1WCMK

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1wcmK00
2Y0SD 4QJVB 4AYBD 2E2JK 1K83K 5M5YK 5IP9K 3S14K 4C2MK 3GTPK 3M4OC 4QIWD 2A68A 4JK1A 5C3EK 2R93C 2NVQC 5M5WK 4A3BK 4BY7C 1I50C 3GTJC 1TWFC 2CW0A 4LK1A 5C4XK 4A3EK 1SFOC 2JA7C 4C3HK 3I4NC 3S16C 4BBRK 3CQZK 3H0GC 5C4JC 3HOUC 3M4OK 4A3DC 1I3QC 4LLGA 4ZH4A 2R93K 4BY7K 3HOVC 2WB1D 1I50K 5TMCA 2JA7K 3S1NC 4X6AC 5IYDC 5IYBK 3H0GK 2JA6C 3S1QK 4OIPA 3HOUK 1K83C 2A69A 2R7ZC 3S2DK 3GTLK 5IP7C 3HOXK 3GTPC 4G7OA 1SMYA 1HQMA 4KN7A 2PMZD 4LJZA 2PPBA 1TWCK 2YU9C 3S1NK 4A3BC 1I6HC 4X6AK 4A3EC 5C4XC 2JA6K 4MEYA 4BBRC 3CQZC 4OINA 2R7ZK 5IP7K 5M3FK 4A3LC 4BBSC 3HKZL 3GTGC 1WCMK 3DXJA 2YU9K 3M3YK 3HOZC 1I6HK 4A93K 5FLMC 4YFKA 5D4DA 5IYBC 3EQLA 4A3FK 4BXXC 4MEXA 3S1QC 1YNNA 4A3LK 3S2DC 4BBSK 4QJVA 3HOXC 4BY1K 3GTLC 3GTGK 4Q4ZA 2BE5A 3HOZK 4KN4A 3RZOK 1TWCC 5FLMK 5FJ8K 3S1MC 2PA8L 4BXXK 1TWHC 2NVYC 4XSXA 4G7ZA 1Y1VK 3S1RK 1Y1WC 4OIOA 3H3VL 1WCMC 3M3YC 3RZDC 4GZYA 3I4MC 3S1MK 4A93C 1TWHK 1TWAC 3S17C 2NVYK 4A3FC 4Q5SA 1ZYRA 2WB1L 3FKIC 1XPPA 2E2HK 4OIRA 1Y1WK 4YFXA 2NVXK 4BY1C 2JA8C 2WAQL 2B63C 4C3IK 2O5JA 3RZDK 3I4MK 3RZOC 2R92C 1YNJA 1TWAK 3S17K 1R9TK 2NVTC 2JA5C 3FKIK 4Y7NC 3HKZD 3HOYK 3S2HK 3K7AC 5TMFA 3GTMC 3S15C 4OIQA 3WODA 1Y1VC 3S1RC 2B63K 2JA8K 3GTQC 4A3IK 2Y0SL 4AYBL 2R92K 3PO3C 4QIWL 2NVTK 2JA5K 5C44K 5M3MK 4Y7NK 3GTKK 3S15K 3K7AK 3GTMK 2E2HC 3PO2C 3GTQK 4G7HA 4A3KK 2NVXC 4A3GK 2PA8D 5M5XK 2VUMC 3PO3K 4NOIA 4Y52K 1R9TC 4KMUA 2E2IK 4XLPA 2A6EA 1IW7A 4C3JK 2VUMK 3GTOC 3HOYC 3PO2K 3S2HC 2A6HA 4A3MC 3H3VD 3HOWC 5IYCC 4A3IC 4A3JC 4XSZA 2NVQK 3GTJK 1TWFK 5C44C 3GTOK 1SFOK 3GTKC 2PMZL 4A3CC 2WAQD 3I4NK 1TWGC 4A3MK 3S14C 3S16K 5C4JK 2O5IA 3HOWK 5IYCK 4A3KC 1BDFA 2E2JC 4A3GC 5IP9C 4MQ9A 1I3QK 4A3JK 4XLNA 4A3DK 5C3EC 3HOVK 1I6VA 4Y52C 4A3CK 5IYDK 2E2IC 4YG2A 1TWGK 4LK0A 4YFNA
chains in the Genus database with same CATH superfamily
1WSRA 4QJVB 2ZUFA 1L0WA 1K83K 2E2JK 5IP9K 4JK1A 4BLBA 2Y3PA 5C4XK 1SFOC 4BBRK 1R9TA 1WSVA 1I3QC 4LLGA 1XXAA 5JVOA 3S1NC 5IYBK 3GTKA 4G7OA 5IP7C 1O25A 1SMYA 3GIRA 2PMZD 1USOA 4LJZA 3S1NK 1I6HC 4A3EC 1VH2A 3A8IA 3CQZC 3JSTA 5IP7K 5M3FK 3HKZL 3TFIA 3N0CA 4WJ3M 1I6HK 4YFKA 4O2DA 3EQLA 4BXXC 1TWFA 3BP8C 3S1QC 5E68A 5CHPA 4KATA 4GTAA 1WOPA 3G4AA 4FM9A 5FJ8K 4GTEA 4BXXK 1O2BA 5L46A 1K83A 2R7ZA 1EK8A 1TWAC 4PABA 3T01A 1ZYRA 3FKIC 1XPPA 1EFWA 2NVXK 3V4GA 1VJEA 4KMDA 1DCOA 4FZBA 1XZQA 1YNJA 1TWAK 1RU0A 3FKIK 4Y7NC 5TMFA 3GTQC 1EI6A 4KMAA 1IQ0A 1INNA 1G51A 4PAAA 5C44K 4Y7NK 3GTQK 1TWHA 2W7VA 3MMLB 2PA8D 3S0XA 3GDZA 4KASA 3OREA 1R9TC 4XLPA 3AQPA 4KARA 2R92A 3GTKC 3I4NK 1F93A 1XXBA 2GSNA 1JOEA 3HXAA 2JH3A 4MQ9A 4C2MC 4A3DK 1XZPA 1ISEA 4Y52C 3L4JA 4LK0A 3LPXA 3T00A 4C2MK 2NVXA 3N0BA 2NVQC 4BY7C 1EQRA 1TWFC 4LK1A 3SZZA 2GAGC 1GE9A 1J6XA 3S16C 5C4JC 3GTOA 4ZH4A 3T02A 4BY7K 3HOVC 1BS2A 4X6AC 2P5MA 4LOWA 3A8JA 1K83C 4KC6A 2R7ZC 4DDQA 3HOXK 4G0VA 2ZUEA 4X6AK 1B4AA 1TWCK 1WOSA 2PHCB 5C4XC 3AD8C 4BBRC 4KAWX 2R7ZK 4A3LC 1VGXA 3M3YK 4LR2A 4A93K 2R93A 5FLMC 1JQWA 5IYBC 5CJ9A 1VRQC 2JA7A 4A3LK 5HL8A 3H0GA 4KN4A 5FLMK 3S1MC 3L4KA 1TWHC 2RGRA 3S1RK 2XCRB 4GZYA 3RZDC 3I4MC 3S1MK 1F7VA 1TWHK 2YU9A 2E2HK 4YFXA 2XCOA 2WAQL 2O5JA 3RZDK 3I4MK 2R92C 4GTCA 5IOSA 4GTFA 3HOYK 3S2HK 3GEIA 3ADAC 4A3IK 1BGWA 2R92K 3BP3A 1XXCA 3FHZA 3PO3C 4J3NA 4KB4A 1TWCA 2GSUA 4KM8A 4C3JC 1EH1A 4A3KK 2NVXC 1Y1WA 5M5XK 3PO3K 4NOIA 1O26A 4C3JK 1F7UA 2VUMK 3GTOC 4KB2A 3AD7C 3SZYA 1WQFA 4GT9A 3H3VD 3OEPA 4C45A 3QX3A 2B63A 3GTJK 5C44C 3GTOK 2PMZL 3S14C 2JA5A 4GTLA 3A8KA 4XLNA 5C3EC 4ILDA 5IYDK 1DD5A 1J6VA 3S14K 4C3HC 2Y0SD 4AYBD 3M4OC 3GTPK 2E2HA 4QIWD 5C3EK 2R93C 4A3BK 2JA7C 2CW0A 4C3HK 3I4NC 3H0GC 3M4OK 4A3DC 1JVIA 5IOTA 5JFEA 2R93K 2KWAA 3FOFA 2P8TA 5TMCA 1IL2A 2JA7K 3H0GK 1DCPA 3S2DK 1TWGA 1WQHA 3BUEA 3LAPA 3GTLK 1HQMA 1XZQB 2YU9C 2PPBA 1WQGA 1X31C 1O27A 4MEYA 3FOEA 4WJ4A 3NUHA 4OINA 2VUMA 4BBSC 1ZVUA 1DCHA 1WCMK 1YCLA 3DXJA 4AH6A 2YU9K 3HOZC 2CFAA 4A3FK 3ERED 1I50A 3GTJA 4M1XA 4BBSK 4QJVA 3HOXC 2EBBA 1PJ5A 4BY1K 2BE5A 3HOZK 3RZOK 1TWCC 2V6SA 2PA8L 2FQOA 1WIHA 4BLAA 4G7ZA 1Y1VK 2JA6A 1Y1WC 3M3YC 3GTPA 4A93C 1O2AA 3S17C 1BJTA 4OIRA 1Y1WK 4P5AA 2JA8C 1XZPB 2B63C 4C3IK 4XCHA 1KQ4A 3GTGA 3S17K 2V6TA 5IORA 2JA5C 2NVTC 1WORA 3HKZD 3S15C 3GTMC 3WODA 3S1RC 2B63K 2JA8K 3GTLA 2NVTK 2JA5K 1VLOA 5M3MK 3TTGA 3S15K 1PJ6A 3GTMK 3Q3QA 2E2HC 3PO2C 1C0AA 4A3GK 2NVYA 2RH6A 1WCMA 2E2IK 2A6EA 4KM9A 3PO2K 4GFQA 5IOQA 3HOYC 3S2HC 1O29A 4A3MC 3HOWC 4A3IC 3LAJA 3AD9C 1O24A 1SFOK 1TWGC 4A3MK 3HOWK 4A3KC 1BDFA 2D6FC 1F9NA 5EGEA 1I3QK 1Y1VA 1I6VA 4YG2A 1TWGK 2VUMC 4YFNA 5EGHA 4G0WA 5M5YK 1IBAA 2A68A 5M5WK 1I50C 3GTJC 4A3EK 3CQZK 3HOUC 1WOOA 4GTBA 2WB1D 1I50K 2ZFZA 4KMHA 5IYDC 2JA6C 3S1QK 4OIPA 3GEHA 3HOUK 2A69A 3GTMA 1O2FB 3GTPC 4KN7A 4LQYA 4A3BC 2GAHC 2JA6K 2V6UA 2E2IA 3VA7A 4P5BA 4GTDA 4KDDA 3AH5A 3GTGC 4WILA 1O28A 1YX2A 5D4DA 4MEXA 4G0UA 4BKWA 1YNNA 1SFOA 3S2DC 1IS1A 3GTLC 3GTGK 4Q4ZA 1J6WA 1I3QA 5TJ3A 2NVYC 1ZXOA 4XSXA 1J98A 3IPJA 4RMFA 4OIOA 1ZQ1C 3GSIA 1WCMC 3H3VL 3GEEA 2NVYK 4A3FC 4Q5SA 2WB1L 4BY1C 3CQZA 3RZOC 1R9TK 1UV7A 1IE0A 1PJ7A 3K7AC 4OIQA 1Y1VC 3TFJA 2Y0SL 1V5VA 4AYBL 3AQOA 2XCQA 3CAGA 4QIWL 3GTKK 3K7AK 4G7HA 4P9SA 4C3IC 1B4BA 4Y52K 1HI9A 4KMUA 1IW7A 2A6HA 1TWAA 1USMA 3FKIA 5IYCC 2GSOA 4A3JC 4XSZA 2NVQK 1TWFK 3N3YA 4A3CC 2WAQD 3S16K 5C4JK 2O5IA 3OPFA 5IYCK 4A3GC 2E2JC 5IP9C 2FQTA 4A3JK 1ZBSA 3GTQA 3HOVK 2CFAB 4A3CK 1AB4A 2E2IC 3G4CA 3TFHA
chains in the Genus database with same CATH topology
2Y0SD 4QJVB 4AYBD 2E2JK 1K83K 5M5YK 5IP9K 3S14K 4C2MK 3GTPK 3M4OC 4QIWD 2A68A 4JK1A 5C3EK 2R93C 2NVQC 5M5WK 4A3BK 4BY7C 1I50C 3GTJC 1TWFC 2CW0A 4LK1A 5C4XK 4A3EK 1SFOC 2JA7C 4C3HK 3I4NC 3S16C 4BBRK 3CQZK 3H0GC 5C4JC 3HOUC 3M4OK 4A3DC 1I3QC 4LLGA 4ZH4A 2R93K 4BY7K 3HOVC 2WB1D 1I50K 5TMCA 2JA7K 3S1NC 4X6AC 5IYDC 5IYBK 3H0GK 2JA6C 3S1QK 4OIPA 3HOUK 1K83C 2A69A 2R7ZC 3S2DK 3GTLK 5IP7C 3HOXK 3GTPC 4G7OA 1SMYA 1HQMA 4KN7A 2PMZD 4LJZA 2PPBA 1TWCK 2YU9C 3S1NK 4A3BC 1I6HC 4X6AK 4A3EC 5C4XC 2JA6K 4MEYA 4BBRC 3CQZC 4OINA 2R7ZK 5IP7K 5M3FK 4A3LC 4BBSC 3HKZL 3GTGC 1WCMK 3DXJA 2YU9K 3M3YK 3HOZC 1I6HK 4A93K 5FLMC 4YFKA 5D4DA 5IYBC 3EQLA 4A3FK 4BXXC 4MEXA 3S1QC 1YNNA 4A3LK 3S2DC 4BBSK 4QJVA 3HOXC 4BY1K 3GTLC 3GTGK 4Q4ZA 2BE5A 3HOZK 4KN4A 3RZOK 1TWCC 5FLMK 5FJ8K 3S1MC 2PA8L 4BXXK 1TWHC 2NVYC 4XSXA 4G7ZA 1Y1VK 3S1RK 1Y1WC 4OIOA 3H3VL 1WCMC 3M3YC 3RZDC 4GZYA 3I4MC 3S1MK 4A93C 1TWHK 1TWAC 3S17C 2NVYK 4A3FC 4Q5SA 1ZYRA 2WB1L 3FKIC 1XPPA 2E2HK 4OIRA 1Y1WK 4YFXA 2NVXK 4BY1C 2JA8C 2WAQL 2B63C 4C3IK 2O5JA 3RZDK 3I4MK 3RZOC 2R92C 1YNJA 1TWAK 3S17K 1R9TK 2NVTC 2JA5C 3FKIK 4Y7NC 3HKZD 3HOYK 3S2HK 3K7AC 5TMFA 3GTMC 3S15C 4OIQA 3WODA 1Y1VC 3S1RC 2B63K 2JA8K 3GTQC 4A3IK 2Y0SL 4AYBL 2R92K 3PO3C 4QIWL 2NVTK 2JA5K 5C44K 5M3MK 4Y7NK 3GTKK 3S15K 3K7AK 3GTMK 2E2HC 3PO2C 3GTQK 4G7HA 4A3KK 2NVXC 4A3GK 2PA8D 5M5XK 2VUMC 3PO3K 4NOIA 4Y52K 1R9TC 4KMUA 2E2IK 4XLPA 2A6EA 1IW7A 4C3JK 2VUMK 3GTOC 3HOYC 3PO2K 3S2HC 2A6HA 4A3MC 3H3VD 3HOWC 5IYCC 4A3IC 4A3JC 4XSZA 2NVQK 3GTJK 1TWFK 5C44C 3GTOK 1SFOK 3GTKC 2PMZL 4A3CC 2WAQD 3I4NK 1TWGC 4A3MK 3S14C 3S16K 5C4JK 2O5IA 3HOWK 5IYCK 4A3KC 1BDFA 2E2JC 4A3GC 5IP9C 4MQ9A 1I3QK 4A3JK 4XLNA 4A3DK 5C3EC 3HOVK 1I6VA 4Y52C 4A3CK 5IYDK 2E2IC 4YG2A 1TWGK 4LK0A 4YFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S D;  4QJV B;  4AYB D;  2E2J K;  1K83 K;  5M5Y K;  5IP9 K;  3S14 K;  4C2M K;  3GTP K;  3M4O C;  4QIW D;  2A68 A;  4JK1 A;  5C3E K;  2R93 C;  2NVQ C;  5M5W K;  4A3B K;  4BY7 C;  1I50 C;  3GTJ C;  1TWF C;  2CW0 A;  4LK1 A;  5C4X K;  4A3E K;  1SFO C;  2JA7 C;  4C3H K;  3I4N C;  3S16 C;  4BBR K;  3CQZ K;  3H0G C;  5C4J C;  3HOU C;  3M4O K;  4A3D C;  1I3Q C;  4LLG A;  4ZH4 A;  2R93 K;  4BY7 K;  3HOV C;  2WB1 D;  1I50 K;  5TMC A;  2JA7 K;  3S1N C;  4X6A C;  5IYD C;  5IYB K;  3H0G K;  2JA6 C;  3S1Q K;  4OIP A;  3HOU K;  1K83 C;  2A69 A;  2R7Z C;  3S2D K;  3GTL K;  5IP7 C;  3HOX K;  3GTP C;  4G7O A;  1SMY A;  1HQM A;  4KN7 A;  2PMZ D;  4LJZ A;  2PPB A;  1TWC K;  2YU9 C;  3S1N K;  4A3B C;  1I6H C;  4X6A K;  4A3E C;  5C4X C;  2JA6 K;  4MEY A;  4BBR C;  3CQZ C;  4OIN A;  2R7Z K;  5IP7 K;  5M3F K;  4A3L C;  4BBS C;  3HKZ L;  3GTG C;  1WCM K;  3DXJ A;  2YU9 K;  3M3Y K;  3HOZ C;  1I6H K;  4A93 K;  5FLM C;  4YFK A;  5D4D A;  5IYB C;  3EQL A;  4A3F K;  4BXX C;  4MEX A;  3S1Q C;  1YNN A;  4A3L K;  3S2D C;  4BBS K;  4QJV A;  3HOX C;  4BY1 K;  3GTL C;  3GTG K;  4Q4Z A;  2BE5 A;  3HOZ K;  4KN4 A;  3RZO K;  1TWC C;  5FLM K;  5FJ8 K;  3S1M C;  2PA8 L;  4BXX K;  1TWH C;  2NVY C;  4XSX A;  4G7Z A;  1Y1V K;  3S1R K;  1Y1W C;  4OIO A;  3H3V L;  1WCM C;  3M3Y C;  3RZD C;  4GZY A;  3I4M C;  3S1M K;  4A93 C;  1TWH K;  1TWA C;  3S17 C;  2NVY K;  4A3F C;  4Q5S A;  1ZYR A;  2WB1 L;  3FKI C;  1XPP A;  2E2H K;  4OIR A;  1Y1W K;  4YFX A;  2NVX K;  4BY1 C;  2JA8 C;  2WAQ L;  2B63 C;  4C3I K;  2O5J A;  3RZD K;  3I4M K;  3RZO C;  2R92 C;  1YNJ A;  1TWA K;  3S17 K;  1R9T K;  2NVT C;  2JA5 C;  3FKI K;  4Y7N C;  3HKZ D;  3HOY K;  3S2H K;  3K7A C;  5TMF A;  3GTM C;  3S15 C;  4OIQ A;  3WOD A;  1Y1V C;  3S1R C;  2B63 K;  2JA8 K;  3GTQ C;  4A3I K;  2Y0S L;  4AYB L;  2R92 K;  3PO3 C;  4QIW L;  2NVT K;  2JA5 K;  5C44 K;  5M3M K;  4Y7N K;  3GTK K;  3S15 K;  3K7A K;  3GTM K;  2E2H C;  3PO2 C;  3GTQ K;  4G7H A;  4A3K K;  2NVX C;  4A3G K;  2PA8 D;  5M5X K;  2VUM C;  3PO3 K;  4NOI A;  4Y52 K;  1R9T C;  4KMU A;  2E2I K;  4XLP A;  2A6E A;  1IW7 A;  4C3J K;  2VUM K;  3GTO C;  3HOY C;  3PO2 K;  3S2H C;  2A6H A;  4A3M C;  3H3V D;  3HOW C;  5IYC C;  4A3I C;  4A3J C;  4XSZ A;  2NVQ K;  3GTJ K;  1TWF K;  5C44 C;  3GTO K;  1SFO K;  3GTK C;  2PMZ L;  4A3C C;  2WAQ D;  3I4N K;  1TWG C;  4A3M K;  3S14 C;  3S16 K;  5C4J K;  2O5I A;  3HOW K;  5IYC K;  4A3K C;  1BDF A;  2E2J C;  4A3G C;  5IP9 C;  4MQ9 A;  1I3Q K;  4A3J K;  4XLN A;  4A3D K;  5C3E C;  3HOV K;  1I6V A;  4Y52 C;  4A3C K;  5IYD K;  2E2I C;  4YG2 A;  1TWG K;  4LK0 A;  4YFN A; 
#chains in the Genus database with same CATH topology
 1WSR A;  4QJV B;  2ZUF A;  1L0W A;  1K83 K;  2E2J K;  5IP9 K;  4JK1 A;  4BLB A;  2Y3P A;  5C4X K;  1SFO C;  4BBR K;  1R9T A;  1WSV A;  1I3Q C;  4LLG A;  1XXA A;  5JVO A;  3S1N C;  5IYB K;  3GTK A;  4G7O A;  5IP7 C;  1O25 A;  1SMY A;  3GIR A;  2PMZ D;  1USO A;  4LJZ A;  3S1N K;  1I6H C;  4A3E C;  1VH2 A;  3A8I A;  3CQZ C;  3JST A;  5IP7 K;  5M3F K;  3HKZ L;  3TFI A;  3N0C A;  4WJ3 M;  1I6H K;  4YFK A;  4O2D A;  3EQL A;  4BXX C;  1TWF A;  3BP8 C;  3S1Q C;  5E68 A;  5CHP A;  4KAT A;  4GTA A;  1WOP A;  3G4A A;  4FM9 A;  5FJ8 K;  4GTE A;  4BXX K;  1O2B A;  5L46 A;  1K83 A;  2R7Z A;  1EK8 A;  1TWA C;  4PAB A;  3T01 A;  1ZYR A;  3FKI C;  1XPP A;  1EFW A;  2NVX K;  3V4G A;  1VJE A;  4KMD A;  1DCO A;  4FZB A;  1XZQ A;  1YNJ A;  1TWA K;  1RU0 A;  3FKI K;  4Y7N C;  5TMF A;  3GTQ C;  1EI6 A;  4KMA A;  1IQ0 A;  1INN A;  1G51 A;  4PAA A;  5C44 K;  4Y7N K;  3GTQ K;  1TWH A;  2W7V A;  3MML B;  2PA8 D;  3S0X A;  3GDZ A;  4KAS A;  3ORE A;  1R9T C;  4XLP A;  3AQP A;  4KAR A;  2R92 A;  3GTK C;  3I4N K;  1F93 A;  1XXB A;  2GSN A;  1JOE A;  3HXA A;  2JH3 A;  4MQ9 A;  4C2M C;  4A3D K;  1XZP A;  1ISE A;  4Y52 C;  3L4J A;  4LK0 A;  3LPX A;  3T00 A;  4C2M K;  2NVX A;  3N0B A;  2NVQ C;  4BY7 C;  1EQR A;  1TWF C;  4LK1 A;  3SZZ A;  2GAG C;  1GE9 A;  1J6X A;  3S16 C;  5C4J C;  3GTO A;  4ZH4 A;  3T02 A;  4BY7 K;  3HOV C;  1BS2 A;  4X6A C;  2P5M A;  4LOW A;  3A8J A;  1K83 C;  4KC6 A;  2R7Z C;  4DDQ A;  3HOX K;  4G0V A;  2ZUE A;  4X6A K;  1B4A A;  1TWC K;  1WOS A;  2PHC B;  5C4X C;  3AD8 C;  4BBR C;  4KAW X;  2R7Z K;  4A3L C;  1VGX A;  3M3Y K;  4LR2 A;  4A93 K;  2R93 A;  5FLM C;  1JQW A;  5IYB C;  5CJ9 A;  1VRQ C;  2JA7 A;  4A3L K;  5HL8 A;  3H0G A;  4KN4 A;  5FLM K;  3S1M C;  3L4K A;  1TWH C;  2RGR A;  3S1R K;  2XCR B;  4GZY A;  3RZD C;  3I4M C;  3S1M K;  1F7V A;  1TWH K;  2YU9 A;  2E2H K;  4YFX A;  2XCO A;  2WAQ L;  2O5J A;  3RZD K;  3I4M K;  2R92 C;  4GTC A;  5IOS A;  4GTF A;  3HOY K;  3S2H K;  3GEI A;  3ADA C;  4A3I K;  1BGW A;  2R92 K;  3BP3 A;  1XXC A;  3FHZ A;  3PO3 C;  4J3N A;  4KB4 A;  1TWC A;  2GSU A;  4KM8 A;  4C3J C;  1EH1 A;  4A3K K;  2NVX C;  1Y1W A;  5M5X K;  3PO3 K;  4NOI A;  1O26 A;  4C3J K;  1F7U A;  2VUM K;  3GTO C;  4KB2 A;  3AD7 C;  3SZY A;  1WQF A;  4GT9 A;  3H3V D;  3OEP A;  4C45 A;  3QX3 A;  2B63 A;  3GTJ K;  5C44 C;  3GTO K;  2PMZ L;  3S14 C;  2JA5 A;  4GTL A;  3A8K A;  4XLN A;  5C3E C;  4ILD A;  5IYD K;  1DD5 A;  1J6V A;  3S14 K;  4C3H C;  2Y0S D;  4AYB D;  3M4O C;  3GTP K;  2E2H A;  4QIW D;  5C3E K;  2R93 C;  4A3B K;  2JA7 C;  2CW0 A;  4C3H K;  3I4N C;  3H0G C;  3M4O K;  4A3D C;  1JVI A;  5IOT A;  5JFE A;  2R93 K;  2KWA A;  3FOF A;  2P8T A;  5TMC A;  1IL2 A;  2JA7 K;  3H0G K;  1DCP A;  3S2D K;  1TWG A;  1WQH A;  3BUE A;  3LAP A;  3GTL K;  1HQM A;  1XZQ B;  2YU9 C;  2PPB A;  1WQG A;  1X31 C;  1O27 A;  4MEY A;  3FOE A;  4WJ4 A;  3NUH A;  4OIN A;  2VUM A;  4BBS C;  1ZVU A;  1DCH A;  1WCM K;  1YCL A;  3DXJ A;  4AH6 A;  2YU9 K;  3HOZ C;  2CFA A;  4A3F K;  3ERE D;  1I50 A;  3GTJ A;  4M1X A;  4BBS K;  4QJV A;  3HOX C;  2EBB A;  1PJ5 A;  4BY1 K;  2BE5 A;  3HOZ K;  3RZO K;  1TWC C;  2V6S A;  2PA8 L;  2FQO A;  1WIH A;  4BLA A;  4G7Z A;  1Y1V K;  2JA6 A;  1Y1W C;  3M3Y C;  3GTP A;  4A93 C;  1O2A A;  3S17 C;  1BJT A;  4OIR A;  1Y1W K;  4P5A A;  2JA8 C;  1XZP B;  2B63 C;  4C3I K;  4XCH A;  1KQ4 A;  3GTG A;  3S17 K;  2V6T A;  5IOR A;  2JA5 C;  2NVT C;  1WOR A;  3HKZ D;  3S15 C;  3GTM C;  3WOD A;  3S1R C;  2B63 K;  2JA8 K;  3GTL A;  2NVT K;  2JA5 K;  1VLO A;  5M3M K;  3TTG A;  3S15 K;  1PJ6 A;  3GTM K;  3Q3Q A;  2E2H C;  3PO2 C;  1C0A A;  4A3G K;  2NVY A;  2RH6 A;  1WCM A;  2E2I K;  2A6E A;  4KM9 A;  3PO2 K;  4GFQ A;  5IOQ A;  3HOY C;  3S2H C;  1O29 A;  4A3M C;  3HOW C;  4A3I C;  3LAJ A;  3AD9 C;  1O24 A;  1SFO K;  1TWG C;  4A3M K;  3HOW K;  4A3K C;  1BDF A;  2D6F C;  1F9N A;  5EGE A;  1I3Q K;  1Y1V A;  1I6V A;  4YG2 A;  1TWG K;  2VUM C;  4YFN A;  5EGH A;  4G0W A;  5M5Y K;  1IBA A;  2A68 A;  5M5W K;  1I50 C;  3GTJ C;  4A3E K;  3CQZ K;  3HOU C;  1WOO A;  4GTB A;  2WB1 D;  1I50 K;  2ZFZ A;  4KMH A;  5IYD C;  2JA6 C;  3S1Q K;  4OIP A;  3GEH A;  3HOU K;  2A69 A;  3GTM A;  1O2F B;  3GTP C;  4KN7 A;  4LQY A;  4A3B C;  2GAH C;  2JA6 K;  2V6U A;  2E2I A;  3VA7 A;  4P5B A;  4GTD A;  4KDD A;  3AH5 A;  3GTG C;  4WIL A;  1O28 A;  1YX2 A;  5D4D A;  4MEX A;  4G0U A;  4BKW A;  1YNN A;  1SFO A;  3S2D C;  1IS1 A;  3GTL C;  3GTG K;  4Q4Z A;  1J6W A;  1I3Q A;  5TJ3 A;  2NVY C;  1ZXO A;  4XSX A;  1J98 A;  3IPJ A;  4RMF A;  4OIO A;  1ZQ1 C;  3GSI A;  1WCM C;  3H3V L;  3GEE A;  2NVY K;  4A3F C;  4Q5S A;  2WB1 L;  4BY1 C;  3CQZ A;  3RZO C;  1R9T K;  1UV7 A;  1IE0 A;  1PJ7 A;  3K7A C;  4OIQ A;  1Y1V C;  3TFJ A;  2Y0S L;  1V5V A;  4AYB L;  3AQO A;  2XCQ A;  3CAG A;  4QIW L;  3GTK K;  3K7A K;  4G7H A;  4P9S A;  4C3I C;  1B4B A;  4Y52 K;  1HI9 A;  4KMU A;  1IW7 A;  2A6H A;  1TWA A;  1USM A;  3FKI A;  5IYC C;  2GSO A;  4A3J C;  4XSZ A;  2NVQ K;  1TWF K;  3N3Y A;  4A3C C;  2WAQ D;  3S16 K;  5C4J K;  2O5I A;  3OPF A;  5IYC K;  4A3G C;  2E2J C;  5IP9 C;  2FQT A;  4A3J K;  1ZBS A;  3GTQ A;  3HOV K;  2CFA B;  4A3C K;  1AB4 A;  2E2I C;  3G4C A;  3TFH A; 
#chains in the Genus database with same CATH homology
 2Y0S D;  4QJV B;  4AYB D;  2E2J K;  1K83 K;  5M5Y K;  5IP9 K;  3S14 K;  4C2M K;  3GTP K;  3M4O C;  4QIW D;  2A68 A;  4JK1 A;  5C3E K;  2R93 C;  2NVQ C;  5M5W K;  4A3B K;  4BY7 C;  1I50 C;  3GTJ C;  1TWF C;  2CW0 A;  4LK1 A;  5C4X K;  4A3E K;  1SFO C;  2JA7 C;  4C3H K;  3I4N C;  3S16 C;  4BBR K;  3CQZ K;  3H0G C;  5C4J C;  3HOU C;  3M4O K;  4A3D C;  1I3Q C;  4LLG A;  4ZH4 A;  2R93 K;  4BY7 K;  3HOV C;  2WB1 D;  1I50 K;  5TMC A;  2JA7 K;  3S1N C;  4X6A C;  5IYD C;  5IYB K;  3H0G K;  2JA6 C;  3S1Q K;  4OIP A;  3HOU K;  1K83 C;  2A69 A;  2R7Z C;  3S2D K;  3GTL K;  5IP7 C;  3HOX K;  3GTP C;  4G7O A;  1SMY A;  1HQM A;  4KN7 A;  2PMZ D;  4LJZ A;  2PPB A;  1TWC K;  2YU9 C;  3S1N K;  4A3B C;  1I6H C;  4X6A K;  4A3E C;  5C4X C;  2JA6 K;  4MEY A;  4BBR C;  3CQZ C;  4OIN A;  2R7Z K;  5IP7 K;  5M3F K;  4A3L C;  4BBS C;  3HKZ L;  3GTG C;  1WCM K;  3DXJ A;  2YU9 K;  3M3Y K;  3HOZ C;  1I6H K;  4A93 K;  5FLM C;  4YFK A;  5D4D A;  5IYB C;  3EQL A;  4A3F K;  4BXX C;  4MEX A;  3S1Q C;  1YNN A;  4A3L K;  3S2D C;  4BBS K;  4QJV A;  3HOX C;  4BY1 K;  3GTL C;  3GTG K;  4Q4Z A;  2BE5 A;  3HOZ K;  4KN4 A;  3RZO K;  1TWC C;  5FLM K;  5FJ8 K;  3S1M C;  2PA8 L;  4BXX K;  1TWH C;  2NVY C;  4XSX A;  4G7Z A;  1Y1V K;  3S1R K;  1Y1W C;  4OIO A;  3H3V L;  1WCM C;  3M3Y C;  3RZD C;  4GZY A;  3I4M C;  3S1M K;  4A93 C;  1TWH K;  1TWA C;  3S17 C;  2NVY K;  4A3F C;  4Q5S A;  1ZYR A;  2WB1 L;  3FKI C;  1XPP A;  2E2H K;  4OIR A;  1Y1W K;  4YFX A;  2NVX K;  4BY1 C;  2JA8 C;  2WAQ L;  2B63 C;  4C3I K;  2O5J A;  3RZD K;  3I4M K;  3RZO C;  2R92 C;  1YNJ A;  1TWA K;  3S17 K;  1R9T K;  2NVT C;  2JA5 C;  3FKI K;  4Y7N C;  3HKZ D;  3HOY K;  3S2H K;  3K7A C;  5TMF A;  3GTM C;  3S15 C;  4OIQ A;  3WOD A;  1Y1V C;  3S1R C;  2B63 K;  2JA8 K;  3GTQ C;  4A3I K;  2Y0S L;  4AYB L;  2R92 K;  3PO3 C;  4QIW L;  2NVT K;  2JA5 K;  5C44 K;  5M3M K;  4Y7N K;  3GTK K;  3S15 K;  3K7A K;  3GTM K;  2E2H C;  3PO2 C;  3GTQ K;  4G7H A;  4A3K K;  2NVX C;  4A3G K;  2PA8 D;  5M5X K;  2VUM C;  3PO3 K;  4NOI A;  4Y52 K;  1R9T C;  4KMU A;  2E2I K;  4XLP A;  2A6E A;  1IW7 A;  4C3J K;  2VUM K;  3GTO C;  3HOY C;  3PO2 K;  3S2H C;  2A6H A;  4A3M C;  3H3V D;  3HOW C;  5IYC C;  4A3I C;  4A3J C;  4XSZ A;  2NVQ K;  3GTJ K;  1TWF K;  5C44 C;  3GTO K;  1SFO K;  3GTK C;  2PMZ L;  4A3C C;  2WAQ D;  3I4N K;  1TWG C;  4A3M K;  3S14 C;  3S16 K;  5C4J K;  2O5I A;  3HOW K;  5IYC K;  4A3K C;  1BDF A;  2E2J C;  4A3G C;  5IP9 C;  4MQ9 A;  1I3Q K;  4A3J K;  4XLN A;  4A3D K;  5C3E C;  3HOV K;  1I6V A;  4Y52 C;  4A3C K;  5IYD K;  2E2I C;  4YG2 A;  1TWG K;  4LK0 A;  4YFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...