1WCIB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
341
structure length
335
Chain Sequence
AHFTFQEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 128
structure length 335
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB01
3FLMA 5EJ8A 2J9FB 3M6LA 5K2OA 4JU9A 4MQ5A 1OLUB 1V1MA 1POWA 3DUFA 2BFDB 1YNOA 1X7YA 2W93A 2IEAA 4KXVA 5K6RA 1T9BA 1V1RA 3ZHQA 5I5GA 4FEEA 1PYDA 4KGDA 1BFDA 5EJ5A 1Y9DA 5C4IA 1JSCA 1V16A 1YHZA 4RJJA 1QGDA 5I4IA 2BEWB 1UMCB 3ZHSA 3OOYA 2XT9A 1POXA 2BFFA 1X7WB 2YIDA 5DEIA 3AI7A 2JGDA 4K9MA 1YD7A 4MPRA 4C7XA 2BFBA 2VJYA 4MPJA 3M49A 4ZP1A 1UPAA 5DGTA 4D5EA 5K3SA 4GM0A 3AHEA 1UM9B 1OLXB 2BFEA 2Q5OA 3L84A 3OE1A 3UK1A 4GP9A 2BFBB 1V5FA 2AG0A 3ZHRA 2VBIA 3AHHA 2JLCA 2QTAA 3DV0A 1T9CA 2FN3A 1X7XB 5I51A 1DTWB 1ITZA 2IHTA 3LQ4A 2JI9A 3DV0B 5ERYA 3AHGA 2Q5QA 1OLSB 2BFCB 1OZHA 5EJ9A 1NGSA 5EJAA 4KXUA 1UMBB 1OZFA 3AHJA 1KEKA 2JI6A 4JUCA 4K9QA 5DGDA 2BP7B 5HHTA 3AHIA 5HJEA 1QS0A 3M34A 2EZ9A 3EXEA 5EXEA 1AY0A 2EZ4A 1R9JA 5HGXA 1UMDA 3EYAA 4QELA 3FZNA 5I5EA 3EXG2 2V3WA 3HWWA 5EXDA 1YBHA 1OLXA 1T9DA 4GG1A 3AHFA 5EJ4A 1V11B 2Q27A 3EXHC 4FEGA 1X80A 2VK1A 2R8OA 4KXXA 1V16B 1X7YB 3AHCA 2AG1A 2XTAA 3LQ2A 1PI3A 1PVDA 1UMCA 3AHDA 1TRKA 3KOMA 4QPZA 5EJ6A 1PO7A 1X7ZB 5IMSA 2UZAA 2XT6A 3F6EX 1W85B 4K9PA 4QQ8A 4D5GA 3LPLA 3RIMA 2UZ1B 2NXWA 4JUAA 2VBGA 2BEWA 5K6TA 3EXIB 2EZ8A 2YICA 3ZHTA 4COKA 3D7KA 4K9KA 3EXFA 1QPBA 2JGDB 4GM4A 4JUBA 5AHKA 2C3UA 3M7IA 1GPUA 2FWNA 2PGOA 3EXHB 1OVMA 1V5GA 3IAEA 3EA4A 1UM9A 1U5BA 2IHVA 2BEVB 1V1MB 3DUFB 3HYLA 1TKAA 1NI4A 1OLUA 1OZGA 1Z8NA 2G25A 1YI0A 2WVGA 4GPEA 2PGNA 2QTCA 4K9OA 1UPCA 2WVAA 4K9LA 2BEVA 2BP7A 3ZHVA 2J9FA 3HWX1 1WCIA 2JI8A 2VK4A 2C3OA 3DVAA 4MPPA 5HYVA 4Q9DA 2BEUB 2JIBA 3JU3A 2C31A 1V1RB 2G67A 2OZLB 1WCIB 1YI1A 2BFFB 2Q5LA 2PDAA 1X7WA 2EZUA 1YHYA 3E9YA 3EXIA 4JD5A 1QS0B 4JUFA 3EXEB 2BEUA 3ZHUA 2E6KA 1V11A 4JUDX 5EJ7A 3F6BX 1W88A 4C7VA 2DJIA 3FSJX 4JU8A 3UPTA 4K9NA 1L8AA 2C3PA 2X7JA 2Q28A 1V5EA 4WBXC 2R8PA 5EJMA 2O1XA 1W88B 4XEUA 1MCZA 1Q6ZA 2VBFA 1N0HA 2BFDA 2R5NA 1X80B 1DTWA 1X7XA 1TKCA 1UPBA 5ERXA 1IK6A 2EZTA 2Q5JA 2UZ1A 1TKBA 1OLSA 1B0PA 3IAFA 5ESDA 2JI7A 4RJIA 2WVHA 1X7ZA 2PANA 2VK8A 4GM1A 3DVAB 3EXFB 2C3YA 1T9AA 1W85A 2C3MA 1RP7A 3MOSA 4RJKA 2JLAA 2OZLA 3EY9A 2BFCA 4KXYA 1U5BB 2IHUA 1UMDB 3LQ1A 2O1SA 1NI4B 1UMBA 2G28A 2C42A 2Q29A 1ZPDA 5FEMA 4MZXA 4KXWA 2BFEB 2Y0PA 3EXHA 3EXG1
chains in the Genus database with same CATH superfamily
2JFWA 5AVOA 2AYZA 1HMYA 3O8QB 5A7FA 5LQDA 2AC7A 3FCXA 4MQ4A 2ZT7A 3THWB 5K0CA 4ZZ3A 1R5JA 1XTSA 3LWZA 4QM7A 1HURA 3V4LA 3LXMA 1LLQA 1K75A 1XI2A 1XRPA 2PIAA 1BIFA 2WJWA 3E6AA 3F98A 1LPBB 2HBZA 2VJYA 5LA6A 1UPAA 4DLAA 1D1PA 2R6HA 3AHEA 4E94A 2GNAA 1US8B 4BGVA 1PJZA 4DDHA 4YJFA 3L0CA 2QE6A 4V1CB 1NBMD 3HBMA 1OXVA 4PLZA 2UV8A 3ZZUA 3F90A 3P2YA 4Y2VA 3OEHD 4IOMA 5BUQA 3IQDB 3O03A 5KMGB 2UVQA 2FUCA 2JIPA 5JWHA 3FWHA 3NKLA 4BQFA 3OE7D 4D8XA 1HDOA 2GN0A 4FGLA 2G0TA 3REOA 2GHIA 2OB2A 2WV7A 3ML1A 4P1ZA 4AJ1A 4BU0A 4DS3A 1G38A 5IBRA 1AHIA 1I9CA 1WY7A 1P4HA 2GLXA 5EIWA 4AN0A 1MO3A 1GR1A 1N0WA 2FKNA 3TQTA 3MJVA 4F2PA 1B0UA 1OYWA 3ZBPA 2DR2A 4DIBA 4JC0A 3RUEA 4H2DA 3LT5A 3C4QA 4YFYA 2AG8A 3G59A 3T7JA 2H4WA 2JAQA 3L4BC 2AHOA 2ISQA 4QVIA 1XZMA 5K0TA 1HE5A 2AQIA 4TYWA 2H1VA 2A0KA 1ZCFA 1L5NA 4X90A 1YOVA 3NTUA 1ZL2A 1DDGA 3P4XA 3WV5A 3DL4A 3RSGA 2W11A 3U44B 5C8DA 5ES4B 1JAZA 2MOKA 4I1VA 3CRW1 4AQYB 5GY7A 1QANA 1Z6QA 3V6LA 4F3KA 1G7TA 4GKBA 1OLUA 3LLUA 4TVSA 3OZFA 2XCRB 2OZPA 1VTKA 3GLQA 1WBBA 4DCJA 5A1TA 2P2CA 4QECA 4LF5B 4UCFA 5K51A 2E48A 4BYGA 1WDKA 1TOAA 3NWBA 2PAFA 5THQA 2OQIA 3ENQA 3GRFA 2GF2A 3ENZA 3KR0A 2X2OA 5KCMA 1EWQA 4ZD6A 1M34B 1FTWA 1XD2A 5ETJA 4KVZA 3IGFA 4NP6A 4RK4A 4CUZA 4N5IX 3MJCA 3Q10A 2C96A 5DN6D 3NDRA 1R0ZA 3NI2A 2BMFA 1GPAA 3AEYA 5E9JA 5CB8A 3NBFA 4CRWB 3GJ6A 4I55F 4GE3A 2CMFA 1D2RA 1EA7A 4AZSA 1HM5A 3ZVNA 1NONA 1P75A 3FNFA 3U7JA 2J59A 1BD4A 3HABA 4TTRA 5KSWB 3W5BA 5FNVB 3GLFE 1NBEA 3UW1A 4A6DA 5LZ9A 1LXCA 2CLKB 4MKIA 1JDNA 3B1ZA 1Y9EA 2PRYA 2KHZA 2PZMA 1KSGA 4EY5A 3T52A 4K40A 4CV2A 3AR6A 1X7DA 1FTSA 3IYLW 1QFZA 4FZ3A 4EX7A 1Z6XA 1Z6AA 2HR1A 2RGWA 4CKXA 4M21A 3OM8A 3FDXA 3IP8A 3MOIA 2AGVA 5IVKA 5AI4A 4BRSA 2WJHA 1HPLA 2X7HA 1DCFA 2Z56A 1DBVO 1QFYA 2X3UA 3L6UA 5G2OA 2IZOA 5EXXA 1ADCA 2P30A 4IXTA 5KNCH 3MXTA 2HA6A 3DTVD 1I4TD 4J2HA 1IUPA 1VXRA 2CYCA 1AF4A 3HS3A 1QGDA 2ZTMA 4RS4A 1VKRA 3CNBA 4KPFC 4QAJA 2V9ZA 4C2BA 1MB0A 4EHNA 3QPCA 4RNCA 4DR4B 3C70A 2PH5A 2ZXFA 4XEHA 4YRMA 3SBEA 3ZY5A 2D8AA 3HCDA 5B6PA 4RC9A 4AN1A 4E6EA 4PSVA 5IKOA 5DMXA 1SQGA 2ZWOA 1N92A 2IXGA 4IFBA 3UK1A 3ZE0B 2HMWA 2FUEA 4LBWA 5A5DA 4Q01A 1YFKA 2JANA 3DDOA 1ZI6A 4XIIA 2C61A 2WA2A 3B3JA 3F8WA 2IL1A 2PAAA 3H04A 4Q4HB 2WWGA 4LJ5A 5EZYB 1M2JA 5ADUS 3JPWA 2WTAA 3NP7A 1T2FA 4HB2A 4MS1B 4ZK2A 4W5QA 4M8IA 2GZDA 2OV4A 1NVVR 3RQIA 3VO2A 3L04A 2FFQA 1C14A 1G2PA 3P0JA 4GPD1 1P6UA 1WB4A 2YN0A 1U5AA 2ZRKA 3NHYA 1JAHA 2FZWA 4C3OB 2V7QA 1P1CA 1C81A 1UOEA 1JIQA 4PPNA 5ARCA 1QQAA 2G3YA 3NHFA 4F06A 4OLBA 5LP6F 1GPH1 3P45A 1XWIA 5ER9A 4DLRA 4Q82A 4S0ZA 3K70D 1X19A 1XF9A 4MXDA 5HA5A 1D07A 3QWBA 4M1SA 2H8KA 4E5UA 1R4NB 2I4MA 3ZU2A 3CS3A 2VYNA 3QUTA 3R5KA 3BTVA 5LBUA 4HVAA 3TLJA 2DGDA 4FC6A 3U1TA 3T6KA 4P35A 2IOQA 5DNYB 4J9UE 3A3NA 4K28A 1U7PA 4FKZA 1AKYA 1D0IA 1BX3A 4XQ9A 4Y7DA 2R48A 1C4WA 1F17A 1EG7A 2XRYA 4L4RA 5T4BA 1RI5A 1I5EA 5HCUA 2QN7A 1MNQA 1CS4C 1RJ9B 3S6JA 3LV8A 1TKAA 1P31A 2EBHX 2K6GA 4U8GA 1BGXT 1C9EA 4UZFA 1EFKA 2CBGA 4IIBA 1PJ2A 3KKEA 1OI4A 3NBUA 3GX1A 2VK4A 2DWUA 5JAIA 2R1VA 2HMVA 3NDBB 3K71B 3G5AA 4CLEA 1FB5A 2V5AA 3EEFA 1ZUNA 5JSZB 1ZGHA 5JAUA 2QIOA 1ZK0A 2HJHA 4FW9A 1NMYA 1BDJA 2KBEA 1RJEA 3HCWA 2HBRA 3I6IA 2O0KA 5DM1A 3ER8A 1EFHA 1RQ2A 1HWYA 4CHTA 3EASA 3Q8MA 1RAHA 1U0JA 2FPXA 4H77A 4HLNA 2A1UA 1V45E 1WUTA 4DPKA 2F9FA 3T7KA 3ND7A 2ZATA 3C98A 1LBQA 5DE3A 4K6GA 4DCGA 4J2OA 2JLUA 2GOYA 3VZQA 4BDSA 1J1UA 5KOYA 4XWAA 4Q9AA 1EX9A 1GO2A 2OOSA 1IXSB 5ALDA 4B8ZA 4PBSA 4EIWA 5ALPA 1CHDA 2ID4A 1ODSA 4HVCA 4U2CA 3IEIA 1E5TA 5ALJA 3SKVA 2K7ZA 1H4VB 4ZFNA 3S0JA 3WJAA 5ESRA 2RGCA 2LP4Y 1PQ4A 3UWSA 3VR2D 1NXPA 4CF5A 5E0KB 3BTSA 3OBIA 5KVAA 3Q11A 5CB4F 3UAZA 3NFYA 5DX1A 4BMXA 5CW2A 4HPXB 1YRWA 4LOHA 5KNBD 1DAOA 2V7PA 2JBAB 3FMPB 4AULA 5AW5A 3J81A 1HQCA 4MA5A 3JWEA 1CRLA 3DS8A 3OESA 4LZNA 1XTZA 3ED1A 6LDHA 1YR8A 2I6TA 3X1DA 4D3SA 3SXUA 1BYUA 3G88A 2AN9A 1NUSA 2PX8A 2PGLA 3JV7A 4OP3A 1E3QA 4KN9S 5EC8A 3LYHA 1RYNA 3RSOA 2IOHA 1SXPA 4H59A 1SXIA 1YOVB 4LA4A 1GTJ1 4FGWA 4B3DA 4QT4A 4URZR 1UM9B 3OE1A 4NOJA 4LC9A 1SIBE 3S2SA 2YC2C 2W6NA 2WY2D 1DUVG 2BN4A 3HPRA 2Q2NA 4C4SA 5LR6A 4LJ4A 5TPZD 3L9WA 1GRVA 1ZITA 4S35A 4Z8XA 2AR0A 1VJ5A 4P34A 2OCYC 1LDNA 2A84A 3CLUD 1KJNA 4H7IA 5IJWA 3NBAA 4F1WA 4ZU1X 2ZJ1A 1GVNB 1T3SA 2XH8A 5CXSA 3FJOA 4Y0NA 1GZ6A 4JJ8A 4ZODA 1XTIA 5K99A 4DBLE 2JFBA 4HYTA 4ZV9A 4CR8A 3JR3A 4PRLA 3WRWA 1TCBA 2HJVA 1EXNA 2OQRA 2V65A 3PNOA 4LRYA 4ZRNA 1P5ZB 5EJ4A 1FFWA 3EEYA 4KFUA 1EWVA 1AH2A 1NMQA 4HSEA 2IV2X 4KQXA 1FW8A 1P5HA 4RY9A 2XTAA 3U4DA 5ENZA 1XA0A 3FG9A 4XAQA 3TIFA 4BJ6A 4AXBA 2F48A 2PBFA 2QRZA 4GZ5A 4F46A 5IMSA 4MUXA 1D6JA 5IANA 1KEVA 1WXXA 2GASA 2PXHA 3SHTA 3RIMA 1SCQA 2DAPA 4XM2A 5CX1B 3T12A 1XMSA 2D62A 4DZZA 1CEQA 4LHXA 3DLBA 1JSRA 5D01A 2C3UA 3H1FA 3FMIA 3JZMA 3IT1A 3V2HA 1AV6A 3BK7A 3FAZA 5FWNA 4BEJA 1RZRD 5CCDA 1LVHA 4TS4A 5AJXA 1CZUA 3SJBA 4ETWA 3L8CA 5ER6A 1U2GC 2VH5R 3OIDA 4RVOA 3S1LA 1U9IC 3LKDA 3HXKA 3C1OA 2D1SA 2HHLA 3NTLA 3ZG6A 1G2IA 1DJNA 4DMHA 4JKOA 5GOTA 3KQOA 3KG2A 1T2UA 4JOCA 4HDAA 1ZEJA 2X8AA 3AKYA 1CDEA 4PGHA 3R8CA 3STTA 3BTUA 3TO5A 4JU8A 3LNTA 4YJ3F 4YREA 3TZLA 1TT5A 2XITA 2XSZA 3Q6MA 2Y1WA 3SEQA 4ZMBA 2FG7C 3EH1A 2GEBA 2GRUA 5JSQA 4MR7A 2PU5A 2ZRHA 3O0TA 5K8VA 2CC2A 4ZI5A 4GLFA 4C0JA 3M6AA 3OJLA 5G1PA 2NAFA 4AUEA 4PXAA 1SA0A 4HK4A 3DZIA 4MKHA 4ZYVA 1ESEA 2IEIA 1EZ1A 2WVHA 1K5HA 2OCLA 3OPNA 3ZV3A 2RHGB 3AETA 3DAFA 3HY3A 3MFYA 3BXFA 4KDFA 1B93A 4MLDA 3HC7A 4P7KA 2RHBA 1Q5PA 3I61A 2C1EA 2GK4A 3X1YA 4BEWA 5FWAA 2RGDA 4KGZA 3FCAA 2PUBA 5LQUA 5F3RA 5ALGA 5DXJA 4PE5B 1AB5A 1E4OA 3M82A 2GR9A 1BCRA 5AHWA 2OR3A 5K2OA 4NBSA 2F1RA 2PV0A 4E09A 5ES3A 1E9CA 1GZ7A 3P2IA 4I4IA 5KTNA 2HSZA 3SG0A 3UKJA 3DWEX 2G4VA 2PL1A 4W63A 4TYNA 3GIWA 2QAGB 4QUAA 4C4PA 2RGAA 1BE1A 1KETA 2D3TA 3VI3B 2W0SA 3ASVA 4CM3A 1POXA 3HXPA 1PIWA 2BFFA 3OC6A 3NRJA 4F5EA 5KSOA 4JA0A 4WCFA 4DQLA 5LQKA 4IO1A 4IIJF 2Y99A 2NXNA 4NU6A 1U0NA 4C4OA 4XUGB 5LA6B 3OZSA 4AZ3B 1L7PA 1O96A 2IPXA 1DEOA 4Z51A 4Q9NA 4MDEA 4TSKA 4QE3A 5CIQA 4C0WA 1P9RA 2GEDA 5A4KA 3CLVA 1KEEA 4HQKA 4RUKA 3Q8WA 3W05A 4O4IB 4QGSA 3MQ4A 5DTQA 4DSZA 5KMGA 1OZAA 3JR7A 4Q19A 1GPWB 3C3PA 3E7PA 3V80A 3W6OA 3RIYA 3B7GA 3A6PC 4MRMB 5IHXA 4POAA 1UJBA 1USWA 4C5BA 2JHGA 1W9MA 3L1JA 4U0KA 3TPFA 1ZZEA 5CXUA 4KPYA 3STUA 1Q16A 2G6BA 3C85A 4WADA 4LGMA 3VTKA 1H6DA 2BM8A 1GNSA 2XA2A 1SXJC 3QBEA 3EVBA 4JODA 2UZAA 5IEJA 1E94E 1GA1A 4F93B 3GL9A 2ZJ2A 3DT9A 1KYZA 4BKQA 2ZAMA 2YCBA 4KU4A 2F55A 2HREA 3OJXA 4XRRA 2H1HA 1P17A 3PIIA 4JBWA 2PS1A 3Q4GA 4GKJB 3GQVA 2V6MA 3HKEB 5D8DA 5B4UA 5TSDA 3T4PA 3LVQE 1SKBA 4M1KA 3IV9A 1NI4A 2WU0A 2VDJA 1FRNA 4MHOA 3LY5A 1KSFX 2OZKA 4MS3A 2BONA 4FYHA 4IZIA 3ZDYB 1E9SA 3TYXA 2BEVA 1I3OA 2BELA 2JS7A 4KO3S 3PDWA 4KUHA 3S7TA 1O7JA 3WGIA 4MV3A 3L7YA 3QV2A 1IULA 3AP3A 4KRXA 1U8YA 5ADHA 2A5FA 3HGQA 1WDLA 2NSDA 2OV3A 2ZR7A 1M34E 3UB4A 1EXVA 3MFQA 4MA4A 3T35A 3U49A 1ADFA 4L2IB 4LSZA 1WXHA 4GOJA 2GZMA 4OP2A 4DXAA 2ZTHA 5AOCA 3BH0A 4NV3A 4RHXA 1U31A 3TTVA 4KVFA 4LHYA 4H7HA 4FR2A 5CGZA 4EHJA 3F97A 3CHYA 4LVUA 2Q2VA 3OJWA 4PNZA 2VDWA 1SBZA 2CEKA 2F1OA 3GC6A 2O5EA 1B42A 1XCJA 1T8YA 1YR9A 1ZY2A 4W9NA 4DREA 1TEHA 3O1LA 1U4OA 5DPMA 4O4LF 4WDRA 2VOJA 4ACAA 2VDLB 3MSXA 3QMPA 5I3ZA 2WNIA 2DECA 1T1GA 3FNRA 4HQ0A 1T6NA 1N9GB 3STVA 1Z5NA 1KEUA 2IGTA 4L0CA 5IBPA 1L4FA 4F04A 1KYWA 3DEIA 3Q5GA 3TECE 3W9SA 1KK0A 4XYMA 3VR2A 3LQRA 2FPSA 1AZSC 1Q44A 1POWA 1Q57A 2V6JA 4OXIA 2YL2A 2R6CA 4PX9A 5A4FS 4AX4A 5KC8A 3S81A 1WNTA 2HU7A 3A4VA 3C7TA 4CLRA 3CY6A 4QO8A 4UBKA 1QF9A 4PRYA 3SQDA 5BSMA 3NEYA 4NS1A 4IDFA 4TVOA 2FW7A 4Q4DA 3SC2A 3W2FA 1X94A 1ESMA 3F3SA 1EGVB 3LT0A 4LYAA 4H16A 4NJMA 1QP4A 1RYMA 2VYQA 4LBZA 5F2EA 4PZDA 1Z39A 2IZZA 3O4RA 3Q2OA 5IZCC 1JEOA 2FN8A 1N25A 2NP6A 2W6QA 3QLEA 4FI3C 2ZRIA 3KZ1E 4LJAA 3KSUA 3HCFA 5H9WA 1T6BY 2G9RA 4JJAA 4FD2A 3L5KA 4AG3A 2IEYA 3D8HA 5CX4A 1G60A 1ILWA 3NANA 4F5ZA 1QM5A 1GPNA 4YUYA 2UZ4A 1PD0A 3CONA 3FYSA 2Z4TA 2PLNA 3FDZA 2E5FA 3AHJA 4KFRA 1M2GA 4KG7A 1U8CB 2B20A 3QU4A 2FRXA 1ZM9A 4W7IA 3VSCA 2JW5A 3GDHA 3CUYA 3EYAA 1J2TA 1EJ0A 1FL9A 2RG7A 3B51X 3IUQA 5A9SB 1CR4A 3OH8A 4QTYA 5IM4A 3C8HA 2DY1A 2EHDA 2EEPA 2XNCA 3KXKA 4R9SA 3EA0A 4TLAA 4JN6B 1PDOA 5EJGA 1ZJJA 3HEBA 1T4CB 2I29A 1A4XA 1AGRA 1IAQA 2C29D 3F2IA 1VMIA 1LW7A 4Y2QA 5IC5A 3SY8A 5LMCA 5KINB 4KN8A 4G1BA 2GJ9A 3DL2A 1HG1A 3BJMA 1RHUA 3BRSA 1UBFA 1NVGA 3IVCA 5JZOA 1YCGA 4EFLA 4MI6A 3UJ3X 1E0KA 2ZSHA 4Q66C 4DR2B 1DKLA 5EE9A 3A6ZA 1MIOB 3VOBA 4PSKA 1HYGA 2XE7A 4RZIA 3IAEA 3SJZA 3ZGOA 1YR3A 1YQQA 3WG9A 3I58A 3WIEA 4W1PA 3GVPA 5EIOA 1OILA 1OZGA 2JNWA 3T1NA 1KAMA 3F6RA 1YHNA 4FI3F 1KMMA 3L8YA 2BPOA 3GEHA 3DKIA 4B6FA 3OF2A 3FWNA 1W76A 4BMNA 5IVPA 2PTHA 4BPRA 4JP5A 3OLXA 2C1XA 3AP2A 4FOSA 4MW4A 4EATA 1NULA 4LV8B 1FE8A 4OHMA 3NKVA 3DMTC 3WWOA 5IX8A 2HHJA 1QOQB 3M5WA 4KDCA 4KQ6A 1E3LA 5CK5A 3AUXA 1DS6A 5FO0A 3VR5D 4AJKA 5M04A 3FZGA 1U28A 2G4LA 3H1BA 3FPSA 5FI0B 1R4NA 4RD6A 2REXB 1FS5A 4FGJA 1XQWA 1V3VA 2GXQA 2JFUA 3H86A 3LD9A 4P4NA 5SY6A 4C7JA 3GVXA 2YNMC 4ND1A 4V2UA 3V7NA 4G8DA 4AW9A 4NRDA 1WUIS 3UIEA 2DYKA 5K3OA 3GPIA 2DTDA 3OHSX 4NBNA 2WICA 4E1BA 4LYFA 1JS1X 3SF0A 2IYYA 4JT9A 4EA6A 3H6GA 1NN3A 3T9AA 3QBTA 2VG8A 2I3ZA 2OG1A 4BOYA 3WKCA 4MV6A 3LHSA 2CVQA 4J0QA 1R37A 3JATB 2ZSKA 3HVUA 4G67A 4LTDA 4QSMA 6YASA 1D2AA 2NVWA 4K8OA 4Q7EA 3I9NA 2DHEA 5AESA 1P0FA 1B41A 3ZE1B 5CDYA 2WKQA 1UFQA 4JP3A 4S12A 4HEJA 4OA5A 4DNXA 1ODTC 2G70A 3R4CA 3SQWA 1ZA1A 1JIXA 2X77A 5PNTA 1X70A 3CNQS 4Q00A 3FI0A 2AMJA 4YRQA 1FLNA 4QDZA 5FHQA 1GTVA 5BOVA 1GYQA 4ECAA 2F1IA 5EJ2A 1I1OA 5HUJA 4UUBA 3IP5A 2OD2A 4C22A 1K6JA 5AVTA 2ZVJA 1ZG3A 2WIBA 4HTFB 1GIAA 4GP9A 4HGZA 1RAIA 1XP8A 5JAMA 2BBWA 4H7EA 1Z6GA 5E4JA 3D4LA 3M6FA 3NHMA 3CVUA 4G1UC 3UQYS 5BN3A 3RTCA 3DAOA 1JHXA 2H4XA 1VSBA 1G7SA 1P4GA 1VCNA 4MVJI 1SOWA 1ZN9A 3QZUA 3VTAA 1OX5A 4JNCA 2PKQO 1PZXA 1APBA 4JBLA 4EHIA 1FZTA 2ZFUA 4RF3A 3R9XB 2GJ4A 2VP9A 4D9MA 2FPWA 4GZMA 5FL3A 5K3AA 4HGPA 4YBRA 2FWPA 2BL4A 3Q3VA 3K5HA 4CWAA 1SU6A 2JGAA 4DNQA 1I6KA 1LZKA 3RV3A 3BJZA 3V34A 1U2SA 4NU5A 2OEPA 2VK1A 1TX4B 2FEWB 4J6FA 2Z2ZA 3M5CA 3L7CA 1H6CA 1YQ9A 3JYQA 3B8EA 1DIRA 2NUBA 2IUEA 2XMCA 3LA8A 4YCBA 3RUHA 2YQZA 3MB8A 5JNVA 3U6KA 3KP1A 4Z9FA 5KSYA 3GFBA 2ZTSA 3THXB 2E49A 2P6PA 4A7PA 3RBAA 1XP5A 1KYYA 1CRPA 3IJEB 4RULA 1NN1A 4I9FA 4NABA 1GSIA 1J9EA 2G08A 3EQ7A 3FPEA 2X1HA 4CMEC 1JAYA 2IZ1A 2OK7A 3ZTTA 1R9GA 4REMA 3LUBA 2ZTVA 3I8SA 3BXZA 4EDHA 1FQWA 2HRDA 1TW2A 3H2KA 3SYRA 3EYWA 3SX4A 3EPLA 4JEIA 3BL5A 4NYMQ 4JELA 2YWHA 1P80A 3A9CA 1ECJA 5KS2A 4BRWA 5JTTA 1T3HA 2SICE 4WZAE 5DT9A 2ZTLA 1FRZA 2O54A 2BFFB 4FFLA 1QK4A 2QDXA 3WISA 2VAWA 4BWFB 2C8KA 4F4JA 2C0CA 1HSZA 3C5EA 1ADBA 3OIWA 5FAXA 1NR5A 5BYAA 4U2BA 3IE0A 3WYFA 4GOKA 1KY4A 2F3UA 2YWFA 2DH5A 3KE8A 4JLPA 1N32B 2VF4X 1G8JA 1Q6ZA 4YAIA 2YV2A 3X2FA 2YJ5A 4C9BA 3QVMA 2O59A 3NOOA 5JXWA 4ZZIA 4OBBA 1UBMS 2H0AA 3BD9A 1LTQA 3EZNA 3JQAB 1EBBA 1QIGA 3ZWWA 1WP9A 3IUMA 1V43A 4W4TA 4UATA 4EJSC 1YQUA 5AKHA 1B8PA 4I1SA 2JLAA 3NGXA 4TUYB 1S2MA 4WESA 5EXTA 5IHPA 5KIAA 2YFHA 2BUCA 4UFOA 2ID9A 1K9VF 2O1SA 2XQKA 3BRQA 1WIWA 3HKBB 3P4YA 4LJYA 1ZPDA 4O4HF 4RWZA 4U2EA 2QU8A 4FOOA 3QMWA 3P9CA 3QRWA 5EPUA 1YWGO 5IZ4A 1PG5A 1XMXA 2C4HA 2D0DA 5ALXA 3UYLA 3G6WA 2WAMA 4ZT6A 1DMSA 3ZE9A 1FU8A 2MMGA 4IDBA 2O2IA 4MYDA 3NNNA 1NUAA 3TCKA 2PSEA 3NTOA 2CXPA 5J9FA 3ONNA 1E3EA 1DSSG 1X0VA 1JSCA 2Y0EA 2EQ5A 4I6GA 4ROSA 4M6WA 2QYSA 2EKZA 3K20A 3AUAA 3SVLA 2I3GA 5F12A 5JJ5A 3CO0S 5FQOA 1CLEA 1N5DA 2DC1A 4I19A 4E5PA 4PLFA 1URPA 3K0CA 4KR9A 3TZQA 1KRXA 1L5RA 4L5AA 4O3FA 2C5HA 4D41A 2E9SA 2NSJA 3PKZA 5EHIA 5BN1A 2V1UA 4YUXA 3H13A 5KOIA 4X8LA 2VPWA 4CLOB 3DP9A 2XVXA 4OBEA 3JQAD 5HE8A 1NW6A 1KO4A 5B2ZA 3WOHA 4L22A 1WTCA 3A1TA 4RVDA 3WGMA 4ZVQA 3MHPA 4OQZA 1JZSA 1C4KA 2FEXA 3A3YA 2WD7B 1WB9A 2EEZA 4MRMA 1JU4A 1T8SA 3M2PA 3A04A 4FQ8A 4CFZA 1B7GO 1M5TA 1V7CA 1EIZA 3AR3A 3RWBA 2CE2X 4RXUA 1L4YA 5HW0A 4MK4A 4MQEB 5KJFA 1YL7A 2OILA 1FA9A 2GXAA 1Z4MA 2X42A 1PBNA 5KKAA 2N42A 1FTYA 3IUNA 4G81A 3FOWA 4G1MB 3H87A 1CJBA 4EWLA 1LCIA 3USES 3BXHA 3KJIA 1YGPA 4I4TA 1BCSA 2VYND 2ZB4A 1FSZA 4IDHA 1QCZA 3V4FA 8ABPA 2PKWA 2YOFA 1V48A 5BP7A 4ZQCB 1SEVA 3ESQA 2C78A 4MJ7A 3ZEIA 2B82A 1L7NA 2WIFA 2LW7A 4PZEA 4AJHA 2VP5A 3PGXA 4XWGA 3ZWXA 3JAKA 1IYZA 5B36A 1M1ZA 1U8EA 3M1LA 5JYCA 3ZHBA 3GUUA 3UMYA 3ZBQA 1C9YA 3C2QA 5LB4A 1UXGA 3QY0A 5B3LA 2C77A 1IVNA 1W34A 1M66A 2WAAA 3PQ8A 2QGNA 1WCIA 1MEEA 1QV6A 4LN1A 1T1EA 3LHDA 4RK1A 3PQEA 5AJYA 2OVBA 3K1YA 5EE1A 5AVVA 4QARA 3KLBA 3KKZA 3IPLA 1EVYA 1KY5A 2OCGA 3ELDA 4Q4JB 4EGCB 3EXEB 2G88A 2RH8A 5DDIP 3WIDA 1RXUA 3A4TA 2D7JA 3KQVA 1X8KA 3AG6A 1IDOA 1ZHHA 5CA1A 3HXOA 1ZIPA 3CNLA 1Z29A 2IP1A 1T13A 2O2GA 3LRXA 3NATA 5IULC 1WUKS 3U3RA 1DELA 4JEMA 1WL8A 4RIGA 4CCWA 3NIDB 1H0HA 3PTAA 2Q0QA 5DXAA 3T54A 1IXYA 1SZJG 2HKIA 4IWNA 4Z4GA 2FWBA 3TS1A 1A9XA 3NAMA 1EDBA 2I5PO 1UJ5A 3A6JA 4BXOA 3EA5A 3FETA 2NU6A 2OO7A 4QYWA 1C3OA 5BWNA 2QU7A 1Z17A 3AR9A 2DR3A 1A8UA 7REQA 3GEBA 1TA9A 4EG1A 3F1KA 1KSJA 1VXOA 4PAQA 3ZDEA 3HY4A 1XPUA 5A2QA 3GFRA 3REFA 4OQQA 3E8SA 4BV9A 2HA3A 4ZT3A 1JB9A 2QLTA 4C7BA 4BMYA 4JROA 5KAPA 2VF2A 4KLZA 2IYVA 1EFUA 1TTPB 3OI7A 4BNMA 4PM4A 1KEZA 2YYZA 4H4DA 4QTZA 3OT1A 3CURA 3K0FA 4BO5A 5KOHA 3QUBA 1RKQA 1JHMA 3R0XA 1TZBA 3LUJA 3HO1A 2NZUG 4GICA 1QGZA 2AE2A 4OX9B 2VKQA 4TTAA 3PD1A 4CW7A 4XCVA 7GPBA 1L7RA 1WLSA 3V3KA 2XADA 3VAYA 3K8YA 4JC5A 1ECLA 2XB9A 4CTJA 2DBYA 1IMOA 4PZYA 2H31A 5FDFA 4PHGA 1NV9A 1K7CA 1SHUX 2NQ2C 1RXWA 4M1EA 5E3JA 5BXYA 4LQCA 4WDQA 4F56A 1IN7A 4HDNA 4Y9SA 2NXEA 2E85A 1OE0A 1KERA 2LD4A 4H4EA 4IDCA 2W2LA 1C3XA 1LUAA 3Q0IA 3MSCA 4G0WA 2LIPA 4PYIA 1J2UA 2X0RA 1A72A 2Z83A 2VJQA 3ELWA 2RHHA 3IIKA 1AG9A 4KBGA 3VPSA 3SPXA 4QL3A 3JZAA 4KXUA 3VDXA 4D97A 5IAAA 3A7EA 2I3AA 5E6UB 4RHUA 5AW2A 3EZLA 1M1YB 3F7NA 4NAVA 4TX1A 2IYAA 1UP7A 1I30A 4HLUA 1LV8A 5AW9A 2ZBDA 1Z73A 4IBOA 4NYMR 3UHJA 1SG9A 1H5NA 2X1VA 3DFZA 1CS0A 2B37A 3IHTA 4AG5A 1ZXXA 4X65B 3A6LA 1D0SA 2ZIEA 3OJOA 1WS6A 3GFTA 2J48A 1YB6A 1F6WA 1CDOA 1HQYE 3FD8A 3H5VA 1SQFA 2VTVA 4GC5A 2IXBA 2C5EA 3O4JA 4HGNA 4JX9A 3OCJA 4TXMA 3CVYA 3T3DA 1VG8A 4ZDKA 5IYZB 1H2FA 2Q3MA 5IXSA 2JCXA 1BVRA 4BFYA 1JV2B 1B0ZA 4W5TA 4H17A 1RMTA 9GPBA 5IUNC 3PUYA 2OECA 4CIAA 3EXFA 4D9HA 1KHHA 4WZ6A 2BTQA 3M7IA 1Y8QB 2D3WA 2X13A 3H19A 3AKDA 1CUEA 3GPDG 3JAWB 1V6AA 1E1RA 2RJNA 4JR2A 4S1PA 3DOUA 3KUCA 4KYVA 4FOLA 4PZCA 3E15A 4X3CA 1EX6A 3ILHA 3SE7A 4AT1A 4Y9UA 3KQYA 3WGGA 5J4VA 3EIQA 3WRYA 1QVWA 2NWQA 4J2TA 2G1AA 4BVBA 4D8YA 5KVSA 4MQLA 3ZE7A 2ZSFA 2V59A 4QNMA 4BNFA 1XCBA 2WF5A 1M3SA 2ZT6A 3UOGA 4JV5B 2NTNA 3PX2A 4JP2A 4A26A 2WP0A 2DT5A 3UENA 4CT4B 3V2GA 4MPTA 4YJ2F 3CU5A 5ECYA 1J20A 4KIJA 3DO8A 1IPEA 1YASA 2IYQA 2W0MA 4MTCA 2IPLA 1IZ7A 5ITWA 3PIDA 5C8YA 1Z07A 4G8BA 3MRSA 4MULA 1NBWB 2GFIA 1GZ4A 2JJQA 2PZGA 2XE4A 2YHIB 1SB8A 1WV1A 2A4MA 1QH1A 1Q77A 1ELOA 1PD1A 2VNKA 1SNYA 2WM8A 3HU5A 3IAM1 4RK5A 4BEVA 2P68A 2YH2A 4KMMA 1E3SA 3N87A 4OHUA 4B7XA 3ZZNA 2VDRB 3PF8A 3DKKA 3A0RB 3ACCA 3NORA 4FFRA 1QNFA 4WX2B 1IIBA 2FEPA 1LPMA 2GO7A 2RI6A 2F9LA 3IVMA 3MOSA 3O47A 2A30A 1ZUD1 3T3OA 1A0OA 3ZCTA 3PQ4A 3T1OA 4BP1A 2PSDA 1M8KA 5DHQA 3EIUA 4ETIA 3UAWA 1A1VA 1RXEA 1QE5A 2PS9A 4EP1A 1L4BA 3D6UA 2Y0DA 4OB7A 1O95A 3RVNA 3HCEA 1UBGA 4RLQA 2LPMA 3ZN2A 2DRIA 3QYPA 4G26A 4XX1A 1XPRA 1WSBA 3CW2A 4H60A 3OQJA 5IC6A 2PKQP 3FOBA 1XWWA 1OHHA 2EJBA 1LTKA 3SKXA 4CMBA 4YASA 3R7NA 2GN6A 5HM8A 2BCGY 4JBYA 2GAFA 4BKMA 5CLFA 2A3NA 4CI0B 4Y0VA 1QX4A 2AOUA 2CVZA 2VP2A 1ARZA 4MA0A 4WI1A 3LECA 1CEEA 5LPNA 1BCSB 1RWNA 4KBFA 2QA5A 4KO4S 2P9YA 1QO0A 4HP8A 4QLOA 1YRHA 1CQZA 4GBGA 4RF5A 3PGMA 3AHHA 5CVUA 4F6CA 4JHLA 5IAOA 5CEFA 3NGLA 4KVGA 3VUFA 4UASA 1RW4A 1HT2E 4GU5A 1PS8A 1N0UA 2YDYA 5AOAA 5EWJA 3DOCA 1G18A 1FRVA 5KO2A 4YRLA 1MV8A 3IP7A 4EDFA 5JNSA 1M34A 3HYCA 1WEKA 2ZB2A 1U0OC 4NV0A 1R9JA 4A8JA 2ODTX 3CCFA 4NYIR 3FMGA 2PUDA 1IBCA 2Z57A 1MVLA 2KBFA 4I4NA 1O03A 1OR8A 4Q1FA 5HCIA 4CKBA 1DC5A 3FWPA 3BREA 5B12A 1O9GA 4RETA 2WJ6A 4PO1A 4CIWA 2JD2A 4DQ0A 1E1KA 2R8BA 3QF7A 3U7GA 1HNXB 4ENUA 4FNGA 3E1SA 5J23A 3L6BA 3THXA 1SN7A 1L4KA 2VHWA 2R8YA 2Q3FA 1R5OA 3NYQA 3UT5B 2ADFA 2WBLC 2WFAA 3GAMA 2YICA 2A0YA 1GCOA 3FZYA 3GRYA 2X5OA 3E0XA 3FKSD 1M2WA 4NULA 3C6ZA 1XA3A 1QRSA 4BN4A 4HS4A 5HWSA 1FYFA 2R00C 1DIBA 4LE0A 5CT5A 2W7TA 4C01A 1HLGA 1O9BA 5K8TA 4RPCA 1DE0A 4MIKA 4TQGA 721PA 2Q5HA 3BSWA 2QD1A 4W8HA 1PHRA 3VU0A 4C04A 3H5IA 3HEAA 1W49A 2G67A 3INTA 3EDOA 3RFCA 3KAKA 2GXUA 4B4KA 1Z4KA 3IILA 3RM3A 2FSVC 1EBFA 2HZ7A 1CW2B 3M6IA 4D6YA 2GHQA 2P6UA 1Y1SA 2WMOB 4FZ5A 4HFNA 4KZKA 4BB6A 1KAEA 1NU6A 3BEOA 2PA3A 4P4UA 5AP9A 2Y1GA 1RLUA 4FXPA 1RQXA 2TMGA 4WBXC 3SEAA 3WQSB 4B0PA 4PQEA 4EW1A 3K7EA 1QU3A 1B14A 1I2ZA 2R1ZA 2VPYA 3E58A 3IT2A 3MELA 4U6SA 5HK8A 4GI5A 2VK2A 4Z7NB 1X1CA 2JGEA 3VC1A 5LOVA 4LISA 5FNVA 1R2QA 4Z4EA 1K1EA 2PZAA 3PXDA 1Z0JA 1HFKA 5LKAA 1G9SA 1W1WA 1PWZA 4KQ2A 3F8TA 3CH4B 5DTRA 3AKEA 3P0EA 1JUDA 2KJQA 4QQFA 2W4QA 1MJFA 3IDAA 4ZI7A 3PEFA 3UHFA 2JJ2D 1ENOA 3F3MA 1LA2A 4DDTA 5KKNB 1PVOA 4LHEA 3IR7A 4WLOA 5EQJB 3ZCSA 3ZGYA 3RFTA 4G5RA 4MQ6A 3RUCA 1G3IA 3X1XA 2O4UX 3FNHA 2GKGA 5FKJA 4KQ9A 1IRIA 2IW3A 1N0VC 2YNMA 3E0QA 3GUYA 3ZW8A 3ZHQA 2VSQA 4BZXA 8MHTA 1I4WA 4FOTA 2G1UA 4NONA 4FFMA 3WK8A 4Y2JA 1A2KC 2A5YB 1CULC 2OP0A 2P9ZA 3OMWA 4IJKA 4KHZA 4EGJA 4EYOA 4XWWA 3F73A 1TMKA 2CXXA 2PX5A 3OT5A 1GN9A 4EI9A 2PMFA 2BWJA 1K8YB 3D8BA 3HCOA 2XOKA 5E4FA 3PDHA 3O38A 4MR8A 1AUVA 3EMBA 3RC9A 5AKZA 4MYSA 4MKXA 2K2QB 4XJVA 1KI2A 4BUJA 2W70A 2OFOA 2A35A 3LOUA 4EBFA 1I3NA 3PHLA 2ZRGA 4RTLA 1A88A 2FE4A 3D54D 4XA8A 4DLNA 2WWHA 3AXSA 2EERA 2ZB7A 4DSUA 4QWWA 4S2UA 3ZWMA 2YHBA 4ARSA 3VA7A 3LQKA 4KNYA 4XARA 4UPEA 1X0XA 3KSDO 1HX7A 1FSSA 3RU9A 1DI0A 1BYIA 4MLZA 4NPCA 1F3OA 2QX8A 4D0NA 4QELA 3V4RA 2AMLA 2ZIGA 3LRTA 2Q1XA 1CY0A 1O4VA 2VXOA 3AR5A 2XB6A 1SQ5A 4HV4A 4BQPA 3HWRA 3W0LB 1J8FA 1KVTA 3EVFA 4O29A 2C9CA 3OHPA 4OUDB 3VKHA 2FFHA 4PN3A 2HIHA 2RH4A 3CLSC 3R3XA 3GPBA 2AFIA 2EFYA 2G09A 3CPEA 2QSJA 1K08A 3CXUA 3F9IA 3HJBA 4V02A 4WMLA 5CJPA 1CR6A 1ZI9A 2WZBA 5F2OA 3WBFA 4OI0A 3MZ0A 3OIUA 5K8IA 3FMFA 1JLRA 1RAGA 4J8PA 2JARA 4IDDA 1UKZA 3OFND 1A8PA 1P8JA 4GRDA 1JLLA 1P3Y1 2H54A 4OFWA 1CIPA 3IIMA 3QVLA 4L27A 5CFNA 4B3MB 4QA9A 5C4GB 3K96A 4YQEA 2QZPA 2CK3D 1WOMA 1YKFA 1XU4A 2CNDA 1PNTA 1JWBB 3KBBA 4LXQA 1TVEA 4OP1A 5LKRA 4QPPA 4Q1EA 3T38A 4B6GA 3K4PA 1FP4B 2PIDA 4KYTA 5IAKA 2Q3EA 4C05A 1E32A 2AX3A 1SBHA 2EGHA 1Z62A 1A8HA 1XMPA 5EUQB 2OC4A 3HA2A 1V7PC 4RGYA 4PICA 3VJMA 1JA0A 3F8SA 2QW0X 2I6GA 2FHPA 4WKCA 3ROQA 1K6IA 3O74A 3SYLA 5JS8A 3TGPA 3M5PA 2MINA 2P6NA 4MQFA 1KO5A 3KKLA 1RM3A 1DX6A 1SFRA 2ZOSA 3UK2A 4DG5A 5CEJA 2IS6A 4ZAZA 1LWOA 3RRBA 5I4BA 5I7SA 4EGQA 3GGOA 1LQ2A 4V2IA 1OW3B 1T8WA 2WDZA 3PXEA 4EBBA 1GPMA 4BJ3A 1VJ1A 2J46A 2RBEA 4BV2A 1PFWA 4OMFG 1ZAYA 3FTDA 4G25A 3AT1A 3OF5A 3EEIA 5B1YA 2R7AA 3KQPA 1ONBA 5LL6P 1E6CA 3BT7A 4ZKDA 5BMVA 4RBNA 2YWRA 4IMPA 2E87A 1Q21A 3FFBA 4WVLA 5FWXA 3BC1A 4DFDA 4TVBA 3LSYA 1AA6A 2TECE 1C7JA 1OD6A 1ZVKA 2IIQA 1QV9A 5L3VA 5GQSA 3W06A 5EQFA 3OLQA 3WZ2A 3BKXA 1XKXA 5E3IA 5A0VA 2G28A 2XBUA 4RDHA 1Y5MA 1F06A 2GKSA 5EYPA 1JTEA 1OFHA 1CS0B 1E89A 4Q03A 4ZVRA 1GAEO 4J7AA 3FPLA 3K92A 1SVIA 4LDAA 2CXQA 3W5SA 5K4HA 3GLHA 4U1RA 4RORA 1LSUA 3UMJA 2FY8A 2M6KA 4ID9A 3TW0A 1VGVA 4IFTA 4Y6RA 3T5DA 4F9FA 1BE8A 5J58A 4M88A 2AKEA 4L8VA 1WOYA 3IESA 1PZHA 1GZHB 4QC2A 3ICCA 1B73A 2QTNA 4BKPA 3WLOA 5JY6A 4ER0A 2Y1XA 3I9OA 5K1ZA 1IM8A 2GXSA 2K4MA 3F67A 3VU1A 1OX4A 1UZLA 5FBQB 4BB9A 1QC5B 3AW8A 4YRSA 1P2VA 4OHXA 4BUZA 4MO2A 1UC4B 1C1DA 2IYOA 3KXIA 3NLLA 3AFNA 1UMBB 1PZFA 2BM0A 3NIBA 4KQFA 3AB3A 1ZNWA 1OHHD 1D7OA 3MINA 3OE5A 4TT8A 5IP5A 5HKAA 2RGEA 2BF7A 4B3IA 2EDCA 1RYHA 5C80A 2WLSA 3IUBA 1H85A 4B3XA 4NZZA 1TCCA 1TGYA 2C94A 5BV7A 3WMEA 4X97A 4TMWA 1N7HA 3F5DA 2FEMA 1Q74A 2R87A 3ESCA 3PVSA 2ANBA 5EHNA 4O1MA 4BMDA 1OWLA 3T34A 2XNKA 4I4LA 1VIVA 4ZU3A 4P0TA 5B7PA 1CRQA 3SSMA 3RIGA 2TRSB 3NPAA 1KMIY 2B0CA 5EIAA 1XQ6A 1YZYA 1II8A 3DMYA 1JHOA 4Q7MB 1ENPA 5LYYA 1YL6A 3AJ9A 1HT0A 3SS7X 3ADDA 1TJPB 1XVAA 4DQVA 4W5RA 2WG0A 3EODA 4NL4H 2GPNA 4HQLA 1DAHA 4OAQA 4E2XA 3FA2A 3V6MA 4RF2A 4HEQA 1BE0A 1PUIA 2PYDA 4YYEA 5THXA 3VU9A 2H92A 5CB4B 5A62A 3RE1A 1W52X 2J9FA 3N8GA 2WPDA 2AD1A 4DABA 2RAFA 1SHKA 1RLJA 1N2XA 2GD2A 3DVAA 5HYVA 4BJHB 2EX1A 1KA9H 1LH0A 2VNSA 3K1JA 3GAFA 3N8KA 3PTZA 4GI2A 4LMAA 4LYJA 4OEHA 4KXMA 3R7BA 3AIOA 1R0LA 5HM6A 2ZE6A 1XZQA 3PGA1 4GI7A 5IN4A 3OECA 5JSKA 4US2R 3KAJA 1CDZA 1VPVA 1UJNA 5CYPA 3UPTA 4DY6A 4QM6A 1QDUA 2VO1A 3UFXA 5PGMA 4K3VA 4UPDA 3OQ6A 5CA0F 1HR0B 4J7UA 4N5NA 3WB0A 4RHEA 5J4HA 3WIUA 1DTWA 1KY2A 3HFJA 2REQA 1IK6A 5C8YB 1C0KA 3WV4A 3AVPA 1UC5B 4R83A 3NVKI 1CERA 2ECKA 3KKPA 2J87A 5G4LA 3SR0A 4CQLA 1E4EA 4UUOA 1H8HD 2YMLA 3IXQA 1NUHA 4X7MA 3TN7A 4DCMA 5GZ3A 3ND5A 4XTRA 3I62A 2EIHA 4FPXA 5B64A 5C5IA 3O7MA 1K4YA 2P11A 1U2GA 2C95A 2W58A 4FT4A 1GCAA 3JQ7B 5EVCA 5HDBB 3RUFA 3ZHCA 3RK0A 3RLIA 1LF0A 2ZDQA 3P32A 3GWZA 4YRFA 4EA9A 1SCJA 1KNQA 1AURA 2IEAA 2RHWA 2FW0A 1FVOA 4CKWB 1ZJZA 1G2QA 3JD0A 3N8HA 4KDRA 3SYMA 4MSUA 4RS3A 2UUCB 1KI7A 3OZRA 3KR2A 2J09A 2EQBA 1MR3F 4IO0A 4U7TB 1KOLA 2NZVG 4IX9A 2FSSA 1HKUA 1BW9B 2INGX 1PEYA 5KTMA 1KRWA 5LQAA 4JCOA 1QH1B 2V4MA 3RKSA 1DVRA 2AR7A 5KJCA 5KNCA 3TQIA 2QTAA 3QHQA 3S2ZA 1Y3HA 4YTEA 3DBHB 1QIFA 4DG8A 5J43A 3U19A 3DYVA 3KJNA 3SZLA 3L0SA 1DOHA 1CRWG 1QK5A 3L82B 2I1LA 2X5JO 2AMVA 3DTVB 4NENB 5FLXA 5K2MA 1K8QA 3GJ4A 3I6MA 2ZWPA 1YFZA 4ZC1A 2XGOA 5EMLA 5GMOA 2BHSA 1PR9A 2HCTA 1AO3A 3IDSA 2F2TA 4LC0A 3AGQA 2NO5A 3UAYA 3L92A 2LCIA 2GCIA 1WD5A 3OSUA 4YRGA 4BO3A 4DG9A 2R60A 4CTMA 1KJ8A 5AJWA 4E03A 4LDRA 4PYNA 1BXKA 3LCUA 1E69A 4NARA 3TSWA 2HADA 1RLTA 5G0TA 2WWIA 4O2BF 1GKUB 4EY4A 1FSFA 3TXXA 4GXRA 2Q4RA 4C2TA 4CM6A 4AQ7A 3T9EA 3R41A 3EVZA 1GGVA 1Z5UA 1SKQA 3P2KA 1E2EA 3QU5A 1E5VA 5I9TA 4CG2A 2QUJA 5A9RA 1ODLA 4CF6A 1OIVA 4IIVA 3NHZA 5JC1A 4KPEC 3JYHA 2FGKA 4LOJA 2PLRA 3ESRA 3QELA 1T36A 4J16C 5HBRA 1BOFA 4Q3DA 1ISFA 1LU9A 1W0CA 2HV8A 3FCUB 3DW1X 5DX0A 3GP3A 1G21A 2YVQA 4OJNA 2A5GA 3Q87B 1VRCA 3DZJA 5MDHA 1AUXA 3MT9A 4DGQA 3MVEA 2BBOA 3S68A 5EINA 1OC2A 1U99A 5HIJA 4EKEA 5JCPA 2D06A 1NKSA 4HDCA 4FMBB 5TJ9A 4BV8A 4GPEA 1ZVVA 3AONB 1NMZA 2ZUBA 3GLKA 3UEOA 1AQUA 2N1BA 3W5AA 1GRQA 3AVVA 2C8LA 3CCCA 4M0UA 1G8FA 5I7EA 3MWGA 3RUPA 1BWPA 2OFFA 3K5PA 1WW8A 5IDVA 2N9UA 1CC1S 4L73A 3NJ8A 2JIRA 4TZKA 5FOUA 4OGGA 5JAQA 4CKCB 5HOQA 1QZZA 4RTJA 1YA8A 2NUTA 5JDIA 1HV8A 1S96A 1Z22A 1YA4A 5GPBA 5JFOA 3QX7A 4Q6WA 5C1IA 4Z49A 2VP3A 1QHXA 2A0WA 1TIKA 3FFTA 1Q0UA 2QYOA 3H4MA 4NDNE 5FJJA 2NW6A 3T1QA 4EEXA 3UJHA 4BMSA 2GD6A 4FWBA 2GAAA 3FOAA 3KFXA 3OX4A 4GKAA 4C08A 5IARA 1B0PA 5IT5A 4ZWNA 2JI7A 2PFSA 3VJLA 3ID6C 3VYUB 1DFHA 4ZMRA 4EYEA 3WDSA 3K0BA 1DCKA 4B33A 4C21A 4N3GA 1YDMA 2HYDA 3UMMA 2B4KA 2BFNA 2GM5A 2V58A 1E2GA 1NOIA 1ZN2A 2Q29A 2PA0A 3EFOA 3MG9A 1UC9A 5K8UA 1QJ4A 1IDN1 3FCCA 3U9LA 4B9AA 4ZTUB 3UJNA 1IHOA 3KOUA 4PPFA 3GCXA 3TR5A 3VOAA 1PW5A 2EKLA 1BXRB 3C5WP 4MUMA 3NBXX 4Y2RA 5KWSA 3RYFB 5TVKA 1T9BA 1JKFA 3RC2A 4WBNB 1N6NA 4QYSA 4ZQEA 4IGAA 1KIAA 2J31A 5DOVA 2I3BA 1YDFA 1NWCA 2I4NA 4HQFA 4MS1A 5B2EA 3ACDA 1BH6A 3KWLA 5FUVA 1KR5A 4OJKA 3WGYA 4M8SA 3OOYA 1SXJB 3JALB 4HVLA 2QD4A 3K0KA 3HBFA 3H2BA 1PDVA 2VTDA 4RVUA 2PZ8A 4NMHA 2O2HA 4X84A 1RCUA 3S70A 4HYQA 2IBMA 1M54A 4FILA 1M8PA 2HJWA 1PQUA 4EHLA 3JWJA 4E12A 1O6FA 5E6RA 2AWNA 2QLBA 4YAFA 2J5KA 5CRIA 2AC4A 1THMA 1HZJA 1MIOA 1SCDA 4PZZA 5DGXA 4BNLA 3AB8A 3WRVA 5JJBA 1G42A 4JEUA 5D3KA 1HT1E 5L3QA 1J7KA 3U09A 2FVYA 4IMIB 2KI5A 2OSBA 3SM9A 1KAGA 1KO7A 1OBOA 3JRNA 1HMPA 4WXEA 1DL5A 1GYPA 1JQBA 4OFXA 2EVWX 3V00A 1XTTA 1OB2A 1A9RA 3GJXC 4O0LA 4UAVA 4US1R 1TUBB 1UMDA 3PITA 3PUVA 1NTRA 5GVRA 4B17A 3T4EA 4S1WA 2JRLA 4RESA 2RAVA 4DDMA 1XDDA 3OWXA 2ID7A 1W4CA 4LC1A 4R4JA 3SHOA 3UNXA 3ZH2A 3WP0A 1RFLA 6GPBA 2IQ5A 1JLHA 3K8QA 4Z7JA 4Q7QA 4XE5A 3O2JA 4HAOA 1W5SA 3W9BA 2NU8B 5D3MA 2O8BA 3IOEA 3IC5A 3AFMA 1YZUA 5COAA 4K9DA 5DSTA 3N8IA 2C2YA 2Q8QA 3UMVA 3BBLA 4I4TF 1KP9A 1D2NA 1ZONA 2QV0A 3JQ9A 1PYGA 2H65A 1DTSA 1G1AA 1ZSNA 2JD1A 1KFKB 2JK1A 3DONA 3EEBA 1TYBE 2FG6C 4FR0A 4HH1A 1SC1A 4CQMB 1A2BA 2VRNA 4UM7A 1TJNA 5IUKC 5CD1A 1VCHA 1FFEA 1RYZA 4UVHA 5HX7A 2BF4A 4M1OA 4F4DA 4B4VA 1T1RA 4A82A 4ZVKA 5FA6A 3PQ2A 2GFHA 1IHYA 2BUBA 2NV2B 2P5YA 3G82C 5FA8A 4D0GA 3KCNA 4P54A 3M2TA 1AC5A 2P0EA 3SC2B 3H5RA 3VYWA 3JYLA 4ALNA 2FPPB 4UUQA 1MO2A 1BJKA 2LE0A 4W9RA 1FSPA 4QJIA 2BEUA 3FYUB 1TZJA 2WTNA 3L1HA 4W9NC 4AG6A 4GMDA 4C78A 3QUQA 4IJUA 5L51A 1FFGA 3RADC 4Y6GB 3WL3A 2BGMA 2PUHA 3ZJUA 3ETCA 3TOXA 4CU2A 3H4TA 3IDFA 1GP2A 3LX5A 2O20A 3T3PB 3GGJA 3I2IA 1PZMA 3AIKA 4V3CA 1YQTA 3KQUA 1OLSA 1Z0AA 4IQ0A 4E14A 2Y67A 4NJEB 4W8GA 1E4VA 4JOSA 4Z4CA 5DHPA 1D2HA 1FFBA 3PPXA 4R5HA 3GRPA 4TT3D 1EPUA 3GI1A 3S1AA 3X1KA 3ZD9A 2WMNB 3HRIA 3L46A 1Y8ZA 4AZVA 1EP1B 3IAM6 4OJMX 4BAUA 1JILA 3O95A 3IPRA 4BWYA 3COJA 2BLNA 4B85A 2H17A 5I48A 2Y3IA 3HCCA 4RZ3A 4LBVA 5HTKA 5BPHA 5EYPB 1ZL0A 2PZEA 4QSHA 2YXLA 2YR0A 4S1TA 5CA1F 2O0JA 5H0IA 2VJKA 5HRCA 1XEFA 1EM6A 4MIYA 2Z3WA 2J0UA 3DG9A 4Z8YA 4E1AA 3GLHB 4WZBE 2LXNA 3AEQA 2Q4OA 4MEJA 4P83A 4YJ3B 3U7IA 3P27A 2BKUA 1FQOA 1WKVA 1J2JA 4C6RA 2H1WA 5ALVA 2WFMA 3SFTA 3RVJA 5E6SB 1OAOA 1W48A 3RG8A 5IT0A 3A06A 3G7UA 2ZSIA 4UPVA 1KDYA 1ISMA 5GONB 2QF7A 4TMVA 1OTYA 3O1IC 3SJUA 1B23P 4RKFA 3VO1A 2VZ0A 1HZZC 3INNA 2BBTA 4JY7A 4IJWA 3WSVA 1U80A 4ALIA 5JECA 2K7FA 3VFDA 3OPVA 2REBA 4B8WA 1LDYA 3AILA 5D5PA 2VHTA 4PLGA 3HA5A 3N0VA 2JCBA 5LIRA 4UOEA 3W6NA 5ICEA 5EXDA 1GCUA 2QLNA 1R6BX 1WWKA 2FUG6 1EWKA 4NI5A 5C5CA 5J3JA 1WAMA 1PR5A 1ZD5A 5MN4A 4UOQA 2ECQA 3ENVA 3R7DA 2IELA 4ZTBA 1PK9A 3GY0A 2M1XA 3FZEA 4A8PA 1BHQ1 3SXJA 1QAOA 4GLOA 1GTZA 4GRIA 3A2MA 4JP8A 4LWQA 4JS0A 5LN1A 1D9ZA 3ZS8A 1SD5A 2GCNA 4CR7A 1E98A 1G8YA 2AUNA 2QRPA 3BIWA 3KHUA 4MRPA 5K0NA 3W2IA 1FJ2A 3EF0A 1ESDA 4L4ZA 4OXQA 1EVKA 3NXKA 4Q1VA 4TTPA 3NWPA 4L08A 3BD7A 2YVAA 4N8DA 1VYTA 2OO5A 4HY3A 4G9GA 1FU4A 1E6EA 4DDUA 3BD8A 1JIVA 3EZGA 4MUBA 1B8OA 1L3BA 1PX0A 2VUUA 4DVJA 3RTGA 4WL0A 2FZKA 2HFJA 1I13A 1YI1A 1ZA2A 2X0JA 3U3JA 4I1YA 3FFAA 4NEQA 2ZBEA 3RAPR 1L4NA 3BK2A 4R2KA 1HOXA 4L0MA 3RFXA 4UVGA 3V7YA 1US8A 4KZPA 3I1FA 2Q0SA 2CUNA 4RTMA 5CVTA 3AERB 1P4JA 1TD1A 4YRDA 3FE2A 1SCKA 4URXR 2BFPA 4A73A 4DDWA 2W2KB 4O2BB 3M3HA 3OOEA 2WSYB 1E59A 5BT9A 1WXDA 3PEVA 4ZMSA 4LNAA 4U63A 4DYDA 2FZCA 2MYPA 2QL5A 3HR7A 5DV9A 4L4YA 5C1BA 1VKHA 3CF2A 2OAP1 3PDJA 3K2IA 1TC1A 5FD8A 1GQYA 3N7UA 1HDEA 4U7PB 1XDZA 2DQSA 1GADO 4U9UA 4YRJA 4PTLA 4R7TA 4A6XA 4LDQA 4U9IS 2XYGA 3T5MA 3WFJA 3RSLA 3CG4A 4UVEA 4KXVA 4Q39A 4RGBA 4WN9B 3KEFA 3THWA 1I3KA 3G2IA 4M6WB 4NJOA 3I6QA 1GQRA 4RM3A 5G0VA 2Q46A 2ZIWB 1CF2O 2APJA 4M22A 4O4IA 2J5BA 4KAAA 4MP3A 5AVYA 5CBPA 2E2WA 2D1TA 2XUFA 5AI6A 2EKDA 1ZK4A 2KWIA 3Q7RA 1QGUB 2NYRA 4P7GA 1G21B 1R6UA 2P9TA 3WGKA 4DSTA 3QEAZ 5KNBH 3FROA 5KQRA 1DJQA 3EHDA 3GD5A 1ZH0A 3A3KA 4QODA 2IQIA 2JGFA 4WAUA 4FE7A 4UHCA 3V4VB 3MB5A 2G17A 5ALKA 1KI9A 1C1YA 4IF6A 1HQDA 3RW9A 1G8PA 1ZJYA 2RGYA 4KTVE 3L07A 4D2IA 3DUWA 1E9RA 1T4GA 3OZVA 4J1SA 4KC0A 5BNFA 3V3TA 4RE6A 4BO0A 2B2XA 3MMPA 4OIFA 4TWRA 2CCJA 1S8OA 3SQXA 1O6GA 1ZHFA 3OLYA 5E8RA 2YJTD 3BHNA 1NVTA 1MG5A 4QQNA 1DQZA 1NQWA 4XQGA 4QD3A 1KO8A 3AU9A 4IVNA 4MQEA 1ZOLA 1PR1A 2B36A 1W2WB 2A0XA 3D3KA 3HKDA 1UKVY 3BA6A 3K0AB 4CKWA 1Z68A 2AD5A 2J32A 3BB4A 3CKYA 2XODA 3AR2A 3N2GA 3R0ZA 4FEGA 4Q9IA 4YFVA 1XQVA 3OZCA 4GI1A 1XVLA 3NHRA 3W7BA 4CQNA 1XHEA 2R7NA 1JEQB 1YULA 4J1QA 4LRXA 2H5JA 3ANNA 5B7NA 2BR4A 2AZ4A 3GNTA 5DH9A 1GQOA 2VIIA 4PEVA 3VQTA 1DIGA 4M49A 1LDEA 1Z8FA 2ZBPA 3LP5A 3QJYA 2QR5A 2G77B 2CFOA 1DRKA 4D44A 1EFVB 1EKXA 1NJGA 4BB5A 2FSFA 1UIRA 1XN4A 3MEQA 4U2GA 1FFDA 1QH0A 3Q3EA 1UFVA 2QQFA 2PGOA 4M9RA 4K6HA 3AM1A 1V5GA 1L4MA 3GRUA 1T8RA 5G53C 3RF7A 2GYVA 5CITA 1L7QA 3EOAI 2PZBA 5U9CA 3M4JA 3GXOA 4NQRA 2QTCA 2XYRA 4MB0A 4DXHA 4BLTA 2EBWA 2QW1A 3UC9A 2AVDA 2G0NA 5HCNA 1MTZA 1JBKA 1WZUA 3DHYA 4JB8A 1F2UA 2Q5LA 3JTEA 4KO1S 2PDAA 4WY5A 4DLLA 1KC3A 2X0NA 4PVCA 4YV2A 3DGFC 4EG5A 4PAWA 4EFNA 1QOPB 2OLKA 2Q6KA 2V45A 1JEYB 1XQ9A 2NU9B 3KHTA 5FFMA 2Z9DA 5BXQC 3CZQA 3AOEA 1JNXX 1IN6A 5KVVA 2J1LA 4E6PA 3ZK7A 3WFIA 1Z2EA 1MLDA 3D6VA 3G13A 5CVDA 4A36A 4LI0A 2QJTA 4X8OA 4X60A 4YXWA 3GEIA 4DRYA 5BW8A 2P4SA 1IEXA 1NN5A 4L4SA 5L7YA 3LTEA 1N77A 3G8CA 1AB6A 2VPZA 1UC8A 3R09A 4NVRA 3A6EA 4BNNA 4DQDA 3C0KA 5BORA 2IH5A 3KSMA 3MTDA 4M46A 5HQJA 5IM5A 5SZHB 2YUTA 4DWJA 1F60A 3BGDA 4IEFB 1H2RS 3RFFA 2XDWA 3WDMA 1K8RA 4DRXB 2C5SA 2JZOA 2X5KO 2QRKA 3BE6A 1OKKA 3ZIAA 3HSYA 1VMAA 4Y9TA 2Q4TA 1I8TA 4FHCA 1B6RA 2PWPA 4KGDA 4G1EB 4YDQA 1SXJA 4MHSA 1G3MA 4KNWA 4CDMA 3QVUA 5IAJA 2O2SA 5FOTA 3EBPA 4NV1A 4RANA 5DZSA 5IN5A 3RC7A 1MZVA 2CL6X 2Z1DA 5DBFA 4D3FA 3O92A 4TQUS 5ED4A 4H3SA 1KK1A 3CNNA 5JCOA 3NC1C 1X1BA 1GDDA 3ZU6A 1V6SA 4CF4A 4V1CI 2IZ5A 3AUYA 2AUMA 1JR4A 4ZO7A 2DPLA 4B7ZA 4D5EA 3GVCA 4TN1A 1N8TA 3B9PA 1JQJC 4MYCA 4YEDA 3T4XA 1PSDA 2GBLC 3P5BA 4KFCA 1RJ9A 2Z9CA 3IXMA 5FPPA 2FE1A 2ZETA 4WNAA 3OOWA 3CE6A 3GCDA 1W4LA 4OLFA 4Q4HA 4BJ5A 1OA1A 4HH0A 1ZC4A 3QWIA 2QM7A 3HYTA 2PGDA 1ZVMA 3I9FA 4ZEVA 4RDXA 2ZRQA 1XZEA 1Y4AE 2DB3A 3H4IA 2ZI9A 3O3NB 1GQ2A 4RHCA 2FPMA 3IUPA 4HDKA 3EXEA 2ODWA 2WIJA 3OCVA 1QVAA 4GVLA 1JKJB 4R1LA 4WOCA 3T95A 1D4AA 2GS9A 2VNHA 1XYVA 2ZI7A 3K1ZA 3NO4A 4XXHA 2R2AA 4YV0A 1XEWY 2B5OA 2C07A 4WLNA 1DAPA 5IAGA 4M98A 3HR4A 1NXOA 1RJDA 4WLEA 4DV3B 3EMDA 3QFHA 3NIFB 4FIZA 3ENKA 4M3NA 4NMXB 4OQEA 3F7TA 4TTSA 3TSOA 4E4TA 4YA6A 3ST7A 1K4KA 5ECDA 4ZAVA 1E61A 3BZUA 4PZPA 4G6ZA 4GRAA 2D1FA 5FPSA 4FHGA 5GOZA 3IRUA 1Y6QA 5LBTA 5C51B 1GTSA 2WAOA 4F12A 4Y2YA 2AIRA 1RM5A 4RA6A 1T5BA 4L72A 4CM8A 2MTBA 1WXIA 2P2LA 1IQRA 3VH3A 1DFGA 4NYIQ 3VDNB 1ZIDA 1QZTA 2FW6A 4AO8A 4EG7A 1SAYA 3ZGZA 3WMRA 5F9MA 3O8OA 3TF5A 4D57A 1CDDA 4JT2A 3AEQB 4JUFA 4QOIA 3TKLA 1PFUA 3BCRA 2OGSA 5H3HA 1JPJA 3K6SA 3WZMA 1JT9A 4FHFA 3G9ZA 3BIXA 1K97A 4LRWA 3A28A 4EGAA 2AOUB 5D3MB 3QOYA 3HJTA 2HWYA 2AI3A 2O07A 1KJQA 5AI9A 1T9GS 5AXDA 4LDNA 3ZE6A 3W5CA 1V7QA 2IU3A 4DBVO 2EZTA 2JC3A 3L6RA 1MMFB 3ZTWA 1JSXA 4PINA 2NQTA 2KB0A 3RS2A 2HK9A 2Q8PA 2MSNA 5JMOA 3VPFA 1DWOA 1KTIA 4IHJB 1PHPA 1VP3A 2FOLA 2OZLA 3HVIA 4GP6A 2Q9BA 5KDLA 3THRA 1I2DA 3WDKA 1HKHA 3U44A 3DZHA 3LGXA 3RU2A 2DKOA 1M2FA 2XV1A 3K30A 4RXMA 1H42A 3R8FA 3HFSA 4IFEA 4NFHA 4I7EA 4UDOA 3TI7A 3LX8A 2C2KA 1X8LA 2SBTA 3B9BA 2Q3DA 5KYXB 2QVBA 3DEYX 2VSOA 3JQ8B 4GEGA 5HOEA 3VHLB 2ATIA 2P2GA 2F1HA 2JJYA 5KJ1A 4JFRA 1IZ9A 2L17A 2VXCA 4XDYA 3C8DA 4CFYA 3AUKA 3E5NA 3GJ7A 1Y33E 3OP4A 2YIDA 2XZDA 2Q50A 3P2MA 1ISSA 4CEIB 4DV7B 4ZZ0A 4WNYA 3LG2A 5A5VA 1W5FA 2IPMA 3CBGA 2B99A 3T61A 2R84A 2WDPA 2CNLA 2W2QA 2V7QD 4U7GA 2AXPA 1EZZA 3NALA 2JLVA 2PT6A 2QY9A 5DASA 5T57A 1LX6A 4DLSA 5EWJB 1G64A 3KT6A 5L4SA 1C9KA 1NSFA 1T9CA 2ON6A 2XCUA 4CMAA 1JJFA 4TZ0A 2B9EA 2O2CA 3ZNPA 1B2RA 4P84A 1U3CA 1E5XA 4N65A 4BTEA 4CL3A 1KEKA 1GGEA 3SOZA 4N12A 2QMZA 1A1SA 4PXYA 5JZVA 4MVJE 4QUGA 2BP7B 2YBEA 3UK6A 1S3SA 1Z6TA 2R44A 3IHLA 4BGEA 4EUKA 5G3YA 2EZ4A 4M9ZA 1WMEA 4J9VA 4E15A 2UVDA 4BFXA 4XWKA 1BU8A 1VZ2A 1FS4A 3S55A 2IT1A 2PYZA 4HMOA 4JVNA 1GFSA 1OTXA 1WMDA 1NNSA 1HYHA 2QLLA 1DXQA 1OF1A 1TAHA 2RJ3A 3UWDA 3X1WA 4AMUA 8OHMA 3LDGA 3LT4A 1QFSA 1R0WA 4N0PA 4O59O 4WGFA 2H4ZA 3ZV5A 3DL7A 4UNSA 4QQ8A 5UKDA 3HJFA 4DKJA 4UQPA 2DWPA 2ODPA 2PZJA 2ADMA 2VCYA 2XD9A 4P4GA 3U3OA 4ERXA 4LW8A 1MT3A 4YP9A 5JT1A 4IKEA 2AT1A 2HGSA 3AW9A 1ZMTA 2QROA 2CFCA 3EWNA 3NX4A 1Z9BA 2ZJAA 2CLEB 4BTVA 2QSUA 1ZSYA 4H08A 2BC9A 2HA5A 1PJ8A 1R6VA 3GRVA 3RJZA 3OZEA 1PKXA 4F9GA 1V1MB 4ZTZB 3QKUA 1U3VA 2WI8A 1EWTA 5L7TA 1U0LA 2MR5A 3GHYA 1ZWKA 3MWJA 4FN4A 2VBCA 4PZAA 5ANRB 5TARA 3DNFA 1XDSA 3DULA 4JJZA 4JKIA 3JAMA 4PZ9A 5H68A 1DIHA 5ENVA 3GGPA 4JLVA 2C8JA 4PLCA 2C31A 2QN1A 1UZNA 5CURA 4JD5A 1Z0SA 2AZDA 3H5AA 5LQMA 2Z0MA 3IPAA 1NRWA 4MEBA 3FBGA 1U7UA 4N18A 1OJLA 1Q1GA 2QVXX 3EDMA 4CIBA 3S8YA 4IUDS 2CSUA 4UMVA 5HS4A 4XSHA 3BWMA 2Q28A 3U4MA 3AL3A 3R0VA 2ZRJA 5GJVC 3U1VA 4BDTA 1VFNA 2ZPAA 3D6FA 3D4NA 4K03A 5KYUA 3R6TA 2A14A 1DNPA 4TS9A 1RJFA 4QREA 4HDMA 5U4XA 3U3MA 4DV2B 2A5JA 1WSDA 2FWAA 2W8BB 4GX2A 1OFGA 4YRAA 2IH2A 1BTOA 1O9HA 5ADVA 3GFPA 1TO1E 3ZQJA 3RYHA 1Y8QA 3LKBA 3FVTA 3ZWPA 4OI1A 2E1PA 1MDBA 3U3XA 1B26A 3NH9A 4DIUA 3COVA 2FMFA 3C41J 2ZXEA 2AQHA 2D2EA 4U7FA 3RS7A 1MX5A 3ROEA 4EPWA 5C8VA 4P80A 2OO3A 1FFYA 3PC7A 4DNOA 1U2EA 3GW8A 3QU9A 4K05A 4FM9A 5CHYA 2BE9A 1X3LA 3MM4A 3DUFA 4BNVA 3QOWA 2JEYA 3PXCX 1EVJA 1NP3A 2QB5A 1BGWA 1MAHA 3KYDA 2HO4A 3JVDA 4IHJF 2VJBA 2WP8J 3KALA 1N6OA 2C4VA 2OB1A 4GGMX 3SZGA 2I87A 3O31A 3PPWA 4YO7A 4HS9A 4DV1B 2GBFA 2GTPA 2HM7A 3G2JA 2B78A 4L3VA 4AB1A 5ERGB 3WNQA 1VL0A 4F3CA 3IVGA 1ZD3A 4A91A 3BDAA 3LCMA 4GYWA 4X92A 1DARA 2EARA 3ABIA 2YMPA 1FX1A 1XHLA 4PRKA 2W2LD 3UB3A 4BBAA 3FIJA 5CBPB 1Q0SA 2A1IA 1H65A 2QG6A 3FPFA 4CKZA 4FW8A 2W6IA 1X8JA 2Q5OA 2X1MA 2RC6A 3A05A 3G2PA 3I05A 2BKLA 3O4GA 2JLRA 3KSAC 5HKKA 2A1UB 2PBRA 3HHPA 3HZZA 4QYTA 3NTRA 3PNQA 3AUTA 1DQSA 4FZVA 3BSFA 4LGCA 4IH4A 3I9LA 3LT2A 4FEYA 1N2SA 2AEFA 3H5TA 3WL4A 3M6XA 3OD5A 3W8EA 4FKMA 2C5GA 5T4EA 5G41A 3RKRA 2BGWA 3E2IA 1QGED 4G8JA 4WCVA 3U9TA 2KLBA 5K0FA 4GX1A 1ZX1A 5E9WA 4IUYA 3S40A 2QD2A 5FX2A 4EKGA 3CZ4A 4RLFA 1OAAA 1NJ8A 4TKMA 1WLYA 4MDFA 4AS2A 1Z0ZA 3KPJA 4GQBA 1Y1KE 2GF9A 4W1RA 4A92A 5IZCA 2XB2A 4YP7A 1KVQA 1UJCA 1RWMA 1X13A 2XF8A 1KDZA 1KDTA 5CP8A 3K6SB 4JQSA 2XBLA 1P1BA 1ORWA 5EAIA 1X7YB 5ED0A 4X6UA 1NFRA 3UV6A 3SD7A 1C3VA 2R9VA 1ID1A 2YZKA 3AF0A 5BMOA 3HXLA 1NX9A 2EXXA 3S44A 1QRAA 3IH5A 5JVDA 1QRRA 3EJ6A 1E20A 4PHCA 1Q7RA 1P5JA 1NMXA 4QPJC 4F3NA 2BGRA 5JJCA 2PKRA 3EX7C 3QW4B 2GVNA 2QKYA 3N53A 2B69A 1KKUA 4L75A 2I54A 4ZCMA 1ZESA 3FVWA 1XAJA 3L49A 1GA6A 2P4QA 2QVYX 3OZUA 2LGJA 4X95A 3WJ1A 3D3WB 1DO8A 1O8BA 2QNIA 1V35A 1XFAA 3FNIA 4RM2A 1RWWA 4GYKA 2FZLA 4PZUA 5J47A 3I39X 4G9EA 3GGDA 4B74A 3H8SA 4ZT5A 3RRFA 2M98A 1MT0A 1F5SA 1COWD 1I51A 2MSWA 4JLJA 1CUZA 3VPCA 4U5QA 1ZRSA 5EIXA 1XKLA 3K0EA 3HVRA 4X20B 5TIIA 3AR4A 5FUMA 2CXOA 2OCPA 2Y27A 4K9NA 3UJ8A 2JGNA 1K66A 1JHAA 4B80A 2VDOB 4DLZA 1A5ZA 1ISJA 2BDTA 2WIDA 4G0NA 3SC3A 3SSOA 4Q7JB 3VU9B 3F3KA 4XIFA 1PT9A 2DPXA 2W5UA 1M6EX 1U1DA 4EKDA 5C52B 1U1GA 4PVDA 4E2YA 3DLAA 5CYGA 5I9MA 1W4BA 2X14A 4RWEA 4DA8A 2Y8EA 1UCFA 1J39A 4WTOA 2ET6A 1AQIA 4JLOA 3S2FA 2DEUA 1BXGA 1MVNA 4ZRMA 5A71A 2J7PA 1V5WA 1TGVA 4X1YA 1KZ4A 2R0QC 2H1LA 2WKPA 2FRDA 4XASA 4D46A 2ALJA 2JHCA 3R5HA 3DBVO 1K88A 4LRUA 4A03A 3SVTA 3KQTA 2WB4A 2O8NA 3VYVA 2Z04A 2OT3B 3OOJA 3OMLA 2FETA 1QR2A 1TIBA 3CX7A 1W0KD 4PBRA 4TMXA 5LD2C 3BMOA 3HDTA 3AR8A 1FDRA 2WU1A 4QFDA 3JQAA 3HXTA 5G4KB 4JI2B 1VA4A 2GYWA 4TSRA 1RTTA 2C92A 3N6XA 5KVQA 3TMKA 3E7DA 1M1YA 2XE8A 1YZTA 4L8LA 1QOZA 3UGQA 3ZDQA 4FDLA 2J9YB 4U6NA 2HWUA 3RJ9A 4QIHA 2FYTA 1QWOA 2P8JA 2G63A 1SVKA 4MCIA 1UDXA 3CX6A 1OI3A 3MIZA 1PG2A 2JAWA 4I50A 2VBIA 3VR3A 4EPYA 3I01A 3MS2A 1NPDA 3TLGB 1Q3TA 2A3RA 1KMHA 2G40A 1VIMA 1NQOA 1R18A 1ADGA 1R0SA 2DG2A 2BSAA 4GYJA 2RB5A 3LVFO 4KQMA 1N3BA 5I7AA 5DEOA 4J0IA 3W2HA 9MHTA 4B1FA 1R3UA 3TPCA 4BKOA 4G56A 3TR6A 2N75A 1ZJ6A 3SI7A 3GLRA 4IJ5A 1PUXA 3E23A 3P96A 1ECBA 3ESXA 1MJNA 3OTGA 1ZNXA 2BGLA 4QU5A 1LRLA 4KO8A 5G3ZA 1AKVA 1YBHA 4PQYA 3HNOA 3FDFA 4RABA 5DM60 2HT1A 1L1RA 4HWOA 5AXAA 5H9VA 5I9BA 1XCOA 2OGZA 1EUQA 1XTJA 3I53A 3KXPA 2JGJA 3KZCA 3FPBA 4NENA 2OBBA 1SOAA 2WHEA 1DV2A 1WW2A 4FFDA 4JL6A 4XB6B 1TYEB 3EG9A 4Y1EA 3AVOA 3QXGA 1IEQA 2EZ8A 4KYUA 3D7RA 4D42A 4ZIRB 8AT1A 1EJ6A 3AWDA 3IP3A 3TL2A 4ND5A 2DUWA 4PO3X 4WNAB 3OU2A 3E5HA 5GV7A 4HDSB 3A26A 1AUQA 3NJRA 1AVTA 2XUQA 5L4LA 4E3WA 5K03A 1Y3BE 2HMYB 4II7A 1GOTA 1O08A 2KW5A 2NYUA 2O3JA 2FN9A 3DGEC 3H05A 3NAQA 2CY0A 1QKIA 4KQHA 4RHTA 1LLCA 3CH7A 5AWFC 4KQCA 1XD8A 1NUQA 5D5HA 1W4ZA 2F3PA 3N3AC 3DJYA 3U1BA 1VCOA 2W6CX 2WFLA 1W5TA 3GQBA 2ADOA 4Q9JA 3MWKA 5SY4A 1WCWA 2A94A 3IVRA 4IZ6A 1LJ8A 4AWXA 5BT8A 2OV1A 3EPRA 3JQBC 1F8XA 3WB2A 4LX8A 4AS3A 3HO6A 5AMXA 4YMVA 5IUJC 5BUZA 3ZK8A 3NEAA 5DFAA 4B4DA 4TRNA 1NVVQ 2ZKIA 2JFYA 1YR6A 1J8QA 1W94A 3LCVB 3T7EA 2O3QA 2B2CA 2XRFA 4NHEA 3X1MA 3TFWA 3BN3A 1G17A 2A33A 1E4EB 5EUBA 4M83A 1IE3A 1LTHR 4N3NA 4OGKA 2OMEA 2CN1A 3ZUGA 3IT3A 1UZMA 5KTTA 3I01M 3E84A 4HQOA 3T8YA 4KK4A 3OIYA 4BNGA 1QLJA 4R98A 3IAAA 1G3QA 2EJTA 4MAAA 3GLIA 2I6XA 3IQFA 3PNVA 1PEDA 3LS2A 1H6AA 3JWIA 2ZEJA 2UXCB 1T9KA 3DLCA 2ZAOA 1A77A 2DY0A 3F5FA 5AVXA 221PA 1Z16A 2RHLA 4ZV7A 5A5FA 5HKOA 4EW6A 3WBKA 1ID8A 4NZNA 3ODPA 3ZNQA 1Y9ZA 4MS3B 3Q85A 1DRJA 3BQ9A 2CCGA 4FFBA 2C9YA 5IJ0A 4C0LA 1XN1A 4GSKA 2VPQA 2DFTA 3RJMA 2F8TA 4DC1A 1PZEA 2CHQA 1ATIA 3SEFA 4CDGA 3KYCB 3FLBA 1JN0A 1Z18A 1V4NA 4DBZA 3DZDA 3QPAA 1A8SA 4P58A 1FMFA 5TDHA 2OBNA 1TA4A 4WSOA 1B8VA 3IR5A 1FXWF 1PGQA 4H6XA 4I2VA 2MYTA 521PA 5TGZA 3SBXA 1I7SB 1L3CA 2O50A 1T0UA 2Q4DA 1GGKA 2PSJA 1IHPA 1SVMA 3H3XA 1H05A 2HLDD 3KNZA 2HH9A 5DMHA 4BVJA 3R3HA 3N07A 4X3OA 1MNAA 1U6JA 2L82A 2ZBUA 4ZREA 1SU7A 4GXNA 2GPSA 2R1TA 2GAOA 2VPPA 2ZR8A 4E13A 3OQNA 4Z86A 3PQDA 2PUVA 1MW9X 3MTEA 4LXGA 1U04A 2QTVB 3TW8B 1FTGA 5AUPB 1IC6A 3KL4A 4I55B 3SHWA 1QRDA 1TVKB 3G2KA 4BVAA 5F7ZA 4HB0A 1U2QA 3LGAA 4B46A 4F84A 1DP4A 4Y1FA 2PPLA 5I5EA 3PUXA 3D1LA 2JA1A 3R3JA 4II2A 2B4QA 4IUBS 1YS2X 1I7NA 3W7VA 3AHFA 1EFRA 1U1FA 1YJCA 3IQHX 2IK8A 4LXTA 4M9UA 5D51S 3UOWA 5B7QA 4BXOB 2Z2XA 3H6KA 1EM8B 3EWSA 2C2GA 3PXXA 1BQ4A 3GFVA 3SGLA 3ANSA 2V96A 3CBQA 3GT4A 1RTKA 1GT6A 3WK6A 1GU0A 2BR5A 3QWAA 1C8KA 2XYHA 3RVBA 1U90A 4QOFA 4E88A 1DHTA 2Q3HA 4KR0A 1V41E 4TUYA 3C5CA 4WESB 2PRZA 4UD6A 2YJNA 3KQLA 1YXMA 4FFWA 4FP9A 3RODA 4QATA 4MYUA 3ZCRA 4IW3B 3EVCA 1DBIA 2Z4SA 2PUGA 4NCBA 4CQJA 1NLMA 2IIPA 4INOA 3VNAA 2UU9B 2UUBB 2OAGA 1ZFNA 1CYEA 1XO1A 1W0JA 4C3ZA 2UYCA 4O1IA 1QQ7A 4QGBA 5C3MA 2H51A 1TM1E 3G9XA 2GI4A 1F1BA 4HDOB 3MINB 2QRJA 1PJAA 1ZRMA 4J3NA 3NC4A 5FEUA 4P0PB 2DBRA 2C3OA 1NZJA 2QX7A 3EG5A 3R7SA 1E5LA 4DGSA 1PU2A 2IYWA 2YYYA 3EXIA 2O1EA 3WOVA 2D5CA 2O3UA 3BS4A 4MW6A 1BNCA 1LFDB 4UULA 4B09A 4MVJP 2A9PA 3N0XA 3QEKA 3STYA 1ZR2A 3QA3E 2CWWA 4R2LA 3UC5A 1DEHA 2OHXA 4IOLA 2JVIA 2MWMA 3HMQA 4U4AA 3Q7EA 3R77A 4G1VA 1FXWA 4PX5A 3AEKB 4BVEA 3IUJA 1RPAA 4P2BA 4J03A 1SB9A 1UWCA 2DOKA 1X7ZA 1CUSA 1Y8RA 2OTCA 2QAGA 1N1DA 3A2KA 3T5GA 1XHFA 3DE4X 3OUTA 1D2MA 3PHBE 4HAVA 2FUKA 1KU6A 1UM8A 3FUCA 3UBMA 5BRJA 4ARZB 5CB6A 3F78A 2H7YA 1IY1A 4Z54A 3U81A 1CUDA 3B38A 1S8NA 1TJYA