1WCIB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
341
structure length
335
Chain Sequence
AHFTFQEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 128
structure length 335
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB01
1UMBA 2PANA 1YBHA 2BP7A 4KXVA 1ITZA 5EJAA 2OZLA 1NI4B 5EJ9A 3AI7A 1UPBA 1T9AA 3EXHC 5K3SA 4MPJA 1QS0A 3FSJX 4FEGA 4RJKA 4KGDA 2QTCA 4D5GA 3EXFA 3LPLA 5EXDA 1OLXB 2J9FB 1POXA 5ERYA 4RJIA 3EXEB 1X7YA 1TKAA 2PGOA 3HWX1 4JUBA 2PDAA 2Q29A 4QQ8A 2BFFA 1BFDA 2G67A 1X7WA 5HYVA 4GP9A 3AHCA 3DUFA 2WVAA 2UZ1B 2XT9A 1QGDA 3EXHB 3JU3A 1X80A 2Q5OA 3ZHRA 3ZHUA 5DGTA 2BFDA 1UMCA 5ERXA 3ZHSA 1GPUA 2VBFA 3ZHVA 4MZXA 2EZ4A 3M34A 3EXIB 1YI1A 3OE1A 1T9CA 5I4IA 5AHKA 3E9YA 1B0PA 4C7XA 5C4IA 1QPBA 4KXYA 3HYLA 1YD7A 2IHUA 3M49A 1YI0A 2EZ8A 2C3YA 1V5FA 4GM0A 1L8AA 1TKBA 2VBIA 3F6EX 1KEKA 3MOSA 4MPRA 5HJEA 2X7JA 4K9PA 5EJ5A 5EJ6A 1V1RA 4ZP1A 1JSCA 3DVAA 3LQ4A 4K9KA 4C7VA 1V1MB 1OLUA 3ZHTA 4JUCA 2VK1A 4MPPA 1V16A 1UM9A 5IMSA 3EXFB 1X7ZB 1PO7A 2V3WA 1V5GA 1YHYA 2BFBA 1WCIB 2E6KA 3AHFA 3IAFA 2EZ9A 1MCZA 2Q5LA 4JUFA 2BFFB 3EXG2 2BEWB 4KXWA 2AG0A 2UZAA 1V11B 1POWA 3RIMA 1X7WB 2JI8A 2VK8A 3AHJA 3KOMA 5DEIA 3DUFB 2Q27A 1NI4A 3AHIA 1TKCA 2BEUB 3ZHQA 4MQ5A 1OLSB 2FWNA 2AG1A 5DGDA 2YIDA 1N0HA 5EXEA 2C31A 4FEEA 2IHVA 1W88B 5I5EA 4JD5A 2JGDA 2BFDB 2XT6A 1Z8NA 1RP7A 4GPEA 2R5NA 1OLXA 3M6LA 2WVGA 3EXG1 2O1SA 3D7KA 2IHTA 4D5EA 4KXUA 3F6BX 2C3UA 5K6TA 1DTWA 1W85A 5ESDA 5I5GA 2WVHA 1T9DA 4JUAA 2BFEA 2BEVA 3FLMA 2BFCA 1OZHA 1X7XA 1TRKA 4JUDX 3IAEA 1U5BA 1UMBB 1V1RB 2G28A 2BP7B 2VBGA 3AHHA 2EZUA 3DVAB 5K6RA 2O1XA 2OZLB 2G25A 4KXXA 1V16B 3EA4A 4GM4A 3EXIA 4Q9DA 3LQ2A 3AHGA 1YNOA 3DV0A 2QTAA 5HGXA 4JU8A 1QS0B 4RJJA 4GG1A 2VK4A 3FZNA 3L84A 4JU9A 2W93A 1OZFA 1PVDA 2JLAA 1X7YB 3EY9A 1UMDA 2C3OA 2JLCA 3UK1A 3OOYA 2JIBA 2R8OA 2EZTA 2VJYA 1IK6A 4K9QA 1V1MA 1OZGA 2JGDB 1PI3A 1UPCA 1X80B 2FN3A 1V5EA 1X7ZA 2C42A 2C3PA 1WCIA 2Y0PA 1UMCB 3M7IA 2BEWA 3AHEA 4K9MA 1V11A 2J9FA 2Q5JA 4K9LA 1OVMA 1DTWB 1W85B 3EXEA 5I51A 1UPAA 4QPZA 3EYAA 4COKA 4XEUA 2BFEB 3LQ1A 1Q6ZA 5EJMA 2BEUA 2BEVB 2BFCB 1OLSA 5FEMA 1Y9DA 1X7XB 1R9JA 2UZ1A 1U5BB 1W88A 4QELA 5EJ7A 4WBXC 5EJ4A 1AY0A 3EXHA 2JI9A 4K9NA 2JI6A 1T9BA 3UPTA 2DJIA 4GM1A 2IEAA 2PGNA 2C3MA 3HWWA 5EJ8A 1YHZA 3DV0B 1OLUB 2JI7A 2NXWA 1UM9B 2Q5QA 1ZPDA 1PYDA 5HHTA 2Q28A 4K9OA 3AHDA 2BFBB 2XTAA 2R8PA 2YICA 1NGSA 1UMDB 5K2OA
chains in the Genus database with same CATH superfamily
2P0AA 4DF3A 4XGKA 5K0SA 4J03A 2EP8A 3VI4B 2F3TA 3AKDA 3ZKWA 3I45A 2JGMA 5BT9A 4JVNA 4QDZA 3UAWA 5ITSA 1FPMA 2JIOA 1G19A 3K92A 3W78A 4MPDA 1SOUA 7YASA 3V4VB 3RW9A 4CMEA 3RUIA 5CPFA 3T4XA 3CVOA 1ITZA 5IK2D 2C29D 3PR2B 2WHQA 1CIPA 4QBFA 3TGWA 2NP7A 3DW1X 4ZI3A 2DWCA 3JSAA 4Z9BA 4J29A 1FYDA 3EF1A 4B6GA 4KAFA 1XTIA 2FXIA 5CXUA 5IDQA 3UMMA 4CM6A 5LMUB 1GJRA 2Z58A 4JEMA 4BZPA 1SXJB 3T3OA 4CQMA 3LH5A 5G1OA 3EGXA 4DMCA 4QD3A 1AB6A 3COYA 2NSDA 2W6JA 1NW4A 1VLQA 4DA9A 5AFSA 1BDHA 4UMDA 4F71A 2UYCA 1KERA 3WNVA 1U28C 2FXVA 1BRTA 2CJWA 3A70A 3JQ7B 4W7IA 4ENRA 6ABPA 4HB4A 4IG4A 1OBHA 1PR5A 3HM9A 3FSJX 4DMFA 5DHAA 3SZRA 4B2IA 1WXXA 5KTTA 2FN9A 2D0OB 5E9QA 5BWLA 1QGUA 5HOEA 3TRFA 4DR6B 4QNNA 3MSXA 2I9PA 5K4HA 3EGDB 5ALUA 3F97A 5K0FA 5E7QA 3HCAA 3I6MA 2V6JA 3GFBA 1X1QA 4FYVA 1OLXB 3KQSA 3VC1A 3F5DA 1Z4QA 4NEGA 4F5WA 1X87A 2RGXA 1I51A 4JT4A 1IBCA 3H84A 3LXRA 3IVMA 4PHHA 1H2BA 4CWAA 5ECWA 2QU7A 4M7RA 3IB3A 3KXLA 3R7LA 2YHIA 3IAUA 4X1KA 2D5BA 1EFVA 4OXXA 1CUBA 2IVFA 1QSGA 3NBKA 2G67A 4P58A 2P6RA 4X1IA 1P4AA 3WBBA 1EXNA 4M54A 4HGYA 2VT3A 1MQAA 1VHLA 3N5KA 3OCVA 5B6PA 4NATA 1UC9A 1WF3A 4RY2A 3VTZA 2EDCA 4R51A 3NOVA 5CA1A 3DKIA 1BSVA 4WSOA 2FA9A 1C0LA 3CKYA 3I01M 3IXLA 1LNQA 1Q19A 4AXBA 5K8VA 2X1HA 1JYFA 3CRW1 2IYPA 3CB2A 3EXHB 5CM8B 1GO2A 2WMNB 4NECA 1APBA 4L4YA 4IIJF 3NT5A 2GMWA 3LQYA 1YDGA 1ZMTA 4XCVA 2DLCX 5HDBB 2O07A 4M4SA 3ZHRA 1HDZA 2PLAA 1MABA 1PUIA 2K7ZA 4TSRA 4WLEA 2XVAA 3CNNA 4TTVA 1EYZA 1U0RA 2NACA 2BMAA 8ADHA 4CMEC 2UYHA 1OU4A 1WMAA 3LOQA 1AJEA 4DV7B 1HI9A 3EK2A 3VZBA 2OGWA 3LSYA 1A96A 4FFNA 3GJZA 1Q95A 4G3XA 1AKWA 5TF0A 4G56A 1RC8A 1EH5A 1Q0SA 2AJ8A 2DLDA 4PG7A 1YS4A 3AR9A 3MUNA 4UU8A 4KH0A 2BM1A 4WK6A 1LDBA 3LC1O 4U8HA 5ED4A 4KWHA 1FFEA 1E2IA 3E27A 2N47A 4I5FA 4OSPA 2C58A 3E15A 1GPMA 1YE3A 3FPSA 3HNPA 3I2IA 2XBLA 4HFMA 4UMEA 4XA8A 2JHAA 3KR9A 2XXAA 4PAGA 3NJRA 1IHXA 1UBOS 2R8EA 2AI2A 2H9IA 2KE5A 2VPYA 5JQGA 1NA5A 4FX5A 3ROQA 3SHVA 2P67A 3WLFA 2ODQA 4CMJA 2PWAA 5CLQA 4MQMA 1N4AA 1UJ6A 1RKXA 3N2LA 3UMGA 1WULS 1PT8A 1P2DA 1DWPA 2KQUA 3B2NA 3HZHA 4QREA 4YQZA 4KE8A 3DT9A 4FT2A 2HAEA 3WKDA 1H6BA 3LUDA 4XX0A 3L7DA 4FQ7A 3QMWA 3QOWA 4YRCA 3TSAA 2IC5A 1LX7A 5E7MA 2JGLA 3TRKA 1X15A 1NI5A 2RC6A 4AULA 1LVGA 3R77A 1Z7GA 3M4YA 1E6UA 4P7JA 3M49A 4CLHA 1T9GS 4KB5A 1RHJA 2QD2A 4INZA 4WFJA 4PHFA 1E2NA 3L8MA 2REBA 3C7DB 3LC0A 4NLLA 2C3YA 4QTZA 2RHLA 3ANLA 1QDUA 1SKBA 3QE4A 2GBGA 4RMHA 5J4KA 2EFYA 1QH8B 3P2IA 521PA 2KLHA 3WLAA 1ZBDA 5DLEA 3GV0A 3V3TA 2CCGA 3NHJA 4B4VA 5CNIA 4Q9JA 4EI2A 1IY9A 1QPZA 2GZSA 4YREA 3Q8WA 1DKRA 4WNIA 1QDLB 2A5JA 2W2NA 3BSYA 3C7CB 3ETLA 4IEFB 4UBKA 4WXHA 1T8YA 1WB5A 3KQTA 4WTOA 4ESHA 4PN3A 1S3FA 3D8HA 2HQ1A 4Q37A 3GJSA 3V34A 1NF2A 3L9XA 3ER9A 3D2AA 2P1DA 1J2EA 2XOKA 5FNVF 4AJHA 4Q7QA 4Z0HO 1DIOB 1Z75A 5LD2C 5JNTA 1PWYE 4ZP1A 3GPLA 1AIPA 3HMQA 1K89A 2ZR0A 3D8UA 3DR3A 3DVAA 3PC8A 4RZUA 3A9RA 4G23A 1ISIA 4U9IS 3TTXA 3ZWYA 3KKNA 1W8IA 4D9GA 3ZHTA 2I87A 1IZZA 3A9UA 3ANXA 5IDVA 5C46F 1ONSA 3JQ9C 4HO1X 4Q4JB 1P1JA 4C0KA 1JJAA 4KMRA 3BERA 3NTQA 4D25A 3DZFA 1EHIA 5FBQB 1E62A 4DSOA 1NBIA 4IZOA 2RGRA 2IXBA 4H4DA 2X7XA 3AYZB 3QOYA 1W36D 3QFSA 1RS0A 4PX9A 4MTLA 1YHYA 1H0RA 4ZA2A 3GL9A 3KJHA 3AHFA 1X9HA 1DEXA 5EXPA 3WRVA 3NTOA 4HAIA 1T1SA 3DB1A 5FBVB 3IEPA 5EE1A 1LVHA 4EITA 9ATCA 3SC4A 4KWEA 4BFUA 3JZFA 1EWKA 4IJMA 4E6PA 2M1XA 5ISMA 1A9TA 1MJHA 2M1ZA 4GZLA 3QU4A 4A9AA 4EJFA 1XP8A 3UA4A 3X1KA 3MCAA 4RVDA 2ZSAA 1PTJC 4EUSA 1X1DA 4AQDA 4Y1RA 1EG7A 3RRYA 1YVDA 3KVVA 3TRIA 5EC8A 3HTXA 2JD2A 3FZGA 1AC5A 1QIJA 1P1IA 1UQRA 1Z4LA 1T5LA 3B8HA 3HV2A 3QKUA 5K1ZA 4EGFA 5JDIC 2PZFA 4ZN6A 4CIBA 2EL7A 1I2AA 1W48A 3O75A 2JGFA 3B1WA 1BX3A 4LOKA 4L85A 4ZAYA 4D3SA 4DCGA 1JFRA 2VDJA 4YRPA 3KQHA 4K88A 1VB3A 5DI9A 2DPYA 5H3CA 5LQKA 4GP6A 5F5XA 4GPTA 2H1IA 1F12A 1ZCBA 2P65A 3NBZC 4UEWA 1N34B 4B83A 1DLJA 1NUTA 2QD1A 2YIDA 3VR1A 2AQHA 3OQ6A 1ZGBA 4R3NA 3R0JA 1EFRA 4FEEA 4JLAA 5C1DA 1AHPA 2XGJA 4OHWA 2UV8A 2WQ6A 2R9VA 3K5PA 4LQDA 1U65A 3SMVA 3OP1A 3V8MA 2R1VA 3GRCA 1DKPA 1JN0A 1RJ9B 4M7OA 4TTPA 4Y0AA 5BRNA 4BMOB 2P6MA 2FPRA 5C8DA 1T2CA 5DXFA 2Y1LA 1U7TA 1Y42X 3E1SA 4MIKA 1LGYA 1WKCA 2Y67A 4IHJA 5DTIA 1UFQA 2R5NA 2BF7A 1CUJA 3IS3A 4EVQA 1H05A 4BLUA 4ZZ3A 5TQ0A 5AP9A 4CKBB 1ZVVA 1VL1A 1XFAA 5CB4A 1MB0A 3DHYA 3GVIA 4MLCA 1W4ZA 4HH1A 3GLHA 3OFVA 2IHTA 3I6IA 3KT6A 3GDWA 4HDSA 4O0LA 5DSTA 1FDOA 4E30A 1P31A 1WXEA 3A27A 2A33A 2HHCA 1RI3A 4KVZA 3UCXA 2OOSA 5K6AC 5J4YA 4FYXA 3OCJA 4CCAA 3K0EA 1VBNA 4BV9A 2HRDA 4KHZA 4OGKA 3ZVKA 1A9XB 5FTNA 2WWVD 3IUEA 2NV0A 3F98A 1VL0A 5C7IO 1KI6A 2G8LA 3EDMA 2KBFA 1NNEA 2HO4A 2AS0A 4TV9A 5JIBA 4NCXA 4H7DA 1GZSA 3QP9A 2P35A 2XQFA 3GRUA 4RU1A 1NJFA 2PUEA 2DQZA 1OTHA 3OEHA 1CJTC 3P9QA 4QGBA 2XWSA 1CJSA 4LY0A 4NCHA 3REQB 3Q11A 2PXHA 4L95C 4DIFA 1VG1A 2F7SA 4CMIA 5B4TA 3COJA 1ZMXA 3DLHA 4BJHB 1C1DA 2AJDA 1Y1LA 3ROPA 1MOZA 3VZSA 1UBHS 4JYBA 1DZIA 2P27A 4JSRA 3FCOA 4BE9A 4BO3A 3C1AA 1VJ0A 2FW7A 2VSYA 4QHSA 1RZ3A 1NATA 4S2UA 4A6XA 4FOPA 4BTLA 4TYYA 3BRQA 3BE5A 3ESBA 2G71A 3GLSA 2EFDB 1HSZA 2OZLB 3O9VA 4JFAA 4N3CA 4NENA 4TYPA 1GAQA 1GGVA 4B71A 5JJIA 1XCLA 3EVEA 3M6IA 1NLYA 3R1IA 3R3YA 4IF4A 5E3IA 1W46A 2EDAA 2X23A 1RMTA 1K2VN 4C01A 4DB4A 1YAJA 4JJAA 3EUWA 1HT1E 1LWNA 1YU6A 2A1TR 1G98A 4HWSA 5LQCA 5DT2A 4WY2A 1UJBA 4MUEA 5FXMA 1YNOA 3C5EA 4R69A 2XYHA 1BXGB 3H11B 1KVRA 3RWMB 3PRJA 4J49A 4A0HA 3HO1A 2FDRA 5A4IS 3LUKA 4HJRA 4MUXA 4FGZA 2QGNA 2IUUA 3WC4A 3H04A 1G6HA 1I7NA 1LQ2A 1G8FA 4F2DA 1KEUA 4AMUA 1AKQA 2HUPA 2X0EA 3EZ7A 1Y3AA 1M2JA 1ORDA 3A11A 1FFYA 3ZD7A 1HG0A 2QI9F 4XXHA 3U44B 5DCUA 1PFUA 4P4TA 5DM4A 4S35A 4XE5A 2PH3A 3UJ6A 2JCGA 3GQBB 3ZEAA 2PGLA 3W05A 4M6WB 9LDTA 2B1QA 2F3UA 4W99A 1X0VA 3WGVA 3N58A 4EEZA 4MW1A 4M9QA 5B3KA 2VYND 1GSAA 1Z3CA 1EGHA 3EQ7A 1RSZA 1T6YA 3RJMA 3AVWA 4AT1A 1TYEB 2Q1WA 4CL0A 3PNKA 1ISGA 1JLRA 4Y9UA 1EDBA 4QX6A 4PPNA 3WWCA 2HBQA 4CDGA 4TZ6A 4IZ6A 2B1JA 4H15A 1T6NA 4BC1A 1TEXA 2EZTA 3W1VA 2BGWA 1OW3B 5LSAA 1TIBA 1JTVA 2A0FA 1NVVR 4QWWA 4UNNA 4RPJA 3TIGA 4XDYA 3LQQA 1N1GA 3TRDA 1FU7A 4R8LA 1FDTA 1GRVA 4ARIA 2H85A 2QAIA 3U39A 4F7WA 3OQIA 4GBMA 5A3VA 1R0CA 1DIGA 3VYWA 4RK5A 2XQJA 3MHTA 4DCMA 3QXHA 3IBFA 2HMYB 3LL7A 3ZK9A 2QVYX 4CKXA 4MKFA 5LKAA 1WCIA 1TFRA 3K5HA 4I8DA 1UT5A 4BVLA 3HC7A 4UTPA 1IQUA 2OXTA 1NXSA 2X58A 2ST1A 3A26A 3PNYA 1QOPB 1WSAA 5AKGA 3V1MA 3MNFA 1NNI1 3H5RA 3GPCA 1DRWA 1ZK3A 2ZWIA 1LI5A 3L6BA 5DIFA 3KYCB 5DTQA 1KHHA 4R9RA 1ULUA 3UYLA 1E3WB 4JASB 1DTWB 5KEIA 4L5JA 2OBYA 4Y67A 5AVRA 2J08A 5CFRA 3L0BA 5LPNA 5BQFA 5B12A 4WECA 2FU5C 3VSEA 3T41A 4COKA 4XEUA 4X94A 4UVEA 4BQSA 2VCHA 5LU9A 4CEJB 4D9FA 1ZZEA 3R75A 5DWDA 5HZKA 2WJZB 1J9GA 4HQOA 3OQMA 3S28A 4IEEA 3T7EA 4NBNA 4IAOA 5IJWA 3DBHB 4B8YA 4BNMA 2F43A 1AQLA 2JJYA 5FQOA 3IQZA 5CM9C 1PZNA 5LA6B 3W3AD 3WIDA 2G1PA 5JRDS 4KUHA 4YRTA 4XPIB 3STVA 5C7LO 2CL0X 2A8YA 3NIBA 3TTUA 1IIBA 2WJJA 4M1YA 2OD9A 2VPXA 3CE9A 1IIRA 1L7QA 4CCYA 1D5CA 1BU5A 1UT8A 1F5NA 3N0WA 3S1LA 1XNGA 2FAXA 2XMCA 1P0CA 3U3ZA 5EA2A 1IG0A 2WSSD 4NAHA 4CIAA 2VJMA 1E0AA 2XA1A 5TV2A 4J0HA 2JJ8A 1SUDA 3MTBA 1NVEA 4BWGA 4H60A 5AJVB 1TO1E 4Y6GB 3ZWWA 2CHFA 1JF8A 4R9NA 2XCOA 3I2YX 2OYCA 3FWKA 1GXSA 3O94A 1XE3A 3HWWA 1ZM4A 3DDNA 4PLZA 5B1IA 5E3HA 2II6A 2J1LA 4G0PA 4GNRA 4BQRA 4RSRA 3MCWA 5DK6A 1NKSA 2PJZA 4AF6A 2R65A 2OPBA 2QVZX 2L69A 1FYWA 1N7JA 2AC7A 2I7DA 2XOXA 3EFBA 3TTYA 3ZDQA 4NEQA 4RVFA 4EPRA 1J0CA 5L3ZA 3RKUA 1RVV1 5B7QA 4PGFA 3IR6A 3HPQA 4TYMA 4YRJA 4F91B 1AQJA 3TGLA 1G5IA 3U1TA 1KDVA 4Z3KA 4N3AA 5K0EA 3KEGA 1N78A 4J7AA 4KIWA 3STUA 2PJUA 2OO7A 3TMYA 2YW2A 2DR2A 4OQLA 4KUEA 4IDDA 4ERNA 3S8EA 5CVJA 1JLKA 1YWGO 2Q45A 2LNDA 4CKYA 4QJIA 1CJKC 2R4UA 3OETA 3CLUC 3EVDA 3HEBA 3JQFA 1JI3A 2O5RA 3H2ZA 1C3VA 4UPDA 5FUBA 4DCUA 2PQ0A 4AX4A 4YN3A 4A5SA 5D85A 1EHCA 2DECA 4A4DA 5B58C 3R3UA 1ANKA 1L4UA 4RF4A 1RYFA 2CV0A 2GZHA 1NJGA 2JGAA 3BE4A 3UXEA 1ZJJA 1JZTA 2O2HA 3IDSA 4LXGA 4RACA 2DKNA 2JFYA 1DBVO 3K0AB 4FHGA 4X90A 2CYAA 4NZPA 4XFJA 1L5NA 1V3QE 2XMGA 1E0JA 2HKIA 4LTDA 4DRYA 5E6SA 1JX6A 1XK6A 3EAQA 4XIGS 1DFHA 4B87A 2WVJA 3BJZA 3FXAA 1HRDA 1S1CA 2XZPA 4L3OA 3UTDA 1N5DA 2HF7A 1R0ZA 1JR6A 1XF1A 1ZINA 1JU9A 2ZTMA 5GOZA 4AJ2A 2F00A 2DT8A 1IXSB 3RHTA 2Q62A 3TMAA 5CW1A 3FSEA 3LDUA 5E0KB 5IKXA 1C9JA 2AFRA 2BKUA 2W6IA 1X0XA 4BCDA 1ENYA 2JGKA 1CXZA 1F5SA 4PS1A 4IGEA 4KEAA 1KP3A 3GG9A 3ZVMA 1PRYA 3WIVA 5K3SA 2HREA 4UULA 1ORIA 4NJMA 4P4UA 1CC1S 3B2EA 3G5MA 4GSLA 1YZGA 3V8PA 1TM7E 3JAKB 5ECYA 3O2QB 5ALSA 5IXSA 3ANMA 3I01A 5AHXA 4ZQCB 5BMVF 5C51B 1ULHA 3LIPA 3R44A 2DWPA 2ZBRA 3BMNB 4UDNA 4Q1EA 1L6IA 3OLYA 4O4JB 5K4GA 3GFFA 3RYHA 2B8WA 3M9LA 3IMEA 4I6EA 3NVAA 1UP6A 2JIPA 3DOEA 4ZVNA 3FVRA 2EYUA 4BFTA 4CM9D 4K6FA 4G67A 1BJTA 4N4AA 1DPGA 2QPTA 1GUFA 1ZU5A 4P32A 4F86A 1XG5A 3GFGA 3TLMA 1J4AA 4JWTA 4Q93A 3ETEA 2AMLA 3W4IA 2VZ8A 5CLLA 2GN0A 3TH5A 4DMLA 2ZXUA 1JSRA 4IDGA 5LDGA 1C8VB 1FYVA 2GN1A 2GN9A 2W6QA 2FPPB 3C8HA 4C6TA 4ZQHA 5HMMA 3TXYA 1T1EA 4P83A 1JRLA 5CNKA 2PWYA 3K16A 4F6RB 5HR5A 4B48A 2HIGA 3T0FA 3MWJA 2XTJA 4DMGA 1GPJA 1V2GA 3QVVA 4RHFA 2VT6A 4AZWA 4RIHA 1ZGHA 1KQNA 4C7JA 1XLVA 1IHDA 3PUYA 3Q8XB 2Q1XA 4W5OA 8MHTA 3QE3A 2FGKA 1E1YA 1P2SA 3VBCA 4FB5A 5BV8A 1VDZA 4AS2A 4JLUA 2XW6A 3WJ1A 2GAOA 1NP7A 3KHTA 2GEUA 1GGEA 2ZIAA 4GR5A 3WNDA 1PYGA 1DFIA 4C1NA 1SC6A 3ZHUA 2FDXA 2I6SA 4CT4B 3U4QB 3THOA 1BZYA 2WZCA 1COWA 2AQKA 3JRNA 3VBEA 5ALQA 4CMAA 1ODTC 1XPJA 1IC6A 3P5SA 4JVSB 5AVXA 4FTWA 4XFDA 5FOVA 3UBMA 1KI1A 4TLEA 4DIDA 1O6BA 3WWDA 1H9BA 2VSFA 4CKCA 3DONA 3H7IA 5ALKA 5TY0A 4B3FX 3NP9A 4TMVA 4IWXA 4Q1AA 4OQPA 1V9SA 1DC8A 1GPUA 4BMNA 4HF7A 4LOJA 1IOLA 2GNOA 1NV9A 3OPMA 1VYHA 3CLUD 1RRFA 2AN3A 3GFSA 3H19A 5FA6A 2W22A 3GLUA 1D9XA 4NAUA 1NW6A 2I3BA 2XD9A 5EZ6B 3I1FA 2HCRA 5I4BA 4MVJF 3VR4D 1GRQA 5AT1A 3C1TA 2WSMA 1WCWA 1C8LA 1XCMA 4P5DA 4BNLA 4P35A 4M22A 5HRUA 1L7NA 2G77B 2QSZA 5LJIA 4UHHA 3EZYA 4RE5A 2C8JA 2CVHA 5I4IA 3WO0A 1NG9A 1BVRA 4BKMA 3ZK7A 3BWEA 3UT5A 3G3EA 2ZBEA 3ILXA 2MSLA 4I1VA 4NARA 4LPKA 2JAUA 2WFLB 2WKSA 1ECPA 1JS1X 4I5EA 1NAIA 3UGJA 2VDOB 3DDCA 1NU8A 2W5UA 1YI0A 3CE6A 3D4IA 2WA1A 4TZKA 4E88A 1YIAA 2G7MC 3LZCA 2MYTA 2OXIA 2PS1A 4RWZA 1LY1A 2PKXA 3MQ4A 4LJ5A 3S27A 3C3YA 5DO9A 4AN0A 2BR5A 4ZD6A 1QHHB 1W25A 3VOBA 4ERXA 3K6KA 4C2BA 1YS6A 2D6FA 4R5HA 5M3BA 5JH7A 1LB1B 5BUZA 4MR9A 1SVWA 3U7IA 5LA6F 4Q15A 3RK0A 1K6EA 3HCRA 4URYR 5JZBA 3QU2A 1SHTX 1MW9X 1NW9B 4OHVA 1KFCB 4TS4A 1B74A 1SBTA 4Y1GA 4Y2SA 3ZS9A 2CJWB 1JR3A 2WD7A 4HB0A 1DU4A 4MPPA 1DBSA 2YRXA 2F90A 3TD9A 3FOBA 3WLNA 3EEOA 3EPKA 2Q4RA 2ORED 3GPDG 5C0OE 1KH2A 4Y9TA 1QGUB 1X3LA 1H42A 4Z5XA 1ESNA 3HJFA 1JPNA 4EQ6B 2GR9A 2NZUG 1E32A 1E18A 2C1EA 3FDZA 4X7PA 4OYYA 3PCTA 3NAQA 4MVJP 3QEBZ 2QTFA 4GIBA 3DKKA 4LJKA 5LBTA 4TL9A 1ZCFA 3V1NA 5KQRA 3R6WA 3SJCA 3M1IA 4EY8A 1AUQA 2O3UA 2UYGA 3E58A 2ZT8A 2HZBA 4XUDA 3EEFA 1G21B 2GEJA 1QOQB 2YHIB 2H0QA 1USVA 4WZBE 3OJ0A 4X1KB 3REFA 5DNAA 1EFVB 2G5GX 2Y1KA 3WP1B 2EIHA 4U00A 4IOLA 4AJEA 2OCLA 1O97C 3NQ41 2DE0X 3OU7A 4X1IB 5KWJA 3I62A 1LS6A 1R15A 3JWHA 1VMIA 2B34A 3NBXX 1C3OB 1XN4A 4KZKA 5I8ZA 1F60A 2FZVA 2Q2QA 2XJ9A 4BASA 4C6RA 1XU4A 2WJ4A 4GOLD 3CGGA 2B1IA 4MO2A 4EENA 4O1MA 3S68A 1QO9A 1PLJA 3LT2A 1DEOA 4ZVLA 3KFVA 2D13A 2QPOA 5JAPA 3ZIAA 2P6OA 1XZGA 4YAGA 6LDHA 5LD2B 1PV2A 1P3JA 1T0HB 1X7HA 4TMTA 4GE3A 3M5DA 5CT4A 3W1WA 1FNCA 2PZKA 2WYUA 3STHA 1NVTA 3ZCPA 4QU9A 1LDMA 2DY0A 5THKA 4BXOA 1DB3A 2PX5A 3QVKA 5AUQA 3JY6A 3VDRA 2E0IA 4NMHA 4G0WA 1B8PA 4D3XA 1N0HA 2VHWA 4A15A 2BMVA 3A8TA 3EMDA 1WM1A 1MABB 3RBZA 2AHRA 3DXZA 1ZL0A 4I1PA 4JYAB 4FN5A 2VP5A 3RABA 5LZ4A 1SAYA 2VHCA 3DVRX 2PZEA 2PYDA 2ZRLA 3OUUA 3P94A 4KBFA 3DL7A 3H75A 1P1HA 2YV2A 1MB4A 1NNLA 3OHPA 3BC1A 4ITUA 1OOEA 3GUHA 4M7PA 4TKUB 2QG6A 2A0XA 4TXJA 3I8OA 3V5NA 3LYUA 5L95A 2VUTA 1IN7A 4PXSA 4FD3A 4RV9A 5HWSA 1JQBA 1EHYA 4JEHA 3CXUA 5T4BA 3E3LA 1FP1D 2VFAA 4X85A 1Z5ZA 2BDEA 3F5MA 4H59A 4ZI7A 2XXAB 3I1JA 5JQGB 3KB6A 2IITA 4YCSA 1W5SA 2E4YA 1W34A 3HXTA 1PGNA 4PO9A 1LBSA 2CNLA 1JPJA 2K6GA 4DLNA 1UDCA 3OH8A 1U0TA 3QIVA 5BV0A 4XX0B 1MIOA 1QV7A 2BI7A 2JAPA 4ODIA 4WZAA 2WVHA 1MH1A 4E1VA 4LC0A 4PS0A 3DTVD 4BECA 1G18A 4OYLA 5LQRA 3KJIA 4RHEA 3TSCA 1G8MA 4EF6A 1XMJA 3AEXA 2HQBA 2ZJ8A 5K3AA 3FPAA 5ETJA 1IDOA 4JJ7A 1FFSA 4MYCA 2GEBA 1SOVA 1ZI9A 2NOAA 3F7MA 4EP1A 3O1IC 4CL8A 4MUHA 1DQSA 1DUIA 5D3QA 1YI8A 3DYBA 4BL5A 5JSHA 3FH0A 1L0BA 4NDNE 4TLMB 1YQTA 2A9VA 1DHTA 3F4KA 3UWOA 3E22B 3K9GA 1WTCA 4HMPA 4PIPA 2XCUA 5AESA 1JXAA 1WHSB 5KAPA 5TSDA 1QRAA 1GTL1 4RVSA 4B45A 1Q3TA 3T35A 5KVCA 4XVQA 3AHHA 2CSUA 2HTFA 4MAMA 4QXQA 3VYRB 4D56A 3E3OA 4TTJA 1SD2A 2WSYB 5BPFA 5E38A 3F3MA 3DVAB 3SF8A 4IW3B 1E2UA 2MYNA 2WOJA 4BLSA 1PLKA 2BZ1A 4B3IA 2QLNA 3O8CA 1PGJA 2F1RA 3K9WA 3NC0C 4C5CA 4F3RA 1EX9A 2AVNA 3BTVA 1A77A 1RPAA 3A2LA 5BURA 5KSYA 2R6CA 1TEVA 4E2FA 2R00A 4UHFA 3GC6A 2IP2A 4IINA 2IEBA 1K92A 3WGYA 3LPAA 1U2PA 1A5SB 1Q7GA 2COEA 4NDZA 3IIIA 4RCYA 4B8ZA 2AV6A 1VDMA 1PT9A 2Q3CA 4ML3A 2A9KA 4GDFA 3CO5A 4PWYA 4WN3A 2ZRFA 3AR7A 1LRKA 3DBLA 4PCUA 5E1OA 3VPCA 3TKAA 3FZNA 1DIBA 3CEMA 2Q7OE 3EGCA 1EBFA 1R27A 2BE7A 2Q8QA 2VRNA 2NG1A 3B3QA 2P0YA 4CU2A 3U4HA 1YA8A 5CLHA 1SIUA 3DT8A 2QT0A 1E69A 1X7YB 5L51A 4YA6A 3DE3X 4B6SA 1VGRA 4QXPA 3LDFA 2CBZA 3PL1A 3BH7A 1FC0A 4JCCA 1KDZA 5CIWA 1UOPA 2NO5A 3UA3A 3HV0A 5DGIA 4X0EA 2V7GA 4KMMA 3BL5A 2E5FA 4LJ9A 4URVR 3DLIA 2JIBA 4E5UA 4GKJB 4MR7B 1Q74A 4K40A 2X6TA 5ALPA 3CRZA 4MOWA 3VPDA 2JVJA 3JQPA 4G8DA 2VRCA 5BN4B 1J0EA 4L4UA 2BYTA 1A98A 2JLZA 1ECCA 1BWRA 1V1MA 4TZ0A 1KI4A 2VJNA 1VBFA 3HXLA 4BGEA 2R1VB 4J8PA 4CQLB 4PNEA 1IUKA 5E4YA 4CLOB 3PUZA 4OFXA 2G9RA 3NTRA 4G8BA 3TLGB 2C2YA 2FN3A 5CHEA 1DMRA 3F6YA 5M04A 4IHJB 4TPKA 2J7PD 1N7HA 1XXHE 2JJ1D 3PFCA 3OX1A 4ZAXA 2QUHA 2VH5R 5HCNA 2ONKA 3O0TA 4Z4EA 1YQXA 3IQHX 3VJLA 3JWEA 2EFGA 5CB4B 2WILA 2Y0PA 3KYJB 1U2DC 2PLRA 3DDUA 4P9NA 2JLVA 1ZKDA 2FNAA 4CL3A 2HA4A 3GLHB 1HZZA 1C3LA 2F2TA 2OQ2A 2WT8A 5C1IA 3NCTA 1M1YA 2N1BA 5K0LA 3AHEA 1RQLA 3G2KA 3GX1A 5ICFA 3BA1A 1GP2A 1DVRA 3KL2A 2VA9A 3L7CA 3ESZA 2FF5A 3OTWA 5EQDA 4F9TA 5I47A 1USGA 3T5AA 2J9FA 4N18A 3HCWA 2I2DA 1GTVA 3ZE6A 4LY9A 2R00C 3BWMA 4PRLA 3BZWA 4ZI5A 1KI6B 3MTAA 4AUKA 3H0CA 4ZZ2A 3ER6A 1P80A 1C9NA 4Q4HA 4TV9B 2OLEA 2P7HA 1JLHA 3ITNA 4EVSA 1HE5A 5TMBA 3LQ1A 3VV3A 2XEDA 3U7QB 3IHKA 4KR3A 4YAOA 2ZUUA 4LWQA 3SYNA 3WFZA 4JDPA 3ABIA 1MX3A 1AK2A 1KSFX 3GGCA 4GDMA 2WINI 5K3OA 1NONA 1RIIA 4GWGA 1K63A 4L8VA 5CW2A 1JYSA 4WCFC 3HB5X 1JAIA 2I67A 4B40A 4ID9A 1R00A 1DDIA 1T9ZA 1WDLA 3K35A 2PRIA 2A7QA 4IIEA 4IH4A 5A6VA 2O14A 1FQOA 3LT5A 4L0CA 3TBFA 4AFNA 5JNRA 1YA4A 3MJSA 1EFDN 3CW9A 4FS3A 4KGXA 4K9NA 1PTKA 1W5AA 1PGOA 2RJ3A 3Q0IA 2W8ZA 4NSNA 4KNVA 4YRQA 5DNUA 3ROTA 3V2UA 4HWKA 3WLSA 4GR4A 4BVAA 2BDUA 4D4MA 3PFIA 4GM1A 4NENB 1R5JA 1KDPA 1SWWA 3QYJA 4RD1A 4MSUA 5CBPA 1IOWA 3LE8A 4DADA 2QJFA 1UIMA 3QJGA 4EUHA 1YOBA 3DMDA 3EHDA 4CCSA 1SUPA 4IXTA 4WDQA 5EWLA 4N0MA 1J5PA 3P5BA 2WU0A 4E70A 3BN3A 4TRMA 1M2FA 3DW3X 3WNZA 2XDAA 3C4JA 1YHZA 2AZDA 2ZJ4A 4C03A 1E1RD 6ADHA 2NUTA 4XR4A 2ZRDA 3KQPA 3UAVA 3BG5A 4XVCA 1OIVA 3O5AA 1EDOA 2Q5QA 5IXJA 4WOKA 4YRGA 3E53A 4FT4A 4YAJA 4DIUA 2PUWA 4U0JA 4DILA 2FOXA 5AH0A 1E9SA 4DUGA 5CJPA 3CPHA 1TJ4A 4QDUA 3GJXC 3KOYA 2WG0A 3H4IA 3VO8A 1G3RA 1HZZC 3VO1A 2NV6A 3FWYA 3X44A 2O7RA 2BBWA 4YXWD 5JQGF 2WB4A 4ZGGA 1J90A 4NZOA 4ZT4A 3OUTA 1H3NA 1CRZA 3ONFA 1N2CA 2AXEA 3IJPA 1G5TA 4AP6A 1DRKA 1HX7A 1FXWA 5IYZA 1XTQA 3Q10A 1DUSA 1S4QA 1OH6A 1Z62A 1AE1A 2B98A 3C6BA 2P6UA 1P33A 1UK8A 2GCNA 1OAAA 2HMUA 1P1FA 2WJAA 3PK0A 3QJYA 4IFTA 4LOHA 1SJ9A 4CXMA 3B36A 1JHOA 2JJ2D 4J0DA 5DYWA 2O0MA 3TQOA 1LV8A 2OUKA 4P2BA 4RHCA 4Q3LA 1CQZA 1YB6A 4KXVA 1Z6ZA 2YWJA 1W4AA 4IMRA 2YVLA 3R8CA 3GRRA 4C3UA 5F3WB 1JHUA 3NHYA 3FPGA 1MR3F 2QPLA 5BP7A 2W4IA 3G5TA 1MU0A 4HXYA 3WKCA 3WLOA 4ZJUA 2P1RA 4IKPA 3DQQA 4ZHQB 3FYUC 3RYTC 2BV3A 3OQIB 5IT9A 1IHPA 3GHHA 4X3OA 5A02A 4RESA 5ESRA 2CHUA 1IB6A 3STWA 1CJBA 4UPVA 3WOHA 4BO2A 5HQTA 2ZBPA 3EZ2A 1NJ2A 2KX7A 3VC2A 2I6FA 3EMVA 2RGNA 2PBZA 2XB8A 2QLBA 4IQGA 1Z2PX 3V3KA 5IF9A 2NADA 4FHZA 4ESEA 3SOZA 1N9KA 1Z0KA 2V9PA 3K3PA 1CBUA 1Y1KE 3IYLW 3LVFO 4FGWA 4HH4A 5B3AA 1YFZA 4EA6A 1AV6A 3OU6A 4XYLA 2IOYA 1H8HD 3PZRA 1CS4C 4O2RA 4WK0B 4S24A 4RH3A 5JPIA 1ISJA 2VQFB 1MT3A 1AXRA 4GOMD 2IUTA 3L8EA 1QQ5A 4LJLA 1JT2A 3FAZA 4FYJA 4N82A 3N2ZB 2FQXA 3T12A 2IIBA 4BFLA 5IVHA 4JI3B 1BFDA 1SBHA 1XGKA 3EEIA 2FZCA 1YS7A 5SZIA 4I1SA 3ZDFA 3V8VA 1EWRA 2N9UA 1HE8B 4N5DA 5DVZA 4FDTA 4BNKA 4N9WA 5FHQA 1P18A 1CB0A 4LG1A 5JJCA 3UV3A 1JKJA 1OXBB 3EZLA 1PZFA 1E5XA 2P2NA 1C7QA 1XDZA 1WG8A 3TKYA 4J43A 2J5XA 5AD1A 3ZHCA 2P3QA 5I4CA 3MMNA 5EI5A 1V3TA 1RRPA 2F43B 3C7KA 3VHQA 2OE2A 4GL2A 1DE0A 4JS0A 1PFVA 4OLHA 1DC4A 2G1UA 1Q0UA 3LECA 4JR0A 3ZGNA 1NC3A 2QENA 3OFSA 1H66A 3ORYA 3LFUA 2XTZA 2HPHA 1KJYA 2ZE7A 3RANA 3CNHA 3QOFA 3UJ7A 3LA6A 3WS7A 3P9IA 2H4HA 2NAPA 4WJLA 4UQLA 5CIQA 3K4QA 3SXUA 2AMFA 1W4LA 3DD1A 2VWGA 3EAFA 5F35A 2D2EA 1QFSA 2VJMB 4Y2RA 1Z6TA 2IHNA 1S8NA 3NONA 3B5IA 1EEXB 4FDAA 4E7OA 2H8GA 5F2EA 3L8FA 4IV8A 3BKWA 4MRSA 1XD9A 5BN3B 2IW3A 3PQFA 2BM9A 1P81A 2BL4A 2Z5GA 5JEDA 1L5ZA 4NBSA 5A62A 5JSZA 1QIFA 2A67A 1GXSB 1SU8A 5A3QA 1YJQA 2QE7A 2OB2A 4DPMA 4ZKDA 4XIJA 3IMFA 4D4IA 1O4VA 1GZHB 4HDOB 3QVXA 2PX2A 3VDNB 5ILOA 2V6BA 4CKZA 1P60A 1P9LA 4DV5B 4QZVA 1PX2A 4UASA 1QR2A 4TMFA 1T3GA 4IHJF 1ZY2A 5ELMA 4L22A 2PIDA 3K5WA 2R7MA 5DCWA 3X1WA 4E21A 1RPZA 3H8SA 1ETUA 5BNIA 5CB4F 1LTQA 1REQA 2CLKB 3E03A 4ETMA 4S1TA 1LBEA 1RKQA 1XRRA 1RWVA 4I5GA 5GAJA 4PG5A 4HTFA 2YDYA 1I3OA 4FMBB 4C4PA 2C0CA 4QFDA 3WISA 3A0UA 3LY5A 4ZPJA 1NW3A 1LQTA 2LCFA 3UF0A 2DHQA 4OLFA 1VE3A 1Y1PA 2FE4A 2JB9A 4MVJE 4RH1A 3ZH9B 5AVWA 3L8HA 5EXXA 5KX5A 3SZ3A 1RXCA 1A04A 1NX6A 2VNAA 4AKHA 2CMFA 5JYBA 1SKYE 1EZZA 1R8JA 4ZCTA 2D7JA 4F04A 3A1CA 4Q1VA 3LWDA 4Q0MA 3O4FA 3IA2A 3IPLA 4QOFA 2VJLA 4TV9F 4LX8A 3EZXA 5CT5A 2PQ2A 3D4OA 4ZFNA 4NU0A 3D7LA 3KVOA 1NC1A 5EJ5A 2PMBA 2VTBA 2NNWB 4M8KA 4EQZA 4BLRA 1QK4A 5B5SA 3K0SA 4PTLA 4MA0A 2HU7A 4HLUA 3UATA 4DC9A 2P78A 2BCJQ 2GBFA 1AV7A 4O08A 3EIFA 2JDIA 1UEIA 3ZVNA 5BNFA 1JAZA 4ZVOA 3WLJA 2O2DA 2DG2A 2BKAA 2GB4A 1XMIA 1DO8A 3RK4A 2NSLA 4WN9A 1V3VA 1P75A 4BWYA 2H7YA 1M6VA 2X2FA 2QY6A 1K4MA 1UM9A 1R4AA 2QAGA 4NJMB 1OT3A 5A6SB 3UWMA 4A92A 3P4UA 3M9XA 1A4UA 2RK4A 1NT2A 3RYFB 1K7FB 4HYEA 2HWYA 3HN7A 3TUIC 2EVWX 2UKDA 4TTTS 5H7XA 3H4TA 1T5DX 4XDZA 2YDXA 2I03A 3WBKA 2HDOA 1DQPA 3UWPA 4FX2A 5B1HA 1FUIA 4MV5A 1F48A 4V0NA 3M5CA 1NP6A 2GZ3A 3OZBA 3TECE 1GPWB 3HFJA 1KJWA 5I9BA 2PUVA 3QFFA 5CVTA 3V8EA 1BGWA 4ND5A 5CFPA 2ECKA 4MYRA 5LIPA 5CP8A 4HEJA 1UZLA 2W37A 3DCIA 4EH1A 2I6QA 3FTPA 3OQPA 3V8NA 5B7PA 3DTVB 2PTGA 4QHYA 2H8KA 1O5OA 5A5DA 2ZQ5A 4L5IA 5F1KA 5LNK6 2V96A 4C6TB 1GWNA 3PL5A 1EQUA 2CDRA 4HDNA 4HTAA 4YRDA 2NSJA 3QX8A 1CR6A 2P9EA 3NFRA 4RVCA 3VC3A 4KLNA 2QU8A 1N3LA 4UAGA 3K96A 4X8OA 3D8TA 4KQHA 1G20E 4AN4A 5HKAA 4JGBA 5ELLA 3ZHQA 4LZWA 5MDHA 3SYTA 3AIIA 4B7AA 1L9KA 4YP6A 2RBEA 3FFXA 4R16A 1S96A 4J1QA 4IFIA 2H06A 2BKVA 2RGYA 1QLWA 4BE4A 3QV1A 4MLDA 4A2CA 1Q6YA 3V80A 1T26A 1ZH2A 2FR1A 4NS1A 1GLGA 1EX1A 3T0GA 2C5HA 3KV1A 4HD8A 2O4UX 5IC5A 1I7PA 1IM2A 1FFXA 1GUZA 3SSMA 3IT0A 1CQPA 1ZUWA 2NU7A 5COQA 3WWZA 4EF4A 1AKVA 1KDTA 3OWXA 4NJEA 4ZEOA 3LRPA 1ZITA 4Q01A 1AO0A 3FOWA 1S5PA 4XYEA 5HILA 1SUIA 2WVGA 2XHEA 2YJZA 4HLUC 2I4LA 2P7IA 3C5WP 4O4HA 4C3VA 4ZHQF 1PJCA 1ZJ5A 2GHIA 3UAZA 1KZ7B 4OQFA 4DV2B 1SNYA 2CFOA 1KYIA 4OXIA 3FVQA 1PQPA 5FOQA 3UFXB 3ND6A 1KPGA 3R5KA 4EB3A 1ODIA 1LTKA 4OV6B 4GGMX 2PA3A 2XDQB 2XKBA 1FRZA 1D6MA 4BAUA 4U7JA 1K8ZB 4MDEA 1XEXA 4BQEA 2C3UA 4FCWA 1XWWA 1G2IA 2R2GA 4WFQA 1MJ5A 3PJEA 4P4LA 2IK8A 5H0IA 3B6KA 3BJMA 5I5GA 3UT5B 3FYTA 3PR1A 1G55A 1QHSA 2Y1EA 2F3QA 2DZDA 2Z09A 1V7ZA 1ZD9A 2VHEA 1GZDA 3NJ8A 5K09A 5FV7A 2ECQA 3WL6A 3FIJA 5C8XA 1Y63A 1CR2A 1BO6A 4LVCA 2I9KA 1K5GA 2ONCA 4TLCA 2HSJA 4KQXA 2CKDA 3WYCA 4P6VF 1MQSA 3LT0A 3RGGA 5J43A 3HVJA 1J99A 4MRAA 4FK8A 3V4SA 4K6GA 3ZX5A 2XR1A 4U7WA 3H2JA 2QRUA 2D00A 3AP2A 1TRKA 1FYFA 1WCYA 1ZN7A 2I7TA 4HDMB 3WFJA 2D1FA 5CDUA 1X39A 3DE7X 2O0JA 4FYHA 4OQ4A 4QXOA 2ECFA 1UOOA 4IJVA 4XYBA 1IEVA 2R6FA 3HN2A 5JH7B 1BYIA 1VFNA 3JQAD 4MR9B 2ATIA 2O57A 3WGJA 4DA8A 3OQNA 2AE2A 4BPBA 3AVYA 1CW2B 4E46A 3FUXA 1O9HA 1W4CA 1ZI6A 4OXRA 4R8VA 1SIWA 4RMIA 1ONBA 2KI5A 3Q6IA 4HDCA 3TCKA 3THYA 1JHVA 3FIUA 5A4MS 1FDUA 4UVHA 1UAGA 4WVLA 4ZEMA 4UNPA 5CR9A 3BBPA 4HEHA 4BP9A 1CZOA 3WXMA 4BYMA 4ZMBA 4BQFA 4ZVRA 1T2AA 5FUYA 1IDN1 4FLMA 1LBTA 3FNGA 3QA9A 5KTSA 2ZIVB 2PT9A 3WAGA 1WW3A 4BNGA 1SR8A 1UBCA 4LDZA 2K4MA 2Q9CA 1UPUA 2AXQA 1J21A 4KI0A 3S0JA 3KZOA 2BJWA 4K87A 5J40A 3KJQA 1WSDA 4RTRA 1WXWA 3L1VA 3QE2A 1QS0B 4GGOA 2JHPA 4GSYA 4CM4B 3ITEA 2R7LA 2G1JA 2RHJA 2GA8A 4YASA 4GH5A 4XB1A 2CUNA 2NPOA 2VK4A 5E1DA 3VAAA 1P91A 2IOHA 4QOSA 2BAGA 2DU8A 3F96A 3AEQA 3Q72A 4PWZA 2GRJA 2NTEA 4R1PA 5IAEA 1SBCA 2CLEB 2OL4A 2NXNA 4NYMR 2ZB7A 4D96A 4MI3A 3S2FA 3E9CA 5HKKD 5KU7A 1D1SA 3LPMA 3SQWA 3VV2A 1XVTA 1YAHA 4V1CI 1ZNYA 1LLCA 3B6IA 4Y30A 1L7PA 5AK6A 5DTJA 3M1LA 1PE0A 3B5JA 2JAWA 1PEYA 3A9TA 1IZ9A 4IQ0A 1YNSA 5EVJA 4BNDA 1OILA 1ZYUA 5KYWB 2Q8PA 4F3KA 4E32A 5TIIA 2A3RA 3OY2A 2X0IA 3S70A 1OREA 1FW6A 4KL8S 2XNKA 3MJ4A 5CT9A 2FWMX 1FSFA 3TSOA 3O3CA 4LMAA 3KQYA 2P9ZA 1PR4A 5JECA 1M6WA 3IEVA 4UBJA 3Q0TA 1J8QA 5TQVA 7AT1A 1UPFA 4I50B 2RGUA 4YUAA 1XB2A 1EJ0A 1LA2A 2R1TA 4NCKA 2AK2A 4LOIA 3W8DA 3IAM6 3IURA 1A69A 3VFDA 1E9EA 1XBTA 4JP2A 4UNRA 2GCPA 4MCJA 3D9QX 3AWDA 3UV6A 2QGFA 2J41A 3T9FA 1KAMA 4YT4A 1IBLB 2FEPA 2VXBA 2Q3LA 2C9DA 2EJBA 1UP4A 2LVBA 1T4DA 5H4HA 4BTEA 4E5MA 2HR1A 1F1JA 1YQQA 2J0EA 4LQLA 4N47A 5E1MA 2BKEA 1U4NA 1UCFA 1W35A 2VHXA 3GNTA 3KTOA 2OK8A 2RI6A 4TM7A 4ZI7B 5BNZA 1Y8QA 3IR5A 2DHRA 2H2AA 3ED1A 3RFTA 4CKEA 1MF7A 3GD5A 1TF7A 3EIWA 3CV3A 1XQWA 4IYRA 4UNQA 4I9FA 3QHAA 3WTCA 1P1KA 3DBOB 4WVFA 2GKOA 4B3MB 1HEUA 2GEVA 3IX7A 4G1VA 5J63A 3HP4A 2GN4A 4K0RA 4X20A 5GP1A 3ZHXA 5DX8A 4FQ5A 1OB2A 5D3KA 3QYPA 2IYUA 3WY9A 2XT0A 4BUJA 2FPLA 5JROA 3F8SA 2A57A 1D7OA 2GGSA 4MP6A 2E37A 4OP3A 3ETHA 1AGRA 5I7OA 1TT7A 4HRAA 2BW0A 5CA0B 5AJWA 3TLKA 4M98A 1U6KA 2VHTA 5KQSA 1ZJ6A 4MRMA 1P2VA 3L4BA 2REOA 3QNMA 1Y37A 2AOVA 2V03A 3BWBA 3OCWA 1P7WA 1YQWA 5TVGA 1TUGA 3KJGA 1ICIA 1TU3A 2D8MA 3CF4A 3TOVA 5DP1A 3AW9A 1TO2E 3C48A 1RAFA 2CMGA 3KB1A 1OKKD 1W88A 3FGPA 4G09A 1I2DA 2JFZA 2P69A 4MA5A 1V8FA 4PF1A 3ZDAA 1IY0A 4ZVKA 5EJ7A 3HUTA 3JVVA 2ACWA 1AY0A 3PPWA 4GZ3A 4LV8B 3HVUA 3WG9A 3WJ2A 5GOTA 3D7SA 1DKQA 3LY7A 1Q7CA 3LQKA 3BIFA 5F2NA 1WZUA 2QTZA 3HMKA 3FHCB 3NDRA 4AU1A 2ZKLA 4AY3A 3SF8B 5GIPE 3R0ZA 4FYYA 2C2MA 4UAUA 3WRYC 2CN1A 1SBZA 1GPBA 3UHJA 3CA8A 2B6HA 4EA8A 3X1MA 1L7DA 1XJWA 4G84A 3AGPA 1N2IA 1RXIA 1PV1A 4DYHA 2AD1A 1TVEA 3N2NA 5ICEA 2GAAA 2HADA 2A9PA 2ZBVA 2YZKA 3DF9A 3G7UA 3NPAA 3VMMA 4ARBA 2V5UA 4S1PA 1U0JA 4YDRA 2P9CA 4LYFA 3HB0A 4DC0A 2OFXA 4HPWA 3T3GA 4ZICA 1GVNB 1M8PA 2IBSA 1HTWA 3LW8A 2PFSA 2IF2A 5EIAA 5T4EA 2RB5A 2GVZC 3MG9A 4MQLA 3KQOA 1T3ZA 4YMVA 4OATA 2L82A 5ELXA 4WCFB 5D5HA 5E8JA 1XZCA 1CFJA 4RPCA 1MC4A 1MJGA 4GPBA 2LW7A 5FPTA 4IIGA 4OHFA 5H02A 3KAQA 2QORA 4KJXA 4D79A 2GVNA 3NC4A 4R2KA 2K5UA 4KXMA 2J48A 2NZXA 4IH1A 4EOGA 5IZCA 3CVYA 3CLRC 4S05A 2XB4A 4W9MC 4Q9HA 4DFDA 2CMKA 1WQ3A 4HHEA 4QPDA 3E18A 1QU3A 1TYZA 2NGRA 4PCAA 5CJJA 2WYHA 3ZTYA 2JFFA 4EM6A 7MDHA 1AKRA 4WLOA 3RSFA 4OU5A 1CDZA 1NW5A 5FLYA 1CVLA 2VH1A 3DFKA 3FTNA 1YZTA 3DOUA 2JCVA 3HU3A 4H4CA 4PSCA 3RBVA 3WNBA 2Q6IA 4JLDA 3K1ZA 4F6LA 5HQ3A 3AW8A 1CVIA 1L4GA 4FI3C 4HOYA 3N7AA 1YB7A 2EEPA 1JSZA 4FHEA 1PZMA 4ZOLB 4QA9A 2H1RA 3UFBA 1ZSYA 1PG5A 1NI4B 2ERYA 4ER0A 3MRSA 3MZ0A 4N7MA 2R2AA 4WERA 1XQYA 1YH3A 1RJDA 2CD7A 3G8YA 4G0XA 1U3GA 3JQBA 2J3JA 1H2HA 2WJYA 3L04A 3W8EA 1MFZA 4CM8B 2BZSA 4YAWA 4FFBA 5H68A 3IOYA 3G8DA 1L5LA 4KE7A 5JH7F 3GT0A 2J3LA 2QP4A 4XD7A 5PGMA 1SD1A 1Z88A 3LNTA 4QPCA 3V8BA 3LY8A 2G72A 3JQRA 3P0FA 3PDIA 4U4AA 2MOKA 6REQB 2CXUA 1CCWA 2C07A 1CNEA 2Y66A 1FSGA 4EFLA 4LQCA 1QJCA 3SE0A 2B3DA 3MWKA 2JG3A 3OSUA 4QT0A 3H2SA 4YMSA 1XO1A 3VSCA 4F9GA 4QJ4A 2J9FB 3R9KA 3IDFA 1H0HA 1YCHA 1E66A 1C9MA 1I6MA 4OGGA 1GNRA 2BUAA 3KUKA 4R01A 1SUWA 1WVMA 4V3CA 1JIXA 3SXJA 2C5EA 3OF3A 5JW6A 1KARA 1G3MA 4HUTA 1OI2A 4H7HA 1XALA 4II7A 3AB7A 3AONB 3LUPA 3RF6A 5HJ5A 2VNIA 4RTSA 3CH5A 3MILA 2C99A 2Y92A 1TYCA 1Q0RA 3CR7A 5ADUS 1H8EA 2MMGA 1C9DB 1MC5A 1XU9A 2PZBA 1RFLA 1CQIA 1P19A 3ROKA 1WKVA 3II6X 4W5QA 1AS0A 2P9JA 1BE8A 3U26A 4BNJA 3NVMB 3FYUB 1GNTA 1XVIA 4IQ8A 4O5AA 1EFHA 2VPQA 2H16A 5CG1A 3VISA 1OZAA 3TEJA 5ILGA 1T6ZA 1SRRA 4ARZA 2O8CA 1PJAA 1E4YA 5IZCC 2D7CA 1G2OA 5JARA 2ECPA 1CHDA 1FF9A 1OWNA 2RGGA 1XHLA 3R4CA 4LDRA 1M2WA 1XMXA 1IN8A 1F2UB 2Q5OA 2HYDA 2WPDD 3OZUA 1TRHA 1SCBA 4IXWA 3MJTA 2R751 3HCOA 4AMVA 4BDSA 5KYYA 1AKYA 2ADFA 3FCSB 2EW1A 3KB2A 1Q3KA 2FLKA 2I66A 2ZI3A 2Z1DA 3U44A 1N2GA 1G5HA 3GEPA 5DIZA 5T4FA 3USES 1XTJA 3OMXA 3GLIA 3KXIA 1J0BA 3KUDA 1UMCA 2QG9A 4FOOA 3K9QO 4YBRA 1M1UA 4MK4A 5L4SA 4EI7A 3OEYA 4IXMA 3IE1A 1TK2A 1BYUA 1ZM9A 4TL8A 5CCBA 1XAJA 2C4HA 5JFOA 1XVVA 2ZTLA 4QEZA 1II8A 4Q3AA 2OMEA 4RVOA 3JQBC 2NUTB 1HOXA 3CLRD 3K70C 2RBKA 4KIFA 3ZXIA 3BL8A 2FW1A 4RETA 2FKAA 4JC0A 4DCNA 1BW9A 4MITA 1BQ3A 2XSZA 3L1UA 4KGZA 3LCCA 4RTMA 2XA2A 2CE7A 5ADHA 3CZMA 4KFCA 4MX8A 4DQ0A 1MOPA 4ZI7F 1HNXB 3PXDA 1JU3A 5GIOE 4E94A 2ZUSA 4IXDA 5CURA 3FR8A 4WCVA 1EDDA 1N2CB 3NYQA 1PJ3A 1TVMA 2F48A 3FVVA 2NXEA 2AN4A 4E15A 1ZD2P 3L7KA 2IV3A 4A8PA 4CLEA 4UZEA 5TPZA 1L5OA 3D6AA 3PKJA 1CHNA 1I6LA 4TWZA 5IRCD 3DP7A 4Y18A 3DO6A 2ZOSA 4ZV9A 1ZL2A 2Q2OA 1BAPA 3TN7A 3WGMA 2X1LA 1Y8CA 5DF1A 5IP5A 3AMVA 4N9QA 1UZMA 2I4TA 4BKUA 1ZRMA 3LI2A 4UW9A 4OHCA 2WT9A 3R5XA 2I5PO 3EQ2A 2AJCA 4WINA 3GN1A 4H3KB 1BX0A 4RKEA 5ALJA 4CEIB 5FOWA 1EUDA 4C08A 1BEUB 3E2IA 4KTTE 3TM5A 2QL6A 3IKLA 3CMMA 4D82A 4ZIRB 2Q4OA 1QZTA 5K0ZA 1IU9A 2YJ4A 3QF4A 2P4EA 2VQ3A 5D7BA 5G4KA 2PN1A 2QN3A 1EDZA 3D6JA 4PQGA 2D3WA 4EO9A 5LVAA 2FPMA 2W2VA 3BS4A 3RVLA 4IDBA 3SLGA 4YRBA 4CTNA 2NXCA 4OQEA 1OX6A 1THTA 1Z73A 3H8JA 2PGAA 5JLAA 3QI2A 1B2LA 3KLOA 1RQ2A 1XKQA 4D0LB 2A5DA 3CR8A 1B23P 5FR2A 4ZDJA 3DL0A 3OAAD 3RFUA 3TIFA 4G0OA 2OFPA 2VXCA 3DZHA 2BR4A 5FR1A 3DAFA 3UGQA 4BMSA 4JK3A 1VIMA 4Y6QA 1RQGA 4ZCSA 1I10A 4G1MB 1FP6A 4U6SA 3K20A 3ZBPA 2EZ9A 3Q3CA 3GJ8A 4FNMA 3GLGE 4NEHB 4REMA 3D4PA 4DGQA 4M9XA 5LBUA 1FQWA 2HU8A 4RZ3A 3TW8B 3KKKA 5AKEA 3D3EA 4MQFA 1IG3A 3NFYA 1TEZA 3BOSA 1JBKA 1M6YA 1UANA 1R0BA 3PE3A 5CJ2A 2PYIA 2H5JA 3BTUA 1GL6A 5C31A 3PFNA 1RQNA 1JKJB 2ISCA 5AIAA 4ES6A 2HT1A 3FNFA 4HADA 3WGLA 1C7FA 3QTTA 3UVEA 5KSZA 2WUWE 1KI2A 2ZSJA 3H0KA 1NXPA 1PP4A 2EJUA 3A1DA 4N5MA 1NBOA 4B3BA 1T3LA 4BN4A 4MQ6A 1ZRSA 1GGFA 3L0SA 2FFJA 2I0FA 4ZYZA 1JAXA 3ZD9A 1AQYA 1JA9A 1KBOA 4BO0A 4G65A 3O3MB 1VKNA 5D84A 3DTTA 1KC1A 1N2JA 1VHWA 2A1UA 3EZ9A 5GTDA 2V7EA 3QLJA 2VHUA 3DAHA 1RYEA 1CY6A 2QW0X 3UHOA 1FMFA 1KEEB 4XVRA 1JLSA 3IV6A 1QLHA 5IJAA 2Q1SA 3JQAB 2XRMA 4PVCA 4HQ0A 1GR1A 3MT0A 3VRHA 4BP1A 4U7GA 2NUAA 1TGYA 3MIZA 1P2GA 3E1KA 5EKDA 3M6XA 1E1KA 4OK6A 4N49A 2PL1A 2ZAMA 3IXMA 3BFXA 3KX2A 2BHSA 4F4JA 1USWA 3GLRA 2Y27A 4E11A 4IS2A 1GTMA 2Z56A 4AKSA 2H5EA 1EK5A 2ZAYA 1EFCA 4DA7A 1FTQA 1MP0A 1O08A 3HRIA 2EL9A 3M6FA 5IASA 4N5NA 1FFGA 1ECFA 1U3UA 3E35A 2QN8A 5B1YA 1N3IA 3DMFA 5SZKB 2YQ5A 2YVQA 2B92A 4EEXA 3R9WA 2WFAA 4PGHA 1R0SA 1IUNA 1C30B 2PMKA 3DNMA 3F6BX 3PJFA 4M0KA 3JAWA 4X3CA 5SYMA 5JI2E 2P79A 2FX5A 2YRWA 4KVAA 3IAM1 4L4SA 4X7MA 3WL5A 3AY6A 3OWHA 5FNZA 3VO9A 3B3GA 4WY8A 3LF2A 2FUCA 3KM0A 5LR6A 3HDJA 5TARA 4GC5A 4JUAA 3ZEIA 3SC6A 1LJUA 2OCIA 1NBHA 3WBFA 3W3ZB 4DR7B 2IEZA 2YJGA 5CNJA 3M81A 2FPIA 4DUPA 5CB6A 2CLSA 2CVFA 3CNQS 1XNJA 1Z12A 2GDZA 4I55A 4Q3BA 3ZE7A 4DA6A 1D2HA 1OFIA 1ADGA 2XUIA 1GZ7A 4J0IA 4Q3DA 3AKZA 3RB8A 1R2QA 4MWGA 1T2FA 1Y3HA 4UD2A 1UH5A 2G1KA 1VBKA 2WAXA 3PQ8A 4JUDX 3MK31 4QHTA 4FR2A 1JA0A 2CXPA 3ZHBA 1OT5A 1H85A 2VNKA 3K73O 4W9NA 1WCV1 5AVTA 5F73A 4FFRA 1Q0TA 2C54A 4JQOA 1VJRA 2G28A 3DBRA 2ATEA 3G2IA 2AF3C 2CC2A 2RHGB 2M6LA 4NPHA 4LI3X 3ANTA 3T9CA 5KB3A 5JXGA 4OQDA 1FDWA 1OHHD 2LZ0A 3L40A 2ZQZA 4MYTA 3NS7A 8OHMA 1T4CB 4KDRA 3LX8A 1U2EA 2NQTA 1XQVA 1SA0B 1DXYA 1L4KA 1L4NA 3AJAA 3JD1A 1E63A 1TA9A 4N41A 4WN9B 5I8WA 1YIOA 1G9TA 2RH8A 3MWLA 3TWOA 1I5RA 1UBJS 4TOIA 3UMBA 4KQMA 1B73A 4XRGA 4CL2A 5TPWA 3KKLA 1OYYA 7ABPA 3TPZA 5KKAA 3CX8A 3UH1A 5I7FA 4G1UC 5AUOB 3K9LA 3NPMA 1ZS9A 1M7GA 2J7KA 1YULA 1L7EA 4AZ3A 2MYPA 4PC6A 3HABA 5EINA 3BMOB 2XOEA 5D00A 3EGOA 2DULA 4DSNA 3KR1A 2BMJA 1N3YA 4TV8B 4BNYA 1MHTA 4GSKA 1UBTS 1SQ6A 2NU6B 3GFPA 5KYTA 1RXYA 1E3DA 1WXQA 2Z6AA 4UMFA 4IO0A 2WUVA 2QVGA 3WLRA 2IW1A 5H80A 2AK3A 2A7XA 1L8XA 1E9DA 2HC9A 2RONA 3GEMA 4JP8A 3LBYA 2G9NA 3JTEA 1C4KA 1UMDA 3CUEF 1A8SA 1XZLA 1G3IA 1W1UA 1C7JA 4G63A 2X5OA 1Z82A 5F21A 3TBKA 3L4KA 4I46A 2A0UA 3AJDA 1C3XA 1ZD3A 2B61A 4BU1A 2IS4A 4BKQA 4L4RA 1ZG3A 1KQGA 2EFEB 4WW0A 2XE6A 1H1DA 4EKYA 5CH5A 4M0DA 5HX7A 2R8OA 1N1EA 1OD6A 1LSSA 1I8TA 1WP9A 1D1TA 1PT7A 2RC5A 2XHZA 3D8SA 5CH3A 2C7GA 4BRWA 4OJTA 3P2JA 5JXWA 2QUBA 3C1UA 5REQA 2BTQB 4GF5A 4E6EA 1FFXB 1RI5A 5JASA 4MUMA 2GKSA 2BKXA 3IELA 4KMSA 4JB0A 1ACMA 4NJEB 3U48A 4W9NC 4EY4A 3DL4A 3H5VA 2F1IA 2BTOA 1CP3A 2CK3A 3AY3A 1EXVA 4HLCA 4B5LA 3L49A 4BVGA 5BWBA 4HZUA 2O8VA 4LN1A 1PR1A 2NPFA 3CVUA 4GX5A 4JJ8A 4X1YA 5C4GB 3OFND 3ZJUA 1O0SA 2Z2JA 1TA4A 2FMHA 3NH6A 2BEWA 2HHJA 2XA9A 5JY6A 1GU7A 5KNBH 3U9TA 1Z56C 3PE6A 5TXGA 3GA7A 1Z63A 1ENPA 1FDSA 2YH2A 3GEBA 4JN6B 1P0QA 2AQIA 5TGDA 4ENTA 2Q5JA 1ADFA 1WV0A 2AUTA 1YZNA 2XMZA 3HBJA 1YASA 3KHKA 3EXEA 3BEDA 3SYLA 2B69A 4XWYA 3KQQA 1QQ6A 2MCFA 3LBAA 4FFPA 2EAUA 1X19A 4N3BA 1J70A 5EFOA 4E5SA 1KJJA 1UBUS 3LD9A 4WPGA 1UXJA 4YCDA 4F72A 3GJ5A 5H70A 4K3VA 3S8YA 4HP8A 1EM6A 2ENUA 2XODA 5AI9A 3RSCA 1XA4A 3QX3A 2PSJA 4JJIA 4J3JA 4LE1A 4E22A 1ODLA 5F9HA 3GD7A 1E9RA 5EP4A 2JAXA 5FEMA 2RGDA 4GBGA 1GZVA 2EQAA 1SKMA 2ZU0C 3M3HA 3HCFA 5HF8A 4WKGA 4DRXA 2Q2WA 1RP1A 3RTEA 1BEEA 4IV5A 3VAYA 3P2KA 2XWJI 3FKJA 3C43A 1T4MA 2F9MA 3LFHA 2JH3A 3I58A 5J58A 3DS8A 3GUYA 1CIJA 1QP4A 1OX5A 1WUIS 3PUXA 5F52A 1J2YA 2C7VA 2HLPA 2WMYA 4AIIA 4RULA 3M33A 4MJ7A 4B3DA 4OSEA 3THYB 2AR7A 3FMPB 2JEYA 3KAPA 5HUJA 5AHRA 2OHGA 3HJUA 4FBLA 4Z86A 5FUXA 3C39A 4J0JA 3LKVA 5T64A 2FK7A 3LO8A 3PXXA 1NR5A 4RCVA 2VQ6A 4E13A 3RYIB 2VYCA 5BN5A 4RTJA 3D6VA 1PZGA 4ZXPA 5LIRA 4Z9XA 1FJ2A 4FIDA 2O8BA 1WZIA 2Y77A 3DGFC 4DABA 4CIXA 2FJPA 2O7QA 4LGMA 1X13A 2EHJA 4MB2A 5CVVA 3RQSA 1EUYA 3NAZA 1IJKA 1N2BA 1O77A 2P9FA 1T1GA 4V03A 1GSOA 1MUUA 1FDVA 4LF8B 1V8DA 2FX2A 4P93A 1M2HA 2OM6A 2WMOB 3HM2A 4MDHA 5A7HA 1DINA 1KDOA 3DFMA 3KVNA 2EFCB 1O95A 1YRWA 4MW6A 2DTDA 1W49A 2JAQA 1DKMA 3AEQB 3CT6A 2WUDA 4IIXA 4JI1B 1RXUA 4L9WA 1Y4AE 3QBEA 3QFRA 4OAQA 1AM4D 2WM8A 4H17A 1UP7A 3MRVA 4BQOA 5AW1A 2IBTA 3WYBA 1TZ2A 2Y9MB 3ONEA 4ZXFA 1LC0A 5LB4A 4EG0A 1O5TA 4WJKB 1RXWA 5KMGB 4U2EA 3RS4A 4HX5A 1GGHA 1XKTA 3IOMA 3AEKB 5FTWA 2PH1A 1VKZA 3EAGA 4N54A 4HDRA 4Q82A 4IZIA 4BNDB 5I9NA 2H1HA 3OOSA 3OKFA 3TZKA 3GELA 3OF5A 3RIHA 5HZGA 3A4MA 3A6DA 2YFHA 2PWZA 2D59A 1JG6A 3TZLA 5KX5F 4M86A 5DHRA 2ONZA 1BE6A 3R5SA 5KOJA 2HBYA 3L79A 1ISFA 1UXGA 4DDUA 3ECAA 1HYQA 1KMCA 3SIWA 3WSWA 1CS0B 1XP5A 2GK4A 4ZAGA 5EYPA 1MQ9A 1M1XB 1KJIA 3D7RA 3IALA 1N5IA 5HTKA 4XTCS 3ZTWA 4UZSA 3GN2A 2C94A 4KQFA 4YUXA 4FW8A 1SHZA 3OPQA 4M0EA 4AI6A 1QIHA 1R0YA 3ZPXA 4JC4A 2CUZA 1DBRA 1W76A 1DJOA 2WFMA 4OM8A 1U8XX 3PXAA 3KQKA 4AK9A 2B7BA 1V26A 3DH0A 5JHGB 2HJ9A 1QU2A 1PX0A 1I4LD 4S3MA 1D6SA 1L5GB 4CKEB 5FBKA 4LJ4A 4G5QA 4DQDA 3MMZA 4EQ6A 3JVEA 3LBNA 3SLKA 4ENUA 3GB9A 4B3HA 4EMSA 5K3FA 2F8MA 4RO0A 3RSLA 5KTYA 1W0KD 1POXA 4TQGA 2P9TA 3F3YA 1MO6A 1I4EB 3E7WA 5CHYA 2PDAA 2BF4A 1TQ4A 5E6UB 3QNWA 4MR8A 1T9KA 3N2EA 4RDXA 1QJ4A 1QHYA 1A88A 1T36A 1S0UA 4CM5A 1RCUA 4V0KA 5EHXA 3FGZA 1WDKA 3VVCA 5KWSA 1X74A 2NTNA 4MRMB 2QXTA 3PEFA 4GAEA 4Y2QA 1BXZA 1CERA 3H13A 1IB0A 1JR3E 4GP9A 4RD2A 4MKGA 3T1VA 3G5AA 1LC3A 1O4WA 4W1SA 1ZK0A 4RQBA 1ZOSA 4TV8F 3VU0A 4A6PA 3G2PA 2HA5A 5DN9A 2DP4E 3R7FA 4HNAA 3UAOA 1MO5A 5BW6B 3OEWA 1I32A 1Y0BA 1E9BA 1W5TA 3CBGA 5ER6A 5KUTA 3JU3A 3S40A 4RSGA 1X80A 1Q3HA 4PTYA 1H93A 1P5ZB 2AYXA 1HY3A 2PGDA 1YR1A 5E9WA 3T9DA 1XEFA 1FRNA 2BN4A 3MS4A 1VCMA 1DOZA 5LMZA 1ST3A 1ZUIA 4AKGA 4PCVA 1SB8A 4IX1A 3AB3A 3PD0A 5D86A 3MRXA 2QNIA 4FEYA 3WMRA 3KZKA 2BMEA 3CGWA 3N2YA 1LW7A 3DBIA 4J0KA 2ASEA 3F0TA 2ODWA 3FTQA 4JWKA 4L6IA 3T7AA 4QATA 2VXYA 2R62A 2VCEA 3OM8A 3ESYA 2R1UA 3FDIA 2O9JA 3L07A 3E0XA 3MTJA 2VWQA 3QBVA 3ZS8A 5ITVA 1KQ3A 2AGVA 4ZTBA 2OCDA 2IPXA 1VHJA 3GOHA 3T7SA 4D99A 4EKGA 1KYQA 5M2QA 4OBEA 1VIVA 4F3TA 3AXTA 3C74A 1C29B 3I8SA 3RU7A 4REQA 3DOJA 2CYBA 4RLFA 2E85A 5BYAA 2G76A 1Z0ZA 2HEGA 3ILVA 3QPCA 4B6OA 4BEVA 1TK9A 1I2BA 2JFWA 2VF4X 3CCCA 1XYYA 4LYEA 3R8FA 4JX8A 1FUYB 3FCYA 3F4LA 5FD8A 4EGJA 3YASA 2HF8A 3R20A 3V4ZA 3QE0A 2DB3A 4HQLA 3AFMA 1I4OA 1X77A 1YD7A 5AOBA 4C7OA 4Y0NA 5LXTB 2ZUEA 1KTIA 3MUFA 3TIVA 1P0MA 4HAYA 2GSDA 5DM70 1QHFA 1ZX1A 4KAAA 2V7BA 1E9CA 4X6UA 5H9VA 3OIFA 2PSHA 5JSKA 4F84A 3CTMA 1O9BA 1W4RA 2JGIA 2Y05A 3K1JA 1I1NA 3ZLVA 4AJLA 5HQ3B 1E61A 1SELA 1T35A 3U2QA 4CIDA 1J8DA 2WF5A 3CEAA 2QD3A 2PCLA 4D92A 4AKEA 3ONDA 1AXGA 3L5KA 2HV8A 1XZNA 3MBKA 2YBEA 4MV6A 3UNXA 2X4DA 3VU9B 3QEMB 5IPFA 1T0UA 1HDGO 2DUJA 4FCTA 2AI1A 3FA2A 3QZUA 3K70B 1YZHA 2HF2A 3U16A 2R84A 2V7TA 3P9ZA 4GOOD 4QU0A 4Y98A 1DMSA 3BCHA 1QKJA 4GUAA 4MB6A 4UATA 2AF4C 4OQZA 3CH4B 1QHIA 1VCNA 3BJIC 3GRAA 3GUCA 2P90A 3H18A 3TLZA 4Q16A 2CD9A 3L06A 1UL1X 3PXBA 1CZKA 2OLKA 1UWCA 3KDPA 5KYKA 4RTKA 1WA5A 3NCHA 4N5IX 3SKVA 3WDSA 3ZQ6A 5BSHA 4WRRA 2IX3A 1N5KA 5IAOA 1QR6A 3ONVA 1CD5A 4RX1A 1DAIA 1UAAA 3G1TA 3GK3A 4MWZA 5K8TA 2B30A 3KS9A 4GVLA 5KVVA 4LF5B 2E1RA 2PL5A 4KX5A 5GINE 2XV1A 1A9SA 3B51X 3CRRA 4A0GA 4NYJR 1ZD5A 4CEHA 2ZYHA 1TMGE 4HPXB 1GITA 1Y8ZA 3KOUA 4I9HA 2TS1A 4ZJZA 4GO1A 5B3JA 4ND4A 2C5LA 3I42A 4J91A 4FC6A 1QE3A 4KGVA 4BV2A 1FTNA 2X4GA 1POWA 5C8YB 5KVQA 1NQ5A 3DUWA 2DFTA 3OMWA 1N0UA 2QRKA 1VRWA 3FMFA 4LYJA 2LKCA 5KPJA 4YJKA 1SULA 1VFPA 4UBNA 5DTRA 2YWXA 2BMDA 3EVAA 1HT3A 3U4AA 5FV4A 1H2RS 3E9DA 1MAUA 2J3MA 5K99A 2Y9PB 5ESXA 4UDXX 4ARZB 3AKYA 3N1UA 4C3ZA 1EWQA 2O8CB 2HH9A 1YMQA 5JCXA 4PSAA 2FH5B 3TIXB 1AZTA 4UUAA 5LBIA 4AS3A 3RT1A 2LIPA 3RYCA 3H1GA 5EJ2A 2EYQA 1NVFA 1P4HA 1QYXA 1VJGA 2A9QA 3FG9A 5HQJA 2XITA 4RPGA 3DE5X 4S12A 4CU5A 5KYYB 1T2DA 4HMOA 1WWKA 1Y82A 4NE9A 5KZMB 1EXDA 4RVGA 1Y3IA 3MLBA 1EFLA 3FRJA 4ZAZA 1Y8AA 4F7DA 2IPAB 1YC5A 1EB9A 3RAJA 3FJYA 3EDCA 2JGNA 4MUIA 1C1YA 3SHWA 3VNQA 4F5EA 4I4IA 3K09C 3EPPA 1I2CA 4WT7A 1TIKA 4BNXA 3VH3A 1JDTA 4YMLA 1R8QA 1K5PA 3I72A 1BMDA 3BM5A 1AF4A 3UXMA 4H18A 1J33A 4OKSA 4ZQEA 3V9PA 1M2OB 1JDUA 2RHRA 4EHIA 4ZMRA 4CF7A 2QLTA 1YDHA 3VPHA 4OBBA 1DKOA 2EQBA 2FJUA 3CJQA 1A82A 1N5OX 2F59A 2Z8YA 3LKZA 3PWSA 2B4AA 3ZWDA 1Q14A 2O2CA 1IMOA 2XZOA 1Z3IX 1Q21A 1DWUA 3E7DA 3PRYA 1GQ2A 1YBMA 1M2NA 4E4TA 1NI3A 4C14A 4O4IB 2HRCA 1BW9B 2QRQA 3GF4A 3MEQA 3LTNC 1SKUA 5IARA 4GRIA 4F12A 5J4HA 1HFEL 1W2WB 4B81A 2JVKA 1XPRA 1QP0A 2DWQA 4ESVA 1HQCA 4L8GA 3DSRA 3PRHA 5E4TA 2ZE5A 3VTFA 5IAJA 3PQDA 4XR9A 2VYVD 2XAUA 4ALNA 2CJYA 4B43A 3HXOA 3ABSB 4CF5A 1TQ2A 4N5HX 1RQPA 2QT1A 4RBNA 1K4KA 4U39A 4WKPA 2HY7A 3A2KA 1R6UA 4EA7A 4ETIA 3A7EA 2F8TA 4UUOA 3R7DA 4YH1A 2H1FA 4D2IA 1LNZA 2BFEA 4JNCA 1NW7A 2CXRA 1NMSA 5B3JC 2Q0XA 4J2OA 3NHWA 4OCZA 1X6VA 3O4IA 3RS0A 4BY9E 3BGOS 2YXNA 2F55A 2PQMA 3AYXB 4D7AA 1FFAA 2B35A 1HKUA 3A6FA 4FI3F 1KIMA 2FWRA 3H5AA 4N6OA 1EUDB 1M1YE 2C88A 3C0KA 3OLCX 4TN1A 4J1TC 1EK6A 3OY7A 3TQFA 1PDVA 4DEVA 2O20A 1UMBB 1O96B 2VP3A 3DP9A 3NIWA 3N05A 4H3VA 3VX3A 3ETJA 3W6UA 3N0VA 4WWHA 4ZGWA 2ZXFA 4G5OA 4G5FA 3ZZTA 3CSUA 1FTSA 3QF4B 1BXRB 3FPCA 4L3VA 5LLDA 5G4KB 3L6UA 1LPAB 3HY3A 1OPRA 2JLRA 2GJKA 1WCXA 2JBAA 1H22A 3T5PA 2WLSA 3SK0A 1ULAA 4BZXA 4HAXA 4UTRA 3UB2A 1QG2A 1SBYA 3DZKA 3IESA 3ZE8A 1YDFA 2AG5A 3A05A 1R12A 2Q5HA 2Z9BA 4CNBA 2OZEA 3BRWD 1WZCA 1XR3A 2PEYA 2ZREA 5AICA 5IG2A 5KKNB 5EZQA 4ZYYA 2ZUVA 5U1PA 2IA5A 1LPNA 1MB3A 2OKGA 2YJ5A 1ZW1A 2AOTB 3CINA 3PDCA 2VO1A 4DDHA 1YZQA 1YVEI 1WEHA 3R0QA 2D1YA 5AJXA 2H63A 1THMA 5J5AA 3ZXYA 4J2HA 4CV3A 4F9FA 2P62A 4G5SA 3K9FC 1RZVA 1Y33E 1DCKA 3KJZA 2CLLB 3NI2A 4EY5A 4UTOA 5JR3A 3IBTA 4JX9A 3KHUA 4MQFB 5JCJA 1Z7BA 1IQPA 2YWCA 1KIFA 3JARB 4I36A 3GUVA 4GXRA 4CMGA 3EC7A 1N6IA 1X14A 2R44A 4R0NA 1MOSA 3L4JA 4RF5A 3WVNA 1DG1G 4BLPA 1AQUA 1DT5A 3LP6A 4GC9A 4HDQB 4W7SA 4CLXA 5KPDA 3AR5A 1COZA 4DQKA 2CNDA 4P53A 1YFJA 1FNDA 3EVBA 1ULSA 2WICA 1TW3A 4IP0A 5E95A 4PGMA 3IJRA 1NMYA 2OCBA 3ZW7A 4TSKA 4BMCA 1DJNA 2ANBA 4I0WB 4F4HA 3OQVA 3SEAA 4RMGA 4DZZA 1H2WA 1SFRA 4Z2YA 2A1UB 3S7ZA 3EIXA 3CFYA 2QIPA 2V65A 1O3YA 4NDAA 3UK1A 3RRMA 4F0JA 2WIJA 5IEBA 2LTAA 4AJKA 4NV3A 1YZVA 2OESA 1KSGA 3G0HA 2WAYA 4UREA 2PE5A 3FTFA 3N3AC 2NO0A 3GVCA 1JMYA 2FJ0A 3OPXA 5JU6A 3H1PA 1CG6A 3FCXA 1JDZA 3GT3A 2ZRBA 2G06A 3IIMA 3UWSA 4CRWB 1VCIA 2O2ZA 2QZZA 4KQEA 5D3MA 1RU3A 3E7PA 4PSUA 2C4MA 2DM6A 1PI3A 3DHWC 4YROA 3S3TA 4LNUA 3RRJA 2FR0A 1DG3A 3BCUA 4KLAA 3PXGA 3SEFA 5BOSA 2PGIA 3LT4A 4BX8A 1S2DA 4MJXA 3NV9A 2H1WA 3CLVA 4QBIA 2IYNA 1MO3A 2NAFA 4WXPA 4WJZA 2QRHA 4B79A 2YY5A 3ETGA 3FSGD 4P31A 4PX2A 5COBA 1S2IA 4OEHA 1XEWX 2I2AA 4PO3X 4KRGA 4TTSA 3FPFA 4FZ5A 1J2RA 5DJ5A 1QKIA 3UKOA 2AUNA 2R4TA 3GJRA 3OJXA 4UVDA 1BVUA 4YUYA 1L4EA 2X1VA 4NE2A 4DWWA 1Z4JA 4EMTA 4N5LA 4YRIA 5KYGA 3ZWBA 2IQ5A 2J5KA 3JAWB 3TZQA 3GNLA 3I76A 3KZ1E 1A7UA 1T1JA 2Q4TA 4Q21A 1DCTA 3HDHA 3FF1A 3U5TA 1IMJA 1Y8RA 1CB7A 4PYMA 2ILVA 2XRFA 3EYAA 2VNHA 4QDJA 3VSAA 1MAHA 2CMHA 3BF7A 1IM8A 2ZTHA 4LXXA 4ZRMA 2SHKA 3O4JA 4I5IA 4IYJA 4DQXA 1IXZA 2FPIB 2VR1A 2G9QA 3O2NA 4EJ2A 2WUFA 1U8EA 4C3OB 4INAA 4HVTA 4L50A 4BCCA 4DJFC 1OLSA 2G9ZA 4IG9A 4M8LA 5B2EA 3O38A 1KC3A 3HQ4O 3C6KA 1G8JA 2R7KA 2UYQA 3AFOA 1Y9DA 5ENZA 3OZVA 1GUBA 4D9NA 2C57A 5C8YF 4XWWA 2WHXA 1E2QA 2PTHA 2D0PB 5L3QA 1CIVA 1FVXA 2QQEA 4RPIA 4C2AA 1EXMA 1Q50A 3URMA 3Q6NA 1XIVA 2E3JA 2VKQA 2JVIA 3ZGXA 4J6FA 3WKBA 1FVFA 3PZBA 2B99A 3P4XA 4RDCA 3UPTA 3VR2D 1IE3A 5EUQB 4DV3B 5L7YA 1KL7A 2LXNA 1HPLA 2ODEA 3P4YA 3PENA 4GD3Q 3CMCO 3B1VA 2AFVA 1E7RA 2EJWA 2QRPA 3H5WA 1EXWA 4MV4A 2PFKA 4NU8X 5TPWB 1UKCA 3KELA 4BO4A 5JFTA 1R6VA 1TCBA 2OV3A 2VSXA 3HJNA 2IU4A 3HU1A 4K8RB 4LEIA 4DIBA 1CRQA 3IUNA 4QBHA 4ZYTA 5BW5A 1RE1A 3D3KA 1QE0A 1NYTA 4I4CA 4OUKX 5FKJA 3OKPA 3W9YA 4PFKA 3HVRA 4R40A 5JS1A 1JIQA 3WP0A 4HB3A 3N87A 3ZQKA 2J0QA 2ECOA 2WV9A 4LOLA 4MH0R 2NIPA 1JLMA 2GPWA 1O94C