1WCZA

Crystal structure of an alkaline form of v8 protease from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
215
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEATGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an alkaline form of v8 protease from Staphylococcus aureus
rcsb
molecule tags Hydrolase
molecule keywords Glutamyl endopeptidase
total genus 58
structure length 215
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA02
3CENA 1AFQB 1MU6B 2P16A 2WINI 4DIIH 2Q6DA 2BOKA 1HJ8A 2ZFTA 1ANBA 3M7TA 4NIWA 1UCYK 3S9BA 4X6NA 2GCTC 2F9OA 4ZXXH 1QQUA 4X0WU 9ESTA 3CS0A 1SGFA 1ZMNA 1ID5H 2QF3A 3ZVEA 1C5YB 3RM0H 4H6SB 2PGBB 1O3DA 5TJXA 2A2XH 3VPKA 1ZR0A 4NFEA 5TCCA 1DUEA 2PFEA 3QX5H 5EQSA 1INCA 2F3CE 4JCNA 4UDWH 5CHAB 2BD5A 5A8ZA 1WOFA 1BCUH 1TGSZ 1C1OA 1BMLA 3DFJA 5F8TA 3GOVB 1HXFH 1J17T 2OTVA 2ZDMA 3PTBA 4ESTE 3ATWA 4GUXA 1GCTC 2HRVA 3HKJB 1LO6A 3IWMA 2VINA 2GCHG 1QY6A 1LHGH 1GBJA 4ABDA 2Z9JA 2FI3E 5JB9S 2FWWA 1BUIA 4FUCA 4YOIA 1ZLRA 5T6DA 4KTUA 3SI4H 2FP7B 3FAOA 5EPYA 1HAGE 1P04A 1K2I1 4B1TA 4JZIA 5CE1A 2QYIA 1Z8GA 2GV6A 2A4QA 4ISLA 4OS5A 2AGIX 2Z7FE 1D6WA 2XW9A 1ZTJA 3RUOA 4IN1A 4NZLA 4XBBA 4AFZA 3LKWA 2ZPSA 4YT6H 4NIXA 5EQRA 3UREA 2A0QB 2BYAX 4K69A 3P8GA 3RXOA 1IQMA 1SHYA 2D2DA 3TNTA 1HNEE 1GJ8B 3UIRA 1TB6H 1E0FD 3EA8A 2J95A 3ZZ7A 3V7TA 5FPTA 3LIWA 4CRDA 3ZZ9A 3GCOA 4OS6A 2RDLA 1O3JA 1DOJA 1YPMH 1GBIA 3E8LA 3MI4A 3Q3KA 1V2TT 1CHGA 1Y8TA 4YT7H 1BRUP 1ZHMA 4MDSA 1BHXF 3P6ZB 2ZU5A 4JK5A 3MMGA 1D3DB 3ITIA 3BTFE 1DWBH 2VJ1A 1GMHF 1T31A 2J34A 4XFQA 4NIYA 4AGKA 3U8TH 4INLA 4THNH 4X1PU 3UUZA 3UWJH 3VGCC 7LPRA 3RXMA 1AHTH 2Y7XA 5C67A 5HXFA 1WQSA 1H8IH 5HM2A 2C8XB 2IJOB 2AEIH 1FLEE 4Z0KA 1UMAH 5J4QA 1O2RA 3OX7U 3TK9A 4H42U 2TRMA 1QQ4A 2C4FH 1QCPA 1NFYA 2ALVA 2WPIS 1GBKA 3A86A 2ZWLH 1MBQA 2BY7X 2FEQH 1P57B 3QO6A 4MTBA 1VR1H 1DWEH 1W12U 5EU8A 3RM2H 1ZRBA 3SJ8A 1SVPA 1UO6A 2WYGA 1T8MA 3A8DA 4DIHH 3URDA 2UUYA 1W7XH 2Q1JA 1S81A 3RMMH 2OD3B 4GCHG 4UEHH 4BXWA 3RXLA 3LGVA 3L33A 4Y8ZA 3MNBA 1BBRE 1NFUA 4XOJA 4JYTA 1UHBA 1LVMA 6LPRA 1WAYB 3BG4C 2TIOA 4SGBE 2ZU2A 2G5NA 4B2BA 1SB1H 3RMLH 3A83A 2QGRA 1YPKH 4FVDA 1JIRA 3PLPA 1DITH 1DXPA 4ZKSU 2WV4A 2ZGHA 1B5GH 1SGDE 3MO3A 1CE5A 1ZJDA 3EYDA 3TK5A 1TIOA 4JZEH 2FX4A 4LXBH 2ZGJA 3FP8E 2G00A 1JBUH 1KLIH 1P2JA 2W3KA 1VJAU 1HBTH 1O30A 4MLFB 2ANWA 2ZPRA 1IQJA 1TBQH 2PUQH 1YCPH 5AF9H 3ESTA 4JK6A 2BD9A 4JZFH 3SV7A 2BQWB 1GI2A 2SGDE 1P11E 1ESBA 1V2NT 4GPGA 1ARCA 1OWKA 1A0LA 3LGWA 1NU9A 2A4GA 2BY6X 3BG8A 1ETTH 5E0HA 4HTCH 1HJ9A 1EB2A 1LHFH 2A2QH 3IITA 5EQQA 1DY9A 3GCHC 4ABAA 3LU9B 2BDGA 1MAYA 1A4WH 2AMDA 1VCQA 2PSYA 1O3PB 2ANKH 2WPHS 1C5LH 1EPTB 1DE7H 3EE0B 2XNIA 2Z3CA 3GICB 3V3MA 1O36A 3MH5A 2ZHFH 1TFXA 2O8UA 4AFSA 1BB0B 1TLDA 2QF0A 2ZFQH 1SGNE 1JRSA 1G3DA 3TK6A 1TONA 4MPVA 1YF4A 4KELA 1IQKA 4GAWA 1C5PA 5L2YH 3U8RH 1O2LA 1MD7A 2H5CA 1XUKA 3T29A 3TVJB 2XC4A 2Y6TA 2G81E 3LGUA 1V2OT 1UVPA 4GHQA 2GZ9A 1P8VC 2CV3A 1PQ5A 4AORA 2R3UA 1W3CA 1DWCH 2HNTC 3EA9A 3N7OA 1VCPA 5C5NA 3U1IB 1NC6A 2J2UA 1F5RA 7GCHG 3VB6A 3K6ZA 2GDDA 1NRQH 1YPHE 1NRRH 2EI8A 1P3CA 1O2GH 4AGJA 1OSSA 2FS9A 3M3VA 3D65E 2IN2A 3BTHE 4FVBA 4A1VA 1UTKA 5C1XA 3UNRA 1GBAA 4XDEA 1CHOF 1E34B 2JH6D 3SUGA 1O0DH 4ABIA 1IQGA 3LH3A 4GVUA 1OYTH 3KL6A 4XSKU 4OS2A 1UVTH 2B0FA 4ZHLU 1Y3XA 2FIRH 3BTGE 3RXIA 5C2ZA 3RC6A 1TYNA 1FY4A 2B5TB 1O34A 1ZPZA 1DUAA 1ZHPA 3KF2A 1K21H 1KTSB 2A7CA 5BRRE 1D4PB 1RS0A 1EP5A 1C2KA 4NCYA 1QB1A 2FOFA 4WXVA 1CT0E 3SHCH 1UTMA 3BTEE 2I6QA 1RIWB 1C5VA 1E37B 1GBCA 1C1SA 1C1TA 1P01A 3HK3B 3A7VA 3KNXA 1T32A 3RXPA 2FX6A 1W0ZU 1HAVB 1WTHD 3GDSA 1G36A 3SGAE 1Q3XA 1IAUA 3LPRA 1WBGB 1CSOE 2FTMA 1Y3UA 3U9AH 4WMDA 3U1JB 1AY6H 2F9VA 5E2OA 1G37A 2UWLA 1LVBA 1ZTKA 3SNDA 2YOLA 2P93A 4K2YA 1EQ9A 1YYY1 3W94A 4IC6A 1O31A 2BD8A 1EJMA 2ZDAH 1KDQB 3TJVA 1KSNA 1LKAA 3MU4A 1C9PA 3T2NA 3DD2H 3RP2A 1PYTD 1SMFE 4IGDA 1KLTA 2GT7A 4Y79A 4WMFA 1C2LA 4A1XA 4JYUH 5FX6A 2VVVA 1HAYB 1GJ9B 3GYLB 3SU3A 1Z6EA 2PLXA 1GMCG 1C2HA 4BANB 3Q00A 3ZZ6A 3UNSA 1VITF 5DGJA 3TPIZ 1LQDB 3SNEA 2A5KA 1YBWA 2R3YA 4ZKRU 1H8DH 1SGPE 3SU1A 2Z6BD 4FUFA 2XCNA 2J94A 3URCA 4MNYA 1NRNH 2VWMA 1QJ1B 1GHXH 2A32A 3M7QA 1TNIA 2R0KA 1P03A 1V3XA 4AB8A 2Y7ZA 2VU8E 2H2ZA 4NA8A 2NWNA 3E1XB 4Q7YA 2H6MA 1ETSH 1NT1A 1KTTB 4UFFH 1GCDA 2BQ6B 4M7GA 2NU2E 2VGCC 3SGBE 5L30H 1QB9A 3O8RA 1IQLA 1CA0B 2FLRH 3UPEA 4DURA 4H6TA 2QY0B 1D3PB 2SGFE 5I46H 3HKIB 1HAOH 1NN6A 1S6FA 1O2WA 5JBCS 5E0GA 3ZVGA 1GI8B 5FCRA 1TNJA 3SJKA 2BX3A 1XXDA 1V2PT 5ESBA 3SU0A 3GY5A 4CRAA 3QK1A 4U01A 4ZAEA 3UOUA 1O5BB 1FPCH 1C5WB 4KGAA 1TMUH 1PPHE 1DFPA 4F4OC 1O2VA 2W5EA 1MCTA 3DFLA 1BQYA 1CA0C 1H1BA 5EGMA 2GVFA 3HGNA 3A80A 3MH6A 4CR5A 1Z7KA 1K1JA 1DSTA 1TAWA 3K9XB 1EB1H 2FOGA 3STIA 3P17H 3UQOA 1HPGA 2C3SA 3LGYA 1HAZB 1NS3A 2ODYB 5DPAA 3QGNB 1C5RA 4HI3A 1H9HE 1P3EA 3M61U 1NROH 2V3OH 1YPJH 1CVWH 4AFQA 3MFJA 4CBOA 3SW2B 3GDUA 2OC0A 4U32A 3O8BA 3OYPA 1AE5A 2PHBA 3KQEA 3KN2A 1QTFA 1WQVH 4YOGA 5GXPA 3PV4A 4TY6A 1DPOA 5FX5A 5LH8A 2SGEE 1DS2E 2B9LA 2XWBI 4CH2B 3ZZ4A 4TYDA 3SNBA 1BBRK 3E16B 6CHAB 1V2KT 1EAXA 3SQHE 3VGCB 1AI8H 1O3IA 3B9FH 1TX7A 1FN6A 1TBZH 4D7FA 4QT8C 3A7WA 4UFDH 1MZDA 5AFYH 1MBMA 1GHWH 1K1IA 4AYYB 2TGDA 1O2SA 2D1JA 2GX4A 3E0NB 1RD3B 1XKAC 3TU7H 2XTTB 4DY7B 2D8WA 1QHRB 2JETB 1VITG 2ZU1A 3E3TA 1ZGVA 1QJ6B 5JYIA 1Z6JH 1RTLA 4DJZB 1BTZA 1YLDA 2OBOA 3D62A 2ZFRH 4U30A 2BLQA 1KY9A 2O9QA 1ZJKA 1FY3A 1G30B 2ALPA 3T28A 1LDTT 1EP6A 4E7NA 1O3HA 1Q31A 3UTUH 4YM9A 5HM9A 4DCDA 2PTCE 1PYTC 1BRBE 4WXIA 3MOCA 1QRXA 2BXTH 3E91A 3LJJA 1C1PA 1MU8B 5DO4H 1NU7B 2PKAB 4LZ4B 4K1TA 1O2OA 1A0HB 3E6PH 2ZCKP 1BRCE 1BTHH 1IQFA 1SGEE 1HRTH 1MZAA 2BQ7B 2BY9X 2VIOA 1BZXE 1OS8A 3SUFA 1E38B 1TNKA 1NO9H 1TGTA 1Y3WA 4X2WA 2QN5T 5C1YA 1TGNA 3RXHA 1KXBA 1FI8A 1ELFA 1XKBC 1FNIA 1CA8B 1ELCA 1FDPA 2XCFA 4MQAA 1BT7A 2K1QA 4K60A 3M5NA 1FONA 2Y80A 5EXNA 5A0CA 3SV6A 4X8UH 5DP6A 2QV1A 5CMXH 2Z94A 1QL8A 3A8CA 3SJIA 1D6RA 4CRBA 3MH7A 1QBNA 4X8VH 4A5TS 3TGJE 1A3EH 4Y0YE 1W2KH 2F9UA 2FS8A 1GDNA 3RXCA 3OY5U 1O3KA 1GI9B 3UNQA 1EZXC 4JZ1A 4YO9A 1BMNH 2UUJB 1PJPA 3RXDA 1SBWA 4HZHA 2C8ZB 2CHAC 4R8TB 1BBRH 5EG4A 2CF8H 1P9UA 3F9FA 1NRSH 1TPOA 1HJAB 3QDZB 4Y11E 1OYQA 2ZECA 1C5OH 3NKKA 1S5SA 1KXCA 2TGPZ 1CT4E 1GCTB 1ABJH 2GDEH 4H4FA 1QL9A 2P95A 1ZYOA 3TNSA 4FUIA 1ELAA 2XRCA 1FY1A 4NA7A 2ZU4A 4Y7AA 4Y8YA 1UTOA 2P94A 1TPPA 2GP9B 2GT8A 1F0SA 1H9LB 1SFQB 1FXYA 3QTVH 4AZ2B 3NZIA 4MPUA 1HGTH 3SV9A 1KXAA 1O38A 3SORA 2GKVE 3V12A 1P9SA 3LC3A 3C27B 1O5EH 1GI4A 2QXIA 4O9VA 1HJAC 2UWOA 2BXUH 3RLWH 1CGJE 4D8NA 1VJ9U 2R0LA 2SNWA 5DP9A 4K8YA 2ZZUH 1CO7E 4FUBA 1SGFG 2BD3A 4LK4A 1N6YA 4ZXYH 1O5FH 2G51A 1EAUA 1YGCH 3SN8A 1C2GA 1FJSA 1VZQH 1CU1A 3TIUA 1Y3VA 5F03A 1YP9A 4I7YH 3NK8A 2B7DH 1B0FA 2OC1A 2ZF0H 3P70B 1F2SE 3PMJA 1GGDC 5F8ZA 3M5LA 5IDKA 1P06A 1IHSH 1P2MA 1GMDF 1XUJA 3TJNA 2ZTYA 1P2NA 5A2MH 2PTNA 4ZHAA 1T7CA 1TMTH 2FOCA 4NGAH 2EA3A 2BZ6H 2VWLA 3QGJA 3EGKH 3MTYA 5FBEA 2B8OH 4ABEA 1AU8A 2BB4A 3VB7A 1AE8H 1N1LA 2Q6GA 1GMDG 1EXFA 3GY7A 1C5XB 4NWLA 2HGTH 1O37A 1GHAG 2TGAA 1VITH 5G4BA 3KGPA 1GVZA 2M5TA 3GY6A 1WUNH 1QA0A 5GWZA 1QL7A 2LNCA 1K22H 4A7IB 1MMJN 1P2QA 4BNRA 6ESTA 1LMWB 3ELAH 3ZVAA 2P59A 1O35A 3SV8A 1GJ5H 5I25A 4TWWA 2OINA 1TRNA 2ASUB 5C1UA 3I29A 1BITA 3S7HB 1FAKH 1TRMA 5PTPA 4LOYH 3VB4A 5DP4A 1ESAA 4AB9A 3PLKA 1C9TA 4I8LA 1UHBB 2FXRA 4NIVA 1GG6B 1P12E 1NESE 3LONA 5DK1A 1FN8A 4WH8A 5FCKA 3LOXA 1W10U 1QNJA 2ZFSA 4K3JA 1PQ8A 5L6NH 1F5LA 4CREA 3PROA 5A0AE 3NWUA 1PPCE 4IS5A 1O3CA 1WCZA 2BY5X 1Y5UT 4NG9H 2H5DA 1V2JT 1MD8A 1S82A 2ZGBH 1ZSLA 1V2MT 3BTKE 1F0RA 1D3TB 4X6MA 1HV7A 4JYVH 4WVPE 1AVWA 2XXLA 5ESTE 3QN7A 3RLYH 2GD4B 4FU9A 3ZVFA 4YOJA 2VWNA 4Y10E 2PV9B 2AERH 5IYTA 3OY6U 1P05A 5JB8S 1YPLH 1SFIA 4R0IA 3TJUA 4O97A 3F9EA 3SU6A 3ZV9A 1MTWA 1GHBG 1ETRH 1FIWA 1C1VH 1GI0A 1RRKA 3GY8A 3SHAH 2ZKSA 5HYOA 1GHAF 3PMHB 1P0SH 1A5IA 5GJ4B 2R2WU 2FTLE 3FP6E 2NU3E 1BIOA 3LGIA 1AB9C 1UTPA 2BD2A 2CHAB 3A84A 3S69A 1SC8U 2H9HA 1AWFH 3GYMA 1YKTA 1K9OE 3H7TA 1QIXB 2WPLS 2BTCE 1O3FA 5A8YA 2ZFFH 4UFGH 3BIUH 3VB3A 4DW2U 2JH0D 1ELTA 2ZG0H 2BM2A 1C5ZB 1GI3A 3PMBB 4AG1A 1ZSJA 1CGHA 2Z9LA 1VGCB 1NFWA 1ANDA 5FHTA 3UY9A 3ZYEA 2BDBA 3ZZAA 1GHVH 3Q3YA 2O8MA 2Z3DA 3SBKA 3M37A 4FUJA 1GBFA 1O5DH 4ZKNU 1GI6A 3BTTE 4RSPA 1UVSH 1C1NA 1L4DA 4X2VA 2ZDLA 4TPIZ 1CGIE 4XBCA 2GGVB 1YPGH 5GIBA 3BTQE 4LZ1H 5HGGA 1TPSA 1LQEA 1V6DA 3FP7E 2ZHWH 1ZSKA 2ZDVH 5E0JA 5TCAA 2FOHA 3K2UA 3BTWE 1P2KA 1PPEE 2A5AA 3RXVA 2D26C 2O8LA 1GVKB 1K1NA 2P3UB 7ESTE 2SNVA 1ANCA 2QC2A 1AIXH 1ARBA 1MTNB 1EZQA 1XUFA 2W7UA 1OOKB 3T5FH 1C1RA 1EATA 3BIVH 1GI5A 3PWBA 1O2MA 1PPBH 1ZGIA 3RDZA 1A7SA 1GI1A 2J9NA 3RXAA 2PSXA 3ODDA 1PQ7A 3RXUA 4FUGA 1O5GH 1O3LA 1B0EA 1AFQC 1MKWH 2HPPH 2H1UA 1DY8A 3RXSA 4WH6A 4DT7B 1DT2A 1SOZA 1SHHB 1QGFA 4B2AA 2ESTE 2EEKA 2UWPA 5FBIA 4BTIB 1FY5A 4ISIH 5FPSA 2A31A 4Y8XA 3S9CA 1O2PA 4B75A 3D23A 2OBQA 2GV7A 1AFEH 4O3TA 1XM1A 1TABE 3KQCA 1LVYA 2ZEBA 3BEIB 3LH1A 1DLEA 4UFEH 1YCPK 1O2YA 1MKXK 2BD7A 4I33A 5CHAC 1UTJA 1C4U2 1C5UA 2JETC 1HAVA 2O8WA 3PLBA 1ELVA 4E05H 2PWXA 5FPYA 1A2CH 1JOUB 1OWDA 3G01A 4K8BA 4GHTA 1UJ1A 1UTNA 4B71A 1YLCA 1OXGA 1C4V2 3O8DA 1YPHC 3ATMA 2VB0A 3PO1B 2SGPE 4BTTB 3C1KA 2C8WB 2XWAA 3RXEA 1V2VT 1H9IE 3D49H 1RJXB 1ZOMA 1A0JA 1O39A 2FYQA 1MTUA 3A89A 4YESB 1E35B 3LT3A 1WTGH 4ZROA 1TA2A 1C1UH 5A0BA 2ZNKH 1T4UH 2BDHA 2ZQ1A 2OQUA 1TGBA 3MU1A 1HB0B 2O8TA 3MU8A 1U6QA 2FYRA 2BD4A 4NSVA 2WV5A 3RC5A 2THFB 1LHEH 1MTVA 2ZU3A 3ZVDA 1MTNC 1GJAB 1O2QA 1O3BA 1ELEE 1GVLA 1SGRE 4ABGA 1C2IA 3BG4B 4INKA 2RCEA 1S85A 1LPKB 1GL0E 2C8YB 1AB9B 1THSH 1T4VH 5DKMA 1MKXH 2FMJA 1C4Y2 3BN9A 1GJCB 2ZTXA 5B6OA 1UK4A 3PM3A 3A87A 4Q7XA 3K65B 2XBVA 3SU4A 2BMGB 2STBE 4YTAA 2R9PA 1AUTC 2HALA 1HIAA 2UUKB 2BDCA 2OUAA 4YLUA 1DX5M 1FZZA 1RGQA 3ZZCA 3TJOA 1O2KA 2BLWA 3CP7A 2ZFPH 3MU5A 1MKWK 2VWOA 1IQNA 1O5AB 1HDTH 1LTOA 2OCVB 1SLWB 5BPEA 3UR6A 3VFEA 4X1NU 3ZZBA 1TRYA 4Y71A 2XC0A 1C5QA 2Z9GA 3QZQA 4AFUA 2SGQE 1SPJA 2SGAA 1EASA 2STAE 3PWCA 5E2PA 3P8FA 3KEEA 1QB6A 2VIQA 4XBDA 1JWTA 5DG6A 4GLYA 1B7XB 1XUGA 1IOEA 2G4UA 1UCYH 4Y76A 2WYJA 1GDUA 4K1SA 1S0QA 3HGPA 3DA9B 1TWXB 3ZYDA 1EUFA 2XBYA 1OP0A 2F9BH 8GCHG 3ZVBA 1RTFB 3MYWA 4MPXA 3PMAB 2ODPA 3ENSB 2ZCLP 3SUEA 2ZC9H 3GCTF 2OP9A 3RXRA 3SJ9A 2XC5A 4BAQB 1HCGA 2GCHF 3P92A 1HAHH 1O2JA 2G55A 1RIWC 1FMGA 1LPZB 1UTQA 3H7OA 5H4IB 1LCYA 3SJOA 5T3HA 3UQVA 3E90B 3AW0A 1DXWA 2H9TH 1JXPA 1D3QB 4X8SH 3O8CA 1G2MA 1Y59T 9LPRA 1P10A 1EAIA 4FU8A 4X8TH 6CHAC 1E36B 2HNTF 2ZO3H 1W11U 5JDUB 1SLXB 6GCHF 3UFAA 2G8TA 1YM0A 2VIPA 3GY2A 1T8NA 4Y7BA 4BAHB 3RXFA 2BX4A 2Z3EA 1KXFA 1GDQA 4E7RG 5DP8A 3S9AA 1KXEA 2TGTA 1F92A 3NUMA 1THPB 3WY8A 2Z9KA 4OS7A 2JKHA 1A46H 3LJOA 5GCHG 3BV9B 4RN6A 5SGAE 4DVAU 4NSYA 1KYNA 2PUXB 4A92A 1GWAA 1P02A 5DP5A 1MTSA 1Z1JA 4AG2A 5F8XA 5EOKA 4ISHH 1OWHA 5EXMA 1GBHA 2PGQB 1GBEA 3A82A 3F68H 2EI6A 1V2UT 1AZ8A 3A81A 3M3SA 3HPTB 2AMPA 4FUEA 2XBWA 1BTUA 2ANMH 2WUCA 5EW2H 4KP0A 1N6XA 1GG6C 1XXFA 4UE7H 4HGCA 1LHCH 2PKAA 3EDXB 2BDIA 2HVXA 3MNCA 4VGCC 1NM6A 3Q3XA 4YLQH 1QURH 3EA7A 2WPJS 4B2CA 3ATIA 2P8OC 2A45B 1N8OB 2ZI2H 1MQ5A 1ZRKA 2GZ7A 5C3NA 4MVNA 4D9QA 1AD8H 4A6LA 1THRH 4ZUHA 3JZ2B 1O33A 2G52A 3KIDU 1DDJA 5LPFA 1P2OA 7GCHF 1BRAA 3RU4T 3ZV8A 2ZTZA 3RU4D 8ESTE 4CBNA 1KXDA 1EKBB 2Y81A 1BOQA 1V2LT 3BSQA 1TQ7B 3SNAA 1EJNA 1J14A 2OC7A 3LC5A 4F49A 5AFZH 1O3NA 1C2JA 2NU4E 1PPGE 1V2QT 4GSOA 8LPRA 1SGTA 5EPNA 2ZHQH 4IMQA 1GI7B 5A8XA 3P8OA 1GJ4H 2ZGCA 4DGJA 1EAWA 4X1SU 3SGQE 2YNAA 1QRWA 1AN1E 4ISOA 5F6MA 2QA9E 3TH2H 1P2IA 2DUCA 3W95A 3BTDE 2FLBH 3HATH 4CRGA 1ZMLA 2J38A 2VH0A 3T26A 3PTNA 1F5KU 1C1MA 1HAIH 1GJDB 1NFXA 2HNTE 1OWJA 2FI5E 3NPSA 1C2MA 2FZZA 3RU4E 4K5ZA 1PPFE 2W26A 1OKXA 1Q2WA 1MAXA 1QR3E 2FOEA 4I8JA 3ZZDA 1Y5BT 1GJBB 1H4WA 1W8BH 4Z6AH 1DLKB 2VH6A 2IOTA 2VVCA 1OWEA 1IQEA 1SOTA 1AQ7A 1TNHA 2J92A 4X1RU 4D76A 1FAXA 3ATLA 2RA0A 1ABIH 2EC9H 3F9GA 2FOMB 1J8AA 1FUJA 2A4OA 1IQIA 3FZZA 3HK6B 3GCHB 1TX8A 1YC0A 1N8OC 4O03A 5GCHF 3SUDA 3UWIA 1SGCA 2HWLB 4VGCB 3SNCA 2QXHA 3T62A 1V2WT 3TLOA 3DT0H 4WJG2 2FM2A 2BHGA 2OXSA 4NFFA 1GBMA 4DG4A 1UTLM 1SLUB 1EZUC 2DE8A 2RA3A 3MHWU 3AW1A 4KTCA 1TOCB 1JRTA 3RXQA 3MWIU 2XBXA 5EW1H 1VGCC 4E06H 3STJA 2A7HA 2QIQA 3PB1E 3NCLA 1O2ZA 3A88A 2ZDNA 5A09A 1A1RA 4ABHA 3QLPH 1Z8JB 3VXFH 1ESTA 1O2TA 1UVUH 2Y5HA 2ZPQA 4X1QU 4I32A 2PKSC 1K1MA 1NRPH 1A5GH 1GHBF 1O2UA 4K1EA 2ZA5A 1BTXA 1G32B 3AASA 3GCTG 1MCVA 5T6FA 1XMNB 4DOQA 4YZUA 3GISB 1HAXB 2ILNA 3MNSA 1J16A 4NWKA 4FU7A 1HLTH 2HPQH 1GBTA 2XYAA 1TNGA 2DE9A 3MH4A 4JMYA 4FXGH 2ZHEH 3RMNH 1AGJA 4HFPB 2FDAA 2BDAA 1ZTLA 1YPEH 3SQEE 1L1NA 1GBBA 1XX9A 4O3UA 3FANA 4JZDH 1TBRH 2F9NA 3PO1C 1DWDH 2R2MB 5JBTA 1ZPBA 1V2RT 1O2NA 2Y5GA 5ABWA 1C5NH 1MQ6A 3RMOH 2FPZA 1CHOG 5LPRA 3T25A 3V13A 1SQOA 1SQAA 1Z71A 1OX1A 2PKSB 2QXJA 1FV9A 5FXLA 1S0RA 1FPHH 5DP7A 2KAIB 3B23B 1KLJH 4CHAC 1GJ6A 1SL3A 1WYKA 1SG8B 1G2LA 5EODA 1QFKH 1M9UA 2OLGA 2QXGA 1EJAA 1O3GA 4IMZA 1LHDH 3A7TA 4BAKB 1IQHA 1BTWA 1C2FA 1OWIA 1CBWB 1EPTA 4CH8B 2VIVA 4ZKOU 1NY22 5HMAA 2VVUA 2WUBA 1L0ZA 4X6PA 4PROA 1SGQE 3GY3A 3L6PA 2ANYA 2AGGX 4RKOB 4TPYA 2JH5D 1C5SA 1AKSA 2V3HH 4BXSA 4OS4A 3RXJA 4CHAB 1L4ZA 2GZ8A 1D9IA 3GY4A 1Z1IA 2TBSA 2FOAA 4XE4A 2G5VA 3F9HA 3VB5A 2ZIQH 2ZDKA 2V0BA 1SQTA 1FY8E 1C2EA 4IN2A 5K7RA 3SV2H 1W14U 2AIQA 2J4IA 4I8KA 2HOBA 1O5CB 1BA8B 1EOLA 2LPRA 3A85A 5GPIB 3R3GB 3FZDA 2Q6FA 2KAIA 1PQAA 1TQ0B 1SR5C 3P95A 4Y0ZE 4AX9H 1BJUA 1VCWA 1DANH 3SO3A 4NZQA 1ELGA 1QBOA 2CF9H 1HUTH 1TNLA 2QCYA 4MPWA 2W7SA 3M5OA 1K28D 2A4RA 2AIPA 4X2YA 1O3MA 3R0FA 4BAMB 3TGKE 1AMHA 3AVZA 1DM4B 2A1DB 1BMAA 1TMBH 4FUHA 2GMTC 1QA7A 4UD9H 3TH3H 3MO6A 3RXBA 1KIGH 4KKDA 3T27A 1NPMA 2H9EH 1AKSB 1G9IE 2FESH 1Y5AT 1G3CA 1GHZA 2NU0E 2ZQ2A 4I8HA 1O2HA 3F6UH 4ABFA 1F0TA 3B8JA 8GCHF 7KMEH 4CRFA 4MNWA 2OQ5A 2CN0H 1BMMH 1SI5H 1XUHA 5ETXA 3RXKA 1SLVB 3EAJA 4MNVA 3ZZ5A 2GCTB 4WMEA 2BY8X 1BHXB 2PR3A 3AAVA 1C1WH 2ODQA 1JIMA 2YNBA 3EQ0H 1GMHG 1LPGB 1FQ3A 1K1PA 1LVOA 4ISNA 4AN7A 3QWCH 2TPIZ 4OS1A 1JMOH 1ANEA 2BVRH 3A8BA 3OU0A 1OP8A 3SZNA 1CT2E 8KME2 3SI3H 2BVXH 4TY7A 2Z9IA 2P8OB 1XUIA 1ACBE 4U2WA 1QBVH 3I77A 1OP2A 2IPHA 3F1SB 4A1TA 5C5OA 1XVOA 2FOBA 4INHA 2VIDA 5E8EH 1ORFA 3DUXH 2GTBA 3ZVCA 1ELBA 3TITA 2V35A 3E0PB 4KTSA 1KDQA 1O2IA 3MNXA 1WV7H 3VXEH 4X6OA 2BLOA 2ZGXH 3I78A 5GDSH 1Y3YA 3RXGA 5JPMH 1GGDB 1ELDE 1AUJA 4BOHA 1C2DA 3FVFB 3BEUA 3U8OH 3ZZ3A 1V2ST 1HAPH 4OGYA 2ZP0H 5EXLA 5FAHA 4NA9H 4WF8A 5L2ZH 4D9RA 3LDXH 3UOPA 1SGYE 1L1JA 1GMCF 1EZSC 1GHYH 2CMYA 3K6YA 4J2YB 2AYWA 1Z8IB 2FI4E 4X2XA 4J1YA 3KQBA 2VGCB 3FFGA 5DP3A 1TGCA 2VNTA 3JZ1B 1A3BH 4ZMAH 1QJ7B 5AHGH 5DJ7A 2GMTB 3S7KB 2W3IA 1AVXA 3M3TA 1S83A 3P8NA 3IG6B 1YCPM 2EI7A 2PW8H 1A5HA 3A7XA 1P09A 4AOQA 3M36A 1K1OA 1NZQH 2UUFB 3UR9A 1XVMA 1ZMJA 1PFXC 1QRZA 1BJVA 2Y82A 1PPZA 4RKJB 4ASHA 1ZZZA 4CRCA 1DICA 3AAUA 3PYHA 2BOHB 3ZZ8A 1BDAA 3SU5A 4BTUB 3RXTA 1TE0A 3OSYA 4ZH8A 1L1GA 1GBLA 1NTPA 3BTME 2AGEX 4IBLH 3U98H 4IW4E 1FIZA 1X7AC 1O2XA 3M35A 2G4TA 2AFQB 5JBAS 1G3EA 1T8LA 1AWHB 4Q80A 2ULLA 4CR9A 5JBBS 4D7GA 2ZHDA 2VIWA 1BTPA 3S0NA 1C5MD 4B76A 1BTYA 5K0HA 1RFNA 4SGAE 1UK3A 1UCYE 2QAAA 4Q7ZA 1TX6A 4WWYA 5AVDA 1HIAB 1TOMH 1UK2A 2CJIA 3KCGH 1EX3A 5C20A 3SU2A 1F7ZA 1TPAE 2BZAA 3H5CB 1TA6A 1J15A 1GPZA 3ATKA 2AMQA 2A7JA 2CGAA 3DHKH 1MUEB 6GCHG 4I31A 1O32A 1W13U 4MG3A 2OC8A 1ZHRA 1O3EA 2I6SA 2P3TB 1GJ7B 1G3BA 4Y6DA 3KHVA 1TALA 4IC5A 1O3AA 1GL1A 1CBWC 2FODA 3VEQB 1LKBA 2WPKS 1MH0A 3LGTA 3QUMP 2AH4X 2BVSH 2HLCA 2F83A 1EPTC 1IHTH 5T6GA 2A5IA 3A7ZA 1CQQA 3L3TA 2ZCHP 1S6HA 4ZHMU 1OPHB 3MO9A 4B74A 4TWYA 1S84A 1GBDA 1AVGH 1HFDA 3M5MA 1J9CH 3NXPA 1A61H 3RC4A 1Z8RA 3BEFB 2F91A 3A8AA 1ZPCA 1WSSH 1T8OA 5J4SA 3QZRA 2SFAA 2BDYA 3A7YA 1SSXA 2NU1E 1C1QA 1HYLA 1K1LA 1W7GH 3U69H 1HXEH 2AS9A 5LGOA 1F0UA 2C93B 1SGIB 1RXPA 3ODFA 1W0YH 3OTJE 2V6NA 1AZZA 2CXVA 3MU0A 2FO9A 2F9PA 4MNXA 3TGIE 1O3OA 1DSUA 1L2EA 2C90B 1C5TA 2P3FH 3V0XA 4FUDA 4ABJA 4Q2KA 1RTKA 4UONA 4B73A 3TH4H 1EOJA 4GCHF 3M7UA 3GCNA 1UVOA 3GDVA 1DVAH 4OGXA 3KQDA 3CS7A 1AO5A 4BAOB 2BLVA 3Q77A 1WU1A 5LPEA 3Q76A 3SOSA 4ABBA 2Y5FA 2WPMS 2RG3A 3BF6H 4AYVB 4WY3A 3QTOH 4I8GA
chains in the Genus database with same CATH superfamily
3CENA 1AFQB 1MU6B 2P16A 2WINI 4DIIH 2Q6DA 2BOKA 1HJ8A 2ZFTA 1ANBA 3M7TA 4NIWA 1UCYK 3S9BA 4X6NA 2GCTC 2F9OA 4ZXXH 1QQUA 4X0WU 9ESTA 3CS0A 1SGFA 1ZMNA 1ID5H 2QF3A 3ZVEA 1C5YB 3RM0H 4OM9A 3AK5A 4H6SB 2PGBB 1O3DA 5TJXA 2A2XH 3VPKA 1ZR0A 4NFEA 2F43B 5TCCA 1DUEA 2PFEA 3QX5H 5EQSA 1INCA 2F3CE 4JCNA 4UDWH 5CHAB 2BD5A 5A8ZA 1WOFA 1BCUH 1TGSZ 1C1OA 1BMLA 3DFJA 5F8TA 3GOVB 1HXFH 1J17T 2OTVA 2ZDMA 3PTBA 4ESTE 3ATWA 4GUXA 1GCTC 2HRVA 3HKJB 1LO6A 3IWMA 5F53A 2VINA 2GCHG 1QY6A 1LHGH 1GBJA 4ABDA 2Z9JA 2FI3E 5JB9S 2FWWA 1BUIA 4FUCA 4YOIA 1ZLRA 5T6DA 4KTUA 3SI4H 2FP7B 3FAOA 5EPYA 1HAGE 1P04A 1K2I1 4B1TA 4JZIA 5CE1A 2QYIA 1Z8GA 2GV6A 2A4QA 4ISLA 4OS5A 2AGIX 2Z7FE 1D6WA 2XW9A 1ZTJA 3RUOA 4IN1A 4NZLA 4XBBA 4AFZA 3LKWA 2ZPSA 4YT6H 4NIXA 5EQRA 3UREA 2A0QB 2BYAX 4K69A 3P8GA 3RXOA 1IQMA 1SHYA 2D2DA 3TNTA 1HNEE 1GJ8B 3UIRA 1TB6H 1E0FD 3EA8A 2J95A 2KFWA 3ZZ7A 3V7TA 5FPTA 3LIWA 4CRDA 1E1RD 3ZZ9A 3GCOA 4OS6A 2RDLA 1O3JA 1DOJA 1YPMH 1GBIA 4ASUD 3E8LA 3MI4A 3Q3KA 1V2TT 1CHGA 1Y8TA 1VKYA 4YT7H 1BRUP 1ZHMA 4MDSA 1BHXF 3P6ZB 2VBCA 2ZU5A 4JK5A 3MMGA 1D3DB 3ITIA 3BTFE 1DWBH 2VJ1A 1GMHF 1T31A 2J34A 4XFQA 4NIYA 4AGKA 3U8TH 4INLA 4THNH 4X1PU 3UUZA 3UWJH 3VGCC 7LPRA 1WXRA 3RXMA 1AHTH 2Y7XA 5C67A 5HXFA 1WQSA 1H8IH 5HM2A 2C8XB 1KMHB 2IJOB 2AEIH 1FLEE 4Z0KA 1UMAH 5J4QA 1O2RA 3FO8D 3OX7U 3TK9A 4H42U 2TRMA 1QQ4A 2C4FH 1QCPA 1NFYA 2ALVA 2WPIS 1GBKA 1YWUA 3A86A 5EIYA 4M9FA 2ZWLH 1MBQA 2BY7X 2FEQH 1P57B 3QO6A 1MABB 4MTBA 1VR1H 1DWEH 1W12U 5EU8A 3RM2H 1ZRBA 3SJ8A 1SVPA 3FKSD 1UO6A 2WYGA 5IK2D 1T8MA 3A8DA 4DIHH 3URDA 2UUYA 5HIYA 1W7XH 2Q1JA 1S81A 3RMMH 2OD3B 4GCHG 4UEHH 4BXWA 3RXLA 3LGVA 3L33A 4Y8ZA 3MNBA 1BBRE 1NFUA 4XOJA 4JYTA 1UHBA 1LVMA 6LPRA 1WAYB 3BG4C 2TIOA 4SGBE 2ZU2A 1S6LA 2G5NA 4B2BA 5B6LA 1SB1H 3RMLH 2J5UA 3A83A 2QGRA 1YPKH 4FVDA 1JIRA 3PLPA 1DITH 1DXPA 4ZKSU 2WV4A 2ZGHA 1B5GH 1SGDE 3MO3A 1CE5A 1ZJDA 3F3BA 3EYDA 3TK5A 1TIOA 4JZEH 2FX4A 4LXBH 2ZGJA 3FP8E 2G00A 1JBUH 1KLIH 4RI0A 1P2JA 2W3KA 1VJAU 1HBTH 1O30A 4MLFB 2ANWA 2ZPRA 1IQJA 3U28C 1TBQH 2PUQH 1COWD 1YCPH 4ACAA 5AF9H 3ESTA 4JK6A 2BD9A 4JZFH 3SV7A 1E79D 2BQWB 1GI2A 2SGDE 1P11E 1ESBA 1V2NT 4GPGA 1ARCA 1OWKA 1A0LA 3LGWA 1NU9A 2A4GA 2BY6X 3BG8A 1ETTH 5E0HA 4HTCH 1HJ9A 1EB2A 1LHFH 2A2QH 3IITA 2KCOA 5EQQA 1DY9A 3GCHC 4ABAA 3LU9B 2BDGA 1MAYA 1A4WH 2AMDA 1VCQA 2PSYA 1O3PB 2ANKH 2WPHS 1C5LH 3DSGA 2J97A 1EPTB 1DE7H 3EE0B 2XNIA 2Z3CA 3GICB 3V3MA 1O36A 3MH5A 2ZHFH 1TFXA 2O8UA 4AFSA 1BB0B 1TLDA 2QF0A 2ZFQH 1SGNE 1JRSA 1G3DA 3TK6A 1TONA 4MPVA 1YF4A 4KELA 1IQKA 5KGOA 4GAWA 1C5PA 5L2YH 3U8RH 1O2LA 1MD7A 2H5CA 1XUKA 3T29A 3TVJB 2XC4A 2Y6TA 2G81E 3LGUA 1V2OT 1UVPA 4GHQA 2GZ9A 1P8VC 2CV3A 1PQ5A 4AORA 2R3UA 1W3CA 1DWCH 2HNTC 3EA9A 3N7OA 1VCPA 5C5NA 3U1IB 1NC6A 2J2UA 1F5RA 5KEDA 7GCHG 3VB6A 3K6ZA 2GDDA 1NRQH 5HIZA 1YPHE 1NRRH 2EI8A 1P3CA 1O2GH 4AGJA 1OSSA 2FS9A 3M3VA 3D65E 2IN2A 3BTHE 4FVBA 4A1VA 1UTKA 3PRDA 5C1XA 3UNRA 1GBAA 4XDEA 1CHOF 1E34B 2JH6D 3SUGA 1O0DH 4ABIA 1IQGA 3LH3A 4GVUA 1OYTH 3KL6A 4XSKU 4OS2A 1UVTH 2B0FA 4ZHLU 1Y3XA 2FIRH 3BTGE 3RXIA 1H8ED 5C2ZA 3RC6A 1TYNA 1FY4A 2B5TB 1O34A 1ZPZA 1DUAA 1ZHPA 3KF2A 1K21H 1KTSB 2L74A 2A7CA 5BRRE 1D4PB 1RS0A 1EP5A 1C2KA 4NCYA 1QB1A 2FOFA 4WXVA 5DSFA 1CT0E 3SHCH 1UTMA 3BTEE 2I6QA 1RIWB 1C5VA 1E37B 1GBCA 1C1SA 1C1TA 1P01A 3HK3B 3A7VA 3KNXA 1T32A 3RXPA 2FX6A 1W0ZU 1HAVB 1WTHD 3GDSA 1G36A 3SGAE 1Q3XA 1IAUA 3LPRA 1WBGB 4FOUC 1CSOE 2FTMA 1Y3UA 3U9AH 4WMDA 3U1JB 1AY6H 2F9VA 5E2OA 1G37A 2UWLA 1LVBA 1ZTKA 3SNDA 2YOLA 2P93A 4K2YA 5AVDA 1EQ9A 1YYY1 5FL7D 2KX4A 3W94A 3F2FA 1O31A 4IC6A 2BD8A 1EJMA 2ZDAH 1KDQB 3TJVA 1KSNA 4RT1A 1LKAA 3MU4A 1C9PA 3T2NA 3DD2H 3RP2A 1PYTD 1SMFE 4IGDA 2GT7A 1KLTA 3OEHD 4Y79A 1YLNA 4WMFA 1C2LA 2WPDD 4A1XA 4JYUH 5FX6A 1HAYB 2VVVA 1GJ9B 3GYLB 3SU3A 1Z6EA 2PLXA 1GMCG 1C2HA 4BANB 3Q00A 3ZZ6A 3UNSA 1VITF 5DGJA 3TPIZ 1LQDB 2RDEA 3SNEA 2A5KA 2LELA 1YBWA 2JJ2D 2R3YA 4FETA 4ZKRU 1H8DH 1SGPE 3SU1A 2Z6BD 4FUFA 2XCNA 2J94A 3URCA 4MNYA 1NRNH 2VWMA 4B6FA 1QJ1B 4TT3D 1GHXH 2A32A 3M7QA 1TNIA 2R0KA 1P03A 1V3XA 4AB8A 2Y7ZA 2VU8E 2H2ZA 4NA8A 2NWNA 3E1XB 4Q7YA 5C0TA 2H6MA 1ETSH 1NT1A 1KTTB 4UFFH 1GCDA 2BQ6B 4M7GA 2NU2E 2VGCC 3SGBE 5L30H 1QB9A 3O8RA 1IQLA 1CA0B 2FLRH 3UPEA 2KM0A 4DURA 4H6TA 2QY0B 1D3PB 2SGFE 5I46H 3HKIB 1HAOH 1NN6A 1S6FA 1O2WA 5JBCS 5E0GA 3ZVGA 1GI8B 5FCRA 1TNJA 3SJKA 2BX3A 1XXDA 1V2PT 5ESBA 3SU0A 3GY5A 4CRAA 3QK1A 4U01A 4ZAEA 3UOUA 4YXWD 1O5BB 1FPCH 1C5WB 4KGAA 1TMUH 2M2AA 1PPHE 1DFPA 4F4OC 3WWFA 1O2VA 2W5EA 1MCTA 3DFLA 1BQYA 1CA0C 1H1BA 5EGMA 2GVFA 3HGNA 3A80A 3MH6A 4CR5A 1Z7KA 1K1JA 1DSTA 1TAWA 3K9XB 1EB1H 2FOGA 3STIA 3P17H 3UQOA 1HPGA 2C3SA 3LGYA 1HAZB 1NS3A 2ODYB 5DPAA 3QGNB 1C5RA 4HI3A 1H9HE 1P3EA 3M61U 1NROH 2V3OH 1YPJH 1CVWH 4AFQA 3MFJA 4CBOA 3SW2B 3GDUA 2OC0A 4U32A 3O8BA 3OYPA 1AE5A 2PHBA 3KQEA 3KN2A 1QTFA 1WQVH 4YOGA 5GXPA 3PV4A 1W0KD 4TY6A 1DPOA 5FX5A 5LH8A 2SGEE 3OAAD 1DS2E 2B9LA 2XWBI 4CH2B 3ZZ4A 4TYDA 3SNBA 1BBRK 3E16B 6CHAB 1V2KT 1H8HD 1EAXA 3SQHE 3VGCB 1AI8H 1O3IA 3B9FH 1TX7A 1FN6A 1TBZH 4D7FA 4QT8C 3A7WA 4UFDH 1MZDA 5AFYH 1MBMA 1GHWH 1K1IA 4AYYB 2TGDA 1O2SA 2D1JA 2GX4A 3E0NB 5EJZA 1RD3B 1XKAC 3TU7H 2XTTB 4DY7B 2D8WA 1QHRB 2JETB 1VITG 2ZU1A 3E3TA 1ZGVA 1QJ6B 5JYIA 1Z6JH 1RTLA 4DJZB 1BTZA 1YLDA 2OBOA 3D62A 2ZFRH 4U30A 2BLQA 1KY9A 2O9QA 1ZJKA 1FY3A 1G30B 2ALPA 3T28A 1EFRD 1LDTT 1EP6A 4E7NA 1O3HA 1Q31A 3UTUH 4YM9A 5HM9A 4DCDA 2PTCE 1PYTC 1BRBE 4WXIA 3MOCA 1QRXA 2BXTH 3E91A 3LJJA 1C1PA 1MU8B 5DO4H 1NU7B 2PKAB 4LZ4B 4K1TA 1O2OA 1A0HB 3E6PH 2ZCKP 1BRCE 1BTHH 1IQFA 1SGEE 2KCPA 1HRTH 1MZAA 2BQ7B 2BY9X 2VIOA 1BZXE 1OS8A 3SUFA 3KQ5A 1E38B 2LP6A 1TNKA 1NO9H 1TGTA 1Y3WA 4X2WA 2QN5T 5C1YA 1TGNA 3RXHA 1KXBA 1FI8A 1ELFA 1XKBC 1FNIA 1CA8B 1ELCA 1FDPA 2XCFA 4MQAA 1BT7A 2K1QA 4K60A 3M5NA 1FONA 2Y80A 5EXNA 5A0CA 3SV6A 4X8UH 5DP6A 2QV1A 5CMXH 2Z94A 1QL8A 3A8CA 2EY4C 2JIZD 3SJIA 1D6RA 2HVYB 4CRBA 3MH7A 1QBNA 4X8VH 4A5TS 3TGJE 1A3EH 5CDFE 4Y0YE 1W2KH 2F9UA 2FS8A 1GDNA 3RXCA 3ZIAD 3OY5U 1O3KA 1GI9B 3UNQA 1EZXC 4JZ1A 4YO9A 1BMNH 2UUJB 1PJPA 3RXDA 1SBWA 1YY3A 4HZHA 2C8ZB 2CHAC 4R8TB 1BBRH 5EG4A 2CF8H 1P9UA 3F9FA 1NRSH 1TPOA 1HJAB 3QDZB 3DSOA 4Y11E 1OYQA 2ZECA 1C5OH 3NKKA 1S5SA 1KXCA 2TGPZ 1CT4E 1GCTB 1ABJH 2GDEH 2W6ID 4H4FA 1QL9A 3W1EA 2P95A 1ZYOA 3TNSA 4FUIA 1ELAA 2XRCA 1FY1A 4NA7A 2ZU4A 4P00A 4Y7AA 4Y8YA 1UTOA 2P94A 1TPPA 2GP9B 2GT8A 1F0SA 1H9LB 1SFQB 1FXYA 3QTVH 4AZ2B 3NZIA 4MPUA 1HGTH 3SV9A 2L6OA 1KXAA 1O38A 2YMSB 3SORA 2GKVE 3V12A 1P9SA 3LC3A 3C27B 1O5EH 1GI4A 2QXIA 4O9VA 1HJAC 2UWOA 2BXUH 3RLWH 1CGJE 4D8NA 1VJ9U 2R0LA 2SNWA 5DP9A 4K8YA 2ZZUH 1CO7E 4FUBA 1SGFG 2BD3A 4LK4A 2CK3D 1N6YA 4ZXYH 1O5FH 2G51A 1EAUA 1NBME 1YGCH 3SN8A 1C2GA 1FJSA 1VZQH 5C94A 1CU1A 3TIUA 1Y3VA 5F03A 1YP9A 4I7YH 3NK8A 2B7DH 1B0FA 2OC1A 2ZF0H 3P70B 1F2SE 3PMJA 1GGDC 5F8ZA 2WV9A 1K0HA 3M5LA 5IDKA 1P06A 1IHSH 1P2MA 1GMDF 1XUJA 3TJNA 2ZTYA 1P2NA 5A2MH 2PTNA 4ZHAA 1T7CA 1TMTH 2FOCA 4NGAH 2EA3A 2BZ6H 2VWLA 3QGJA 3EGKH 3MTYA 5FBEA 2B8OH 4ABEA 1AU8A 2BB4A 3VB7A 1AE8H 1N1LA 2Q6GA 1GMDG 1EXFA 3GY7A 1C5XB 4NWLA 2HGTH 1O37A 1GHAG 2TGAA 5EJLA 1VITH 5G4BA 3KGPA 1GVZA 2M5TA 3GY6A 2OK5A 1WUNH 1QA0A 5GWZA 1QL7A 2LNCA 1K22H 4A7IB 1MMJN 1P2QA 4BNRA 6ESTA 1LMWB 3ELAH 3ZVAA 2P59A 1O35A 3SV8A 1GJ5H 5I25A 4TWWA 2OINA 1TRNA 2ASUB 5C1UA 3I29A 1BITA 2K8IA 1FAKH 1TRMA 5PTPA 3S7HB 4LOYH 3VB4A 5DP4A 1ESAA 4AB9A 3PLKA 1C9TA 4I8LA 1UHBB 2FXRA 4NIVA 1GG6B 1P12E 1NESE 3LONA 5DK1A 1FN8A 4WH8A 5FCKA 3LOXA 1W10U 1QNJA 2ZFSA 4K3JA 1PQ8A 5L6NH 1F5LA 4CREA 3PROA 5A0AE 3NWUA 1PPCE 4IS5A 1O3CA 1WCZA 2BY5X 1Y5UT 5CHBA 1NBMD 4NG9H 2H5DA 1V2JT 1MD8A 1S82A 2ZGBH 1ZSLA 1V2MT 3BTKE 1F0RA 1D3TB 4X6MA 1HV7A 4JYVH 4WVPE 1AVWA 2XXLA 5ESTE 3QN7A 3RLYH 2GD4B 4FU9A 3ZVFA 4YOJA 5GNDA 2VWNA 4Y10E 2PV9B 2AERH 5IYTA 3OY6U 1P05A 5JB8S 1YPLH 1SFIA 4R0IA 3TJUA 4O97A 3F9EA 5C0UA 3SU6A 3ZV9A 1MTWA 1GHBG 1ETRH 1FIWA 1C1VH 1GI0A 1RRKA 3GY8A 3SHAH 2ZKSA 5HYOA 1GHAF 3PMHB 1P0SH 1A5IA 5GJ4B 2R2WU 2FTLE 3FP6E 2NU3E 1BIOA 3LGIA 1AB9C 1UTPA 2BD2A 2CHAB 3A84A 3S69A 1SC8U 2H9HA 1AWFH 3GYMA 1YKTA 1K9OE 3H7TA 1QIXB 2BTCE 2WPLS 1O3FA 5A8YA 2ZFFH 4UFGH 3BIUH 3VB3A 4DW2U 2JH0D 1ELTA 2ZG0H 2XNDD 2BM2A 1C5ZB 1GI3A 3PMBB 4AG1A 1ZSJA 2QF5A 1CGHA 2J98B 2Z9LA 1VGCB 1NFWA 1ANDA 5FHTA 3UY9A 3H09A 2BDBA 3ZYEA 3ZZAA 1GHVH 3Q3YA 2O8MA 2Z3DA 3SBKA 3M37A 4FUJA 1GBFA 1O5DH 2AHME 1GI6A 3BTTE 4RSPA 4ZKNU 1UVSH 1C1NA 1L4DA 4X2VA 2ZDLA 4TPIZ 1CGIE 4XBCA 2GGVB 1YPGH 5GIBA 3BTQE 4LZ1H 2WZQA 1TPSA 5HGGA 2K0QA 1LQEA 1V6DA 3FP7E 2ZHWH 1ZSKA 2ZDVH 5E0JA 5TCAA 2FOHA 3K2UA 3BTWE 1P2KA 1PPEE 2A5AA 3RXVA 2D26C 2O8LA 1GVKB 1K1NA 2P3UB 7ESTE 2SNVA 1ANCA 2QC2A 3FN8A 1AIXH 1ARBA 1MTNB 1EZQA 1XUFA 2W7UA 1OOKB 1FX0B 3T5FH 1C1RA 1EATA 3BIVH 1GI5A 3SYJA 3PWBA 1O2MA 1PPBH 1ZGIA 3RDZA 1A7SA 1GI1A 2J9NA 3RXAA 2PSXA 3FOAA 3ODDA 1PQ7A 3RXUA 4FUGA 3KYGA 1O5GH 1O3LA 1B0EA 1AFQC 1MKWH 2HPPH 2H1UA 1DY8A 3RXSA 4WH6A 4DT7B 1DT2A 1OHHD 2JJ1D 1SOZA 1SHHB 1QGFA 4B2AA 2ESTE 2EEKA 2UWPA 5FBIA 4BTIB 1FY5A 4ISIH 5FPSA 2A31A 4Y8XA 3S9CA 1O2PA 4B75A 3D23A 2OBQA 2GV7A 3SZEA 1AFEH 4O3TA 1XM1A 1TABE 3KQCA 1LVYA 2ZEBA 3BEIB 3LH1A 1DLEA 4UFEH 1YCPK 1O2YA 1MKXK 2BD7A 4I33A 5CHAC 1UTJA 1C4U2 1C5UA 2JETC 1HAVA 2O8WA 2KZ4A 3PLBA 1ELVA 4E05H 2PWXA 5FPYA 1A2CH 1JOUB 1OWDA 3G01A 3F2HA 4K8BA 4GHTA 1UJ1A 1UTNA 4B71A 1YLCA 1OXGA 1C4V2 3O8DA 1YPHC 4HG6A 3ATMA 2VB0A 3PO1B 2SGPE 4BTTB 2WSSD 3C1KA 2C8WB 2XWAA 3RXEA 1V2VT 1H9IE 3D49H 1RJXB 1ZOMA 1A0JA 1O39A 2FYQA 1MTUA 3A89A 4YESB 5EJ1A 1E35B 3LT3A 4ZCNA 1WTGH 4ZROA 1TA2A 1C1UH 5A0BA 2ZNKH 1T4UH 2BDHA 2ZQ1A 2OQUA 4I86A 1TGBA 3MU1A 1HB0B 2O8TA 1SKYE 3MU8A 1U6QA 2FYRA 2BD4A 4NSVA 2KCAA 2WV5A 2PP6A 3RC5A 3WWBA 2THFB 2YMSC 1LHEH 1MTVA 2ZU3A 3ZVDA 1MTNC 1GJAB 1O2QA 1O3BA 1ELEE 1GVLA 1SGRE 4ABGA 1C2IA 3BG4B 4INKA 2RCEA 1S85A 1LPKB 1GL0E 2C8YB 1AB9B 1THSH 1T4VH 5DKMA 1MKXH 2FMJA 1C4Y2 3BN9A 1GJCB 2ZTXA 5B6OA 1UK4A 3PM3A 3A87A 4Q7XA 3K65B 2XBVA 3SU4A 2BMGB 2STBE 4YTAA 2R9PA 1AUTC 2HALA 1HIAA 2UUKB 2BDCA 2OUAA 4YLUA 1DX5M 1FZZA 1RGQA 3ZZCA 3TJOA 3CNRA 1O2KA 1W0JD 2BLWA 3CP7A 2ZFPH 3MU5A 1MKWK 3DSPA 1IQNA 2VWOA 1O5AB 1HDTH 1LTOA 2OCVB 1SLWB 5BPEA 3UR6A 3VFEA 4X1NU 3ZZBA 1TRYA 4Y71A 2XC0A 4Q4LA 1C5QA 2Z9GA 3QZQA 2JDID 4AFUA 2SGQE 1SPJA 2SGAA 1EASA 2STAE 3PWCA 5E2PA 3P8FA 3KEEA 3UAIC 1QB6A 2VIQA 4XBDA 1JWTA 5DG6A 4GLYA 1B7XB 1XUGA 1IOEA 2G4UA 1UCYH 4Y76A 2WYJA 1GDUA 4K1SA 1S0QA 3HGPA 3DA9B 2KR7A 1TWXB 3ZYDA 1EUFA 2XBYA 1OP0A 2F9BH 8GCHG 3ZVBA 1RTFB 3MYWA 4MPXA 3PMAB 2ODPA 3ENSB 2ZCLP 3SUEA 2ZC9H 3GCTF 2OP9A 3RXRA 3SJ9A 2XC5A 4BAQB 1HCGA 2GCHF 3P92A 1HAHH 1O2JA 2G55A 1RIWC 1FMGA 1LPZB 1UTQA 3H7OA 5H4IB 1LCYA 3SJOA 5T3HA 3UQVA 3E90B 3AW0A 1DXWA 2H9TH 1JXPA 1D3QB 4Q63A 4X8SH 3O8CA 1G2MA 1Y59T 9LPRA 1P10A 1EAIA 4FU8A 4X8TH 6CHAC 1E36B 2HNTF 2ZO3H 1W11U 5JDUB 1SLXB 6GCHF 3UFAA 2G8TA 1YM0A 2VIPA 5HKKD 3GY2A 1T8NA 4Y7BA 4BAHB 3RXFA 2BX4A 2Z3EA 1KXFA 1GDQA 4E7RG 5DP8A 3S9AA 1KXEA 4XD7D 2TGTA 1F92A 3NUMA 1THPB 3WY8A 2Z9KA 4OS7A 2JKHA 1A46H 3LJOA 5GCHG 3BV9B 4RN6A 5SGAE 4DVAU 4NSYA 1KYNA 2PUXB 4A92A 1GWAA 1P02A 3F2GA 1MTSA 5DP5A 1Z1JA 4AG2A 5F8XA 5EOKA 4ISHH 1OWHA 5EXMA 1GBHA 2PGQB 1GBEA 3A82A 3F68H 2EI6A 1V2UT 1AZ8A 3A81A 3M3SA 3HPTB 2AMPA 4FUEA 2XBWA 1BTUA 2ANMH 2WUCA 5EW2H 4KP0A 1N6XA 1GG6C 1XXFA 4UE7H 4HGCA 1LHCH 2PKAA 3EDXB 2BDIA 2HVXA 3MNCA 4VGCC 1NM6A 3Q3XA 4YLQH 1QURH 3EA7A 2WPJS 4B2CA 3ATIA 2P8OC 2A45B 1N8OB 2ZI2H 1MQ5A 5C17A 1ZRKA 2GZ7A 5C3NA 4MVNA 4D9QA 1AD8H 3UB0A 2F4LA 4A6LA 1THRH 4ZUHA 3JZ2B 1O33A 2G52A 3KIDU 1DDJA 5LPFA 4Z1MD 4AC9A 1P2OA 7GCHF 1BRAA 3RU4T 3ZV8A 2ZTZA 3RU4D 8ESTE 4CBNA 1KXDA 1EKBB 2Y81A 1BOQA 1V2LT 3BSQA 1TQ7B 2XOKD 3SNAA 1SQRA 1EJNA 1J14A 2OC7A 3LC5A 4F49A 5AFZH 2IJD1 1C2JA 2NU4E 1O3NA 1PPGE 1V2QT 4GSOA 8LPRA 1SGTA 5EPNA 2ZHQH 4IMQA 1GI7B 5A8XA 4DT4A 3P8OA 1GJ4H 2ZGCA 4DGJA 1EAWA 4X1SU 3SGQE 3N7EA 2YNAA 3OFND 1QRWA 1AN1E 4ISOA 1QZ8A 5F6MA 2QA9E 3TH2H 1P2IA 2DUCA 3W95A 3BTDE 2FLBH 3HATH 4CRGA 1ZMLA 2J38A 2VH0A 3T26A 2RFKC 3PTNA 1F5KU 1C1MA 1HAIH 1GJDB 4TSFD 1NFXA 2HNTE 1OWJA 2FI5E 3NPSA 1C2MA 2FZZA 3RU4E 4K5ZA 1PPFE 2W26A 1OKXA 1Q2WA 1MAXA 4F55A 3PV5A 1QR3E 2FOEA 4I8JA 3ZZDA 1Y5BT 1GJBB 1H4WA 1W8BH 4Z6AH 1DLKB 3PRBA 5DN6D 2VH6A 2IOTA 2VVCA 1OWEA 1IQEA 1SOTA 1AQ7A 1TNHA 2J92A 4X1RU 4D76A 1FAXA 3ATLA 2RA0A 1ABIH 2EC9H 3F9GA 2FOMB 1J8AA 1FUJA 2A4OA 1IQIA 3FZZA 3HK6B 3GCHB 1TX8A 1YC0A 1N8OC 4O03A 5GCHF 3SUDA 3UWIA 1SGCA 2HWLB 4VGCB 3SNCA 2QXHA 3T62A 1V2WT 3TLOA 3DT0H 4WJG2 2FM2A 2BHGA 2OXSA 4NFFA 1GBMA 4DG4A 1UTLM 1SLUB 1EZUC 2DE8A 2RA3A 3MHWU 3AW1A 4KTCA 1TOCB 1JRTA 3RXQA 3MWIU 2XBXA 5EW1H 1VGCC 4E06H 3STJA 2A7HA 2QIQA 3PB1E 3NCLA 1O2ZA 3A88A 2ZDNA 5A09A 1A1RA 4ABHA 3QLPH 1Z8JB 3VXFH 1ESTA 1O2TA 1UVUH 2Y5HA 2ZPQA 4X1QU 4I32A 2PKSC 1K1MA 2HLDD 1NRPH 1A5GH 1GHBF 1O2UA 4K1EA 2ZA5A 1BTXA 1G32B 3AASA 3GCTG 1MCVA 5T6FA 1XMNB 4DOQA 4YZUA 3GISB 1HAXB 2ILNA 3MNSA 1J16A 4NWKA 4FU7A 1HLTH 2HPQH 1GBTA 2XYAA 1TNGA 2DE9A 3MH4A 4JMYA 4FXGH 2ZHEH 3RMNH 1AGJA 4HFPB 2FDAA 2BDAA 4RT0A 1ZTLA 1YPEH 3SQEE 3OE7D 1L1NA 1GBBA 1XX9A 4O3UA 3VG8A 3FANA 4JZDH 1TBRH 2F9NA 3PO1C 1DWDH 2R2MB 5JBTA 1ZPBA 1V2RT 1O2NA 2Y5GA 5T1VA 5ABWA 1C5NH 1MQ6A 3RMOH 2FPZA 1CHOG 5LPRA 3T25A 3V13A 1SQOA 2V7QD 1SQAA 1Z71A 1OX1A 2PKSB 2QXJA 1FV9A 5FXLA 1S0RA 1FPHH 5DP7A 2KAIB 3B23B 1KLJH 4CHAC 1GJ6A 1SL3A 2GJGA 1WYKA 1SG8B 1G2LA 5EODA 1QFKH 1M9UA 2OLGA 2QXGA 1EJAA 1O3GA 4IMZA 1LHDH 3A7TA 4BAKB 1IQHA 1BTWA 1C2FA 1OWIA 1CBWB 1EPTA 4CH8B 2VIVA 4ZKOU 1NY22 5HMAA 2VVUA 2WUBA 1L0ZA 4X6PA 4PROA 1SGQE 2IPQX 3GY3A 2ANYA 2AGGX 3L6PA 4RKOB 2JH5D 1C5SA 1AKSA 4TPYA 5KECA 2V3HH 4BXSA 3MQKC 4OS4A 3RXJA 4CHAB 1L4ZA 2GZ8A 1D9IA 3GY4A 1Z1IA 2TBSA 2FOAA 4XE4A 2G5VA 3F9HA 3VB5A 2ZIQH 2ZDKA 2V0BA 1SQTA 1FY8E 1C2EA 4IN2A 5K7RA 1UW7A 3SV2H 1W14U 2AIQA 2J98A 2J4IA 4I8KA 2HOBA 1O5CB 1BA8B 1EOLA 2LPRA 3A85A 1BMFD 5GPIB 3R3GB 3FZDA 2Q6FA 2KAIA 1PQAA 1TQ0B 1SR5C 3P95A 4Y0ZE 4AX9H 1BJUA 1VCWA 1DANH 3SO3A 4NZQA 1ELGA 1QBOA 2CF9H 1HUTH 1TNLA 2QCYA 4MPWA 2W7SA 3M5OA 1K28D 2A4RA 2AIPA 4X2YA 1O3MA 3R0FA 4BAMB 3TGKE 1AMHA 3AVZA 1DM4B 2A1DB 1BMAA 1TMBH 4FUHA 2GMTC 1QA7A 4UD9H 3TH3H 3MO6A 3RXBA 1KIGH 4KKDA 3T27A 1NPMA 2H9EH 1AKSB 1G9IE 2FESH 1Y5AT 3DCLA 1G3CA 1GHZA 2NU0E 2ZQ2A 4I8HA 1O2HA 4P02A 3F6UH 2W6JD 4ABFA 1F0TA 3B8JA 8GCHF 7KMEH 4CRFA 4MNWA 2OQ5A 2CN0H 1BMMH 1SI5H 1XUHA 5ETXA 3RXKA 1SLVB 3EAJA 4MNVA 3ZZ5A 2GCTB 4WMEA 2BY8X 1BHXB 2PR3A 3AAVA 1C1WH 2ODQA 1JIMA 2YNBA 3KYFA 3EQ0H 1GMHG 1LPGB 1FQ3A 1K1PA 1LVOA 4ISNA 4AN7A 3QWCH 2TPIZ 4OS1A 1JMOH 3EE7A 1ANEA 2BVRH 3A8BA 3OU0A 1OP8A 3SZNA 1CT2E 8KME2 3SI3H 2BVXH 4TY7A 2Z9IA 2P8OB 1XUIA 1ACBE 4U2WA 1QBVH 3I77A 1WDIA 1OP2A 2IPHA 3F1SB 4A1TA 3OTPA 5C5OA 1XVOA 2FOBA 4INHA 2VIDA 5E8EH 1ORFA 3DUXH 2GTBA 3ZVCA 1ELBA 3TITA 2QE7D 2V35A 3E0PB 4KTSA 1KDQA 1O2IA 3MNXA 1WV7H 3VXEH 4X6OA 2BLOA 2ZGXH 3I78A 5GDSH 1Y3YA 3RXGA 5JPMH 1GGDB 1ELDE 1AUJA 4BOHA 1C2DA 3FVFB 3BEUA 3U8OH 3ZZ3A 1V2ST 1HAPH 4OGYA 2ZP0H 5EXLA 5FAHA 4NA9H 4WF8A 5L2ZH 4D9RA 3LDXH 3UOPA 1SGYE 1L1JA 1GMCF 1EZSC 1GHYH 2CMYA 3K6YA 4J2YB 2AYWA 1Z8IB 3OEED 2FI4E 4X2XA 4J1YA 3KQBA 3PV2A 2VGCB 3FFGA 5DP3A 1TGCA 2VNTA 3JZ1B 1A3BH 4ZMAH 1QJ7B 5AHGH 5DJ7A 2GMTB 3S7KB 2W3IA 1AVXA 3M3TA 1S83A 3P8NA 3IG6B 1YCPM 3N7DA 2EI7A 2PW8H 3GS9A 1A5HA 3A7XA 1P09A 4AOQA 3M36A 1K1OA 1NZQH 2UUFB 3UR9A 1XVMA 1ZMJA 1PFXC 1QRZA 1BJVA 2Y82A 1PPZA 4RKJB 4ASHA 1ZZZA 4CRCA 1DICA 3AAUA 3PYHA 2BOHB 3ZZ8A 1BDAA 3SU5A 4BTUB 3RXTA 1TE0A 3OSYA 4ZH8A 1L1GA 1GBLA 1NTPA 3BTME 2AGEX 4IBLH 3U98H 4IW4E 1FIZA 1X7AC 1O2XA 3M35A 2G4TA 2AFQB 5JBAS 1G3EA 1T8LA 1AWHB 4Q80A 2ULLA 4CR9A 5JBBS 4D7GA 2ZHDA 2VIWA 1BTPA 3S0NA 1C5MD 4B76A 1BTYA 5K0HA 1RFNA 4SGAE 1UK3A 1E1QD 1UCYE 2QAAA 1TX6A 4Q7ZA 4WWYA 1HIAB 1TOMH 1UK2A 2CJIA 3KCGH 1EX3A 5C20A 3SU2A 1F7ZA 1TPAE 2BZAA 3H5CB 1TA6A 1J15A 1GPZA 3ATKA 2AMQA 2A7JA 2CGAA 3DHKH 1MUEB 6GCHG 4I31A 3NRLA 1O32A 1W13U 4MG3A 2OC8A 1ZHRA 2WHXA 2EQNA 1O3EA 2I6SA 2P3TB 1GJ7B 1G3BA 4XRNA 4Y6DA 3KHVA 1TALA 4IC5A 1O3AA 1GL1A 3N99A 1CBWC 2FODA 3VEQB 1LKBA 2WPKS 1MH0A 3LGTA 3QUMP 2AH4X 2BVSH 2HLCA 2F83A 1EPTC 1IHTH 5T6GA 2A5IA 3A7ZA 1CQQA 3L3TA 2ZCHP 1S6HA 4ZHMU 1OPHB 3MO9A 4B74A 2QF4A 3WW7A 4TWYA 1S84A 1GBDA 1AVGH 1HFDA 3M5MA 1J9CH 3NXPA 3F0OA 1A61H 3RC4A 1Z8RA 4F48B 3BEFB 2F91A 3A8AA 1ZPCA 1WSSH 1T8OA 5J4SA 3QZRA 2SFAA 2BDYA 3A7YA 1SSXA 2NU1E 1C1QA 1HYLA 1K1LA 1W7GH 3U69H 1HXEH 2AS9A 5LGOA 1F0UA 2C93B 1SGIB 1RXPA 2KCYA 3ODFA 1W0YH 3OTJE 4B6EA 2V6NA 1AZZA 2CXVA 3MU0A 2FO9A 2F9PA 4MNXA 3TGIE 1O3OA 1DSUA 1L2EA 4ACBA 2C90B 1C5TA 2YMSD 2P3FH 3V0XA 4FUDA 4ABJA 4Q2KA 1RTKA 4UONA 4B73A 3TH4H 1EOJA 2V3MA 4GCHF 3M7UA 3GCNA 1UVOA 3GDVA 1DVAH 4OGXA 3KQDA 3CS7A 3F0PA 1AO5A 4BAOB 2BLVA 3Q77A 1WU1A 5LPEA 3Q76A 3SOSA 4ABBA 2Y5FA 2WPMS 2RG3A 3BF6H 4AYVB 4WY3A 3QTOH 4I8GA
chains in the Genus database with same CATH topology
3CENA 1AFQB 1MU6B 2P16A 2WINI 4DIIH 2Q6DA 2BOKA 1HJ8A 2ZFTA 1ANBA 3M7TA 4NIWA 1UCYK 3S9BA 4X6NA 2GCTC 2F9OA 4ZXXH 1QQUA 4X0WU 9ESTA 3CS0A 1SGFA 1ZMNA 1ID5H 2QF3A 3ZVEA 1C5YB 3RM0H 4H6SB 2PGBB 1O3DA 5TJXA 2A2XH 3VPKA 1ZR0A 4NFEA 5TCCA 1DUEA 2PFEA 3QX5H 5EQSA 1INCA 2F3CE 4JCNA 4UDWH 5CHAB 2BD5A 5A8ZA 1WOFA 1BCUH 1TGSZ 1C1OA 1BMLA 3DFJA 5F8TA 3GOVB 1HXFH 1J17T 2OTVA 2ZDMA 3PTBA 4ESTE 3ATWA 4GUXA 1GCTC 2HRVA 3HKJB 1LO6A 3IWMA 2VINA 2GCHG 1QY6A 1LHGH 1GBJA 4ABDA 2Z9JA 2FI3E 5JB9S 2FWWA 1BUIA 4FUCA 4YOIA 1ZLRA 5T6DA 4KTUA 3SI4H 2FP7B 3FAOA 5EPYA 1HAGE 1P04A 1K2I1 4B1TA 4JZIA 5CE1A 2QYIA 1Z8GA 2GV6A 2A4QA 4ISLA 4OS5A 2AGIX 2Z7FE 1D6WA 2XW9A 1ZTJA 3RUOA 4IN1A 4NZLA 4XBBA 4AFZA 3LKWA 2ZPSA 4YT6H 4NIXA 5EQRA 3UREA 2A0QB 2BYAX 4K69A 3P8GA 3RXOA 1IQMA 1SHYA 2D2DA 3TNTA 1HNEE 1GJ8B 3UIRA 1TB6H 1E0FD 3EA8A 2J95A 3ZZ7A 3V7TA 5FPTA 3LIWA 4CRDA 3ZZ9A 3GCOA 4OS6A 2RDLA 1O3JA 1DOJA 1YPMH 1GBIA 3E8LA 3MI4A 3Q3KA 1V2TT 1CHGA 1Y8TA 4YT7H 1BRUP 1ZHMA 4MDSA 1BHXF 3P6ZB 2ZU5A 4JK5A 3MMGA 1D3DB 3ITIA 3BTFE 1DWBH 2VJ1A 1GMHF 1T31A 2J34A 4XFQA 4NIYA 4AGKA 3U8TH 4INLA 4THNH 4X1PU 3UUZA 3UWJH 3VGCC 7LPRA 3RXMA 1AHTH 2Y7XA 5C67A 5HXFA 1WQSA 1H8IH 5HM2A 2C8XB 2IJOB 2AEIH 1FLEE 4Z0KA 1UMAH 5J4QA 1O2RA 3OX7U 3TK9A 4H42U 2TRMA 1QQ4A 2C4FH 1QCPA 1NFYA 2ALVA 2WPIS 1GBKA 3A86A 2ZWLH 1MBQA 2BY7X 2FEQH 1P57B 3QO6A 4MTBA 1VR1H 1DWEH 1W12U 5EU8A 3RM2H 1ZRBA 3SJ8A 1SVPA 1UO6A 2WYGA 1T8MA 3A8DA 4DIHH 3URDA 2UUYA 1W7XH 2Q1JA 1S81A 3RMMH 2OD3B 4GCHG 4UEHH 4BXWA 3RXLA 3LGVA 3L33A 4Y8ZA 3MNBA 1BBRE 1NFUA 4XOJA 4JYTA 1UHBA 1LVMA 6LPRA 1WAYB 3BG4C 2TIOA 4SGBE 2ZU2A 2G5NA 4B2BA 1SB1H 3RMLH 3A83A 2QGRA 1YPKH 4FVDA 1JIRA 3PLPA 1DITH 1DXPA 4ZKSU 2WV4A 2ZGHA 1B5GH 1SGDE 3MO3A 1CE5A 1ZJDA 3EYDA 3TK5A 1TIOA 4JZEH 2FX4A 4LXBH 2ZGJA 3FP8E 2G00A 1JBUH 1KLIH 1P2JA 2W3KA 1VJAU 1HBTH 1O30A 4MLFB 2ANWA 2ZPRA 1IQJA 1TBQH 2PUQH 1YCPH 5AF9H 3ESTA 4JK6A 2BD9A 4JZFH 3SV7A 2BQWB 1GI2A 2SGDE 1P11E 1ESBA 1V2NT 4GPGA 1ARCA 1OWKA 1A0LA 3LGWA 1NU9A 2A4GA 2BY6X 3BG8A 1ETTH 5E0HA 4HTCH 1HJ9A 1EB2A 1LHFH 2A2QH 3IITA 5EQQA 1DY9A 3GCHC 4ABAA 3LU9B 2BDGA 1MAYA 1A4WH 2AMDA 1VCQA 2PSYA 1O3PB 2ANKH 2WPHS 1C5LH 1EPTB 1DE7H 3EE0B 2XNIA 2Z3CA 3GICB 3V3MA 1O36A 3MH5A 2ZHFH 1TFXA 2O8UA 4AFSA 1BB0B 1TLDA 2QF0A 2ZFQH 1SGNE 1JRSA 1G3DA 3TK6A 1TONA 4MPVA 1YF4A 4KELA 1IQKA 4GAWA 1C5PA 5L2YH 3U8RH 1O2LA 1MD7A 2H5CA 1XUKA 3T29A 3TVJB 2XC4A 2Y6TA 2G81E 3LGUA 1V2OT 1UVPA 4GHQA 2GZ9A 1P8VC 2CV3A 1PQ5A 4AORA 2R3UA 1W3CA 1DWCH 2HNTC 3EA9A 3N7OA 1VCPA 5C5NA 3U1IB 1NC6A 2J2UA 1F5RA 7GCHG 3VB6A 3K6ZA 2GDDA 1NRQH 1YPHE 1NRRH 2EI8A 1P3CA 1O2GH 4AGJA 1OSSA 2FS9A 3M3VA 3D65E 2IN2A 3BTHE 4FVBA 4A1VA 1UTKA 5C1XA 3UNRA 1GBAA 4XDEA 1CHOF 1E34B 2JH6D 3SUGA 1O0DH 4ABIA 1IQGA 3LH3A 4GVUA 1OYTH 3KL6A 4XSKU 4OS2A 1UVTH 2B0FA 4ZHLU 1Y3XA 2FIRH 3BTGE 3RXIA 5C2ZA 3RC6A 1TYNA 1FY4A 2B5TB 1O34A 1ZPZA 1DUAA 1ZHPA 3KF2A 1K21H 1KTSB 2A7CA 5BRRE 1D4PB 1RS0A 1EP5A 1C2KA 4NCYA 1QB1A 2FOFA 4WXVA 1CT0E 3SHCH 1UTMA 3BTEE 2I6QA 1RIWB 1C5VA 1E37B 1GBCA 1C1SA 1C1TA 1P01A 3HK3B 3A7VA 3KNXA 1T32A 3RXPA 2FX6A 1W0ZU 1HAVB 1WTHD 3GDSA 1G36A 3SGAE 1Q3XA 1IAUA 3LPRA 1WBGB 1CSOE 2FTMA 1Y3UA 3U9AH 4WMDA 3U1JB 1AY6H 2F9VA 5E2OA 1G37A 2UWLA 1LVBA 1ZTKA 3SNDA 2YOLA 2P93A 4K2YA 1EQ9A 1YYY1 3W94A 4IC6A 1O31A 2BD8A 1EJMA 2ZDAH 1KDQB 3TJVA 1KSNA 1LKAA 3MU4A 1C9PA 3T2NA 3DD2H 3RP2A 1PYTD 1SMFE 4IGDA 1KLTA 2GT7A 4Y79A 4WMFA 1C2LA 4A1XA 4JYUH 5FX6A 2VVVA 1HAYB 1GJ9B 3GYLB 3SU3A 1Z6EA 2PLXA 1GMCG 1C2HA 4BANB 3Q00A 3ZZ6A 3UNSA 1VITF 5DGJA 3TPIZ 1LQDB 3SNEA 2A5KA 1YBWA 2R3YA 4ZKRU 1H8DH 1SGPE 3SU1A 2Z6BD 4FUFA 2XCNA 2J94A 3URCA 4MNYA 1NRNH 2VWMA 1QJ1B 1GHXH 2A32A 3M7QA 1TNIA 2R0KA 1P03A 1V3XA 4AB8A 2Y7ZA 2VU8E 2H2ZA 4NA8A 2NWNA 3E1XB 4Q7YA 2H6MA 1ETSH 1NT1A 1KTTB 4UFFH 1GCDA 2BQ6B 4M7GA 2NU2E 2VGCC 3SGBE 5L30H 1QB9A 3O8RA 1IQLA 1CA0B 2FLRH 3UPEA 4DURA 4H6TA 2QY0B 1D3PB 2SGFE 5I46H 3HKIB 1HAOH 1NN6A 1S6FA 1O2WA 5JBCS 5E0GA 3ZVGA 1GI8B 5FCRA 1TNJA 3SJKA 2BX3A 1XXDA 1V2PT 5ESBA 3SU0A 3GY5A 4CRAA 3QK1A 4U01A 4ZAEA 3UOUA 1O5BB 1FPCH 1C5WB 4KGAA 1TMUH 1PPHE 1DFPA 4F4OC 1O2VA 2W5EA 1MCTA 3DFLA 1BQYA 1CA0C 1H1BA 5EGMA 2GVFA 3HGNA 3A80A 3MH6A 4CR5A 1Z7KA 1K1JA 1DSTA 1TAWA 3K9XB 1EB1H 2FOGA 3STIA 3P17H 3UQOA 1HPGA 2C3SA 3LGYA 1HAZB 1NS3A 2ODYB 5DPAA 3QGNB 1C5RA 4HI3A 1H9HE 1P3EA 3M61U 1NROH 2V3OH 1YPJH 1CVWH 4AFQA 3MFJA 4CBOA 3SW2B 3GDUA 2OC0A 4U32A 3O8BA 3OYPA 1AE5A 2PHBA 3KQEA 3KN2A 1QTFA 1WQVH 4YOGA 5GXPA 3PV4A 4TY6A 1DPOA 5FX5A 5LH8A 2SGEE 1DS2E 2B9LA 2XWBI 4CH2B 3ZZ4A 4TYDA 3SNBA 1BBRK 3E16B 6CHAB 1V2KT 1EAXA 3SQHE 3VGCB 1AI8H 1O3IA 3B9FH 1TX7A 1FN6A 1TBZH 4D7FA 4QT8C 3A7WA 4UFDH 1MZDA 5AFYH 1MBMA 1GHWH 1K1IA 4AYYB 2TGDA 1O2SA 2D1JA 2GX4A 3E0NB 1RD3B 1XKAC 3TU7H 2XTTB 4DY7B 2D8WA 1QHRB 2JETB 1VITG 2ZU1A 3E3TA 1ZGVA 1QJ6B 5JYIA 1Z6JH 1RTLA 4DJZB 1BTZA 1YLDA 2OBOA 3D62A 2ZFRH 4U30A 2BLQA 1KY9A 2O9QA 1ZJKA 1FY3A 1G30B 2ALPA 3T28A 1LDTT 1EP6A 4E7NA 1O3HA 1Q31A 3UTUH 4YM9A 5HM9A 4DCDA 2PTCE 1PYTC 1BRBE 4WXIA 3MOCA 1QRXA 2BXTH 3E91A 3LJJA 1C1PA 1MU8B 5DO4H 1NU7B 2PKAB 4LZ4B 4K1TA 1O2OA 1A0HB 3E6PH 2ZCKP 1BRCE 1BTHH 1IQFA 1SGEE 1HRTH 1MZAA 2BQ7B 2BY9X 2VIOA 1BZXE 1OS8A 3SUFA 1E38B 1TNKA 1NO9H 1TGTA 1Y3WA 4X2WA 2QN5T 5C1YA 1TGNA 3RXHA 1KXBA 1FI8A 1ELFA 1XKBC 1FNIA 1CA8B 1ELCA 1FDPA 2XCFA 4MQAA 1BT7A 2K1QA 4K60A 3M5NA 1FONA 2Y80A 5EXNA 5A0CA 3SV6A 4X8UH 5DP6A 2QV1A 5CMXH 2Z94A 1QL8A 3A8CA 3SJIA 1D6RA 4CRBA 3MH7A 1QBNA 4X8VH 4A5TS 3TGJE 1A3EH 4Y0YE 1W2KH 2F9UA 2FS8A 1GDNA 3RXCA 3OY5U 1O3KA 1GI9B 3UNQA 1EZXC 4JZ1A 4YO9A 1BMNH 2UUJB 1PJPA 3RXDA 1SBWA 4HZHA 2C8ZB 2CHAC 4R8TB 1BBRH 5EG4A 2CF8H 1P9UA 3F9FA 1NRSH 1TPOA 1HJAB 3QDZB 4Y11E 1OYQA 2ZECA 1C5OH 3NKKA 1S5SA 1KXCA 2TGPZ 1CT4E 1GCTB 1ABJH 2GDEH 4H4FA 1QL9A 2P95A 1ZYOA 3TNSA 4FUIA 1ELAA 2XRCA 1FY1A 4NA7A 2ZU4A 4Y7AA 4Y8YA 1UTOA 2P94A 1TPPA 2GP9B 2GT8A 1F0SA 1H9LB 1SFQB 1FXYA 3QTVH 4AZ2B 3NZIA 4MPUA 1HGTH 3SV9A 1KXAA 1O38A 3SORA 2GKVE 3V12A 1P9SA 3LC3A 3C27B 1O5EH 1GI4A 2QXIA 4O9VA 1HJAC 2UWOA 2BXUH 3RLWH 1CGJE 4D8NA 1VJ9U 2R0LA 2SNWA 5DP9A 4K8YA 2ZZUH 1CO7E 4FUBA 1SGFG 2BD3A 4LK4A 1N6YA 4ZXYH 1O5FH 2G51A 1EAUA 1YGCH 3SN8A 1C2GA 1FJSA 1VZQH 1CU1A 3TIUA 1Y3VA 5F03A 1YP9A 4I7YH 3NK8A 2B7DH 1B0FA 2OC1A 2ZF0H 3P70B 1F2SE 3PMJA 1GGDC 5F8ZA 3M5LA 5IDKA 1P06A 1IHSH 1P2MA 1GMDF 1XUJA 3TJNA 2ZTYA 1P2NA 5A2MH 2PTNA 4ZHAA 1T7CA 1TMTH 2FOCA 4NGAH 2EA3A 2BZ6H 2VWLA 3QGJA 3EGKH 3MTYA 5FBEA 2B8OH 4ABEA 1AU8A 2BB4A 3VB7A 1AE8H 1N1LA 2Q6GA 1GMDG 1EXFA 3GY7A 1C5XB 4NWLA 2HGTH 1O37A 1GHAG 2TGAA 1VITH 5G4BA 3KGPA 1GVZA 2M5TA 3GY6A 1WUNH 1QA0A 5GWZA 1QL7A 2LNCA 1K22H 4A7IB 1MMJN 1P2QA 4BNRA 6ESTA 1LMWB 3ELAH 3ZVAA 2P59A 1O35A 3SV8A 1GJ5H 5I25A 4TWWA 2OINA 1TRNA 2ASUB 5C1UA 3I29A 1BITA 3S7HB 1FAKH 1TRMA 5PTPA 4LOYH 3VB4A 5DP4A 1ESAA 4AB9A 3PLKA 1C9TA 4I8LA 1UHBB 2FXRA 4NIVA 1GG6B 1P12E 1NESE 3LONA 5DK1A 1FN8A 4WH8A 5FCKA 3LOXA 1W10U 1QNJA 2ZFSA 4K3JA 1PQ8A 5L6NH 1F5LA 4CREA 3PROA 5A0AE 3NWUA 1PPCE 4IS5A 1O3CA 1WCZA 2BY5X 1Y5UT 4NG9H 2H5DA 1V2JT 1MD8A 1S82A 2ZGBH 1ZSLA 1V2MT 3BTKE 1F0RA 1D3TB 4X6MA 1HV7A 4JYVH 4WVPE 1AVWA 2XXLA 5ESTE 3QN7A 3RLYH 2GD4B 4FU9A 3ZVFA 4YOJA 2VWNA 4Y10E 2PV9B 2AERH 5IYTA 3OY6U 1P05A 5JB8S 1YPLH 1SFIA 4R0IA 3TJUA 4O97A 3F9EA 3SU6A 3ZV9A 1MTWA 1GHBG 1ETRH 1FIWA 1C1VH 1GI0A 1RRKA 3GY8A 3SHAH 2ZKSA 5HYOA 1GHAF 3PMHB 1P0SH 1A5IA 5GJ4B 2R2WU 2FTLE 3FP6E 2NU3E 1BIOA 3LGIA 1AB9C 1UTPA 2BD2A 2CHAB 3A84A 3S69A 1SC8U 2H9HA 1AWFH 3GYMA 1YKTA 1K9OE 3H7TA 1QIXB 2WPLS 2BTCE 1O3FA 5A8YA 2ZFFH 4UFGH 3BIUH 3VB3A 4DW2U 2JH0D 1ELTA 2ZG0H 2BM2A 1C5ZB 1GI3A 3PMBB 4AG1A 1ZSJA 1CGHA 2Z9LA 1VGCB 1NFWA 1ANDA 5FHTA 3UY9A 3ZYEA 2BDBA 3ZZAA 1GHVH 3Q3YA 2O8MA 2Z3DA 3SBKA 3M37A 4FUJA 1GBFA 1O5DH 4ZKNU 1GI6A 3BTTE 4RSPA 1UVSH 1C1NA 1L4DA 4X2VA 2ZDLA 4TPIZ 1CGIE 4XBCA 2GGVB 1YPGH 5GIBA 3BTQE 4LZ1H 5HGGA 1TPSA 1LQEA 1V6DA 3FP7E 2ZHWH 1ZSKA 2ZDVH 5E0JA 5TCAA 2FOHA 3K2UA 3BTWE 1P2KA 1PPEE 2A5AA 3RXVA 2D26C 2O8LA 1GVKB 1K1NA 2P3UB