1WCIB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
341
structure length
335
Chain Sequence
b'AHFTFQEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 128
structure length 335
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wciB01
1T9DA 3M49A 1TRKA 1YHZA 2JGDA 1IK6A 3E9YA 1UMDA 3EYAA 1QGDA 4GM4A 1OZFA 3L84A 1UMCB 1UPAA 4JU8A 3JU3A 4K9OA 2BEWB 3KOMA 4D5EA 4WBXC 1V1MA 3DV0B 4GG1A 1B0PA 2C3YA 1PYDA 2J9FA 3ZHUA 3EXG1 4QQ8A 5HYVA 1X7ZB 4QELA 1L8AA 5K6TA 1DTWB 2BFEB 1V5FA 4D5GA 1T9BA 1OLUB 2VBFA 1WCIA 2R8OA 3FLMA 2G28A 2R5NA 5K3SA 2C3PA 3FZNA 3EXHC 2BFCB 2QTAA 3ZHVA 1U5BA 4JUCA 3UPTA 2OZLB 4JUBA 3AHEA 2O1SA 5EJ7A 3AHDA 1V1RB 2BFBA 4JUDX 5AHKA 1TKCA 2W93A 1OLXB 3EXEB 4GPEA 2EZ8A 1V16A 4FEGA 1W85B 4JD5A 2BFFA 2BP7A 1ITZA 1YD7A 2Q27A 3DVAA 1W88A 2JLAA 1R9JA 1X80B 2EZUA 4K9PA 4KXWA 2R8PA 2JI7A 5EJ5A 1X7XB 2VK8A 3AHFA 3DUFA 2QTCA 1YI1A 3HWX1 4Q9DA 3EXFA 5DGTA 1UMCA 5EJ9A 4KGDA 5ERYA 3ZHRA 2C42A 2BEWA 1UMBA 3IAFA 1YHYA 3EXHA 2PDAA 1OVMA 1NI4B 3FSJX 4XEUA 1PO7A 1RP7A 1UPCA 2WVHA 3LQ2A 2C3UA 1JSCA 2V3WA 5EJAA 1UM9A 1QS0B 1OZHA 2JI6A 2PANA 3ZHTA 2BEVB 1UPBA 1NGSA 2XT9A 3HWWA 2UZ1B 2WVAA 1V11A 1QPBA 2IHVA 1V5EA 2BFDA 5I4IA 1X7YB 2VJYA 3LPLA 2G67A 2IHTA 1OLXA 4K9QA 4ZP1A 3AHJA 2C3MA 2Y0PA 2AG0A 5DGDA 3AHIA 3UK1A 2YIDA 4RJIA 2C3OA 3EY9A 5ESDA 2Q28A 4RJKA 3AHCA 2BEUA 5C4IA 1OZGA 2XT6A 3EXIA 2J9FB 2DJIA 1X7XA 2VK4A 5EJMA 4K9MA 2IHUA 5EXEA 1GPUA 4K9LA 3OE1A 1OLSB 1WCIB 5K2OA 2EZ4A 3RIMA 1U5BB 3M34A 1NI4A 2UZAA 1T9CA 2JIBA 2VBGA 1V5GA 2JI8A 4RJJA 3EXG2 1YBHA 2BFBB 2Q5LA 4COKA 4MPJA 5HHTA 3LQ4A 1QS0A 3LQ1A 3F6BX 3AHGA 3F6EX 3DV0A 5K6RA 3D7KA 2BFFB 4KXVA 3M6LA 2BP7B 3ZHQA 3AI7A 1X7ZA 1POXA 1YNOA 2E6KA 3DVAB 4KXUA 1DTWA 2BFEA 1T9AA 1OLUA 2NXWA 2YICA 5EJ6A 4KXYA 2BFCA 3HYLA 3DUFB 1BFDA 4MPRA 5EJ8A 1X7WB 2O1XA 2OZLA 3EXFB 2Q5OA 4C7XA 1TKAA 4K9NA 5I51A 4MQ5A 1V1RA 4K9KA 2C31A 1UMBB 2XTAA 3EXHB 4KXXA 1PVDA 2EZ9A 2IEAA 3EXEA 1W85A 2PGOA 2G25A 2JGDB 2PGNA 1UMDB 1PI3A 2AG1A 1OLSA 1UM9B 4FEEA 1TKBA 2FWNA 1X80A 1MCZA 2JI9A 1V1MB 1YI0A 5DEIA 3AHHA 5IMSA 5EXDA 1V11B 2BFDB 1Q6ZA 1Y9DA 4GM0A 4MZXA 3EA4A 2EZTA 4GP9A 4JU9A 1N0HA 2Q29A 5HGXA 5EJ4A 1AY0A 2X7JA 1POWA 2WVGA 3MOSA 5HJEA 1KEKA 4JUAA 2BEUB 2Q5QA 3EXIB 2Q5JA 1V16B 3IAEA 4QPZA 2VBIA 4C7VA 3M7IA 3OOYA 4GM1A 2BEVA 5I5GA 1X7WA 1Z8NA 2UZ1A 2VK1A 2FN3A 4JUFA 1ZPDA 4MPPA 5FEMA 2JLCA 3ZHSA 1X7YA 1W88B 5I5EA 5ERXA
chains in the Genus database with same CATH superfamily
3AR5A 2GDZA 2EDCA 4LY3A 2NU8B 4F71A 1XK6A 2CHVA 1HZJA 3PRYA 2VPTA 4LK3A 4WD3A 3EASA 4Q19A 5TARA 4AZ0A 1WV0A 3X1MA 1OFTA 1DINA 2CWWA 3N2ZB 4C6HA 3ABSB 3HR4A 4CHGA 3BF8A 1G9TA 4H17A 1WCWA 4ALJA 1HDZA 1JIKA 1WVGA 5EWJB 4CNQA 1OXUA 4JGIA 1NVGA 1DX6A 2JK0A 3DHVA 4TSFA 2OL4A 3E81A 4U7GA 4JC0A 4Q37A 1K97A 4V0QA 4CMGA 4BQEA 1XG5A 2ZI6A 4FKMA 4O2BA 3RC7A 4EVSA 2ZWMA 4WBXC 4Z2AA 4DLBA 3DAOA 4O59O 3B6EA 5LZ5A 5U4XA 4YV7A 1U8EA 1KYTA 1TECE 3MJVA 4YACA 4F84A 5F77A 4BKQA 1P31A 4RQUA 1SQSA 1RT9A 5KVSA 5JECA 2Q5EA 4BVHA 4O8CA 3PHCA 1R8XA 4NEGA 4WXHA 8ABPA 3A4LA 5LWQA 4LBWA 1NRXA 3A9RA 2ZTUA 3DW3X 4BEVA 3V2GA 3JARA 1OXBB 2RFLA 3E3AA 3HC7A 4WVFA 1GLVA 3UJ9A 1VSBA 1QQ5A 3SZMA 3UA3A 4BDSA 1T9BA 1R6AA 3Q11A 1N2CE 1N0UA 1JEAA 3KJFA 4RA6B 2XKJE 2Z3ZA 4ZHQB 1QYXA 2AE1A 1NXVA 4FGWA 2AYXA 2FP4B 1G6HA 1IHOA 2JGIA 1E7YA 2BMAA 2EATA 2R7NA 2YVQA 2VTBA 4P83A 1QH8A 3GUVA 3A2MA 4GZ3A 4RSHA 4EUEA 2ZZNA 1DEOA 1LK0A 2Y9MB 3MWGA 3PICA 4AROA 2HO4A 2EF1A 1K6XA 2JFOA 3BHIA 4EB6B 3K16A 5C46F 5KWSA 2PA3A 3A32A 4CI0B 5BSWA 2VRCD 1NPDA 1XZQA 2CLOB 3SSAA 1AQUA 2AGVA 2FNAA 3BGOS 3JATB 5J40A 5C1PA 4GLFA 1X94A 1BSVA 2V4ZA 1W6RA 3QUTA 2GK4A 4FCVA 4N3CA 2W6QA 1A27A 1NP3A 1SK8A 2JB9A 3NWOA 4I55A 5L7TA 3OUUA 4TSKA 2J3LA 4BNGA 3U60B 1BKYA 4HATA 4GPEA 1CZHA 1GZ3A 2GEKA 2QP9X 2OBMA 4QFDA 4UMEA 5SY6A 2J3JA 2VNKA 4U9UA 1NR1A 2P3SA 4G67A 4PLHA 4LDNA 1U3GA 1EM8A 2ZVQX 4C08A 1ZLXA 4BY9E 1ZVVA 4C0SA 3TIIA 2CHEA 2PUTA 3P97A 1AHHA 1ITZA 3FNFA 1NFQA 1JDBC 2FPMA 2YQZA 4E2YA 1F0PA 1YMVA 3FTFA 3PCRB 5E3JA 5LKRA 1W49A 1Z07A 4HXEB 3BIFA 3AI2A 4MV8A 2TMKA 4CFYA 1OB2A 1G8JA 3L0SA 3GRUA 2H6EA 2GF0A 2MYNA 5P8WA 4OQEA 3ELYA 1Z8FA 3LDHA 4I1YA 4C2UA 2QY9A 1N36B 4RUKA 4LE2A 1AKNA 2WM8A 2PGLA 4DR7B 1I6KA 1OQAA 1GAWA 2W2OA 2NT4A 1JLRA 3MQFA 3QPBA 4WOCA 3GC6A 3O31A 3RS7A 4DARA 1Q77A 1X2BA 4AZWA 1GL3A 1O97C 4CXMA 4F4JA 1X7XB 3AHFA 4BNTA 3S44A 1ENYA 1SC1A 3W2FA 1KYQA 1NUSA 1RAAA 2R62A 4Q9NA 2B2CA 3CZCA 4BFLA 1PG2A 2TMYA 4MWZA 1PGPA 4LYJA 4YJ3F 1Z6AA 3EXFA 3O9MA 3WADA 1XD2B 2OO5A 2SKEA 2I76A 4DJJA 3WBBA 1MHPA 4ALIA 5DI3A 1VLLA 1BDMA 2P2YA 4PQEA 4DBVO 4PM4A 4DLWA 4HNVA 5IJZA 1YFLA 1NBME 3PGA1 1OGJA 5AXAA 1EE9A 3LKDA 3N0WA 3CUKA 4KAAA 1NUPA 3VDMA 1OVMA 1EVZA 1RWNA 3IPRA 4MUMA 2IP1A 5HIIA 4JI4B 1RVV1 2ZJFA 3HWSA 4KO4S 4UHBA 1AQNA 5CVEA 2YQ5A 3RVSA 2WSMA 4QOHA 1ZX1A 3EDOA 4DJDC 3WTBA 2JGFA 4WHMA 3GUYA 5CH3A 4BTEA 4XEUA 1ZITA 5BR8B 4NSNA 1L5KA 3BK2A 2A1UA 2APJA 2V9PA 4MQLA 1Z45A 2X77A 3FJYA 5DCUA 1FSZA 3T4PA 5F12A 2GAJA 2QNBA 3L18A 2PXXA 1RBQA 4Y2SA 3IP8A 2NU9A 5BVGB 1NW5A 2Z30A 4M9CA 4E94A 3Q87B 2Y1CA 3FFWA 4KWCA 5F1OA 4F6LA 5HBRA 2E4UA 4DRYA 5C51B 1MO3A 3T7DA 4L51A 3L8ZA 1XJ0A 2FZGA 3OIUA 4S05A 2B5WA 3QF4B 2RG1A 8GPBA 2X23A 4QXAA 2C9CA 5E1MA 2A67A 2OB2A 2RG7A 4XD7D 1U3TA 2O3TA 3OT5A 1UPBA 4BNFA 5HIKA 4XIIA 1D07A 1UDWA 2ZP1A 4BLVA 1JIUA 3HWWA 3ELWA 1FDRA 1E3JA 1GR0A 3GYBA 3INNA 1DX4A 3OAAD 4HQLA 5BW4A 1Q21A 3NIDB 2PAAA 4IWXA 2WWVD 2P6OA 4KPEC 1FP1D 3WI7A 3Q8XB 1GUFA 4XQ9A 4Q18A 4BP9A 2WJVA 4TVKA 3HVUA 3ZS8A 3PJEA 4CTOA 1KS9A 3UO8B 2ZRKA 1RWMA 2H1FA 3LGSA 4A8HA 5EIBC 1H0RA 4C03A 2G67A 3RYCB 2QTFA 3JQ9A 4GEGA 1J9EA 2MMCA 3E7XA 4GKKB 2ZJ0A 5CYGA 3H2ZA 5CB6A 3I04A 2A88A 3E3LA 2PUJA 1K5GA 4LF9B 3C45A 3IMFA 5FUXA 3RAPR 3SD7A 5CFLA 5DYYA 1ABBA 4MCIA 1D1SA 1LW7A 1JMVA 2JEYA 4TL9A 5J63A 3RYTC 3SJZA 3GB9A 4Q6BA 1SEPA 4HLUA 4FS3A 3F5SA 2HU2A 4KN8A 4DSAA 1VBMA 3ZGYA 4EY7A 1LWOA 5AVJA 1BRTA 2DUMA 2RDMA 1GZ6A 3OQ1A 2R1TB 3NGMA 3CRRA 4ETWA 1GZSA 2GT1A 5EHQA 3LX4A 3HEBA 3SY8A 1FTYA 3I6MA 2I65A 3LQFA 2CXPA 3NT2A 2AMYA 3ZCXA 4BNLA 4HLQB 4K0RA 4HAIA 3WWOA 2YDXA 4I1RA 3COPA 4DCOA 5C4IA 5CA1F 1ZGJA 3ZE2B 4OXXA 3E27A 1SVIA 2FUEA 4FXPA 2X9QA 3QKRA 1UZMA 1F0KA 2EFYA 2FTKE 3QENA 2EYUA 3U4AA 2Q5HA 2XUDA 4XE5A 2BE9A 2YFQA 4DRXA 3DQPA 1I4TD 1A3CA 1WMDA 1P77A 4QYWA 4W7IA 2FXIA 3WGJA 2YY5A 3R7DA 4DJAA 2FX3A 1A9OA 2B8TA 4PQGA 3K6RA 2DERA 1P1RA 2I2AA 2IZZA 2E87A 2H3HA 1A7KA 1Z63A 4V2IA 3W8FA 3SF8B 3CX7A 4MRMA 4BMDA 1FXUA 2CCKA 1W47A 2X3YA 3KYDA 5GAJA 3VPFA 1G55A 1F0NA 2ZIEA 2EZ4A 1G2OA 2HNAA 4LHEA 4LAFA 5HFJA 4G97A 2Q9UA 3GDHA 3GZNA 2OKGA 3QX7A 1P1FA 1U90A 2A86A 3GEEA 1F1JA 1HI9A 2GKGA 3ZGNA 3S7ZA 1ETUA 3W5BA 1Y8QB 1XLUA 1IY1A 2JIBA 4HQFA 2OXIA 4G6ZA 5EPOA 5A05A 3UBMA 1V5GA 1RQ2A 3OJ0A 4EVIA 1RFGE 1XWIA 4C3ZA 5FD8A 4MK4A 2VKQA 1IAQA 2PX3A 3BWVA 1L4FA 4I4CA 5H9VA 4EB3A 1ORHA 1FX0A 1IOLA 2C4MA 3QPVA 1H1LA 1JG6A 3CLKA 1EGAA 3ZTYA 5I4KA 3D6MA 4S0ZA 3U3RA 3H6KA 1LSOA 1TTHA 4BNJA 1A4RA 5G3ZA 2CSXA 5JCZA 3LX6A 2AQ8A 3B52X 4K9RA 3RH0A 4HLNA 3WMRA 1OYOA 4G0UA 5FV4A 3L0CA 1KI9A 3P9YA 3R6LA 5KTRA 1CE8B 3GROA 4U2FA 4BTLA 4F1WA 4YJHB 3PKZA 3I73A 3S0JA 2DX7A 2QYSA 5KC9A 2Z5VA 2Q9CA 5F3DA 1X7ZA 3BRWA 3N8DA 4B79A 4ABTA 3SLGA 1NE2A 1KH2A 3I9MA 1S2OA 4RZQA 4ZEWA 4YK7A 3R75A 1JHQA 1MG5A 1IHUA 4B4VA 2BEKA 3BMQA 3GY0A 3I9NA 5GM2A 3L4KA 3NBAA 4L16A 4L2IA 4RPHA 4F4HA 3SIRA 3KEFA 4J91A 2E7ZA 4B44A 4ENRA 3TTXA 5FEUA 4FR2A 3ZXUB 2ANBA 1HQKA 3FYDA 4JJFA 2ZUFA 1GYRA 1AKEA 1ZRMA 5IT9A 5GMOA 1RHJA 3FOWA 3S2FA 4DSZA 1XZKA 1G63A 3IJPA 3WXBA 5AIBA 3RU3A 1P74A 1JQDA 1M1ZA 1AK9A 3HKEA 2QRKA 4PYNA 1ZR4A 1JWLA 1E4VA 4DIKA 4PHHA 4RVFA 3OIDA 4FNAA 4BLUA 3UY4A 3ZXXA 3ZV7A 4CLRB 5A1JA 2H59A 4BO0A 3DYBA 4KX3A 3PC2A 2VSYA 3H2JA 4LXUA 4OL9A 2XMRA 3H19A 1ZVJA 2OQ2A 1RRGA 2IPMA 4IV0A 1JTFA 3GEGA 4L9WA 4QPDA 1UZUA 4IIBA 4OHVA 3S2UA 3X1JA 5BYKA 5LZ4A 2BTOA 4MQMA 4EQ6B 2B8NA 4JYCA 2XTZA 4YAIA 1IFXA 5IVIA 3MMXA 3VTKA 3WP1B 5B4TA 2FW8A 2J7PA 2NV2B 1FZQA 5IJ9A 1CZKA 2WIKA 4V0MA 3HJFA 3SP1A 2YS7A 3LWBA 1FP4A 3UJBA 1W85A 4ARZB 1EX1A 1L4HA 4K8RB 2CLSA 5KYUA 5LBUA 3IKTA 4EG3A 3FDFA 3KXDA 1PJ3A 4IH9A 4ZVSA 4TL8A 1IUNA 5DM2A 5REQB 1B76A 1U3VA 4IKOA 3SHTA 3BWMA 4WKCA 3BULA 5K01A 3F1LA 2OAEA 4AS2A 2DEUA 4W5WA 3O8OB 4Z1MD 5FBKA 1E9DA 1XTTA 1A82A 4R1SA 1JPUA 4RIHA 1R6XA 3WLPA 1OLSA 3IB6A 4TV9B 5U1PA 4W4TA 2Y3IA 5C8YB 1X80A 4OBEA 1Y89A 1VSTA 3MIZA 3PGLA 5DBHX 5DISB 1BDBA 5TNXA 3RC8A 1QCZA 1RQGA 1U0FA 5LYJB 4LJSA 3AY6A 4R9RA 2QF7A 1SH7A 5GONA 4YRBA 4AMUA 1KQ3A 4DCCA 1HBJA 1KS2A 2Y2VA 4FI3C 2YWDA 3EE6A 3VC3A 1YL7A 2G72A 5DCLA 2P5UA 1XL0A 2R8BA 3PQ4A 4EHIA 2BFDB 2NZYA 1JFTA 5EIOA 2P9BA 3PNQA 5IAKA 3DE5X 1R15A 2RGNA 1S3GA 1I3LA 2GWHA 3AP1A 2E82A 2QLTA 3LVBA 5FWYB 3SYKA 3ZWXA 3ZE7A 1S1MA 5IYZF 4C76A 4EEZA 3BTOA 2XB2A 2RGXA 4PZPA 1JJBA 2JCSA 4DQDA 3PIIA 1GADO 5THXA 3U3ZA 1BVRA 3KJGA 3ICCA 1T2AA 4WDQA 3TI7A 1EM6A 2A5YB 4DB4A 4Y2YA 1Z37A 4E5YA 3EPKA 1POWA 3QIVA 4NMMA 2AR7A 3N0TA 3PI6A 4NOMA 4BWGA 4Z4GA 4EH1A 5DNVA 4WOJA 3SYNA 1TJ3A 4LZOA 1FOEB 4NCKA 3DBVO 1Y4UA 3MGCA 3GMSA 4P4SA 2JKZA 2QVBA 1E7WA 2G3YA 1ECCA 2RK4A 1L7NA 2F43B 2QTBA 3FPKA 2FMHA 2GJ8A 3R3XA 4KE9A 3CTMA 1BD3A 1X1EA 1G8FA 3LT1A 1ZFNA 3P0EA 1KI4A 1FRZA 4IIJF 4TTIA 2CNLA 1SXPA 2R79A 3RSSA 3C7CB 1L1EA 4LYHA 5ALUA 4MZDA 4MCJA 4AUMA 1PJ4A 1U31A 2Q5JA 3UMYA 4L95C 5E8JA 4DEYA 4F8JA 5HS4A 1XQ1A 4YRLA 2ZRMA 6REQA 4NCBA 4C7VA 4D3SA 2I4IA 3B6ZA 3LBNA 4GM1A 4HSEA 4C88A 4JI5B 4A91A 4GBMA 1F8UA 4KX5A 4MUFA 4BHTA 3PTAA 2JKYA 2PL9A 4YP5A 2V3VA 3F98A 1C3LA 3FKSA 1D9XA 3IAXA 4GUAA 4I14A 1QFYA 3QTTA 3HYCA 4UNQA 1UBLS 1T2DA 1UBKS 2DFLA 4JT9A 4ZOLA 5C5DA 3UHPA 1NAIA 2BTQA 3ILVA 4TTQA 4QPCA 2F00A 1BOOA 1DC7A 1YS6A 4AO6A 4QRIA 2VF2A 3RFUA 2LDBA 3IEUA 3P9PA 4EX6A 2CHUA 2A8YA 2UUAB 2JLRA 1L5LA 1GZ7A 1EFPB 3O8QB 4NAUA 5LP6C 2PO5A 5C8ZA 1OWPA 1MOSA 3RUAA 3HXQA 3LVRE 4DCTA 3FJ1A 1MD9A 2OENG 5DM0A 4IJKA 3UG7A 16PKA 5JNVA 3ZK8A 1BDJA 3RLFA 1BQ3A 1E4YA 3IMKA 1HWYA 2PWYA 3I1FA 3V1TC 5IEJA 3LRXA 4CF7A 1GPYA 4FSXA 2WMNB 3QG1A 1CUGA 3I52A 3SDZA 1HFJA 5KNCD 4L8VA 4PS0A 1TQ4A 5C2JB 4QBHA 2NZ2A 4UBKA 1FLAA 4L72A 5FOUA 1XRSB 1FEZA 1TZKA 1XTRA 5A5FA 4KQ2A 1MVLA 1O95A 5DU2A 3HZHA 1BMFA 1A69A 1G64A 4QDJA 5T7BA 5LMUB 1JG3A 3F3SA 4KR3A 3CIOA 1UKAA 1GSOA 3HUFA 3LCMA 3PPWA 5GY7A 1TA4A 3WIUA 1CR2A 3HU3A 1Y7IA 4LNHA 4R1MA 1VDZA 2GJKA 1S96A 4GFDA 1Q22A 4BBAA 4W6QA 4B09A 2OO3A 4CIWA 5JRDS 3UJNA 2O2GA 3ROXA 1U7TA 1J7KA 3FUCA 4XSGA 1WBDA 3S1SA 2PTGA 1Z4KA 4J0EA 3GA7A 4MVXA 3WBKA 5FA8A 1NJSA 3NHLA 2FN7A 1CR4A 4G36A 3WJ7A 3H8VA 2YCLA 4D0LB 3NHYA 1RPZA 3NM4A 3WYFA 3Q6IA 3WXMA 4GS5A 1L9KA 2NZVG 1YR8A 3R3WA 4WT7A 4CODB 3LYUA 2BFCB 1IN5A 4OXIA 2QW1A 1DV2A 4I1VA 1WSDA 2D0PB 4QUAA 1VGRA 3CW8X 4C87A 4FGZA 1I1NA 1J2TA 1ADCA 4YREA 3MLEA 3M4ZA 5ALYA 3RTEA 3NFRA 1YXMA 4P36A 4JN6B 1JKIA 3JQRA 4NPCA 3I2JA 5C3MA 3MRSA 3O7MA 3LYLA 3PEUA 3KB2A 2H2HA 1M1YA 1ZMOA 3R7SA 4FZVA 1NXPA 4JV5B 2BISA 3EGWA 5CVVA 4O2RA 4FBLA 1E2MA 4Z0PA 5LXTB 4W5NA 4A26A 4DYHA 3GF4A 4LX0A 1DRUA 621PA 1GD1O 2O2JA 2AT1A 4IDHA 1P6XA 1T5OA 1Y8CA 1SBIA 1UBOS 2EZ8A 3DEFA 4G0OA 3ZV5A 1U7PA 4DBLE 5GWXA 5JMTA 1E7MA 5GP1A 1OFGA 1ZXBA 3TWOA 2AUNA 2Z8XA 2H7CA 4IIGA 1ZQ9A 3KQQA 2NVOA 4HH1A 1DIBA 3OQMA 3RSGA 3N87A 3K70D 3VZQA 1NSYA 3IEVA 3U4HA 4NZNA 4DDVA 1ZOPA 1V4VA 3NP9A 4U9HS 4TS4A 4E3ZA 2JLYA 1FSPA 1M5UA 1SUEA 1Q1NA 4R0VA 4C0WA 1DMSA 1KZ6A 2FRDC 3GG9A 2DT5A 4XA8A 3QF7A 1NVAA 4PC6A 5PNTA 3RK4A 2BR3A 3QU9A 1G3UA 1RFLA 3WLIA 2DFNA 4EIWA 1CP3A 1ZXLA 2YC2C 1HDYA 3G6KA 3OE7A 1OWLA 4N4AA 2VF7A 3NHPA 3T5BA 4H7IA 4PNZA 3DUFA 3VDRA 4XQ0A 3K1ZA 1ZD4A 2QRGA 1OT5A 1OMOA 3CIFA 3TX2A 2ZJ7A 3MMZA 1YI1A 1V8BA 3Q3CA 4ZRMA 5BW6B 1PV1A 1NNLA 1Q57A 4X9XA 3BSYA 2XMSA 1OGYA 4MRSA 5DLQC 2C04A 4I5GA 1Y63A 2IYTA 3PC6A 4DMHA 4EZBA 3DGEC 4N01A 3GCZA 4TQAA 1DADA 3I09A 1U4NA 5EJ9A 4DBLC 4D3XA 1QKJA 1U98A 3PNVA 2JCVA 4ZCLA 1OBVA 1NR7A 4HGNA 3UM9A 5AESA 1AS2A 1I4LD 3BDVA 1HV8A 4U7DA 4BX3A 1LFAA 1YS9A 3P8ZA 2HV8A 2W6JA 5E38A 4CEJA 4J43A 1OCEA 1RBYA 4QOIA 4TKVB 3VYRB 4PPNA 2GZSA 1ZYUA 1HNXB 1QONA 1EKXA 2Y67A 2J7PD 3B85A 1VIYA 4RLFA 3EFBA 1JT2A 1GN9A 3DOUA 4G25A 4M1SA 4NCJA 1XD9A 2VLBA 3HVHA 1UOPA 4LNAA 5JAQA 3VHLB 2LKDA 4FYVA 1VQ1A 3E15A 4YBZA 5EUMA 3LQ2A 3KL2A 5AUQA 2Y99A 3CWCA 4EBFA 4Q4AB 2HAEA 3VO8A 3KDPA 2NX2A 3AC0A 2P9YA 4OI0A 2WYOA 1XRJA 2TRSB 3RVQA 1BXKA 2QZPA 3G9UA 2WZBA 3WR5A 3CVOA 5GV8A 2C1ZA 3VTZA 4WXYB 4WJLA 4XX0A 5AVWA 2XTJA 4OHYA 5EKTA 1OZHA 1UDAA 1ZBDA 4OHPA 1VA4A 4E22A 2X9GA 1N6LA 3FF1A 2QMEA 2WM2A 4W1PA 1AS3A 1YRBA 4QA9A 5HKKD 2X0NA 2EU8A 2WABA 3AOGA 2BKXA 2O8DB 5K4GA 3IUSA 5JI3E 5IUJC 4B87A 3EULA 2WJWA 4B31A 3MMPA 2HLPA 5FUVA 4K8OA 2HT6A 2VF8A 4FOSA 3VR2A 3ZR4B 4FEYA 4NU6A 1HDEA 3R41A 4U2CA 5DK4A 4KREA 1IBCA 5I7HA 2HCFA 3B20A 2OG2A 4YPVA 4BRZA 4YQEA 3W79A 4F6RA 2QUKA 3ZG6A 1JSXA 2XVAA 4PNEA 4ZYXA 1E3WB 1B6TA 2NUPB 3ACBA 4MH0R 2JIDA 3ETCA 2Z58A 3CRVA 3HI6A 4LXGA 1RTKA 4RAOA 4ZK2A 4TMWA 3DAFA 4DMLA 4ZP1A 1C0EA 1D4ZA 1JN0A 4RKWA 4AO7A 5BW8A 2ZUBA 1H2RS 2C3MA 3CF2A 4I1PA 3PIDA 1VBKA 1OYWA 2YVUA 2DZDA 3UICA 2I22A 3OIVA 4C7OB 1GG2A 1MEEA 1R0LA 1S01A 3HCWA 3LK6A 5LZ7A 1IBRA 3ZLVA 3FUVA 3QU5A 4UHHA 4DC9A 3GZ4A 1FFWA 4BEJA 4OI4A 2G40A 2O7RA 4P3NA 3SNKA 4HQ6A 3ZHZA 5AM1A 3C8DA 2OQVA 2DBRA 2OORC 2EGHA 4MLZA 3IA2A 4YO8A 5F51A 4DR4B 1WABA 2PMCA 3TBFA 4IJQA 1PFUA 1TUBB 4UXHA 3V7NA 4ZFNA 2WKQA 4JJZA 2BBOA 1P2UA 2IU4A 4BCDA 4WINA 1I3MA 4PAOA 7ADHA 5ARBA 5LZ2A 4IV5A 1HA3A 4EKEA 4D8WA 5ES3A 4AI6A 4B3DA 5FO0A 2GYYA 1U7XA 4I5DA 4ILEA 5G02A 5C8VA 2W22A 2VJNA 4WN9B 3ZE8A 2R86A 3W90A 1XALA 4FI3F 4ALLA 5JTUA 1R5NA 1K86A 4WTOA 1D1TA 1TOAA 2GUGA 4L5AA 2IHUA 3HBMA 1WXHA 4FYMA 4E5UA 4H4DA 4R40A 2BYTA 3OTIA 2QTMA 4KSYA 3EBLA 1PLLA 1UADA 3E7PA 4LDQA 1FSSA 4I66A 3H75A 3E9CA 3FKSD 2VYCA 4I19A 5DGXA 1FP2A 4R1PA 2WAOA 1PR3A 4OFWA 1EFHA 4R1OA 1M1NA 3GT7A 3P1JA 1L7AA 3KZXA 4TL6A 1GNLA 2QR3A 3IOCA 5K3FA 3VHXB 5CG1A 1FJXA 4YP6A 3ORHA 5KJ1A 2OBBA 2AEMA 2NZUG 2O1WA 3LFUA 2GPNA 2VBCA 1R0RE 1Z75A 1JAXA 2WU3A 2PE5A 5TV2A 3KQKA 2H2GA 1FFCA 2I67A 3O1JC 4ABYA 5B36A 3OMXA 3MJRA 3N8GA 5ALDA 3SOPA 2BAGA 4RJJA 4DM7A 4C2TA 4D4KA 3FFAA 4HNGA 1GGVA 5JS6A 4FFOA 4XCQA 5JZVA 3NIBA 1VGVA 2GM9A 1OJ7A 3P9RA 4TKZA 4F3KA 3MJSA 4PN7A 1FFBA 3E23A 1PNQA 1KZ1A 2Q1XA 4YUVA 1KBOA 3WK4A 3CLTD 4F21A 4WXPA 1J06A 3E0XA 3M9XA 1CUIA 1M1XB 3EISA 1WU8A 3S2ZA 1U0NA 1XDWA 4LOJA 3OOEA 4QFMA 5A2GA 2QTWB 5K6RA 3FVTA 1AGPA 1EHIA 4X7MA 4Q4JB 2DG2A 3BN3A 1QHYA 1ECPA 5T8KC 4BQPA 5I47A 4I46A 4RULA 4U7JA 2WZDA 1FMFA 2QLJA 4OLFA 2WF8A 5KJ6A 1MAVA 5TEVA 1R6BX 4UCFA 4IHKA 3GT4A 4JJ4A 4CCWA 4EG1A 3RODA 4UDXX 4YRAA 4EBBA 4R2WA 4O2AA 2IE0A 3ZE6A 2IPXA 1WXWA 2WG1A 3PXBA 4QX6A 4AZ3A 2Q2WA 1FNDA 2I33A 4X95A 1MC4A 5DTIA 4PX9A 1EUCB 5FPQA 1HNWB 2HHJA 1AV6A 1HZZA 1E5LA 1MXHA 1YGPA 1DBWA 3FWPA 4LXTA 4HEA6 5CU7A 1MW8X 1P9RA 2A9FA 2P9HA 5C37A 1GJRA 2WFLA 4FD2A 1QIKA 5FBRB 1JYFA 1NFFA 3UAGA 1QYVA 2FEOA 4RVNA 3TRIA 2Y9PB 2BFPA 3M6IA 4I5IA 4UCXA 3ONVA 5D01A 1Q7TA 1Z62A 2FOIA 4ZI7A 1TKAA 2NO9A 2P7HA 4HDAA 1DGQA 3BWBA 2K87A 2LW7A 3ETEA 821PA 1C8KA 2X1MA 4XB2A 4DV4B 3QLJA 4OMDA 1HO3A 1PL0A 3KFVA 3NONA 4RVCA 1IPHA 2CL6X 2QRQA 3O4JA 4XGKA 4XM2A 1SAYA 4WEOA 5A7GA 3IVRA 3GLIA 1OKKD 1CWUA 2ZDHA 1L7DA 1K1EA 2QN8A 4IHJF 4PV7A 3STWA 5JANA 2C8KA 1T4MA 3PJRA 1XYVA 2LNDA 1NNI1 1DAMA 2Z8YA 3DZKA 1SCIA 5IZ4A 5CX1A 3LH5A 4GR5A 4DMGA 4WZAB 1EUQA 1XTQA 2FN8A 5SYMA 3TGWA 2F67A 2Y1GA 1U2QA 3TEFA 3L7BA 5KTOA 1C0LA 2AOUB 3E7WA 1QXSA 3FZGA 1JLLA 2WTNA 1B1CA 1CRQA 3GEBA 4L0DA 5TMDA 1JHZA 1Q7CA 1W9MA 1Y33E 1SVUA 5BQXA 4WCFA 2HA2A 2GPYA 2RHWA 4MJLA 5ITZB 5CX4A 1P1KA 2Z6AA 1WLYA 4AKHA 3HXLA 3HKDB 4L02A 3GP5A 4EY8A 3CKKA 1P4SA 2FWIA 3FA2A 2C97A 4AY4A 3BCHA 1TJ5A 3O7WA 2H00A 2NQTA 2ZAYA 4DR1B 1ZU4A 5G40A 3S4YA 2FPIB 3B1KA 1IU9A 3FGPA 1LK5A 1I7NA 1P9OA 1Q3TA 2WAYA 2WF7A 3A6LA 3KHUA 1ND5A 4B8ZA 2WTAA 4EOGA 1DLJA 1QYDA 1R9NA 3ND6A 3RGWS 3HPRA 5JH7F 2H1VA 2ZVJA 3CG4A 4HB0A 1C4XA 3LRTA 5L95A 2V1UA 4Z9FA 1NX9A 4YUZA 3OE7D 5CYOA 5CT5A 1JB9A 2AXEA 3KUCA 1RHMA 4DEXA 3TPFA 4UBJA 3PJDA 2EJUA 2E4YA 1MJGA 2GK7A 1QM5A 3MJFA 4U8HA 3W8RA 1SG6A 1HNZB 2OHXA 2DAPA 2X9VA 3PGVA 1NZJA 1PZEA 2EQAA 2YZMA 1CRWG 1RPJA 4GHWA 1MPXA 1NMYA 3TIVA 3U49A 2XZTA 3G0DA 4M87A 5EKUA 2OCYC 1YC5A 3V8BA 5C32A 3WQRA 4DY6A 2FW1A 3IQGX 1M5TA 4KDCA 2VAWA 1II0A 5CIYA 1ISMA 1JG4A 4F85A 2CZQA 1BHSA 2G0TA 3IQIX 5BN3A 2A0XA 1RJEA 2ABWA 5SY4A 1AUQA 1L2TA 2COUA 3KFLA 1DBIA 3PJFA 4YCNA 4WCVA 3CVUA 3E9ZA 4OAOA 1TM4E 2XF8A 3UJCA 2J5RA 1VHWA 2JAHA 3QLVA 4MUNA 3ZI4A 3BWYA 3LUGA 4HX9A 2HPZA 2A0YA 4FZJA 3IQHX 4ZVPA 3S1AB 1KSJA 4RORA 1E96A 3CT4A 4MVWA 2YYZA 4EZEA 1OHHA 2JLBA 2XNSA 3RV4A 3VTAA 1QNLA 3AEQB 4FYPA 1K2WA 1QB7A 2H7VA 2PWAA 2H9YA 3G8CA 3U4DA 2XNDA 4JNKA 3RTBA 1Y6GA 2BEUB 2F1HA 2C20A 2QI9C 1ZI8A 1IL0A 3LNCA 2J6HA 2OGUA 4DFDA 1TZMA 5B6PA 4CCSA 3G0CA 3T1NA 1XMIA 4U2KA 4UUOA 2HBYA 2VUSA 5JE8A 2PUWA 3QVXA 4UULA 3L8DA 4EPVA 2DHRA 4YRSA 4AS1A 3V8EA 5SYNA 4OHZA 4P92A 2C84A 3OJWA 3JALB 1BS2A 5HDBB 5LLDA 1W9HA 1SCDA 4DJEC 2QX9A 1P8AA 2XGMA 5JYCA 3VUEA 1YFZA 2EBWA 3PL5A 2J8ZA 1CJMA 3BORA 1ZVQA 5H83A 1WZCA 3T3EA 1IVYA 2PUVA 3VR2D 1T0HB 1YMQA 1DC3A 2DQSA 1V6SA 4FWBA 3I6QA 1H94A 1U2PA 3OUZA 3OF3A 2FUCA 5FI3A 1Y48E 4GX5A 4JC4A 4R2XA 2KYRA 3EQ9A 4J0DA 4OQPA 1YMUA 3H9EO 3HLYA 4W8OA 5KWVA 3FPLA 1ULHA 3BWEA 3D7NA 4IX1A 4YHBA 5KCMA 3N9IA 4TTRA 2OLJA 4JKIA 1NVKA 4H31A 1F06A 2R6FA 3KT0A 2Z2ZA 3VBCA 3IO5A 2A0FA 4MWDA 1LI7A 1OXSC 5FAXA 3H8WA 1CEQA 4MV4A 4AG3A 2IPNA 4BMNA 5A6VA 5FUYA 1U2GC 4GZLA 1D6JA 1XTSA 4IQ8A 3AJ8A 2E5LB 3OFJA 4RIFA 5HCIA 1OAOC 5DRTA 1J1ZA 1JXOA 1SOWA 2EVWX 1XLTC 1L7MA 2N3ZA 2RK3A 2VZ8A 3WTCA 2GM4A 1C1XA 2DULA 2QYHA 1Q74A 2BIFA 3M89A 2OCLA 3U1TA 2ZI5A 4JLJA 3THYA 5DBEX 2BMEA 4J2HA 2IA5A 2PLAA 4C0HA 3DC2A 1W4ZA 2OZKA 2VHUA 2PGAA 1Q95A 1DKNA 4ASUA 4GPD1 2FE4A 2FPWA 3O8CA 2XDQA 1EP1B 3RYIB 4ZZ0A 1TB4A 3LD9A 2B20A 5MGBA 3IX7A 2G63A 2OESA 4KV7A 3ILHA 4NMLA 3WSWA 3PNBA 4GPTA 4GDMA 4DLXA 3SS8A 3GLKA 2H57A 3QWIA 5K2MA 2Z3VA 4XGRA 4EJ6A 5ADUS 3SXJA 2GJ9A 3C7AA 3C98A 3SC2A 5AVXA 5KYXA 4HQKA 5G4KB 5HKBA 1RPTA 1WXFA 3FCEA 2AW5A 4FGJA 3PQ6A 4D80A 3DLCA 4QD3A 1I30A 2DPGA 1G6KA 2EERA 2OGTA 5KAMA 5DN6D 2C3PA 4N41A 2HJWA 2Z9BA 1BIFA 2D0OB 1RP1A 1X1QA 5TY0A 5BQPA 9ATCA 4NFHA 4W5TA 1SQFA 1SD1A 2GPJA 1YBMA 3A1TA 4JUBA 3ROGA 2EKQA 3DAYA 4JFAA 4LDRA 4WESB 1CDEA 1TAGA 2JAUA 2YWRA 2O1SA 3BXHA 4AJKA 4ZA2A 4RD1A 3DBLA 4YUXA 2Q0SA 5TS3A 4EA6A 4XTRA 4W5OA 4OQXA 5T4FA 4JUDX 4PBTA 1R74A 1Z08A 3ESXA 3FD8A 1A9YA 1TMGE 3KLMX 1E94E 4YQYA 2M6RA 3DEKA 4Q1DA 1EWTA 2ID4A 2YVLA 4YAWA 1C81A 3CH7A 4ZGWA 4DAEA 3D7SA 4E13A 2PA0A 3B1VA 1F6DA 2F8MA 3AJAA 1N78A 3RC3A 4D9HA 1VG0B 3A37A 4FEGA 5B2FA 1AG9A 2C0QA 3INYA 3LP5A 2A35A 2O3UA 1C0IA 1WUHS 1XEXA 2DGDA 3CNQS 2PSHA 3LC0A 3TSCA 3V3KA 1JAHA 2QN2A 2JBWA 3MBIA 3TTYA 3X1ZA 4K6OA 3QVMA 3UAYA 3PR1A 2CNDA 3ER8A 4Z0TA 3KK0A 3W1VA 1YD7A 3AVWA 2YBDA 1MB9A 1C14A 2W48A 3NH6A 3WO0A 3MWFA 2QL6A 5AJZA 4UAGA 1LVHA 4M1TA 1QRSA 2XUHA 4E21A 4KIFA 5KQGA 2VPPA 2WT4A 5EZYF 4S24A 4F4DA 4WGGA 2CJXA 4H1WA 3F9RA 4DA4A 2HLDD 4O1MA 2POQX 2C9ZA 1TEZA 2ZAGA 3JQ9C 4A82A 1SZJG 4KXWA 4QSMA 5EJ5A 4OY3A 2CXOA 2OSVA 2WW8A 4ERXA 4Y2JA 3OSZA 3P5BA 3TW0A 5TPWB 3H5RA 5C53B 5C81A 5GJWC 1L8QA 5SYAA 3LIPA 1CUCA 1GKYA 1PFQA 1CUYA 2PSDA 1H3FA 3GH3A 4NV0A 1E0JA 1R5OA 3JS5A 4F9TA 5B4VA 5C8XA 4PCUA 3MWLA 4URUR 4HLUC 1QZUA 3FGNA 5JLJA 1IZYA 3WGQA 1G2PA 5IWAB 5LJLA 5ERYA 1DAEA 1VL1A 3EIQA 1DCTA 1KJ8A 1XPJA 3EA0A 1KAGA 2AZMA 1N0VC 1KEEA 3FETA 5EIFA 1C3OB 4II2A 4C20A 4JS0A 2GZ2A 5J4KA 4WKPA 2CYBA 1ZNZA 1VKNA 4XGIA 5I45A 3NAGA 1YQDA 3GJ7A 3DT8A 4ZGBA 4L9SA 4IWYA 2DUUA 1WPXA 2D7JA 2R8YA 3JR3A 1R0SA 1PJ2A 1VM6A 2E89A 3FYUC 3FTCA 4NS1A 5WRFA 1Z2NX 1Z3IX 5A4KA 1U8UA 3SGLA 1OX4A 2VDPB 2V03A 2XBUA 3U31A 3DMTA 4O33A 1HLPA 3DHEA 3VI4B 4N3AA 1Y42X 4N49A 3X2SA 4R8MA 3JQGB 4A73A 3W1EA 4WQMA 1KJZA 3ZU3A 4CQMB 1QK5A 4BEWA 2C2WA 3NYQA 3QWAA 3L0IB 4ZVLA 5ED4A 5A2QA 3HFJA 5I8PA 1CC1S 1JEOA 3STXA 1L8OA 1NURA 1IB6A 1IG0A 3CN7A 1YB2A 4X1OA 5EE0A 4MHSA 3REOA 3DNMA 1DB3A 1HLFA 1U1IA 1A7UA 1UJNA 1NG9A 3VO1A 4C6RA 4YUAA 1UDBA 3OEED 4R8RA 3RPEA 5ISMA 3D59A 2D00A 2H1WA 2G17A 2XT9A 1WCYA 4N5DA 3PNMA 1NMZA 2ZTHA 1P0QA 2QL5A 5DOZA 4HDMB 5E9QA 2ZG6A 1J33A 2WVAA 1JXMA 1NUTA 1TF7A 2WSBA 3FYTA 3LUAA 4TTAA 2W2KB 2IHVA 3H2GA 3WLQA 4C5CA 4CM8A 4ESEA 3U44A 2ISSD 1PW5A 4MDYA 6ADHA 1QHHB 2IYXA 4RHTA 1PFKA 4YR9A 2C4VA 3D8UA 5ANRB 2XSZA 1ZA1A 1SJ9A 2FMFA 4FX2A 3RAGA 4YQFA 4O4HF 2IHTA 5JAOA 3WWPA 2YWHA 2GM3A 1J8MF 4QAJA 2FZ4A 2GBLA 2H8GA 1NVVR 4BE9A 4BP8A 1V26A 3KIPA 4HYQA 2UAGA 1WHSA 5DHQA 5FDFA 4QJ3A 1OV4A 2YYAA 2QX6A 4R8LA 5HPYB 5DGDA 1LU9A 3AEKA 1X7HA 3AHIA 1T2FA 5IBRA 1KJ9A 3WKAA 1T4CA 4IIVA 3DAHA 5CGZA 4RMGA 3TOCA 4EHFA 5KU7A 5D00A 1F2DA 4URFA 2AFHA 3QRWA 4XR9A 1T8RA 4V0ME 2VZLA 2DVMA 3CSUA 4BN0A 3LPMA 2P1ZA 2AA3A 3G89A 1ZKMA 3AHCA 2E5WA 1Z26A 3WK8A 4B74A 3KEGA 3DV9A 1XWWA 1X14A 5H70A 3WGTA 4AS3A 4EA9A 1I24A 4X91A 2AJDA 4L5CA 4QBGB 4G5XA 3UBTA 2JFFA 3USCS 3C3EA 2J59A 4BPRA 1L6RA 5E6RA 4ZGGA 3WNCA 4QG3A 1OHHD 1EGVB 2OVBA 3GQVA 3EQ2A 4M0UA 3V2UA 3WHIA 3I5XA 1PS9A 3MTGA 3ZLUA 1O94A 2Y1KA 2C2XA 4F4UA 1PV4A 1JA0A 2BI8A 5KJFA 3JVVA 1XMSA 2BM1A 4O4IB 4QNNA 2A33A 4IRMA 5K6AA 1K66A 3RF6A 5EESA 4OB8A 1ZMRA 2FMXA 1ZVMA 3BFJA 4AURA 5IPFA 3TQTA 5F2EA 1G8MA 3GVIA 3G2KA 5J2UA 1I3NA 2BGMA 4X8OA 4LF6B 1LBHA 2QVCA 1QG6A 3H86A 2G70A 5K2OA 5KYKA 4FBGA 2IYVA 5TQ2B 3RIMA 1X7GA 3GA0A 2GD1O 5GJCA 1II8A 5AVSA 4FOOA 2OMKA 1TK2A 5HDQA 3WGYA 5BQFA 3NNNA 2LCIA 4PYKA 4QDUA 3JPYA 1NI4A 1Y3BE 2VJKA 3E8SA 2BHLA 2JDIA 1QGUB 1UT6A 1MENA 3MYRA 4XXHA 3DCYA 3WRXA 3I3OA 4PVDA 4JL5A 2E48A 1CQIA 4IQ4A 1W0KA 1TZ2A 2PY6A 4O29A 4ZVQA 5CAEB 4L5IA 2MSWA 1YR7A 1Y80A 2FSVA 1P2SA 1RQLA 2PJDA 3DE3X 2Q7OE 3WFIA 4BO8A 1M6HA 2BV3A 4PGHA 4RQBA 4JROA 2V0CA 4HS9A 3L92A 2MJLA 1XZAA 5JBIA 3QUCA 1ZN8A 1B41A 1VFPA 4LF5B 4WBNB 5AT1A 4DR6B 3Q3JB 1DARA 3KAPA 2C5LA 3AHGA 4KPUB 3BSFA 2PKQO 5EG5A 2QI9F 2VPWA 1X0VA 3EWAA 1I10A 1Z83A 2GLUA 3QPWA 1KIAA 3T3PB 5BN1A 3SQOA 1DMRA 3TFWA 3IR5A 1EG7A 4DEVA 3EXAA 3M6LA 4JMLA 1KQOA 4HPWA 2K6GA 2VN8A 4FQ7A 3U9TA 1TFUA 4QTYA 2VH2A 1EE1A 3ZV4A 2DY0A 2ZRHA 4N76A 1PF7E 3O9VA 2O3JA 1DTWA 1FW6A 4KLRA 5TX7A 1UIRA 1UFOA 3AR8A 3JV7A 4FYYA 4OYRA 3UQZA 1FDWA 2I1LA 1PGOA 3AOEC 3NASA 4RMIA 2A78A 4WOPA 2ECQA 1OLUA 3FSRA 3QYAA 1WG8A 2J5KA 1SXQA 3FIJA 2QPLA 2W90A 4EGAA 5DHSA 5JXHA 1D8TA 4NYMR 4GKJB 4I55F 5JUWA 1YK1A 4IIXA 3TVYA 1BS9A 4CMBA 4F5YA 1E79A 3IP9A 4PFJA 2HJHA 1I8TA 5IAGA 4P0PB 1M7HA 4H1HA 5JZ9A 3TCNA 4MPRA 3N2YA 4XQCA 2ZZMA 4AYTA 1K5PA 4P54A 1W0CA 2I2FA 4F7DA 3OZEA 4ERNA 3HCAA 1ODJA 4Q00A 1HTTA 3PS9A 4BO5A 1NM5A 3PR3A 3BD9A 5KKCA 3AB7A 2HMWA 1NTRA 5IBPA 1UFQA 1EWRA 4GH5A 3N07A 2FQXA 2XTAA 3FHLA 4YJ2B 2ZIVB 2VYQA 4IDNA 3LHDA 2GYWA 3AF3A 2BUAA 3FCOA 5FUQA 3FNRA 3IE0A 3CN9A 2XKAA 4CKZA 3K9FC 3OLCX 5B6JA 4GOOD 4ND6A 1Z22A 2ANCA 4UC0A 2WWIA 4A8PA 2A9QA 1KK3A 4B8WA 2EJTA 1L1RA 1FQOA 1VE7A 3WBFA 2OZEA 3WLSA 1U3DA 3ILXA 5CVJA 4INJA 1V71A 3KUXA 4V0RA 1E7RA 1YFKA 2F6RA 1K7EB 1GQQA 3CUYA 3HJCA 2OBYA 3Q9UA 4JJEA 1SRQA 3B5EA 1A2BA 1APBA 1NNEA 1ODFA 4S0XA 4WJZA 4AK9A 1YOVB 4JWKA 3B53X 5ITWA 1QF6A 4YX9A 3M5PA 3FTEA 1GA4A 4DN6A 3HSYA 5DXFA 3NHZA 3OX4A 3NR2A 2Q4DA 1BQ4A 1WW3A 4KQKA 3HCFA 1VA5A 1MORA 2JAPA 3KZVA 1N92A 3VOBA 1EXDA 2XLCA 3O2JA 2HPVA 1N2ZA 2IY7A 2WG2A 1SOMA 2CFIA 1MQ9A 3BREA 3PFKA 4FGLA 4JJKA 4V0SA 3GRAA 5AKLA 3STUA 4ZCRA 2HU5A 3D6FA 3U0BA 1H4SA 1P72A 3AUYA 1LPMA 3OT1B 3P9ZA 4XUDA 3DTVA 5B7QA 3HB0A 2AKAB 1U7HA 1PL8A 1R37A 5FYQA 5CDUA 4RDXA 5HW0A 1E3EA 3MTAA 4Q7JB 1XNJA 4OXQA 3SIWA 1CD5A 1S7GA 3W0LB 3A1UA 5DHAA 4LJKA 2B6HA 5H8WA 2OUKA 1CQZA 2MT9A 3F8WA 4FPXA 4JL8A 2OY0A 1W2WB 3M8KA 4LJ6A 4QHSA 3QA3E 3R5FA 1GV0A 1T5IA 5LCXA 2EKLA 3KKMA 3IPCA 3AILA 3D7RA 3I45A 4P7FA 3IHTA 2XCLA 1DO0A 1KMNA 3CX8A 3LXUX 4EHKA 3S81A 3O8DA 4DG9A 3JQFC 2IXFA 3CCFA 3E8XA 1R3DA 2CHFA 1SBQA 4DL9A 3ID6C 4MGYR 3ANLA 2VT2A 4OHKA 5KQRA 3INGA 3QNMA 4JB8A 4B7AA 2FPRA 3PENA 2M2IA 3A6DA 5B5SA 4L27A 1YE8A 4Z6KA 2A9KA 4HQ0A 3ANSA 4CM7A 4UQLA 3D31A 4DG8A 2O2IA 1HM5A 2I3ZA 1I4OA 2JJ8A 3OLWA 4PSAA 4U5QA 5B1HA 5HJEA 5AM0A 2J3HA 1AF4A 1LV8A 2O8CA 3LX8A 2F4NA 2LPMA 5I9MA 5IJXA 1EBFA 1F5SA 2CMGA 3AONB 2H7YA 3KQSA 3L5KA 2HYDA 1G38A 1QV7A 1ZGBA 4OBXA 2HWYA 1FVXA 4B3TB 5EXXA 5EUBA 4TKUA 3RRJA 1G42A 2YXLA 3KPWA 5ALJA 4UFPA 2HKIA 4RF4A 2QM0A 3DDHA 4J1SA 2FUG6 3U7EB 1PBTA 3NAZA 1P91A 4ZAGA 1JHXA 1SWVA 3OOYA 2VYNA 3OFNA 4JA2A 3SJUA 5LWHA 2HB6A 2C7QA 2JFHA 4CEHA 2N46A 4B7UA 5DGCA 2IZ7A 5T4BA 1RACA 4U5XA 4YQZA 3UXYA 4DV6B 3UF0A 1NVVQ 1RLIA 1SQ6A 2IL1A 2K2QB 4RKFA 4B32A 5LU9A 2X7HA 5IAAA 5IDYA 3SIXA 1I7QB 1YIDA 1JDNA 1J39A 1WM1A 1G7RA 1D09A 1TX4B 1JQAA 3GW8A 3LPDA 3LQYA 4JUIA 4Q02A 4MVJI 5IKMA 1UC5B 2R1VA 1YQWA 4Q01A 3RVMA 2BM0A 3IR6A 1R6TA 1WZ2A 4BV3A 4BBJA 3GGGA 1KC1A 1ZK0A 2JGLA 1U9YA 1VI5A 1EFVB 2IOQA 2MOKA 1OI7A 3A3YA 3V4ZA 3ZHCA 5M04A 3UFXA 4KL8S 4YT2A 1M10A 2VXBA 2IW1A 2VO1A 3TB6A 3U7RA 1EK6A 5GZ3A 2DY1A 1KEPA 5BURA 4K03A 3E9YA 4UARA 1GPLA 1T0PA 1ZEJA 3DMNA 3EYAA 4URYR 3RKUA 5JXIA 3O95A 3U5TA 2HZ7A 4EFLA 2VJPA 3FPSA 1CRPA 4IIHA 2V59A 3D5QA 3ZXYA 1XZDA 3N7AA 1EUYA 4YP0A 3JU3A 1PQ4A 3C4VA 3MWEA 5L7WA 3CPJB 2QTHA 3W9SA 1D9ZA 1I1OA 1SVNA 1XQ9A 4W1SA 4DGSA 4EKIA 5LUAA 3Q2OA 1TM7E 3RQIA 2CLLB 2C3YA 3X1XA 5B4UA 1PYDA 4MGIR 1PQUA 2ZW9A 1HEIA 2Q21A 2EG5A 5CURA 3VYSB 4QQ8A 1LFDB 4HMQA 4X90A 4IQ0A 1ZUWA 2C2BA 3VNAA 4DNOA 3IGFA 3NI2A 3QBTA 2DP4E 1ZL2A 2IX3A 4NCNA 2GHQA 3ZDBA 3NC4A 2FSSA 4G4GA 4KN9S 4Y6LA 2ODEA 1DXOA 1MR3F 3DKVA 3ELUA 3EOAI 4NEHB 3U4IA 3L07A 2UYCA 5TGZA 3REGA 1RSZA 4BLOA 5KPJA 3Q7PA 3OQIA 3I76A 3SE7A 1XRRA 2WF5A 5JNUA 2CN1A 3QUAA 4F72A 2H08A 2DBVO 3UVEA 3V32A 2GBFA 2GSDA 3HR7A 1U0RA 4PONA 4US2R 1JHOA 3H9QA 3FYCA 1KERA 5C1OA 2FDXA 3PPIA 1QF9A 3PQ5A 3EMBA 1X15A 2GO1A 1PL6A 2YBEA 4UNSA 3OI7A 1REQA 4PZUA 4X3PA 5F64A 2VSNA 4MS1B 4UHJA 4KO2S 4M2LA 3PEVA 2XLBA 3ELBA 1XWFA 4TWBA 4OD0A 5HZKA 2C96A 4P35A 2XOXA 2PBRA 4BMSA 3PGJA 4X64B 4L3WA 5AYVA 3A1CA 3EDMA 2D7CA 2F1JA 2JDID 4IXNA 5K9ZA 1AJEA 3LS2A 1XNGA 1H2WA 2H52A 3CZ4A 1UM8A 1XRMA 2HMAA 1UJCA 2RHHA 2OHGA 2VDWB 3NKFA 1QQTA 3X2EA 5I7WA 2W58A 3WAGA 5F98A 1OFIA 3AEUB 3P5SA 4EHJA 1Q0RA 4QVKA 5FPSA 2X19A 1K0FA 2QDKA 4PCVA 3FPGA 5LQJA 3N2IA 2LIPA 3ZU6A 5L3SA 3ZI7A 2XRFA 2KLBA 3N2LA 1AE1A 5JWHA 4YV0A 3BJRA 4D0SA 1D2AA 4OV6B 4GICA 3BXPA 4B3MB 1WPRA 4JP8A 4OJTA 3IAM1 5KIAA 4YFYA 1EXVA 1Q1ZA 2WTEA 3SR4A 3UMRA 3GDFA 2Q6IA 3AM4A 2XMQA 3K0EA 3BRCA 3G2HA 4MROA 1L4LA 2A9PA 3MCZA 4NYMQ 4I9UA 1ZN9A 3JVDA 2EQBA 1Z7BA 2WAMA 3K5IA 2I55A 3IVCA 4LV6A 2YL2A 3X0DA 2ACEA 2PYDA 1TT5A 1NSTA 1AX9A 3AT1A 3KQUA 4UU8A 4ZEOA 4E12A 3L43A 5DTRA 2J31A 4Q3KA 5EP1A 1X70A 3I5YA 2R4UA 1AXRA 2GEVA 1UK7A 1AGXA 2JIPA 2XAUA 3D64A 1T29A 1OAKA 2QSZA 3GEDA 3EAFA 2Q0HA 4HXGA 1K4KA 4I2NA 5K8UA 4G0PA 1KNXA 1NATA 2HJ9A 3OWHA 4XW2A 4CQJA 1J2JA 1NV8A 1XHEA 4M4SA 4MQFB 5HZMA 721PA 5IDWA 5JSQA 1M8JA 4I9GA 5KNLA 1PNOA 4Q9DA 2KLHA 5DGTA 4CLOB 2Q2VA 2ZUUA 3P9IA 1GLGA 1T5BA 1ZD1A 4YAFA 1XNRB 3GIWA 2XY4A 1J0CA 3FDZB 4OLAA 1VHDA 1RHKA 2ZYWX 4M7OA 3ZHRA 1IBMB 2V9CA 5A6SB 3RABA 4Y8VA 5C8DA 1E92A 1U2TA 2RGGA 3LFHA 3OIWA 3Q9LA 5DASA 2CB9A 2MWMA 1XTVA 3BX1A 3LLCA 1C30A 1T43A 1Z7EA 2NW6A 2OGZA 2R6DA 1IQ0A 1E61A 2JBHA 1GFSA 4QWWA 1DPFA 2IVZA 1KRWA 1IRIA 1H6BA 5DOVA 4AP9A 2I29A 3TZ6A 2JCGA 4BFXA 2ACWA 1ACJA 5HKAA 5GONF 4EMBA 1N32B 2IJGX 3KZCA 2NTEA 1M2EA 3JD0A 4QNRA 1R50A 3M3DA 2GPBA 2PJRA 1PK8A 1HYHA 2DFKB 1JKJA 3LP8A 1BTOA 4MX8A 3BAZA 1S4MA 5JVDB 3C2QA 2NSLA 2H07A 3MPOA 2JLZA 1LDNA 1G21B 2GD2A 4LECA 4U00A 3NUZA 1LNQA 3GCXA 1NOJA 5JJCA 4UPVA 2A94A 2PU5A 2HJSA 3LXRA 3QFHA 4CCYA 4MVJH 2GJAA 2JFGA 2H18A 2R96A 4NBWA 2I7TA 4PRLA 1ZH6A 4C07A 2Q2OA 2F62A 4G23A 5C1IA 3SI7A 3TFQA 2ZSEA 5GPBA 3HN2A 4J6FA 5HM6A 1C4KA 3FAZA 3MF4A 4FYKA 3RS5A 2CDBA 3DLTA 3HADA 3L8YA 4CWAA 1RI3A 2PNFA 1TZBA 3HKCB 1LBEA 4EYOA 4YP7A 5FRDA 5KWEA 4XOIA 1IMJA 2F2TA 2W6ZA 3L06A 4O4JA 5F1KA 1XZHA 1E2BA 2V7GA 4H7PA 1SUSA 5C34B 3TTUA 2P6RA 5JAMA 1VJRA 4KLZA 3IL2A 5K0SA 2R6R1 2ZFUA 4G3XA 2ZZKA 1JIXA 1WXEA 3AFHA 4ZI5A 4ZOAA 3GK3A 3QM1A 4GXQA 2ZI4A 1E1RA 4WFKA 1SXJE 1NUHA 3ESAA 4GT1A 1BU8A 4ZYWA 1T36A 1N5OX 3L6BA 3NPMA 5ETJA 1IBSA 1KKUA 1YAJA 2V7EA 4YRJA 3VGJA 4W9NA 2AG0A 3K6SA 1SUIA 1XXLA 1G9SA 4Y2GA 1A1VA 3MJTA 4LJLA 1HOTA 1XP5A 3GYGA 1RLJA 2Q4OA 4HAZA 4L4RA 4JIMA 5HNKA 1QRDA 2RKWA 3THWB 2O8EB 1OZAA 1VE1A 3CA8A 2YXPX 1SR8A 1UBMS 3B12A 3DC7A 3IEXA 3JZIA 3KAQA 3PX2A 4WEQA 1DDGA 1P2VA 3GPBA 1VPWA 2V5VA 2QDXA 1I6MA 1I0ZA 3JAWA 2XOKD 1EJBA 3MT8A 2PZJA 4CKCB 4R1UA 3EDYA 1IULA 1VTKA 2JHCA 3BHJA 4YJFB 3PXEA 3AFIA 4MKXA 4ZOLF 2I4TA 3EIEA 4UM9B 5T5QA 2IUYA 3QQPA 3MUEA 4EMUA 1XF1A 3EXIA 1T3HA 3L8MA 5GJBA 2B0JA 2QHXA 1ISPA 3KR1A 3OG9A 2XAAA 4KFUA 1FLDA 1XIVA 3PC8C 1FQKA 1JZQA 4GX0A 4NJEB 2VK4A 1V9CA 3DDZX 4U6SA 1L5MA 1EJ0A 1DKPA 4UATA 1E2IA 3ZZ0A 4EYKA 3ROTA 5CJPA 4QQRA 1PDWA 1RM3A 4G07A 5FA6A 3S6JA 4DJ5X 2I8CA 1LLUA 1U9CA 4OJMX 3R3JA 4EGCB 1SXJC 5ERGB 3ES9A 2HNKA 5CXUA 2GARA 4GIBA 4Q3CA 4DA9A 2AOTA 3OY2A 2PX6A 2R65A 1JEJA 3T1YB 5JASA 1Y5RA 4L78A 4D56A 3ICQB 1F0YA 2RB5A 2XDYA 3F67A 4FFWA 4H4EA 4HNSA 3HY4A 1E6CA 2ZR7A 4DWVA 1TEHA 2VEOA 5KYYB 3EARA 4L3OA 5DPMA 4OQ4A 3AJRA 1YONA 4FQ8A 4WK4B 4HVAA 5AVQA 1XRLA 2EHJA 2JAOA 1M7BA 1US8A 1N4DA 1P0IA 2C95A 4CKYA 2HBQA 4JLNA 1FFSA 4A5OA 1QUEA 2Q4EA 4TSRA 3OCCA 2BCJQ 4MW5A 1KVUA 4WCFC 5EWJA 1SU4A 2VSQA 5E3IA 3I9V6 3JQEA 4BV9A 2OV2A 5CH5A 4MRPA 4NESA 3LSTA 2GCNA 2VAMA 1FFYA 1DBPA 4IZOA 4DPMA 5D6OA 5ALKA 3DLAA 1CF4A 1S3IA 2A0KA 1QYIA 3WB9A 5EHXA 3SS7X 1I7DA 2J0QA 2UZ0A 1Z8HA 3FYUB 3OECA 4FFBB 2R0QC 4IFEA 1G5HA 3M3HA 2BFFB 2NU6B 4IJUA 3UB2A 1JR3A 3WKEA 2FHPA 3DOEA 1HFKA 3TNDA 3UWMA 3D2LA 1W75A 1PSWA 1E6UA 3K1JA 1C4WA 4WVLA 4WL0A 1MXFA 1PFVA 5HF6A 4REQA 4ME6A 4AC9A 4D4GA 1QO9A 2E6KA 3KP1A 4YT5A 5K8JB 2CDRA 1NQ5A 3TQRA 4N0PA 2HYIC 3H5WA 2XB4A 3T7CA 1MT0A 1VPVA 3WV4A 4K87A 2HSEA 4WOBA 1GUBA 2MSCB 3ILSA 4XWGA 3FOZA 3SEAA 1E2EA 1Y6JA 4MQUA 4A9AA 1LBTA 2NXWA 2VDKB 4OM7A 4RA6A 2XCOA 4Z4QA 2XECA 4RF3A 3WRVA 1EBUA 4ZHQA 3ZU2A 1U2ZA 4Q3AA 4PN3A 2FP4A 1NLZA 1PWZA 1VL2A 3MRXA 4LRUA 2WZQA 4QQKA 5EERA 4B45A 2ZSIA 4EO9A 4MVCA 4DM4A 2NAPA 2GXUA 4KIUA 2L19A 5T3UA 1U7WA 4GMGA 1EZZA 1YE5A 1XMJA 2I6GA 5DHRA 4EB6A 1RQ7A 2O3SA 4FWIB 4ZXPA 4QFCA 1RZ3A 4DT1A 4JCOA 2C5BA 3VVCA 3OM0A 4LXXA 4XVCA 2BN4A 1HK7A 4Z0HO 5CVUA 4XYMA 3A6PC 1VLJA 2I66A 2QVXX 2ZYHA 4U3JA 3JATA 4PX2A 4X8HA 3THOA 2VJMB 5BYAA 1HT3A 2WPDD 3F71A 4XIYA 1I01A 5BOVA 1OBHA 3CNNA 3KAKA 4MUKA 3OKFA 5FTNA 5M3BA 1J6UA 3NDJA 5M29A 1T26A 4DUYB 3FCXA 4KYIB 3ZXSA 4OJNA 2CJWA 1FUEA 2ENUA 1QMGA 3RSZA 4EUFA 2JFBA 2ZJAA 2PUBA 3DKRA 2QAJA 2P90A 5AVVA 5DULA 3RTGA 2ONCA 2B98A 3EH2A 5LVAA 3UMMA 2X2FA 2G9QA 3GLUA 4C29A 3CZ9A 3U7JA 2VTKA 1VXRA 2W2XA 4CKEB 5DT2A 3O73A 1XA3A 2P2CA 3Q41A 2E6UX 4BP1A 1KDZA 3RVRA 1UBFA 2PVCA 5AM5A 4YDRA 1EDEA 2I6UA 3DEIA 3Q0EA 3W6OA 1BXRB 3H5NA 1UM9B 1PUIA 1Z4QA 2GBCA 3ENVA 1Z29A 4WI1A 5A06A 3MOIA 4XH9B 1XDDA 3ZTWA 4AY5A 3EVEA 2RCYA 3K2IA 2FDCA 7GPBA 2ZB2A 2J08A 1ULZA 4BCCA 4PLGA 5DTEA 3LF1A 4DLAA 2Q9BA 2AJ8A 2W8BB 1BGWA 5L6LB 6AT1A 4I8XA 1IN6A 2PWBA 4M36A 1V45E 3QVUA 1J8FA 3FUXA 4MYSA 5MF6A 4QDOA 4PFSA 1A98A 3R6WA 5TR9A 4CM6A 3H1BA 1XD2A 1IXSB 1B0UA 2QAIA 3KB1A 1XZGA 4GI7A 4MR9A 1D0SA 1Q1QA 5CA0B 1V25A 3DKIA 1TPYA 5JG7A 3MINB 2PK3A 2OD2A 4OHRA 2ILVA 1QORA 1KDVA 3RIXA 3WL5A 1E9VA 1P1JA 1IXYA 4KZPA 3C6YA 4X1IB 2LD4A 2WVJA 1JKMA 4M89A 3SQXA 1QX4A 2A3NA 2H65A 2Y93A 2YQ4A 4RETA 4W5JA 3NB0A 3WYAA 1Z0JA 5JZOA 4N40A 5K09A 1WDTA 2I80A 2YX1A 4NK5A 4TVSA 5FJIA 2NLOA 1EFKA 3HFRA 3BA1A 3P19A 4QTTB 1A9TA 1FU7A 2BMVA 4C3UA 3P0HA 1KPIA 3C5EA 1R5JA 1B6SA 2OV1A 5F1YA 3TUIC 5AKYA 5JZMA 3AEYA 4NFYA 2WB4A 4F4FA 1SCKA 5BPHA 4G37A 3C1OA 2EL9A 3PEYA 5JY1A 2NZJA 2W6ID 3IDSA 1JQ5A 4GP7A 2OK7A 2CLMB 1I1QB 1K9SA 4IEFB 1NXQA 4GOXA 3ROEA 1XXHE 5DTQA 3O3CA 1CUXA 3QF4A 2N1MA 4LVNA 1E9BA 4JP1A 3JPWA 1EH5A 5KQLA 3F46A 2VBIA 1KJIA 2CYCA 2A9JA 4L08A 4BNDB 1QYCA 2YMLA 1LQTA 3MVEA 5GGXA 2FPUA 1CSEE 1CUZA 3R77A 2PCLA 5I5GA 2FMUA 1ZGAA 1EDBA 2WUVA 2C0CA 4Y2HA 5LQDA 1JHDA 1Z36A 1HETA 1W94A 2QA5A 3I53A 5AVTA 1QR2A 4J7UA 4I3GA 5TSDA 2ZCVA 4S1PA 1RQRA 3WE7A 4GNRA 2NXEA 2WE7A 5FUBA 2FR8A 2P9GA 4WNCA 4PX3A 3ZKWA 5I7UA 3RYCA 3DEZA 5BT8A 3O0TA 5ERXA 4KLCA 4E4TA 5A4MS 2H31A 5JMWA 1BOFA 4UTZA 1G6Q1 4ZREA 3OETA 1RHRA 3KOWA 3A25A 3AF5A 3HL0A 1SKUA 4PXAA 4B2LA 5JQGF 1UMDA 1LRJA 2O7VA 3SYLA 4BVLA 4L9AA 4PLCA 1N5MA 4G1VA 2BMFA 2R1TA 3A6GA 3P0JA 1E69A 4S1VA 4AJ4A 4TTVA 3VR5D 3K9WA 3OJOA 4C7JA 5LMNB 1I6LA 1W7AA 3SVZA 3VZPA 3RGGA 4NBTA 3SQDA 5K3DA 1P1CA 1TFRA 4YALA 1NPTO 1U02A 1E2GA 1T0BA 2CK3D 3LY7A 3KQMA 1K68A 1U6IA 2JLXA 1YR6A 4UTXA 4Q7MB 2QL9A 4PIMA 1XL1A 4OYLA 1WXGA 3D81A 2PLNA 1P9LA 4KQWA 4NE7A 1R4AA 3D8RA 4PIPA 3RVNA 4HN2A 6NULA 1JZTA 5JZBA 1URPA 3L6UA 4OCZA 1H6CA 4M46A 3LPAA 4OREX 1ELOA 3OEHD 4Q15A 4E11A 3NQ41 1R0KA 4JBWA 3EVBA 1PV2A 3NKVA 3NIGB 2BFOA 2LE0A 1H1TA 1J8VA 3KSBC 1JLKA 1V5FA 1N25A 2ZBRA 3QKUA 1Y9EA 3W5DA 1QP8A 2IXTA 3SF8A 3C3DA 1JBQA 1Q2XA 5IDQA 1TRHA 4OHOA 1DWUA 1ZQ1A 3DWGA 3BGVA 2BMWA 1ZXXA 4IDCA 2FW7A 3F9CA 4AICA 4URVR 5L6MB 1X3LA 1ZICA 1XCPA 4D1YA 3VPHA 1OOEA 4EI2A 3EMKA 1A8QA 4IKEA 4B3GA 2GCIA 2CNBA 4QJBA 4FJ2A 3BXEA 4F5ZA 3MG9A 4CIVA 1M2GA 2QW8A 2X6QA 4XGNA 2JFZA 1P0CA 5KC8A 1NXSA 1X8XA 2AX3A 2OM2A 2VUIB 2VWQA 2ERXA 1GQSA 1AK1A 2CD9A 2RHGB 3QVVA 4PRZA 1GCUA 3CLRD 1GFWA 4IIJB 4UFOA 5JRZA 1Z2PX 1U04A 2V7XA 3L1VA 3M9WA 1QC5B 3DMTC 1FSFA 2FPGB 4H4CA 4EG0A 4LQLA 3U6BA 4YBRA 4YYZA 4FD3A 3ASUA 4QIHA 2ISCA 1K3FA 2PR7A 3E48A 3Q3GE 3DZDA 5DWDA 3MWJA 5EUQB 3RWBA 3WISA 4CQLB 1YDGA 1K92A 3AV0B 5K8LA 1IVSA 1W35A 2FEMA 2GAFA 5U9CA 1F8XA 2FQQA 1DTEA 3IV9A 3STYA 3N1UA 2EGUA 1U8YA 1HUQA 1Y5MA 2WNHA 5IVPA 4MDFA 2BGGA 2P62A 1GDTA 5FF9A 1G8SA 3CW9A 3K8OE 3SNHA 2IOFA 3ZW7A 3HCRA 1CE8A 4HTAA 2DUJA 4IM7A 4P9NA 5FBLB 5E9JA 2OC9A 3WNZA 4YJHA 1KXZA 1L4YA 2NVWA 1TZCA 2GJ4A 2HW8A 2UVDA 4D82A 4M86A 4QRDA 3JQBA 1ZCZA 3AK4A 3CZMA 1GPKA 3HNRA 3DPUA 3PZBA 4LYEA 3K0SA 3CLUD 2RHOA 4DDMA 4BXOB 1GEEA 2G9ZA 4GNKA 3TE7A 3L0BA 4ZI7F 3AVTA 4RYLA 4X85A 3H6HA 2B2NA 1LSSA 2NYRA 5IXSA 3FRHA 4JEIA 5JCXA 5LKAA 3GLHA 4LZLA 1XTUA 2GCOA 3ONNA 4O4LB 3R0QA 3KU4A 1BKSB 4D46A 1LLQA 4B6FA 1CFJA 2VQ6A 4HDKB 3MGGA 4K9PA 3Q6NA 5ALWA 3JRNA 4B9EA 2SCUA 4IJ6A 3HCEA 4N0MA 1PT8A 3LA8A 4RPGA 2OG1A 4JOQA 5H59A 6LDHA 4Q7EA 4GBED 3U09A 4PYRA 1UK9A 2ODNA 2FQYA 2AI3A 3NTOA 1ZM2A 4CM9A 3B36A 4UXJA 2AG5A 3WAKA 3I6BA 2BL4A 2XV1A 3WNQA 3N59A 4NE9A 5J47A 1T1JA 2BGNA 2DFVA 4G9BA 3V42A 5LOVB 3IAFA 2YFYA 2Z9DA 4LYAA 5E7QA 4BZXA 3OZFA 2X5NA 1JAZA 3EB9A 4Y1RB 4KRGA 1T0UA 3A6FA 3ZLJA 4P7GA 4ARSA 1PEDA 1ZNYA 3COJA 3KKQA 4O3FA 3GLGA 1F1BA 4ARZA 2NV0A 1XROA 1Q7EA 2O2CA 2V55B 4MW7A 1UEIA 5FTWA 3N05A 4PAWA 5C35A 4AL4A 2Q8PA 1BNCA 1L7EA 2YV1A 3V8VA 1E6KA 1DRJA 4U63A 4LPKA 1KIMA 3N8IA 2P2SA 3UYLA 5FCDA 4ZV4A 5K6AC 5J5AA 2NG1A 4CZ2A 3O8OA 4M1YA 8OHMA 4O5AA 2WG0A 4P6VF 1CETA 1MVOA 4E5VA 1JSLA 4EO7A 1TTTA 3LYHA 4W5HA 2O5CA 1DAOA 4EJMA 3BBPA 1DI0A 3BZWA 1H23A 3OPYA 5K03A 1JYSA 1NDQA 4KE6A 2PUFA 1W5SA 1KJYA 4OXKA 2BCEA 1L5RA 5C8YA 5B3LA 1HQDA 5LB4A 2AJBA 3M83A 2JI6A 3GELA 1I4WA 5CPFA 2RH4A 4YN3A 4PHCA 4YRPA 4C1NA 4H6WA 2FFHA 5DT9A 5JFOA 4DIDA 2AXNA 1NR5A 3IAS1 5D2CA 2RGBA 1XTBA 4OVKA 3A1DA 3TLJA 1ISRA 4NECA 4D0GA 3IYLW 4V0OA 1ESZA 4J4BA 4P2BA 4CKBB 5J4HA 2PUGA 4ZO8A 2Q99A 2D5AA 2C03A 5AW8A 2L17A 2BFDA 3MBKA 4JQZA 2IYRA 3A3PA 1TVMA 2SBTA 4WSOA 1E3QA 2IHZA 3BXGA 3WK5A 1KOLA 1B93A 4BDTA 3S2IA 3HBFA 3NTQA 5AVKA 3SX0A 4V0LA 1NONA 3TAHA 3TEMA 1BA2A 3T3NA 4AKIA 1WP4A 4LC0A 2JIQA 1M7GA 2EKBA 2O5VA 4OQMA 2P2LA 1NBOA 4DR2B 2ID7A 2BEJA 4HPXB 5CVDA 3RASA 5CNJA 3FNHA 3N6RA 1UJBA 3LUPA 4BKMA 2YWFA 3GPCA 2R8XA 4O2LA 4RJIA 5HFNA 2E5FA 4HH4A 1HT2E 2F90A 4R3NA 4BJ3A 1H6DA 2WD7A 4CMJA 5B12A 2C2OA 4YI5A 2IYFA 4BKOA 3MGBA 4J1NA 1Q7RA 2EBFX 2YWEA 2AJTA 3DOHA 3IAAA 1C7RA 3KQOA 3DDUA 1NLYA 4J7CA 4TV8B 4C9BA 3WK7A 4P4TA 2Q6KA 1ST2A 3C6XA 1KMQA 2FZ5A 1I94B 5IVDA 4XI9A 2XUKA 5EKSA 5CB4F 1W93A 2F43A 2P4QA 1N8SA 3GBVA 3FPFA 3FVQA 4H7KA 1YZLA 2ZBDA 1MPTA 3DL0A 3SIPA 3C39A 2IU3A 4OOEA 3SJAA 3U2QA 3TSZA 5HF9A 1O6FA 1P4GA 3JQ7B 1P5FA 2XEDA 2XT0A 4B3BA 2AQKA 4R9VA 3PX7A 1L5WA 3UH1A 6Q21A 5JWOA 5EKXA 1D1QA 1VE6A 2C1EA 1JW9B 4RVOA 4TXMA 4ZVTA 3VJKA 1YR9A 4I0WB 2TS1A 4UZEA 4HNAB 1XJQA 3JQ8B 3CVJA 4BGDA 5EJMA 1DUSA 3FBGA 4H6XA 2NSDA 5IW8A 1M6EX 2DPYA 5FH9A 5K0NA 1M76A 2V6IA 2XRYA 3QPCA 2QQFA 3A3OA 3MXOA 1OC2A 4HJRA 3CGWA 3PB3A 3K0CA 3QG5A 3ZDXB 1GPUA 2YJ6A 3F7NA 1V35A 4F8YA 3K7EA 1Y3DE 5A4FS 3MCVA 4LWPA 5DXJA 3FDJA 4BQIA 1A76A 3IKMB 5U4QA 8ATCA 3SWWA 2DFTA 4MUJA 1XAIA 3EOBI 3CRW1 4PTYA 1C3XA 4BN4A 2ADOA 3A28A 5KTKA 4WXEA 1TVKB 2QMUA 3HG7A 4UHDA 5JD6A 4LF4B 1J0XO 1IRXA 2FPPA 3D6NB 3O8QA 1EFPA 1CUSA 4HEA1 4EUHA 2V8BA 2X58A 3P4UA 4M8LA 3VBEA 4HWSA 4IQFA 5M7EA 3AF0A 5MN5A 3TQIA 3OLVA 1Z2AA 5DBOA 1WNFA 2QZZA 2JI8A 3D4LA 4HSGA 4V02A 2AI2A 1AUVA 2CV0A 1EVLA 2ZSBA 5A0TA 1ODCA 2XITA 3N8NA 3Q5EA 1M74A 4BVKA 1K6JA 1U8CB 4N82A 1CKEA 1WJGA 2G76A 2I4LA 1YSCA 2J3IA 3CKLA 2W4MA 2QRLA 1HKUA 2JEZA 2LP4Y 2WQZA 1CUBA 4BUJA 4IIFA 2O52A 2PPVA 3QELB 4Y9DA 3AZOA 3DYVA 4I6GA 2O0KA 2QLFA 2ZPAA 4NHEA 4BNNA 1SCNE 4OA5A 1JRLA 5AJHA 5BXQC 5L9AA 3A2NA 1DJMA 3D7KA 4AF8A 3P2OA 1NC1A 4ZYUA 1H4VB 3R9XA 3GVXA 1ZUD1 2PYZA 3LBYA 5TMEA 2BP7B 2PGJA 1ODIA 2I2DA 1EFUA 2W6CX 1WZNA 1Q0PA 1WXXA 1SZPA 2N75A 3K4HA 2G9VA 3KBOA 2ZBVA 4G01B 4H59A 1N5IA 3DAGA 2R87A 1J25A 4A6EA 2I34A 4PTLA 4FJ1A 1OI4A 3BQ9A 4EG7A 3JQDA 3HPQA 1G1MA 3M81A 3OP1A 4I6JA 2OQRA 1K88A 3OUTA 4MAMA 4EABA 4EKDA 2ZB4A 4GDFA 1CY2A 2NUAB 3FJOA 1QF7A 1BFUA 2LXNA 2OXRA 1FYWA 5CPBA 2FW6A 3G8BA 5BMVB 1KI8A 4KITB 1IY0A 3E82A 1ZIDA 4IZIA 1E2HA 3AW9A 3R6TA 4GMDA 1D1PA 1QGAA 1ZH2A 4BFWA 1UIMA 5ESWA 4DA8A 2BFCA 4B47A 3ZVKA 2FP3A 2IPAB 4L74A 2Q1UA 3LWDA 5KNBD 2I7VA 2HZBA 4C4OA 1BG6A 2QUAA 1U9ZA 4TTJA 3WGIA 1TYCA 2GN0A 5CNIA 1VB5A 3H4VA 4E2FA 2VTBB 3P96A 4DAOA 4Q05A 3GAAA 5AW7A 1OE0A 2YHSA 2Z1NA 5BV8A 2GRUA 3KUUA 2RBKA 4MKGA 4AFNA 4PLZA 2C31A 2I6QA 3LK7A 1SD5A 1CJKC 2F9FA 1DJNA 1FUIA 2ATCA 4A6XA 4F6CA 1NAHA 3EXHB 3AR9A 3TLZA 1RLTA 4M9RA 4D6PA 3C8MA 1VLVA 5B3KA 1M2FA 3SX2A 5HJ2A 2AG6A 3BH6A 5L8VA 3EDQA 3VPGA 4K9DA 1N5KA 1ORVA 1C7JA 1PJLA 3QSYA 2QD1A 4YCSA 2PGOA 2FWRA 3DWFA 4B4OA 1FDOA 2II6A 2PGNA 2Y4OA 3BAFA 3PVZA 2A1TS 4JBIA 5ECGC 3RHFA 4D3FA 5CB8A 4XUEA 5KS2A 1G16A 1JL3A 4BIMA 4ZJYA 2XI4A 4RDCA 3ZCUA 2TSYB 2QUZA 4GWLA 2QMQA 1ZK3A 1GTRA 1E63A 4KRXA 4L15A 4GL2A 3UHFA 5BNTA 5E0KB 1QBKC 3VH3A 4ANFA 2REXB 3PUJA 3HYNA 3LSYA 2GD0A 4DF3A 3D7LA 4NBRA 4FMDB 5I7OA 3FWHA 1NJGA 1VE3A 4BMYA 2NAFA 2O6LA 3MAGA 3WQQA 4ZDKA 4J8PA 3JYPA 3A31A 5LB2A 1CY0A 3ZIAD 1S8OA 1RC1A 2PEZA 1UOQA 3KNZA 4Q9AA 2WUDA 4JAVC 1KDOA 5KMGB 3KAJA 4J3NA 4NF2A 3GGCA 4NBUA 5LU8A 1QTNA 5BV7A 5DM4A 3U9LA 1PT7A 2IT1A 3H4IA 4YMTA 3DF9A 2ATVA 2ONKA 2XCRB 2VSOA 1FTQA 1WS6A 4HX2A 1ECBA 3H6GA 3UJ3X 5H1YA 4HDNB 2XGJA 1PTJA 2VDOB 2O14A 4D0RA 3MHTA 4KGZA 3SC3A 3N6VA 3TLYA 2QVZX 5CT6A 5JDIA 2QX7A 2WV7A 2VCEA 3WYGA 2ROQA 4OUDB 1FYFA 1I3CA 2XUGA 3KYCA 4N5MA 4LZPA 4KMRA 5DTJA 3AUAA 4JIGA 4MMZB 5FTJA 1PJ8A 4L4XA 1V5IA 3UAOA 3A4MA 4LMPA 4A2PA 4UU1A 3NCTA 3R74A 2VNIA 4HDRA 4WZBA 3HDYA 5HP4A 4WX2B 1XSEA 4MW4A 4TKVA 2FZCA 4IZ6A 4EUKA 4MP6A 1F2VA 4MW2A 1Y3IA 3Q7IA 3PXDA 3SVTA 2ZUEA 3AJ9A 1NYQA 5C0OE 1GEGA 5EOVA 1ND6A 1XAJA 4NU8X 5F52A 4CUZA 1VG8A 2LTAA 3TSYA 3ULKA 4DS3A 4EB8A 3QLUC 1OWOA 2YHBA 4KUHA 2QRZA 1QFZA 4KDEA 1T5LA 1L7BA 2PG3A 3MS7A 4TMXA 5EQJB 5J4VA 4Q4AA 1P81A 3BXXA 4OUKX 1D4AA 2ZBUA 3GJZA 1DSSG 3O6VA 5FOXA 1TNDA 2PL1A 3L1JA 1F4VA 1GKLA 2BFWA 4EA7A 4DV2B 1RD4A 1OR8A 2CLKB 2J5QA 1O4WA 3IODA 3JXEA 5F9MA 4BGUA 2DB3A 2P79A 2O0JA 1CQJB 3UGQA 1G20B 3I05A 4D7AA 2O8DA 2QX4A 4UOQA 1XRPA 3CEAA 4V1CB 4DY4A 4EYGA 2VTEA 2WYVA 4BVEA 3PFCA 4GYYA 1IY2A 1A4UA 4PGMA 4W5RA 4DNPA 1EFCA 1NG1A 2QAGC 3IKLA 3PSHA 1YZUA 2K7FA 2Y0CA 1Q7GA 1XV5A 4FUQA 2RGRA 3ZHSA 4KQIA 1SIWA 5JCJA 2GO7A 3H3JA 1GU0A 4LHZA 1BN7A 1E64A 1TQDA 2H7XA 3SJCA 4B3HA 4HVCA 2B7CA 1RWKA 3BMXA 4U7TB 3R23A 4HZUB 1SRRA 5KNDA 4NQZA 4GZMA 1XK7A 1Q91A 2I4OA 4MWOA 1QIEA 4Q9HA 5YASA 5ALSA 3DFUA 4K46A 3OC0A 1XVLA 5ALIA 2VHQA 4OXYA 1S5PA 5DYWA 2O0HA 4BLPA 1AHPA 2CBGA 5K3EA 1WQ3A 1MA3A 1IK6A 1LDEA 1X1RA 1VLHA 3KD3A 4GI2A 4JLVA 4BFSA 4C7OA 1X7DA 4HZGA 1JIVA 2XBMA 3HUTA 1PN3A 2JJMA 3A06A 4D98A 1GPDG 2ZXFA 5ALFA 1KRHA 5J1TB 1Z5UA 3RS3A 1LBIA 3RTAA 5BWMA 1UPAA 2F9MA 2BSXA 2OHHA 2BBWA 2PH5A 2WAXA 3RRNA 1HXHA 1W59A 3EGDA 1G6OA 4JZKA 3I6ZA 4KPFC 4H27A 3HR8A 4J49A 3GD5A 1PWXA 4LHYA 1ZD5A 1W73A 3GFRA 3W3AD 3UUWA 1B0PA 2OCAA 3MB8A 1UC9A 4RM2A 3KOOA 4O8ZA 3QTLA 3ZI0A 4ZICA 5IFLA 3E4DA 4J75A 4KNVA 4U2BA 4JLOA 1KK0A 1HG1A 2HHCA 5DYNA 2ACVA