF B;  1T7P A;  2UXD F;  7FD1 A;  3M8Q A;  1S4E A;  4ZVH A;  2F4F A;  2AD9 A;  3C6U B;  4KH0 B;  3IWX A;  3G6E S;  3G96 A;  1S48 A;  2NUU G;  2RRA A;  1NKB A;  2G0C A;  3GJR B;  4CLT A;  3I87 A;  2J0S D;  3MAA A;  1RTI B;  1ZM2 A;  2PMH A;  1NSA A;  2IVM A;  3PEJ A;  4FDF A;  4M8L A;  2IFX A;  4OYB A;  1BGX T;  1DLO B;  1BWV A;  5KFR A;  5KG1 A;  1FK9 B;  1JJ4 A;  2N3O A;  2PI4 A;  2L3M A;  3DXS X;  3KJN B;  4USK A;  3T6J A;  4DV2 F;  1WJ9 A;  3CDA A;  4QBU A;  3LH2 S;  4WXW A;  3M2U B;  2R2S A;  3CCU S;  4CO4 A;  3HMJ G;  4DG1 B;  5GAE U;  3ZFV A;  3FFI A;  4ZLP A;  2M9K A;  3W2V A;  3B82 A;  2RU9 A;  2XS2 A;  1T94 A;  2UXD J;  1FKP A;  4C98 A;  4DQQ A;  3AOD A;  2MKS A;  5HLF B;  2KFY A;  2JFK A;  2FZK B;  2V4J B;  3LGN A;  2G1D A;  2G2Y A;  4DR3 F;  3K5N A;  3NG8 A;  2DHG A;  1F3F A;  4WXO A;  4DZD A;  2JEF A;  2ZIT A;  1MW7 A;  4LSN A;  1O0P A;  1OJ4 A;  2P2C B;  2AGO A;  2JHE A;  5EN1 A;  1TK0 A;  3CJR A;  2J0W A;  3H7H B;  4LRA A;  2I8E A;  2EC2 A;  3ZZ0 A;  1VBK A;  2EK6 A;  1FKA F;  2RRN A;  2PEB A;  3BGF A;  4NAS A;  2HFZ A;  2DNN A;  1IKY A;  1FJ7 A;  1S1X A;  2PGC A;  2ZVI A;  3Q83 A;  2HEK A;  4J90 A;  2OUG A;  5ETL A;  3RAQ A;  4QWD A;  2HLU A;  4USV A;  2VBZ A;  3MHY A;  1OMS A;  1T9V A;  2LXU A;  2H5E A;  5KFH A;  4QPX A;  2IAJ A;  3BDP A;  2C22 A;  1QLN A;  3MTJ A;  3MPV A;  4OIX A;  1KFS A;  2DIT A;  3HHL D;  3KYL A;  3K0J A;  1K47 A;  3Q8P B;  1R7I A;  2E44 A;  3P45 B;  1RWM B;  1FEE A;  3P4U B;  3NWG A;  3SQG A;  4Q45 A;  3CE8 A;  3VWS A;  3EMT A;  2J76 E;  3QT7 A;  1XIQ A;  2QSW A;  1YTY A;  1X7V A;  3D3B J;  3B8H A;  2WSC C;  1T05 A;  4YR0 A;  3PX4 A;  4LVO P;  4ZP8 A;  2BX6 A;  1ZM3 A;  3DRR A;  2X1A A;  4JOU A;  1QVF R;  4H4M B;  3UWT A;  4I2Q A;  4NCA A;  4P72 A;  1R8C A;  2RS8 A;  3GQC A;  1C4A A;  3GCX P;  4ECU A;  5DS7 A;  1FNO A;  3RZA A;  4USI A;  5CZV A;  3PNI A;  2WK4 A;  4UF4 A;  5FDL B;  3QJL A;  4M94 A;  1P27 B;  1DRZ A;  1OY6 A;  3Q8Y A;  5MAO A;  5JVG Q;  2GJ2 A;  3KDO A;  2EG1 A;  2VKZ G;  2EBE A;  3EJM A;  3TUI C;  3VAH A;  2FY1 A;  3CJK A;  3AQP A;  2L48 A;  2Q79 A;  2HNZ B;  3ZC4 A;  3OVA A;  3UN2 A;  4EU0 A;  3UD4 P;  4ANE A;  2XS7 A;  2E9R X;  1ITP A;  4XDC A;  2QT7 A;  3J80 Y;  1VIO A;  4IFV A;  1URR A;  1X0P A;  4ALZ A;  4PXE A;  2DNK A;  2B56 A;  2C3U A;  1FXR A;  2C2E A;  2HGN A;  1P6T A;  5I3Q A;  3N6L A;  4AE5 A;  2WCX A;  2VFV A;  2HIY A;  5HVF A;  1Y10 A;  3IGN A;  1XNQ J;  5H1S V;  2VDI A;  3T6B A;  1KOH A;  2J0X A;  4F0H A;  3MM8 A;  4DBQ A;  1YI2 S;  3VAI A;  3C16 B;  3FNN A;  1SH3 A;  1JKH B;  1P1L A;  4XPE A;  3QO9 A;  3OBI A;  2J7K A;  2KJW A;  5B0D A;  2DHA A;  1NND A;  1AW0 A;  3IRX A;  5GMK a;  3GJQ B;  1HI0 P;  2KVQ E;  4KHM A;  4KV8 B;  1B0P A;  1UVM A;  4U9R A;  2QSF A;  1R8B A;  3EPG A;  5J2P B;  2GAG C;  3IG1 B;  2HKE A;  3WZ0 A;  4CIO A;  1VK3 A;  2A1B A;  4OI3 A;  1C1B A;  3FZ2 A;  1PYT A;  2ZE2 A;  1N5Q A;  2W9C B;  3L4B C;  4LBI A;  1OYD A;  3LAN A;  1SJF A;  5CYQ B;  1Q7L B;  1Z4U A;  1H0H B;  3DLH A;  1CQN A;  4ENO A;  2JEI A;  1V3R A;  3K8W A;  4DV3 F;  3H59 A;  5KFW A;  3OUY B;  5M2P A;  1N5S A;  2NXU A;  2EVZ A;  1X4H A;  2E1P A;  1DQA A;  4F2S A;  4UY8 T;  3CCV S;  3IBC B;  1BD6 A;  3VAM A;  4URS A;  4J9O A;  4CT9 A;  2Z58 B;  2R7T A;  2JH3 A;  1WEY A;  3JTP A;  2CFX A;  1F5B A;  3W9H A;  2BOA A;  3K89 A;  2QL5 B;  2KYZ A;  2M2B A;  4CLW A;  1GMW A;  3BSC A;  4PXD A;  2CNO B;  1Y0H A;  1VMB A;  3SIP B;  3LP0 A;  4USJ C;  2C3P A;  1C0U B;  1HNV B;  1FWL A;  4DV3 J;  2MJN A;  3O44 A;  2BAC A;  2YWK A;  5C2G A;  3SFG A;  4IOB A;  3W5X A;  4IG0 B;  1BHN A;  1FA0 A;  3JB9 k;  4QCL A;  3ENQ A;  2DY1 A;  4DV4 F;  1B3T A;  1LWE A;  1FD2 A;  2OHD A;  1NZA A;  3M2V A;  3RJM B;  3NS7 B;  4KGZ B;  1T11 A;  1T9Y A;  5GAG I;  3RRH A;  3RYL A;  1Z1Z A;  4HVZ A;  5KG4 A;  3GYX B;  4P2X A;  4JI0 J;  5GAD I;  1OS5 A;  2RKI B;  1KN6 A;  3IAS 9;  3HSJ A;  2OPR A;  3NS6 A;  1M1H A;  1QDU B;  3RW7 A;  1KWM A;  4HTI A;  4NCB A;  1AXQ A;  4FZV A;  5J2N B;  3OQ2 A;  3M32 A;  1YJR A;  2XLK A;  5CYM A;  4PZV A;  4F4A A;  3U27 A;  2AYM A;  4P74 A;  4C3L A;  2OH2 A;  2AIR B;  5E41 A;  3RAM A;  3D4J A;  2KB2 A;  1MN7 A;  4CLS A;  1IN0 A;  5KFV A;  4EBC A;  1PIE A;  4I68 A;  1VHF A;  5C25 A;  3QWU A;  2B6A A;  3OFG A;  2BOP A;  2RS2 A;  2PSZ A;  4OYO A;  2V8D A;  1SUQ A;  3VTI A;  4RBV A;  2Q3P A;  4DPU A;  2HHP A;  1R6V A;  2NXC A;  3R97 A;  2A0F B;  2B8P A;  3R5B A;  4UW2 A;  3FGV A;  4L73 A;  3CJ4 A;  3GZ7 A;  5DG7 A;  1SL0 A;  4FF1 A;  3UO0 A;  1VYA A;  2HZC A;  2L9W A;  5A2Q U;  4ED0 A;  2ZBC A;  1RCO B;  2IC3 B;  1CBK A;  4ED6 A;  1RT2 B;  5DO2 A;  1HLW A;  3MM7 B;  1HWJ A;  1JXV A;  2BRK A;  2XTJ P;  3UR0 A;  4LFB J;  1M5O C;  3OD2 A;  3HLU A;  3PKY A;  4A48 A;  3G8Q A;  4WIQ A;  4J9R A;  4OZ0 A;  3MXH P;  3DRS B;  2CNK B;  4DFP A;  1KRP A;  1NK5 A;  3RRK A;  4ECW A;  3RB4 A;  4Q5V A;  2CQP A;  3Q8S B;  5D4O A;  1N5T A;  4D3H A;  3QRR A;  2V2V A;  4B3S F;  1SQF A;  1V3S A;  1WEX A;  3AD7 C;  1N6Q A;  3V4M A;  4DV7 J;  1IXK A;  4F8R A;  2Q6B A;  2EWH A;  5KFU A;  4B02 A;  4LRF A;  4DS5 A;  3T5J A;  4DN9 A;  4NML A;  3TA1 A;  2F5G A;  1YQH A;  3MCS A;  2UUW A;  5LM7 E;  3TUP A;  2YQ1 A;  3E51 A;  1QE1 B;  5A0Y B;  2RF2 B;  3KJQ B;  4N41 A;  3MUV P;  2R2T A;  2BM1 A;  3GB0 A;  2Z2Z A;  2I1R A;  3WC0 A;  1R31 A;  3W1Y C;  2OPP A;  1S1T B;  3CWJ A;  3W60 A;  1A6L A;  2HAF A;  3CDU A;  4EYH B;  1RU1 A;  2ADB A;  2AW0 A;  4J9N A;  3D28 A;  3UDV A;  5M2R A;  3QLH A;  4RZR A;  2GQ2 A;  3CO0 P;  5AXN A;  3SCJ E;  2FJW A;  3D6F B;  1GMV A;  4DUZ F;  3OFH A;  4H4O A;  1GMU A;  2EEY A;  1RWO B;  4S0M A;  1ZM9 A;  2OI2 A;  3KXD A;  3PXG a;  4KB7 A;  4WYW A;  4LIR A;  4IDK B;  2RVJ A;  4N76 A;  2GNK A;  2DPI A;  3MR5 A;  4NRT A;  2W2P P;  3PZP A;  2AU0 A;  4X64 F;  2OFG X;  2OSQ A;  3K7R A;  2XS5 A;  2XEX A;  1KQS R;  3G4S S;  4NA2 A;  4RNN A;  2EBG A;  4IOA Q;  3CJ8 A;  3FEZ A;  5EX3 A;  2NS1 B;  4F3O A;  4NEZ A;  5AE3 A;  1FRI A;  2DEI A;  5CHC B;  1NB7 A;  1TR0 A;  3ENW A;  1MWZ A;  4NA1 A;  2VFU A;  2JDJ A;  2MQN A;  2RQC A;  5EWE A;  4WF9 Q;  3M30 B;  1SJQ A;  5DZ6 A;  1HR0 F;  2D41 A;  5I42 B;  2VA3 A;  3L7U A;  1MU2 A;  4KGM A;  4FNI A;  1DAX A;  1VQN S;  4OI2 A;  2RHS B;  4R25 A;  4ECX A;  5ETR A;  3SQO P;  4EZ9 A;  1SQE A;  2AMC B;  1UWB A;  2DR8 A;  2CAJ A;  5L9X A;  1KVI A;  2DGU A;  1RHR B;  3BQ2 A;  3L09 A;  4R8U B;  2B4V A;  1KP6 A;  3J7A N;  1H98 A;  4Z37 A;  1NSP A;  4LF8 F;  1BQM A;  4B9M A;  3TRG A;  2OP5 A;  1B7Y B;  2MLY A;  4FYY B;  3GII A;  3UCZ P;  2CDQ A;  4NYO A;  5CD4 H;  2DRB A;  2DT9 A;  1RLC L;  4Y0F A;  3HF5 A;  3NNA A;  3A8I A;  4OJG A;  2IRX A;  1T95 A;  4JBC A;  2MKI A;  1LXJ A;  1S5Z A;  4CLF A;  3KK3 B;  2BQ3 A;  4MKB A;  3OJU A;  2PA3 A;  3FBC A;  3DHW C;  1RQ0 A;  4HKQ A;  3LP1 B;  4R0E A;  2AEF A;  2SXL A;  1O51 A;  2ZVS A;  4WBF A;  4WJB A;  2RQ4 A;  3NKY A;  5IV4 A;  1U1O A;  4C11 B;  3UN3 A;  3KLV A;  2X1G A;  4X84 A;  2JFD A;  3OR2 A;  4B3R F;  4PG8 A;  3BKU A;  4X4P A;  3OTO J;  2AYB A;  1JXE A;  2IJF A;  1Y3J A;  2DIS A;  2G2O A;  3X3U A;  1VRU B;  4LF8 J;  3THP A;  4K5R A;  4KSE B;  3MM5 A;  1LKZ A;  1UZH A;  5CH7 B;  5EDW A;  1E6Y B;  2J7W A;  3VVT A;  3ETO A;  4IR9 A;  4KY3 A;  5HO4 A;  4PG7 A;  4C8O A;  2AQ4 A;  4DOZ A;  1S9F A;  4DQR A;  4EWT A;  3SV3 A;  1SCJ B;  2BJE A;  2KRR A;  2ZBQ A;  5AXM A;  2VG6 A;  2OGU A;  4CLZ A;  3KMQ A;  3B54 A;  1RT4 A;  1F5C A;  4B3R J;  1TVR B;  3JSB A;  1KC8 T;  1MMN A;  3JSM A;  1U09 A;  4RW6 B;  3ZZU A;  5KFE A;  4ZCI A;  2MZT A;  3MEC A;  2UXB F;  1DZ5 A;  1RT7 B;  3CUL A;  4OJH A;  4JV5 F;  3CCM S;  1UCN A;  2DO0 A;  2ZD1 B;  2MZQ A;  4A8Q A;  7FDR A;  1PAE X;  3PRV A;  5HL7 Q;  3TR5 A;  1U48 A;  2JLF A;  3IXQ A;  1D09 B;  4KPC A;  1FWK A;  3MDF A;  4AD6 A;  5HVG A;  1WKK A;  1DUR A;  3BGR A;  5GAH U;  1RT5 B;  1F3V A;  4ED1 A;  5EGY A;  5J1E A;  2OPS A;  3T5L A;  3EYZ A;  1KOO A;  1WI8 A;  5EHH A;  3DM2 A;  4BDP A;  1SC3 B;  1EAY C;  3GP9 A;  3P8B B;  4KO0 B;  3QBC A;  2QA4 S;  3GSI A;  5M2U A;  4NPO A;  3CCZ A;  1RGV A;  2F9J A;  4NXM F;  1U1M A;  3LTO A;  4IG3 B;  4E0D A;  3KFW X;  5G0R B;  1S1W B;  4JV5 J;  2CQI A;  4DR7 F;  4DR6 F;  3TAR A;  2GO9 A;  3OFF A;  4JV2 A;  2DGV A;  4JI6 F;  4O3N A;  5E0O A;  3QID A;  4AQY F;  4OHZ A;  3I0S A;  1QY7 A;  3DKD A;  4NLG A;  4Z2X A;  2O1P A;  1O5J A;  2BE2 B;  4U67 Q;  3Q86 A;  5KFS A;  4Y34 A;  4C2M A;  2DNP A;  4WII A;  3D0I E;  1UFW A;  3ZZR A;  3TEH B;  5C42 B;  1GMW D;  4LRC A;  3Q8U A;  4UUX A;  3I4H X;  5L39 A;  1RTH B;  2OEM A;  5GVQ A;  5DM6 Q;  4NXM J;  1GH8 A;  5IM0 B;  3SZ2 A;  2YKN A;  2QLJ B;  3SCL E;  3V4I A;  3DLG B;  2IYG A;  4RBU A;  1RAI B;  1M5K C;  4DR7 J;  4Y00 A;  2W2O P;  4QWA A;  2OO4 A;  3WDO A;  3LWL A;  1X0F A;  1QAY A;  4MT1 A;  3R6G B;  1TK5 A;  3FCW A;  3LF0 A;  1MSW D;  3PKM A;  4ELT A;  2HAI A;  4OHX A;  2E9T A;  2WON B;  3VZI A;  1C0T B;  3KLF A;  3CJ0 A;  4TY8 A;  2CNL B;  2KT3 A;  5EWF A;  5CYJ A;  5C24 B;  1S6P A;  4DV0 J;  1YVF A;  3IGV A;  4P2S A;  1FDB A;  4EBE A;  2J9D A;  4LBP A;  4G1P A;  1L3K A;  3N5B A;  5F3Z A;  4J9U E;  4DL3 A;  2NXN A;  1RT3 B;  1U49 A;  4DS4 A;  3KLI B;  4EUV A;  2D3O R;  2VOP A;  3F0N A;  4LF7 J;  4OI0 A;  2Z8Q A;  2VIH A;  1HNW J;  1T03 A;  1HL6 A;  1U26 A;  4ZVE A;  1ROF A;  4O3Q A;  3NGD A;  2B5J B;  4WZM A;  3CTR A;  4DDF A;  3BGU A;  3UR3 C;  1GFW B;  1LNQ A;  2QE5 A;  3WBZ A;  5LL6 d;  5A8W B;  3FSI A;  3CUN A;  2PFD A;  4OX8 A;  3W8P A;  2XMT A;  4F25 A;  4A8K A;  2QO3 A;  2MQP A;  1WTB A;  2ZNZ A;  2L41 A;  1NHK L;  3D67 A;  4TU9 A;  2V2K A;  5F8L A;  2KM8 C;  1TAQ A;  4DQS A;  5CA5 A;  1L3S A;  3POT B;  3FMW A;  4JV0 A;  3UNG C;  2N4D A;  2CXE A;  4ANC A;  4NLW A;  3JAM U;  2X1F A;  5A76 A;  1E6V B;  4ZK7 M;  1HPZ A;  2E5J A;  2P6T A;  3E3X A;  1RTJ A;  1YJU A;  1MML A;  5KFY A;  3W9I A;  3ZXW A;  2C28 A;  4F2R A;  4B3O B;  5T7L B;  4JI5 F;  2MJU A;  2UUC F;  4DV5 F;  2E7X A;  3ILL A;  3C15 A;  2YVS A;  3SDE A;  4KIA A;  3L9Z A;  3G9C A;  2DD8 S;  3FK4 A;  2FUG 9;  2G9O A;  3NOG A;  1GQE A;  3M05 A;  1S79 A;  2FB0 A;  2YWW A;  1D9A A;  1FI4 A;  1U1N A;  2HS3 A;  2EKY A;  4CZC A;  3HHL C;  1R8H A;  1MLA A;  3LAL A;  4R0J A;  4LJM A;  1MWQ A;  2KM8 B;  2CRL A;  2XG8 A;  1D0E A;  1ZYQ A;  1VQL S;  3J81 Y;  3GIR A;  5DLF A;  1X8D A;  1SI9 A;  2KYX A;  4ID5 A;  4JI1 J;  3TQE A;  3UDE A;  4RW9 A;  1IKX B;  2G0J A;  4ATN A;  4NLD A;  5KFA A;  1KQK A;  1JB0 C;  1RKI A;  2CPE A;  2K1R B;  2RIL A;  5B0E A;  1VIS A;  4WU3 A;  1M1G A;  3MWB A;  5ETO A;  2OJ3 A;  2UUC J;  4G1I A;  1REG X;  3VZH A;  1Q86 T;  2VOO A;  2LLZ A;  4ZVT B;  2RDI A;  2Y3Y A;  2CPF A;  3ELH A;  5D3G A;  1T9X A;  2HW3 A;  3I9Z A;  1RHQ B;  3M2R A;  3RU0 A;  3HHL B;  4O4G A;  5HSP A;  2COL A;  5THW A;  2LYV A;  3FQL A;  1X4F A;  2OAU A;  4AND A;  4KR0 B;  1TKZ B;  2Y1I A;  2WZ1 A;  1TFW A;  4OLP A;  3J81 j;  4DF8 A;  2ZKT A;  5JVH Q;  4Q2L A;  2BQR A;  1IBM F;  2CYY A;  2FY8 A;  4O3P A;  1GXL A;  2BMB A;  1JLG A;  4UZB A;  2M70 A;  3F41 A;  4FS2 A;  3D6T B;  4AXJ A;  1WC4 A;  4ZCL A;  3RBD A;  3MPW A;  2M0G B;  2KG1 A;  1Q0N A;  4F67 A;  3MD3 A;  2HVH A;  2P9G A;  4RNO A;  1YDL A;  3C19 A;  4ZP9 A;  1S6O A;  5A8K A;  3E01 B;  4P75 A;  3HUL A;  2W1B A;  4XTT A;  2R9L A;  1H7W A;  2DVI A;  1K0T A;  4CH0 S;  2ZOF A;  4ZJQ A;  4ZIW A;  1RBA A;  1J5E J;  1I5O B;  3MR3 A;  1JJH A;  5ETP A;  2M3D A;  3PR5 B;  2DB1 A;  2W2N P;  3JTO A;  4ERD A;  3HFK A;  3NP5 A;  4N8O A;  1QTN B;  1R6Y A;  3K5O A;  3ISN D;  1TMM A;  2IM0 A;  2UU9 F;  1IBM J;  2V9W A;  2PEH A;  4C8K A;  2XMW A;  4J9K A;  1FX4 A;  4DL5 A;  2Z57 B;  3JSR A;  5DDO C;  4KHR A;  1N36 F;  1EKS A;  1FRL A;  3G71 S;  1WKL A;  4PEO A;  1FJE B;  4FXW A;  1RWX B;  2CQ0 A;  1SJR A;  1I6J A;  4LF5 F;  1VI7 A;  3G82 A;  2G1H A;  4JI3 F;  4ZMM A;  2NZC A;  3DU6 A;  3QGP A;  1RTD B;  4DPY A;  2UUB F;  4K0K F;  4G1Q A;  5IQ6 A;  5G4D A;  2HQC A;  5KT7 A;  3HT3 A;  5I3U B;  1KTQ A;  2AX1 A;  4NLS A;  3TAN A;  4WK3 A;  1X9M A;  5L38 A;  1QTM A;  2UU9 J;  3T1H F;  1S9E B;  4J9P A;  2LEP A;  4WPA A;  4IO1 A;  1RAH B;  5KFZ A;  2R2U A;  4FKY A;  4NOH A;  2F7V A;  2BA9 A;  5A6W A;  3RAX A;  4MKV A;  3I31 A;  2VFT A;  4LFA F;  1NKE A;  2YWH A;  1EP4 B;  3QSI A;  4RL1 A;  5KG6 A;  4LF5 J;  3PAC A;  2GIR A;  4YY3 F;  3THV A;  4YDD B;  4JI3 J;  4CWB A;  2HS0 A;  3KG4 A;  1FVS A;  4TLQ A;  2E7V A;  3S8S A;  2V94 A;  1DTQ A;  5E3R A;  1FJG J;  3I0R A;  5LJ5 Y;  4CNY A;  3AY0 A;  2XMK A;  1RE1 B;  4YB7 A;  4Q43 A;  3CB4 A;  1XNR F;  2QIF A;  1CJV B;  4ZJO A;  1FKO A;  3KLE B;  1YJV A;  1UVK A;  3T1H J;  2Q6C A;  3TZZ A;  4YB5 A;  1O6X A;  1JLE B;  8AT1 B;  4OX6 A;  1XMQ F;  2DR6 A;  3GR0 A;  4KFB A;  4PWD A;  2FJX A;  2JX2 A;  1K9M T;  4H4K C;  4I4B A;  1VGY A;  1DTT A;  4R5P B;  3EZO A;  3QJP A;  4ZPT R;  3EDR B;  1JMT A;  2QA4 G;  2GW8 A;  4K4Z A;  2OD4 A;  3BO3 A;  2DCU B;  3NGS A;  1IKW B;  3MM9 A;  3BYR A;  1B0T A;  2V2Q A;  4JV1 A;  1DLO A;  4USH A;  1U1Q A;  2PMZ D;  4ZVR B;  2DGW A;  2BE7 D;  2DH7 A;  1YBU A;  5ITH A;  1XNR J;  4CQ1 A;  1RK8 A;  2IMW P;  2A6M A;  4DX5 A;  2A18 A;  2UVU A;  4V19 J;  1WOO A;  3V6J A;  3IAM 9;  2RML A;  3HT0 A;  3DN9 A;  2C3O A;  4F4X A;  4QW9 A;  3TAQ A;  1VQO S;  5K20 B;  2VON A;  1WC6 A;  3A8J A;  5HLF A;  4NCG A;  3NBP B;  2CJQ A;  2V4J A;  2CPH A;  3BQ1 A;  2UV8 A;  4YUD A;  1X4G A;  2VG5 B;  2FZC B;  3EE3 A;  4JI4 F;  4GC6 A;  1RUS A;  4J9M A;  1TL4 A;  1X4D A;  4ICL A;  5A2Q Y;  3OTB A;  2CG4 A;  3NGT A;  2HGL A;  4ZS6 A;  4Y2A A;  5HRO B;  3AJ1 A;  2VPX B;  1WWH A;  2XMU A;  4N56 A;  3I5C A;  4EYI B;  1SJ4 P;  2KZM A;  4OYX A;  2HBR B;  1NDL A;  3HHK A;  4MK8 A;  1JLQ B;  2RQM A;  4P71 A;  2DTJ A;  3M8P B;  2M5Y A;  3IWL A;  4ZCM A;  1N0V C;  1IM6 A;  4YHH F;  3HVT A;  5C5J A;  1PYS B;  1RLD A;  4J91 A;  2K8G A;  2QRR A;  2GCF A;  5HMW A;  1UEK A;  2ATL A;  3DXB A;  4U6P A;  1NM2 A;  2IBK A;  4CH7 A;  4QYR A;  1IKV B;  2W4D A;  2Q1L A;  4JI4 J;  6AT1 B;  3VR1 A;  4HLB A;  3TO8 A;  3PX0 A;  4DI6 A;  2FHM A;  3CCW A;  1SV5 A;  1JWW A;  2FLL A;  4L76 A;  3H5S A;  3BGL A;  2X3D A;  3MMB B;  2OFH X;  3D3C J;  2RHQ B;  5F8G A;  4ETZ A;  3O3L A;  1W2B R;  3RB6 A;  5J2M B;  4N5S A;  2CKW A;  2G0I A;  3PEH A;  2CQ2 A;  3PRD A;  2CPZ A;  1VBY A;  4WFB Q;  5K14 B;  4X2B A;  4JYA F;  2MHE A;  1OWX A;  5LMU F;  2YNH B;  2JWN A;  2GJF A;  4FPR A;  3AOC A;  4DFK A;  4KHP J;  4AFF A;  2V0N A;  4QWE A;  3KUE A;  2HVZ A;  1HNI B;  4ECV A;  2PMW A;  3G6Y A;  1S0N A;  5KFK A;  2GVD A;  1IQZ A;  4PPD A;  3Q8R B;  3KK1 A;  1YRX A;  2CPJ A;  1UWA A;  2XGQ A;  5E7O B;  5FD1 A;  3TEG A;  1RIS A;  2CIM A;  3P5B P;  5CCL A;  5LXY A;  4FYD A;  1WG1 A;  3M8Q B;  1I94 J;  2EG2 A;  3L7O A;  3EGV A;  1CS4 A;  4M5M A;  1GXU A;  1RXO B;  1Y5L B;  2Y1R I;  2HZA A;  1U8W A;  2VB6 A;  2DY9 A;  2EFQ A;  4QZV B;  3OL7 A;  5A6P A;  1NCL A;  3MAA B;  2R7R A;  1BMQ B;  2YY3 A;  1FDA A;  2Z30 B;  4RUB A;  2VJV A;  5LMU J;  4Q44 A;  3KLH B;  1VQ5 S;  1CJU B;  2FZG B;  3T19 A;  4DPX A;  2XZD B;  1T9W A;  3MEE B;  1K73 T;  1TZ0 A;  2NCK L;  5LOQ A;  2EW9 A;  4BC9 A;  2ZZT A;  2IVY A;  3T5H A;  3FUY A;  1JKH A;  3DOM B;  3CED A;  3FFI B;  4HT5 A;  4C48 A;  4ZP6 A;  4V1A k;  2B8Q A;  5E3A A;  2B7C B;  2OTL S;  4DF4 A;  1IR0 A;  4DV1 F;  2DGS A;  4I6Y A;  1FKP B;  4HAC B;  4X4S A;  1RZM A;  4ZPB A;  2XY7 A;  5J2P A;  3IG1 A;  2BAN B;  4ZVG A;  4QYZ K;  1HQE B;  2PII A;  1RT1 B;  2AZ1 A;  3K5P A;  2QL9 B;  1TAU A;  1DAR A;  3DGP B;  4PAB A;  2HHH J;  4WU2 A;  4EBD A;  4FF2 A;  2W9C A;  2JSX A;  4IFY B;  5EWG A;  5ETS A;  4FYV B;  2ZJQ Q;  2BKO A;  3CT9 A;  4KGV B;  4ED7 A;  5A8R B;  5CYQ A;  4DU7 A;  4G3I A;  3A8E A;  4K59 A;  3U7J A;  2WOM A;  1VQ6 S;  2B3T B;  1VQM S;  4NRU A;  2I38 A;  1PYO B;  1KVJ A;  3ONQ A;  2LQ5 A;  4ZVU B;  4E2F B;  2VBW A;  2CPX A;  1IKY B;  4Y6I A;  4IR1 A;  5B09 A;  2HNY A;  2DJW A;  1F6T A;  3VQS A;  2HGM A;  5CD4 A;  4ZA1 A;  4F4Z A;  3EGZ A;  4B9T A;  1GTE A;  2NSB A;  5GAG U;  1YX2 A;  2GX8 A;  5DDR C;  1O8B A;  3UW1 A;  5E2Q A;  5GAD U;  3T1Y F;  5LSL A;  2AT1 B;  4RW8 B;  1SKS A;  3AQO A;  2IRY A;  2YX1 A;  1EZZ B;  1CG2 A;  5IZH A;  1NPP A;  4ETX A;  2F65 A;  4DL7 A;  1C0U A;  1HNV A;  1TV6 B;  1Y00 A;  5B0G A;  5K8M A;  2LVW A;  3LUY A;  1S7H A;  2FVS A;  4ZLJ A;  3IO1 A;  3GTY X;  1U8S A;  4NLY A;  3QGI A;  4IG0 A;  1RWK B;  1EAR A;  4MFB B;  3PCO B;  4NLX A;  4Q7A A;  4USW A;  2IY5 B;  2AYG A;  1T05 B;  3CW2 C;  2CPI A;  3OSP A;  1Z2Z A;  4ZPD A;  2BRL A;  3V2U C;  3ZNJ 1;  1KEK A;  4I2Q B;  4A8Y A;  4DPO A;  4RWW A;  2E29 A;  1TUG B;  5HMX A;  3UD5 A;  2RDJ A;  4FXV A;  2KXN B;  3M8W A;  2RKI A;  3AOB A;  3T1Y J;  3JSY A;  2AV5 A;  2LU2 A;  3L7P A;  3OW2 R;  1FDN A;  4CNZ A;  3S1T A;  5J2N A;  4LF4 J;  1WKJ A;  4CT8 A;  3EPI A;  1EB0 A;  2HQD A;  3CJK B;  2KHC A;  3QRP A;  4RR5 A;  3CCJ S;  3FBB A;  1BQX A;  5D15 A;  1B99 A;  1Y5I B;  1RB0 A;  4WKR A;  2VQF J;  1FE0 A;  1X9S A;  3UQS A;  2QLX A;  3VGT A;  1N88 A;  2A2C A;  1N54 B;  2ZZN A;  4FBT A;  5AE1 A;  3FVY A;  3BRE A;  2BJD A;  3CD5 A;  4KE5 A;  4URG A;  1Q1K A;  2KXH A;  1LWC B;  2R4F A;  3C6T B;  3MM8 B;  1FRJ A;  2I9S A;  5ETT A;  5AT1 B;  3IR6 B;  1DQ9 A;  2A2D A;  1NJI T;  3BDE A;  1LQ9 A;  2F1F A;  4DFM A;  2VFR A;  3QIP B;  1BWE A;  2YH0 A;  3IRX B;  4ZOS A;  3HFZ B;  3KK2 A;  1KHW A;  5F0W A;  3RGI A;  1VQ7 S;  4QIW D;  3AXM A;  3LP2 A;  4GKJ F;  4GVB B;  3IA0 A;  3OHA A;  1RT2 A;  4RBT A;  3IR7 B;  1S0M A;  3QT6 A;  3MM7 A;  1C1B B;  4TY9 A;  3VAG A;  2P8I A;  3W66 A;  1L3T A;  3ZO7 A;  3AFG A;  1UPM B;  3DHX A;  1TUW A;  3DRS A;  2IYI A;  3N79 A;  4ECT A;  2PC6 A;  3BB5 A;  5AE2 A;  1RWU A;  2W25 A;  3CCL S;  1TQL A;  1RJJ A;  2R7Q A;  3NAH A;  4IO9 Q;  1AA1 B;  2E5I A;  1CUL A;  1M5P C;  3QMQ A;  2EFO A;  4O0N A;  4IKA A;  5L1L A;  4QWB A;  1VFJ A;  2FIU A;  2FVR A;  2R8K A;  4LIW A;  2ZBI A;  3QT8 A;  4LMZ A;  2P9E A;  3K2Y A;  1NBE B;  1KBR A;  3JYT B;  2BQU A;  4B08 A;  1ZZN A;  3T1A A;  4QIV A;  3BGO P;  1H7X A;  1S1U A;  4HEA 9;  3N4W A;  3Q23 A;  3DCA A;  2K7J A;  2DNQ A;  2GV1 A;  5KFM A;  2PI5 A;  4ZN3 A;  4HH0 A;  3NRB A;  5KOX A;  1LWE B;  2HHV A;  1XMO J;  3OT9 A;  4DR2 F;  3FZB A;  3M2V B;  2XZW A;  4BHQ A;  3G8S A;  2PN6 A;  1VRT B;  2BE9 B;  3OTC A;  2X7I A;  2CNN B;  1CPZ A;  1UET A;  2VPW B;  2Z2M A;  1FJC A;  2JJ4 D;  2N4C A;  4LSL A;  2GJI A;  5JJB A;  1WG5 A;  4FPI A;  3VHQ A;  1NU4 A;  2GIF A;  4IDK A;  1U25 A;  2FPH X;  3M32 B;  4F4Y A;  1NK0 A;  4C0O C;  5IT9 Y;  1YSJ A;  4Y2C A;  4I6W A;  2L08 A;  2Z2Y B;  4X66 J;  5BXI A;  1FNX H;  4K8R A;  1Q5Y A;  4YB1 P;  3CC4 S;  2OIH A;  2BJ7 A;  3RB0 A;  2CJK A;  3JAM Y;  3O6Q A;  4RO0 A;  3VAF A;  3TAP A;  1H73 A;  3BV8 A;  1UVI A;  3HJF A;  3BSA A;  2MQQ A;  2WSF C;  4Z7C A;  1JX4 A;  4JP8 A;  4RW4 B;  5DG9 A;  3G6X A;  2H4Y B;  2VD3 A;  4PG5 A;  2DO4 A;  2MXY A;  3B4M A;  3VVU A;  1YJW S;  3GIM A;  7AT1 B;  2K7K A;  4TN2 A;  4ED2 A;  1RT6 A;  3OVS A;  5AXK A;  3MR2 A;  4PQU A;  1SPB P;  5LMN F;  2BJ9 A;  5F0U A;  3CC2 S;  4DL6 A;  2CVI A;  1TU0 B;  3NXZ A;  5C7P A;  1SQG A;  4ILR A;  2E5L J;  4LF9 J;  2YNI A;  2F4V F;  2JEJ A;  1CC7 A;  3BZQ A;  5J1N A;  3KG0 A;  3BBF A;  2MDA A;  1S59 A;  1Y11 A;  4OZL A;  1EHW A;  3VAJ A;  4WK1 A;  4DZ6 A;  4ZVP B;  4DR4 F;  1IUJ A;  2C3Y A;  5U47 A;  4WTO B;  3Q2T C;  3SSR A;  4IH6 A;  1FE4 A;  1JNZ B;  5HJX A;  1X9W A;  3KK3 A;  2XMA A;  3DMJ A;  3SXL A;  3LP1 A;  2HWH A;  4HI2 A;  3MM6 A;  1UFL A;  3UN5 A;  4YEA A;  3A4T A;  2KFZ A;  1UTA A;  4C11 A;  3LPE A;  2R7V A;  4CO1 A;  2CZ9 A;  2YPY A;  3D66 A;  3RBX A;  1HNX J;  2FVQ A;  1HMV A;  1PBU A;  2ASJ A;  1FD8 A;  5F8I A;  1RAO A;  4AT1 B;  3R5J B;  1VRU A;  4UQG A;  5LXR A;  2LEB A;  1KLM B;  5KT5 A;  4WP3 A;  2GZO A;  1GEH A;  4C3M A;  2GGP B;  3ULH A;  5EUH A;  3W5Z A;  3ZZP A;  3HHE A;  2KN4 A;  5LJ3 Y;  5DZ7 A;  4DR4 J;  3T5K A;  4DV6 F;  1M1K T;  3BQ0 A;  2F8M A;  1A7G E;  2NSC A;  2XHW A;  1VQP S;  1TL7 B;  3BH6 B;  2ASD A;  2OPP B;  1WOS A;  2GS8 A;  3ISN C;  3D1Q A;  5HVH A;  3M6U A;  4K5S A;  3E2E A;  1NJX A;  3QZ7 A;  3BKT A;  3BKF A;  3EGW B;  3TX0 A;  4RW6 A;  5D8H B;  4UTG A;  2MTL A;  1TL5 A;  1RT7 A;  2FJA B;  4BWM A;  2ZD1 A;  3HD2 A;  2OEL A;  5AJ3 F;  5KFO A;  4DV2 J;  1TEL A;  1NKC A;  1H74 A;  2B43 A;  2LEA A;  2Z4P A;  4DFJ A;  1ELO A;  1RAB B;  1RT5 A;  1X4A A;  1U6F A;  1GX5 A;  2XYP B;  2PD1 A;  4HL9 A;  1KR4 A;  1MRO A;  3NWR A;  1RAD B;  4KO0 A;  2IM2 A;  4A8S A;  4DX8 H;  3C8Y A;  2W4P A;  1SIZ A;  3O2I A;  4DR3 J;  2OML A;  2E66 A;  4IG3 A;  2JEG A;  4PWW A;  2W7O A;  5G0R A;  1S1W A;  4A8F A;  1MU2 B;  5AJ3 J;  3TI0 A;  2E9Z A;  1MG7 A;  5D78 A;  1RWP B;  4DEZ A;  4ZLL A;  4XIU A;  3HHD A;  2YKM A;  5H9F K;  1N34 F;  4X4Q A;  3QRQ A;  3G2X A;  2BE2 A;  4C4W A;  4LRB A;  2XC9 A;  4GO5 X;  4X4T A;  3A3N B;  3MAH A;  2NLW A;  3AT1 B;  2ZUA A;  5C42 A;  1UJ4 A;  2YKQ A;  3GJT B;  1AB8 A;  3IC1 A;  4K7Q A;  2DR9 A;  3UI3 A;  2ZH4 A;  3Q0A A;  2ZH8 A;  3M8S A;  2M88 A;  2NQP A;  2O01 C;  3M9M B;  2HRY A;  2E5G A;  3CF5 Q;  5H9E J;  4CCH A;  3W2W A;  1OO0 B;  1FES A;  4NA3 A;  3ET6 A;  4RW7 B;  3D6H B;  3DRY A;  1EET B;  3O5T B;  3HK2 A;  3QYY A;  2E1C A;  4LRE A;  4K4X A;  1F2G A;  4EO8 A;  4QJV A;  1HYS B;  2WON A;  5IXU A;  3V6D A;  1VLY A;  2IJN A;  3HDS A;  3CJ5 A;  5C24 A;  3OR2 B;  2HK2 A;  4XAK A;  2A10 A;  2HMI A;  2UXC F;  4BBY A;  3BO2 A;  4DQI A;  3NCR A;  2DXE A;  4FF4 A;  4CYU B;  1CSJ A;  4UT4 A;  3LGH A;  3KUH A;  1U47 A;  2CQB A;  2VBY A;  1RWN B;  1YRT A;  3KLI A;  4O44 A;  1RAF B;  3MM5 B;  4A8M P;  1S9G A;  2FYX A;  1NRK A;  4QIE A;  3RBZ A;  3J7Y U;  3K59 A;  2RQK A;  4KQZ A;  4QWC A;  3H4D A;  2ZH1 A;  4DU8 A;  5SZT A;  2PT0 A;  1RAA B;  4A8W A;  2B5J A;  3BF4 A;  2YNF A;  3GG0 A;  3KWM A;  3GPA A;  1YJ9 S;  2OD6 A;  1QAJ A;  2AF6 A;  1VC0 A;  2VG6 B;  5A8W A;  5LSO A;  3K57 A;  4P9S A;  5IT0 A;  2VOD A;  1RT4 B;  3GSD A;  2W7A A;  4M5D A;  2UXC J;  3V81 B;  2M8D B;  3KDN A;  1PBA A;  3BPD A;  3MEC B;  3QFH A;  1HD0 A;  2H5I B;  1U7L A;  3AJD A;  1KD1 T;  1SVD A;  2P9C A;  3K8V A;  2VF3 A;  4HTJ A;  1RYR A;  2HG4 A;  1S99 A;  2OEJ A;  3RRG A;  1VR6 A;  2B9Y A;  1E6V A;  3ZZY A;  5KFC A;  4WFX A;  2AJ4 A;  5T7L A;  2YWE A;  4DL0 C;  1IBL F;  1S6Q A;  4RNM A;  2HFN A;  2H48 B;  5LT5 A;  3M6V A;  2VFS A;  1R89 A;  2ZH3 A;  3I96 A;  3DM2 B;  3ZTP A;  1BXN A;  2FTR A;  1S0V A;  4Q0B B;  4ZKA A;  2V68 A;  4CRJ A;  2ZBP A;  3UCU P;  2XO7 A;  1BY9 A;  3N28 A;  3CD6 S;  2HHU A;  3R1H A;  4NLT A;  1C2P A;  3SV4 A;  2DNM A;  3NGR A;  2XHC A;  1IWG A;  4F4K A;  1RA6 A;  1HBO A;  2B7B B;  2NXE A;  1UA0 A;  3I0S B;  3U1M A;  4PUO B;  3I9V 9;  3QAE A;  1JLC A;  3AAW B;  2M4M A;  4J7C A;  2HND B;  4Y2I A;  3NMA A;  4KH1 B;  4M63 A;  1WOR A;  4J9L A;  3MUT P;  1JNR B;  2KZZ A;  2EFN A;  2JLG A;  3QZ8 A;  4F3Q A;  2UVR A;  2X1B A;  1NHV A;  2RSQ A;  3IRW P;  5B0F A;  3EZ5 A;  1UVL A;  2BR0 A;  1U2C A;  1REV B;  3GWC A;  3MZI A;  4PXC A;  2YKN B;  1PGZ A;  3UE2 A;  4XO0 A;  2IRU A;  1TKZ A;  1CJT B;  3HFV A;  4U8Y A;  2QX0 A;  2D74 B;  3QFW A;  2HHX A;  4F0K A;  3BN7 A;  2AGP A;  2H51 B;  2OPQ B;  4OYM A;  3HJV A;  1VBX A;  3R27 A;  4MIA A;  2DIV A;  3IS9 B;  3PO4 A;  5BJR A;  3KLF B;  4V19 X;  2B9W A;  5L1J A;  1KHV A;  2CQ1 A;  1KSP A;  1K44 A;  1Q78 A;  4DMZ A;  3DU5 A;  4C8N A;  1WD6 A;  4ZP7 A;  4DV4 J;  4Q8E A;  4X65 F;  3DI6 A;  1U1R A;  1TL1 A;  1Q8B A;  2KXF A;  4DL4 A;  3G6V A;  4BS2 A;  2MZR A;  2VG7 B;  2O5D A;  5EX0 A;  1UW4 A;  2YH1 A;  2ASL A;  4A46 A;  1ZAW A;  2J8S A;  4JI8 F;  4PPZ A;  5ETM A;  1OIA A;  1PIL A;  4DR5 F;  1SH0 A;  2QYC A;  2W01 A;  1Q82 T;  3DRP A;  2C42 A;  2KH9 A;  4HDH A;  4B3T F;  5F3T A;  4C0H A;  4I7F B;  1R8P A;  2ALY B;  5IWA F;  1F9H A;  4C8L A;  4IQM A;  3GFH A;  4XK8 C;  4K4S A;  4OZ3 A;  4J5O A;  3PIP Q;  1IM4 A;  2W2Q P;  4B9V A;  1U6B A;  1T9U A;  3LGM A;  5HQ8 A;  1U2R A;  2MB0 B;  2GVZ B;  3A12 A;  1RTD A;  2DXD A;  4LF2 A;  1NH7 A;  1OYE A;  3U02 A;  4QPT A;  3I5B A;  1HPZ B;  5I3U A;  4G65 A;  4DR5 J;  5B08 A;  4LF6 F;  3UNY A;  4NZ7 A;  5IOL A;  3D1H A;  3FEX B;  2KTQ A;  3F44 A;  4Y28 C;  5IWA J;  1RAE B;  2VV5 A;  1R0C B;  3MGJ A;  2BXJ A;  3ZZT A;  3RG6 A;  4AYB D;  2XBP A;  4TYA A;  1H2U X;  2QL7 B;  4P7T A;  2MKJ A;  1Q7Y T;  1A0O B;  1VQS A;  1ULR A;  2NYH A;  2XCA A;  3M7V A;  1EP4 A;  2MEW A;  1CQM A;  4WE1 B;  3PV8 A;  2DNY A;  1NJW A;  4F36 A;  4WFY A;  4ZLN A;  3CME S;  4RW9 B;  4YFU A;  3CCS S;  3W7B A;  4FKX A;  1J5O B;  1VQK S;  1C1C A;  2AZ3 A;  2Z0G A;  3DLK A;  4NLR A;  3PRB A;  2NZ4 A;  5RUB A;  3GCW P;  1CJV A;  4MKA A;  3MCM A;  3KLE A;  1SXL A;  4B3S J;  1F1B B;  4I6A A;  3HO1 A;  1JLA A;  4YB6 A;  3R8Y A;  3KMS A;  5HBM A;  2GHV C;  3AXK A;  3R5D A;  4O4G B;  4LR7 A;  5E3C A;  1Y3K A;  2KG0 A;  4NE9 C;  3P3D A;  2MKK A;  1ZPV A;  1H6K X;  3PYD A;  2LQ9 A;  1U4B A;  3RB3 A;  4CO0 A;  3CPW R;  5D0E A;  2VPY B;  2J9D E;  1N56 A;  2QMU B;  3W61 A;  5J2Q A;  1JLG B;  2QLW A;  1FHT A;  2XLI A;  4Z7Y A;  3FCH A;  3T9Z A;  3R7N B;  4DJB A;  1NPR A;  2GC8 A;  1Q79 A;  1ZET A;  4FBU A;  4KGK A;  3CJT A;  1RWV B;  2HLT A;  5CAB A;  3S01 A;  3T41 A;  3H4B A;  4G6V B;  3TQ1 A;  2F9D A;  2LXI A;  4BWJ A;  5KT2 A;  2IA6 A;  4DUZ J;  1ZBT A;  4X62 F;  5E33 A;  4H4K A;  2QMW A;  2WTF A;  1ZZF A;  4IYQ A;  5IT4 A;  4KGX B;  3TWZ A;  1XR6 A;  2XI3 A;  2X51 A;  2GQQ A;  4USM A;  1V6H A;  4KJI A;  1N33 F;  4DCO B;  2NXJ A;  3EWG A;  3BSO A;  4M1K A;  3FEY B;  4TLR A;  5DQH A;  4I67 A;  1M5S A;  4X64 J;  2LKZ A;  2U2F A;  2B51 A;  1YJT A;  5KFX A;  4A47 A;  4ILL A;  2JC0 A;  4MAK A;  3IBW A;  3GYG A;  3H5U A;  1UKU A;  3CVK A;  3KHG A;  1UP1 A;  2E7W A;  3G82 B;  1Q5V A;  5I4M A;  3CC7 S;  1UVJ A;  1HR0 J;  1N5Y A;  4RKU C;  1JLQ A;  3M8P A;  1TK8 A;  4K2X A;  3NL0 A;  2BM0 A;  4ZPA A;  4OL8 A;  3W8G A;  3KHR A;  3AD8 C;  2C1E B;  5KFJ A;  1RHM B;  1ARO P;  2RUS A;  3PYF A;  3MPD A;  2XCP A;  3CCR S;  1QSY A;  3R2D J;  3MMA A;  4YDX A;  1N4L A;  5T14 A;  1CC8 A;  1ZA1 B;  2DIU A;  1IKV A;  4M5K A;  2UZA A;  1KQF B;  4HYK A;  3MED B;  1H38 A;  1JLB B;  2Z2L A;  1VCT A;  2LQB A;  4P2M A;  3OR1 B;  1G4C A;  2NYI A;  2VUG A;  4E98 A;  3HKW A;  3MMB A;  1VBZ A;  5DG8 A;  3RR8 A;  4O3R A;  1HBN B;  2FJE B;  3NOC A;  5J2M A;  1WAC A;  4YOE A;  1LWX A;  2AKW B;  1WF2 A;  1UZD A;  1RAJ A;  2QLB B;  4NLP A;  2V63 A;  1X31 C;  3LQV A;  5K14 A;  3EM1 A;  3H90 A;  3MMC A;  4W92 B;  3TVY A;  4YQW A;  2MQO A;  3C14 B;  2HSE B;  2ZOG A;  1L3U A;  1HNI A;  1WUU A;  2DGX A;  3N6N A;  4QOT A;  3J7A 1;  1OPZ A;  2AEJ A;  3KJV A;  2W2M P;  4PWU A;  1TFY A;  2BEF A;  1N8R T;  1FXL A;  4C97 A;  2V34 A;  5BYS A;  3HVW A;  1QVG R;  2XZT B;  2F8H A;  4B3M F;  4LSZ B;  1FNM A;  4PWD B;  1SC4 B;  3EDQ B;  2XI2 A;  1DTT B;  2VJU A;  3PJ9 A;  3QAU A;  4ES1 A;  4XPC A;  2JLE A;  3GIL A;  4CI0 B;  3IFE A;  1PCA A;  1DY3 A;  4L3N A;  2LXF A;  3KLG B;  2DNG A;  1W7W A;  3MM9 B;  2YWG A;  5JUM A;  3TJA A;  3KLH A;  4F7V A;  1CJU A;  1BQN A;  5D77 A;  3GYN A;  4QR1 A;  2ACY A;  3MEE A;  4EO6 A;  4KT0 C;  1YGY A;  1TMJ A;  3CDE A;  2CG8 A;  3MPU B;  3GG1 A;  1NB2 A;  3CJ3 A;  3HD1 A;  4DCJ B;  3SSQ A;  3DOM A;  4X4N A;  2LP4 A;  4WWS A;  4B3M J;  2UXB J;  4IQX A;  4ZPW R;  2C2R A;  1IVZ A;  4HAC A;  2FGC A;  4ZVF A;  3QAT A;  2I5J A;  2BAN A;  1HQE A;  4NCG B;  1RT1 A;  3PR4 A;  3DGP A;  1JLF A;  3D0G E;  1VC6 A;  4IFY A;  2ZNY A;  4DX7 A;  2RB7 A;  4GO7 X;  4ZN1 A;  5A8R A;  1FXD A;  2AJQ A;  4WP8 A;  5D4N A;  4ELV A;  2MLZ A;  4ICL B;  1C4C A;  2HVD A;  1B70 B;  1U24 A;  4RUC A;  2GHP A;  3ZTQ A;  2W8L A;  1TL3 B;  4DSL A;  3W65 A;  1KS2 A;  1B64 A;  2CZ4 A;  2WHO A;  4ZCK A;  1X5T A;  2G13 A;  2WBM A;  3WC2 A;  4DR6 J;  2MY8 A;  2YNG A;  3HVT B;  4JI6 J;  1HBU B;  1RKJ A;  1PJ6 A;  4LQ3 A;  4AQY J;  2WW8 A;  3ITH B;  3R7S B;  3J81 U;  1F9F A;  2WSE C;  2BVZ A;  3TVZ A;  4DN0 A;  2DGT A;  2JOQ A;  4OHY A;  5K8P A;  2QMX A;  2ZDP A;  1M90 T;  2MYF A;  4XDD A;  4RW8 A;  2C3M A;  4CTA A;  3PG9 A;  1OY9 A;  2W9B B;  3DOK B;  1SV5 B;  2OKQ A;  1V5I B;  2H3E B;  1TV6 A;  1FFG B;  4PCQ A;  2BKP A;  1VK8 A;  4MFB A;  2BJ3 A;  3I56 S;  3KHL A;  2DYA A;  1FVQ A;  2R2R A;  3B6B A;  1W2I A;  4K4U A;  1S7I A;  1EKR A;  4MKY A;  2WW4 A; 
#chains in the Genus database with same CATH homology
 2BW7 A;  2GVZ A;  3C15 A;  4OYZ A;  1U0H B;  4USV A;  3UVJ A;  1AZS B;  1FX4 A;  1AZS A;  1CJU A;  4CLS A;  1WC3 A;  4OYX A;  1TL7 A;  3MR7 A;  2WZ1 A;  2W01 A;  1YBU A;  2GVD B;  5D0E A;  2GVD A;  4OYI A;  4OYO A;  4OYA A;  4NI2 B;  5D15 A;  1U0H A;  4CM0 A;  4USU A;  3C14 B;  5D0G A;  3G82 B;  4P2F A;  4CLK A;  4CLY A;  3G82 A;  4UST A;  1WC1 A;  1WC4 A;  1CJT B;  1CJV B;  4OZ3 A;  1CS4 B;  5D0R A;  1CS4 A;  1AB8 A;  4OYW A;  4CLU A;  5D0H A;  1CUL B;  4OYM A;  4USW A;  1YBT A;  4WP3 A;  1CUL A;  1WC6 A;  2QV6 A;  1WC5 A;  1Y10 A;  4NI2 A;  4P2X A;  4CM2 A;  1FX2 A;  5IV3 A;  4CLZ A;  1CJK B;  3C14 A;  4OYP A;  4CLP A;  3MAA B;  4CLT A;  3MAA A;  3C16 B;  1CJT A;  1CJV A;  4CLL A;  3C16 A;  2GVZ B;  3C15 B;  1WC0 A;  3UVJ B;  3ET6 B;  4CLF A;  3ET6 A;  1CJU B;  4OYB A;  4WPA A;  1YK9 A;  4WP9 A;  1TL7 B;  4WP8 A;  4P2M A;  4CLW A;  4OZ2 A;  1CJK A;  1Y11 A;  5IV4 A;  3R5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...