1WCZA

Crystal structure of an alkaline form of v8 protease from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
215
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEATGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl endopeptidase
publication title Crystal structure of an alkaline form of v8 protease from Staphylococcus aureus
rcsb
molecule tags Hydrolase
total genus 58
structure length 215
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA02
3RXMA 5A0BA 2ZFSA 1EQ9A 3A7ZA 3SU6A 3UUZA 1CT2E 1DPOA 1OWJA 2P3TB 4AB9A 1QA0A 1VITG 2QXGA 1O2HA 1C5RA 4YO9A 3GDUA 1GCTB 3RM0H 1C4U2 3SN8A 1GPZA 4UEHH 1P2JA 3FZDA 2R2MB 3F1SB 4HGCA 5C67A 5F6MA 5IDKA 2AEIH 1GMDF 4K3JA 1HNEE 3UOPA 3MYWA 5L2YH 1GBDA 2QYIA 1C1WH 4ASHA 1QL9A 2UWLA 1AE8H 3HPTB 2QGRA 1JWTA 2ZQ2A 1UK4A 4K8BA 1GHWH 2TPIZ 1W0YH 1O3LA 1W3CA 1N8OB 1C9TA 3MI4A 1P03A 3A8BA 3OU0A 1IAUA 1P2QA 1SQTA 2J94A 1TOMH 1QB6A 1HXFH 4CR5A 3JZ2B 3MO3A 3TGIE 1SFQB 1AVXA 1FIZA 4IMQA 1P2OA 2Y5HA 1TOCB 4D76A 2VIDA 7KMEH 1ABIH 3DHKH 2TGAA 1BJUA 2VINA 1A61H 1FLEE 3M5NA 1P57B 3GY5A 2TGTA 1OKXA 4B74A 4NWKA 3MNXA 2BX4A 1LVOA 1CQQA 3D65E 1N8OC 2XXLA 1W13U 3KCGH 2DUCA 1G30B 2CV3A 1P06A 1NO9H 1NU7B 3MMGA 1G3CA 1VITH 1FI8A 2SGAA 5ABWA 1ESAA 2Z9KA 3A85A 1LPZB 4YT7H 2ZU3A 1CO7E 4I31A 5AF9H 3S9BA 1E0FD 1FY3A 2OP9A 3LJJA 5EU8A 3P70B 3ATMA 1JIMA 4X8VH 4AFUA 4K2YA 2GCTC 3LC3A 1P12E 1XXFA 3ODFA 4RKOB 5LPRA 2GTBA 3P8GA 3UNRA 3E0PB 2HOBA 1CA0C 1AFEH 2P93A 4H6SB 1UCYH 3SGQE 2PFEA 1QL7A 1TX7A 6GCHF 1GJDB 3NKKA 1GBTA 1LPKB 1NESE 1O3CA 3GDVA 1HFDA 1CVWH 1ZTLA 1C1QA 3NCLA 4NA7A 1UK2A 1MD8A 1OP2A 1DXWA 2VIVA 2AH4X 2DE9A 4E06H 2BD3A 2FM2A 1GHAG 2W7SA 3RXIA 1SGFA 2ESTE 4X8UH 2D1JA 2XYAA 1ZYOA 3BEUA 2BQ6B 3KQEA 3PYHA 1BB0B 2VH0A 5TJXA 3SNBA 2A1DB 1V6DA 1AMHA 1C2MA 1G32B 1F0SA 2HGTH 1UTKA 3SHCH 2ZFFH 2FESH 4GVUA 1GHZA 1S81A 3I29A 4OGXA 2QY0B 1C5UA 1Y3YA 3A82A 2VWLA 1MZAA 1BTUA 2HNTE 5EQRA 3BG4C 1O2WA 1IQJA 3A80A 1TWXB 1OWEA 1TA6A 1FUJA 2AIPA 5EG4A 1DITH 1GG6B 2Y80A 5FPTA 3SV7A 3SZNA 3P92A 2FTLE 3NK8A 1MTVA 3DA9B 4HI3A 1ANEA 4O3TA 4CRDA 4H4FA 1GI1A 3LGYA 4THNH 4DGJA 2HPPH 4YLUA 1YBWA 4ZAEA 1FY5A 1HYLA 5F8TA 1KY9A 3ATIA 1EP5A 1ZSLA 5JB8S 1BBRH 1C2EA 3QZRA 3A7WA 1S85A 1GHBF 1SL3A 1GGDB 2OBOA 2UUYA 3R3GB 2HPQH 1XXDA 2GT7A 2BDBA 1TNJA 2GGVB 3UR9A 2H2ZA 3LH1A 4JZEH 4QT8C 1PFXC 4UFEH 4D9QA 4RN6A 1BRCE 1EKBB 1SR5C 1PPZA 2P16A 3SUEA 4LOYH 3TNSA 2TBSA 2Q6DA 2EC9H 4AG2A 4JMYA 1DWCH 1DUAA 1LCYA 4U2WA 2OC8A 1MU6B 3Q76A 3QTVH 1EJMA 2YNAA 1NS3A 2OQ5A 1IQKA 1C5VA 3LDXH 1TRMA 2SGFE 2VWMA 3BIVH 1GJAB 2BZAA 2XW9A 3SNEA 2Y5FA 2ZDMA 4DOQA 1K28D 3EAJA 4IGDA 4I8GA 2NU2E 3ZZ7A 2BD8A 1TNGA 3TJNA 3M5LA 5C1YA 1MKXK 3IITA 2G55A 2GV7A 1CT4E 2ZA5A 2V6NA 4IBLH 1FV9A 3FVFB 3TGJE 1CGIE 2WPHS 5CHAB 2THFB 2ZGCA 1IQGA 1HAVA 1T4UH 1NRRH 4TYDA 5EOKA 1CSOE 4JK6A 1M9UA 3LKWA 1GI4A 1UVTH 5ESBA 2BY6X 1O3NA 2ZU4A 1S6FA 2Z94A 1T8MA 3EE0B 1YPKH 3LONA 4X8SH 1QNJA 1C5MD 2BVXH 1P10A 1QRWA 1FN8A 2BHGA 1P3CA 2C8WB 3SJ9A 2ZHDA 1LHFH 1P9SA 2QIQA 5CHAC 3QO6A 1JOUB 2G5VA 2Z7FE 2O8UA 2ZEBA 1HAOH 1AY6H 2CMYA 1NT1A 1TONA 1O2UA 1LKAA 8GCHG 1F0UA 1O3BA 1K1IA 1W8BH 4WH6A 1LVMA 5EW1H 5L6NH 4CRCA 2GVFA 1YPGH 1S84A 3PMJA 1AU8A 1HAGE 1HAXB 5C2ZA 1BBRE 4CREA 1C2HA 1ORFA 4FUJA 1FQ3A 1VJAU 3SNCA 3ZZBA 4BNRA 1ESBA 3AW1A 3ZVGA 1O3OA 2Y7XA 1GJ4H 2BQWB 5AFYH 1AFQB 4WXVA 1BTWA 3B9FH 3RXEA 1GI6A 1VGCC 4I8HA 1DSTA 1DX5M 3LIWA 3FFGA 1L1NA 1O36A 4Y8ZA 1K1MA 2J38A 4E05H 1PQ8A 1O34A 2QF0A 3S7KB 4K1EA 4BAKB 1QRXA 1AB9B 1O5AB 5T6DA 1TBQH 4YOGA 1H8IH 2BLVA 1TGSZ 4JZIA 1K9OE 4ZUHA 4XOJA 7ESTE 1Z1IA 1AFQC 2P3FH 1BTPA 3U1JB 3DUXH 1YF4A 1Y5BT 3MU5A 1MD7A 4NIYA 1SGRE 1TGCA 2GCHG 2ZHEH 1GMCG 3NUMA 4X2WA 4A6LA 3M3TA 1H4WA 2F91A 1EZUC 1O39A 5TCCA 3VXEH 1FY4A 1J9CH 1MQ6A 1V2MT 3T5FH 1GL1A 1LPGB 1V2JT 2GDDA 3L33A 1AB9C 2PHBA 4AYVB 2H6MA 1VR1H 2VIWA 2PUXB 5E0HA 1FDPA 1C5WB 2IPHA 3RUOA 2PKAA 3RXQA 5K0HA 2ZI2H 2PSYA 1ZZZA 2GZ8A 1KLIH 1RD3B 4BTUB 1XKAC 2UUJB 1T8NA 1O30A 3TU7H 3VB6A 2NU0E 3MOCA 4MNWA 3T27A 5CE1A 1WU1A 3BIUH 1ZGIA 7LPRA 3SU4A 1MTUA 1W7GH 2Y81A 1GL0E 1P8VC 1HJAB 1V2OT 1O2JA 3RXTA 4LXBH 1RGQA 2GZ9A 4KP0A 1L1JA 1YPLH 1KXCA 5F03A 1MAYA 2BD9A 2BX3A 2FX6A 3EYDA 1CGHA 2D2DA 1O3PB 1GDQA 2ZDLA 2PKSB 4B1TA 5JBTA 4H42U 1OYQA 2V0BA 4MQAA 3F6UH 1BRAA 1FXYA 1BDAA 1A0LA 1LDTT 4Q7ZA 2W5EA 1VCPA 1JBUH 5HM9A 1G37A 3UFAA 4MLFB 1DY9A 1DS2E 3LGTA 2WPJS 1V2NT 1GMHG 2GV6A 2FEQH 3LH3A 1QY6A 1YC0A 3D49H 1BMAA 4KTCA 1ZOMA 2FS9A 2BMGB 2ZF0H 2PKSC 1MCVA 5A8XA 4YM9A 2VVUA 1T8LA 3MWIU 2OBQA 1TAWA 1Y3XA 4MVNA 2B9LA 1LHGH 3PTNA 1UVUH 2BDIA 1BIOA 3BF6H 2VB0A 2CF8H 2EA3A 2Z3DA 1L0ZA 1A3BH 4PROA 1GDNA 1ZHPA 3BTGE 4BAMB 2C4FH 4FU8A 2RA3A 4K5ZA 5C3NA 2A2QH 1LHCH 2JKHA 2BDHA 5DG6A 3SQHE 5DKMA 1INCA 1Y59T 1BOQA 1HAIH 3PLBA 3ITIA 1D3PB 1QL8A 3CENA 4JZ1A 2AERH 2CHAB 2QA9E 1SLWB 1BCUH 5JBCS 5C1UA 1FAXA 1EB2A 1MKWH 1GJ5H 3W94A 4MNYA 4Y8YA 1AGJA 1W11U 2G00A 2QV1A 1ELCA 2C90B 1BHXF 1ANBA 2PUQH 2XC0A 1QGFA 3LPRA 4UD9H 1YYY1 3OX7U 2KAIB 3C1KA 2ZCHP 1ELAA 2IOTA 1XUGA 3GYLB 1QTFA 2P94A 4ISOA 3SV2H 2QXJA 1HAYB 4TPYA 1BMMH 1P0SH 4FUDA 1OP0A 2W3KA 3MU1A 5DP4A 2CHAC 4Q2KA 2UUKB 4DCDA 5DJ7A 1P11E 1Z8JB 2ZPRA 1HIAA 4B75A 5FCRA 3WY8A 5EW2H 5FXLA 2BDCA 1QJ1B 3V3MA 1GBIA 4NSYA 4NWLA 2H9HA 3O8CA 1IOEA 1V2QT 2A4OA 4XFQA 3VXFH 1AKSA 1EZQA 2BDAA 3C27B 2HWLB 1AIXH 1K22H 2BYAX 3UNQA 1SLUB 1EAWA 4DURA 4F4OC 1BZXE 1QQ4A 3M7QA 2ZECA 2ZTZA 1ESTA 4XDEA 2RDLA 3RP2A 1CHOF 1V2VT 1D4PB 1QRZA 2AIQA 4H6TA 1UTPA 2VH6A 1GCDA 4Y8XA 2V3HH 1JIRA 4DIIH 2XRCA 2ZDAH 4F49A 1WYKA 2CF9H 2F9UA 4OS6A 1SGQE 2B7DH 4MPUA 1YCPK 4X8TH 4X1QU 1W12U 2BVSH 1D3QB 2WPLS 5EQQA 5JYIA 1L1GA 3M3SA 2AMPA 1ELTA 3PV4A 4D8NA 1WCZA 1LVBA 2OXSA 1TPPA 2BZ6H 2R3UA 5FHTA 1SQAA 2XC5A 1GI8B 1NFYA 3SUGA 3U69H 1H9LB 2D26C 3UNSA 5HM2A 7GCHG 9LPRA 5LPEA 1T31A 2OLGA 2BLQA 3OSYA 2BD5A 3HKIB 3ZVAA 5GIBA 3SBKA 3F68H 1MBQA 1U6QA 2DE8A 1DFPA 2VU8E 1F5RA 1QBNA 3UWIA 4ABAA 1GVZA 1PYTC 2O8MA 3AAUA 4FUEA 3F9EA 3HATH 4Y10E 4JYTA 3VFEA 3D23A 3KQCA 4FU7A 1AE5A 4Y11E 3QLPH 1SGPE 4XE4A 1P2MA 4WJG2 3RXBA 2BM2A 3HKJB 2XBVA 5EPNA 1QJ6B 1H8DH 2ZU1A 2Z3CA 1EAUA 3UOUA 1F92A 1TQ7B 1V2ST 3LU9B 3HK6B 4B2BA 4ABHA 2CXVA 1O35A 3KF2A 2XC4A 2H5CA 2O8WA 1BT7A 1O3EA 1ZPCA 2R3YA 1PPFE 3EDXB 3CS7A 4OS4A 3QX5H 2GT8A 1WAYB 4UFGH 5I25A 2QCYA 1S83A 2OC1A 5GCHG 5C5NA 3BTHE 2NU4E 3P95A 3SJ8A 2GCTB 1TE0A 2OC0A 1AD8H 1DANH 4MPWA 5LGOA 3RXSA 2I6SA 3OYPA 1CA0B 1O5DH 1HAVB 1MU8B 3KIDU 2WV4A 1TNLA 5J4SA 5JPMH 1IQEA 1OX1A 1W2KH 2JH0D 1O0DH 1TB6H 2ANWA 3U8OH 2NWNA 2ASUB 4XSKU 2Z6BD 1C5LH 5C5OA 3QGJA 4BANB 1YPJH 2IJOB 1HDTH 2BY5X 2AFQB 1GBFA 3UWJH 3TK5A 2BY8X 1WOFA 3LT3A 3BEIB 4UE7H 1UCYK 1K1OA 4E7NA 1TX8A 2QF3A 1KSNA 8LPRA 1HAZB 2BTCE 1OWIA 4VGCC 1GBKA 1KTTB 2H5DA 3BG4B 3BTEE 1NPMA 4FUIA 1PQAA 1UO6A 2HLCA 2FOCA 2H9TH 1IQNA 1W14U 5GWZA 1UHBB 3ELAH 2G51A 1HXEH 3MH7A 1O2RA 3KL6A 3AW0A 3M3VA 4I7YH 2A5IA 4AFQA 1TYNA 2AGIX 4X6MA 1IQMA 2SGEE 1XM1A 3V13A 3URCA 2PLXA 2OINA 3M36A 3VPKA 1GVKB 3MNCA 1TA2A 6CHAC 3RMMH 3ZZ3A 3U9AH 4FVBA 4TWWA 1CE5A 1SOZA 1TMBH 3SHAH 3TH3H 1KDQB 4A1TA 1A5HA 1TPOA 2EI6A 1C5QA 5EXMA 4B73A 4NZLA 1RXPA 3E91A 4X2XA 3MU8A 4KKDA 5HGGA 2ZPSA 3EA8A 1ETRH 2YNBA 5EXNA 5FPSA 1ZMNA 1X7AC 4OGYA 1IQIA 2A5KA 1FY1A 3T2NA 4R8TB 2ZGHA 3E3TA 1VITF 5I46H 3SGBE 2YOLA 4U32A 4R0IA 3M5OA 2ZTXA 2GKVE 1PPBH 1MTWA 2VJ1A 4KTUA 3GCTG 1Q2WA 1YPMH 1CHGA 1E34B 3P6ZB 3PLKA 1ZSKA 2PKAB 3I77A 5PTPA 1EASA 3OY5U 1HUTH 3L6PA 1HBTH 3P8NA 3RXOA 4ZKSU 1O2GH 3V12A 5A0CA 1NTPA 1RFNA 1A1RA 2ZCLP 1C2IA 1JMOH 1KTSB 4I32A 3STIA 3BTDE 3EGKH 1HCGA 3RU4E 1DVAH 2XCFA 1NROH 3B8JA 2PW8H 3LGIA 5CMXH 2ZTYA 1HB0B 1SGDE 1XMNB 3LJOA 4JK5A 1GI3A 1GHVH 3UPEA 4Q80A 4I8JA 1L2EA 1YLDA 3F9FA 2F9OA 4X1NU 3MNSA 1DT2A 1JRTA 4XBCA 2PGQB 2ODQA 1S0RA 3M7TA 1J17T 1AUJA 1D3TB 5AHGH 1EPTA 1F7ZA 2GDEH 1G2LA 4Y71A 1ZHMA 4WY3A 2FLRH 2G5NA 1E35B 1W7XH 1A5GH 3QUMP 4KTSA 1GBCA 1SB1H 3V7TA 1MH0A 1EP6A 1HAHH 2J34A 1PPCE 4INLA 1EUFA 1K1LA 1WTHD 4ABFA 4Y6DA 1Z8IB 3PO1B 3GY4A 1MCTA 1OSSA 1TLDA 5DPAA 3L3TA 1RRKA 3DT0H 2LNCA 3TIUA 1O31A 3AVZA 4AZ2B 4IN1A 1O2MA 4GPGA 1VGCB 1ELBA 2BB4A 3ESTA 3U8TH 1THSH 1C1UH 4X2YA 3SORA 1GI0A 5A8YA 3A8AA 1IQHA 1QB1A 3KQBA 2CGAA 3K65B 4ABIA 1SGIB 1SBWA 1GHAF 3RMNH 5J4QA 1O3IA 3PO1C 2J95A 1VZQH 1SVPA 2FODA 1C1PA 2VWNA 1K1NA 1GVLA 3I78A 1O5FH 4CH2B 3ZZ8A 3BTME 5AFZH 2FOMB 1ELDE 5E2OA 1ANCA 2F3CE 2VIPA 3BTTE 3T25A 1GJ6A 3VGCB 3UQOA 4Q7YA 1BHXB 1C5YB 4I8KA 1KLJH 1XVOA 1TFXA 1QBVH 4UFDH 4WMFA 3PMAB 2HVXA 4X1SU 3TH2H 1C5PA 3M35A 2AGEX 1ZTKA 2BD2A 1K2I1 4A7IB 1OYTH 1AUTC 1UTMA 1TIOA 4YESB 1OP8A 1SC8U 3GDSA 5B6OA 1UTOA 2AYWA 2XBWA 3TPIZ 1HIAB 1O2OA 1TNKA 4GCHG 4X6PA 3RXGA 3VGCC 1C2GA 1DWEH 3MFJA 2BDYA 5DGJA 4LK4A 3F9GA 4ISNA 1TMUH 1O2QA 1WBGB 4ABDA 1AWHB 5DK1A 2FIRH 2EI7A 1PPEE 1ETTH 1C5ZB 1FONA 5JB9S 2A2XH 4YOIA 2TGPZ 3A88A 8ESTE 3U1IB 1DICA 1J8AA 1ZLRA 4BOHA 3SNAA 5E8EH 4AN7A 1AVWA 1GJ9B 2HALA 1ELEE 4FXGH 1ANDA 3SW2B 3A87A 2BOKA 3BEFB 4U30A 2FTMA 1YM0A 2ZG0H 4XBDA 1AZ8A 4YZUA 2FOFA 3ZVFA 1W10U 2EEKA 2SNWA 4ABJA 4UONA 2FI3E 3ZZ5A 1O3HA 2FWWA 2FXRA 4LZ4B 3BTQE 2AMDA 2XBXA 1SFIA 2BD4A 4CBNA 3SU1A 2JETC 1SOTA 3S0NA 1V2WT 3BV9B 1A0JA 2G81E 1DM4B 1XKBC 1SQOA 5DP5A 1C9PA 2FOEA 2SGQE 5F8ZA 8KME2 2Q1JA 4I33A 1GHXH 1WQSA 4MNVA 2Z9LA 5GPIB 4CBOA 2R9PA 1ZJKA 3NWUA 2ZNKH 3UREA 1O3JA 2W26A 1GI9B 1PQ5A 1D6WA 4TY6A 5E2PA 1KIGH 3HGNA 5DP3A 3VB7A 1HLTH 1NN6A 4FUHA 3GISB 1V3XA 2ZQ1A 3ZVEA 3T62A 1T4VH 3A7XA 3O8RA 1HJ8A 2FDAA 4ZROA 3MU0A 1CU1A 3SI4H 4ZHLU 4AGJA 1GMDG 3TK6A 1F2SE 3EA9A 1C1RA 1XUJA 1AZZA 1K21H 4NFFA 1TPAE 1V2RT 1MMJN 1D9IA 3ATLA 2VVVA 2UWPA 2Q6FA 1L4ZA 1T32A 3RXRA 1ZGVA 3BTFE 1QURH 1EX3A 1TPSA 1AQ7A 3STJA 3PM3A 1XUHA 2WPMS 4AX9H 1P2KA 4CH8B 1LKBA 2F9PA 2AMQA 4OS5A 4Y76A 1A2CH 4MDSA 2ANMH 3ZV9A 4D9RA 1IQLA 3T28A 2ZFPH 2OCVB 3R0FA 4X1RU 2A0QB 1ARBA 4K60A 3T29A 4FUGA 4A5TS 4RKJB 1B7XB 3UY9A 3RXAA 3ZZ9A 3A7VA 1O38A 2FZZA 4ZKRU 2GD4B 5FX6A 1B0FA 2F83A 5HXFA 1O2LA 4E7RG 4ESTE 1NRNH 2FI4E 4FU9A 5AVDA 2PR3A 4MPVA 5SGAE 1HRTH 1NC6A 5BRRE 3F9HA 4NIVA 1O2PA 3SI3H 1GJBB 2G4UA 5EODA 2PTCE 3SU2A 3GCNA 1GJ7B 1DLEA 1KXEA 3OY6U 2TGDA 1UTNA 3BG8A 2TRMA 2A7HA 2FOGA 1G3BA 2ALPA 2ZPQA 4MNXA 1O3DA 1WUNH 2GCHF 6GCHG 1GMCF 4BTTB 4GAWA 3Q3YA 4BAOB 4CR9A 1OPHB 5HMAA 4KGAA 1FNIA 2ZDVH 2B5TB 4X2VA 3GYMA 3DFLA 4Y0ZE 1GBLA 3E8LA 1Z8GA 1C5XB 1CGJE 1PPHE 1EZSC 2M5TA 3MO6A 3S9AA 5DP6A 3SO3A 2W7UA 3SQEE 5FBEA 4A1VA 2V3OH 3IWMA 9ESTA 3SU0A 1G2MA 2XTTB 6LPRA 2VGCC 1LHEH 2ANKH 4D7FA 1O3FA 1YP9A 1Y3WA 1UTQA 1XUIA 1YCPM 1NRPH 3RXHA 1S0QA 1ELGA 4WF8A 2FMJA 2CN0H 2PTNA 4TPIZ 1H1BA 2A4RA 3ATWA 3QZQA 3T26A 5DP9A 2BLOA 3MO9A 1TRYA 1S82A 1W0ZU 3ZVBA 5F8XA 1QFKH 4X0WU 3UTUH 1VJ9U 1ARCA 4UDWH 1ZRBA 1IQFA 1O2XA 5ETXA 3Q3KA 1GHYH 1MTSA 1ABJH 2HNTC 2FOHA 3GY3A 1O37A 2ZP0H 1O3AA 1L4DA 3H5CB 1RTLA 3M61U 1TMTH 3SNDA 1PJPA 2Y5GA 1QR3E 1F5KU 2C8YB 1NZQH 1EOLA 1GHBG 2RA0A 2STAE 2I6QA 2UUFB 5L30H 1JXPA 1ZTJA 3NZIA 3HGPA 1C2LA 1WTGH 3B23B 1HGTH 4CHAC 1ZR0A 1LQDB 2R0KA 2Z3EA 4ISIH 3NPSA 2SFAA 1GBEA 2B8OH 4JZFH 3ZZ6A 1GMHF 4AFSA 1IHTH 1TGTA 1AN1E 2ODYB 1GBHA 1FPHH 1SI5H 2LPRA 2WYGA 5FX5A 5EPYA 1LMWB 1UVSH 3EQ0H 4YOJA 3GY7A 1EXFA 3QTOH 2TIOA 3VB4A 1LO6A 4K1TA 1LHDH 1ELVA 1GCTC 1THRH 3LGWA 4I8LA 2FOAA 2F9VA 1ZRKA 2XWAA 2G52A 3GCHB 3TGKE 2OD3B 1OXGA 1MZDA 1SGCA 1EAXA 5DP7A 4JYVH 4GHQA 1ELFA 1G3EA 4B76A 1EOJA 1EPTB 2ZGXH 4IN2A 1BTYA 1NRSH 1OWKA 4DIHH 4AGKA 3A89A 4NZQA 2J92A 4ABGA 4RSPA 1O2ZA 4NFEA 2GX4A 5A09A 4JZDH 2A4GA 1NFUA 3VEQB 3GCHC 3MH4A 2ZC9H 4VGCB 1Q3XA 3ZZCA 4B71A 3RXLA 2P95A 2KAIA 1FMGA 2BY7X 4X1PU 4ABBA 1RJXB 5JDUB 3Q77A 1EPTC 2Y82A 1O5GH 1RTFB 2PV9B 5G4BA 4NSVA 1QQUA 1P01A 1V2LT 3UQVA 3SV8A 4UFFH 1C5OH 1O3KA 2Y6TA 1C5NH 2GZ7A 1YKTA 2ZZUH 1GBMA 2J2UA 4GHTA 1Z8RA 4BXSA 3MTYA 4OS1A 3UIRA 2K1QA 3E90B 1T8OA 2ZFQH 1MBMA 4K69A 6CHAB 1SMFE 2PGBB 3VB5A 1O32A 2J4IA 2FO9A 1B5GH 2JH5D 3PLPA 1LTOA 2ANYA 2R0LA 2ZU2A 3AASA 4AFZA 3TK9A 1RS0A 1TALA 1TABE 2HNTF 4K8YA 2F9BH 5HYOA 4B2CA 4IMZA 1C1SA 1J15A 1XUFA 3ZV8A 1Z6EA 1P2NA 2C93B 5T3HA 3A7YA 4Z0KA 2BXUH 1O3GA 3RXKA 1Z71A 2A7JA 4GUXA 3LC5A 4WMDA 3SJOA 3RMLH 2ZHQH 1BTHH 3K9XB 3LOXA 3A8CA 5FCKA 4Q7XA 3RMOH 2QXIA 4HFPB 2J9NA 1NU9A 4X6OA 4ZXYH 1GJ8B 2SNVA 1TRNA 4FVDA 2H9EH 1CBWB 3ZVDA 1SHYA 5ESTE 3RC6A 1XUKA 4ZKNU 3P8FA 1O5BB 1AHTH 1PQ7A 1BBRK 7GCHF 1A5IA 1YGCH 3P17H 3TJVA 4J2YB 1Y3VA 2UWOA 3Q00A 1Z6JH 5FPYA 1H9HE 1OWHA 1ZSJA 3RXUA 2G8TA 4ISHH 5GXPA 3URDA 4INHA 1V2KT 2SGDE 4YTAA 1V2UT 4WVPE 2FS8A 3K2UA 1KXDA 3FZZA 1Z1JA 3AAVA 1MAXA 1CBWC 4D7GA 5K7RA 3HK3B 1GG6C 1BA8B 2P3UB 6ESTA 1ZJDA 1F0TA 1O2NA 3CP7A 3PTBA 1KXAA 1THPB 1D3DB 5E0GA 2R2WU 3U98H 2VIOA 5C1XA 3SV6A 1YPEH 2Z9IA 1AVGH 3Q3XA 1P09A 4A92A 1EATA 5E0JA 4INKA 3NXPA 1FAKH 1BITA 1O3MA 3GOVB 1NRQH 2FYRA 2VNTA 2G4TA 3A8DA 4HZHA 3A7TA 1ETSH 4DG4A 2A45B 1GGDC 1FN6A 1PPGE 2RG3A 4MPXA 3UR6A 2V35A 2BQ7B 4Y7BA 4DW2U 2ZIQH 4IC6A 4AORA 1QCPA 5GCHF 1ACBE 1Y5AT 2RCEA 1MKXH 1UCYE 2Y7ZA 4OS2A 3E6PH 3U8RH 1XX9A 2VWOA 2ULLA 5LH8A 3GCOA 2B0FA 2WPIS 1GJCB 1OS8A 2BVRH 3W95A 1C5SA 1KXBA 1K1JA 4WXIA 1UTJA 1C4V2 2SGPE 3TJUA 2QXHA 3KNXA 3ENSB 3V0XA 2WINI 1GI2A 3KEEA 1KXFA 1EZXC 4BXWA 1G9IE 5TCAA 3PROA 4AG1A 1SPJA 3PMHB 4Z6AH 3ZVCA 4GSOA 1DE7H 1HPGA 1Y3UA 2ZDNA 1BUIA 1FPCH 2D8WA 5GDSH 1VCQA 2QAAA 1NY22 1DWDH 1ZMLA 3M7UA 4YT6H 1QA7A 1KLTA 2ZHWH 1P02A 3ZYEA 3VB3A 1UVOA 2A4QA 1ZHRA 4M7GA 4O9VA 3LGUA 3D62A 4KELA 4MTBA 3QDZB 1C4Y2 1BQYA 3H7OA 1O33A 2AS9A 1BRBE 5L2ZH 2ZKSA 4LZ1H 1D6RA 3GY6A 4BAQB 3ZZ4A 2PWXA 2Q6GA 3FP8E 1Y5UT 4FUBA 3E0NB 3RXPA 3SGAE 3GY2A 1FY8E 4SGBE 3E16B 4JCNA 1FIWA 3ZYDA 1UHBA 3PWBA 2WV5A 2ZGBH 1TNHA 2O8LA 3PWCA 4TWYA 1C1MA 1EJNA 1P3EA 1BTXA 1UVPA 3SOSA 3SUFA 3KHVA 2Z9JA 5GJ4B 1LQEA 1HV7A 2GMTB 1JRSA 1QIXB 1CT0E 3DFJA 4SGAE 1OWDA 4Y79A 3ZZAA 2WUBA 3RXJA 1KDQA 1K1PA 1N6XA 1P04A 1WQVH 4ZKOU 1AKSB 2ZWLH 2WPKS 3DD2H 2ODPA 1DLKB 3E1XB 4CRAA 4O03A 4DJZB 1FZZA 4GLYA 3SUDA 5A8ZA 2BOHB 2QC2A 3M37A 1C1OA 5JBBS 1DXPA 4CRFA 4O97A 1N6YA 4NA9H 4AYYB 1QHRB 2JETB 1O2SA 5EXLA 1E37B 3SV9A 2GMTC 1MUEB 1EB1H 1C5TA 3RU4T 1TBRH 2ZCKP 3FP6E 3GCTF 1CA8B 3A86A 2XWBI 1Z7KA 4YLQH 2ZU5A 5EQSA 3P8OA 5LPFA 3RC4A 4BTIB 1SGEE 4JYUH 1DSUA 3MH5A 1BTZA 3TH4H 1CHOG 1C2JA 4MG3A 1TNIA 2ALVA 1BMLA 1SGTA 1E38B 4O3UA 1NFXA 3SU5A 2OC7A 4DVAU 4CRBA 1A7SA 5C20A 3RXCA 1EAIA 2P59A 5T6GA 2OTVA 3BTKE 3RXDA 1J16A 2XCNA 1TX6A 1E36B 3M5MA 3TVJB 1V2TT 4WH8A 1A4WH 1AO5A 1GBJA 4ZHAA 3GY8A 4ZMAH 3QN7A 3PMBB 2Z9GA 5IYTA 2O9QA 4X6NA 4ZH8A 2ZFRH 2BDGA 1MTNB 4Y7AA 1O2TA 1YPHC 2FX4A 5DO4H 1NM6A 3FP7E 5DP8A 3SU3A 1TBZH 4B2AA 4FUFA 5FAHA 1MQ5A 2ZDKA 3PB1E 3K6YA 1UJ1A 5FBIA 1HAPH 3RM2H 3LGVA 1DUEA 3TNTA 3QGNB 4DY7B 3O8DA 3RLYH 1S6HA 1HJAC 1A3EH 1SGYE 5BPEA 3RDZA 2C3SA 2FYQA 1PYTD 3FAOA 3JZ1B 1SG8B 1MTNC 3BTWE 2HRVA 4TY7A 2A5AA 4FUCA 4AOQA 1GI7B 3S69A 8GCHF 2A31A 4IS5A 3RXFA 1C2DA 1QJ7B 3CS0A 4HTCH 4NIWA 1SHHB 1F5LA 1J14A 2P8OB 2ZO3H 1TGBA 1LVYA 3ATKA 3QK1A 3K6ZA 5EGMA 3SJIA 1O2KA 2WUCA 2A7CA 2EI8A 4BAHB 1O2VA 3RU4D 2ZGJA 2A32A 4K1SA 1DWBH 1G36A 1AI8H 5T6FA 1MKWK 4WWYA 4ZXXH 1QB9A 2W3IA 3IG6B 3BSQA 4IC5A 3A84A 2FP7B 1S5SA 1P05A 1RIWB 1T7CA 2NU3E 3A83A 1A0HB 3MU4A 2P8OC 1YLCA 1AWFH 1P2IA 1IHSH 2C8ZB 5A2MH 1F0RA 2AGGX 3BN9A 1B0EA 2ILNA 4NCYA 1NFWA 1ID5H 2WYJA 2XBYA 4XBBA 2FPZA 2PSXA 4NA8A 2XNIA 5JBAS 3KQDA 1GBAA 1FJSA 2ZFTA 2FI5E 2STBE 1Q31A 4OS7A 3TLOA 4NIXA 1WSSH 3MNBA 1O2IA 1UMAH 2GP9B 5H4IB 1BJVA 1RIWC 2FOBA 3RC5A 4GCHF 1C2FA 2BD7A 1SGNE 3A81A 2VGCB 1KYNA 1ZPBA 1ZPZA 3KN2A 4DT7B 1RTKA 1VCWA 3TITA 1C2KA 2O8TA 2OUAA 1EJAA 1Y8TA 2C8XB 1SGFG 3N7OA 3SJKA 3EA7A 3KGPA 2OQUA 1UTLM 2JH6D 3GICB 3O8BA 2NU1E 2QN5T 2VVCA 3FANA 2ZHFH 4IW4E 4J1YA 4ISLA 1UK3A 1H9IE 3RLWH 3G01A 3RXVA 4WMEA 1TGNA 1ZMJA 2H1UA 1DY8A 3MH6A 4AB8A 1WV7H 4U01A 1BMNH 1C1TA 1C1VH 4Y0YE 3QWCH 2F9NA 1DOJA 2VIQA 4NG9H 1GBBA 1OOKB 4CRGA 3S7HB 3S9CA 1GI5A 1O2YA 1C1NA 1O5EH 2BLWA 1DDJA 1N1LA 1QBOA 1XVMA 1SLVB 3MHWU 4NGAH 1HJ9A 4A1XA 1A46H 1YCPH 1P9UA 4CHAB 3TJOA 2FLBH 1SLXB 3OTJE 4ABEA 2BY9X 1G3DA 3ZZDA 1GWAA 4ZHMU 1TQ0B 1GDUA 2CJIA 3ODDA 1SSXA 1YPHE 2IN2A 1V2PT 1BRUP 3H7TA 5A0AE 1O5CB 2BXTH
chains in the Genus database with same CATH superfamily
3RXMA 5A0BA 2ZFSA 1EQ9A 3A7ZA 3SU6A 3DSGA 3UUZA 1CT2E 1DPOA 1OWJA 1MABB 2P3TB 4AB9A 1QA0A 2JDID 1VITG 2QXGA 1O2HA 1C5RA 4YO9A 3GDUA 1GCTB 3RM0H 1C4U2 3SN8A 1GPZA 4UEHH 1P2JA 3FZDA 2R2MB 3F1SB 4HGCA 5C67A 5F6MA 5IDKA 2KCPA 2AEIH 1GMDF 4K3JA 1HNEE 3UOPA 3MYWA 5L2YH 1GBDA 2QYIA 1C1WH 4ASHA 1QL9A 2UWLA 1AE8H 3HPTB 2QGRA 1JWTA 2ZQ2A 1UK4A 4K8BA 1GHWH 2TPIZ 1W0YH 1O3LA 1W3CA 1N8OB 1C9TA 3MI4A 1P03A 3A8BA 3OU0A 1IAUA 1P2QA 1SQTA 2J94A 1TOMH 1QB6A 1HXFH 4CR5A 3JZ2B 3MO3A 3TGIE 1SFQB 1AVXA 1FIZA 4IMQA 1P2OA 2Y5HA 1TOCB 4D76A 2VIDA 2K8IA 7KMEH 1ABIH 3DHKH 2TGAA 1BJUA 2VINA 1A61H 1FLEE 3M5NA 1P57B 1SKYE 2TGTA 3GY5A 1OKXA 4B74A 4NWKA 3MNXA 2BX4A 2W6ID 1LVOA 1CQQA 3D65E 1N8OC 2XXLA 1W13U 3KCGH 2DUCA 1G30B 2CV3A 1P06A 2F43B 1NO9H 1NU7B 3MMGA 1G3CA 1VITH 1FI8A 2SGAA 5ABWA 1ESAA 2Z9KA 3A85A 1LPZB 4YT7H 2ZU3A 1CO7E 4I31A 5AF9H 3S9BA 1E0FD 1FY3A 2OP9A 3LJJA 5EU8A 3P70B 3ATMA 1JIMA 4X8VH 4AFUA 4K2YA 2GCTC 3LC3A 1P12E 1XXFA 3ODFA 4RKOB 5LPRA 5KECA 2GTBA 3P8GA 3UNRA 3E0PB 2HOBA 1CA0C 1AFEH 2P93A 4H6SB 1UCYH 2WHXA 3SGQE 2PFEA 1QL7A 1TX7A 4OM9A 6GCHF 1GJDB 3NKKA 1GBTA 1LPKB 1NESE 1O3CA 3GDVA 1HFDA 1CVWH 1ZTLA 1C1QA 3NCLA 4NA7A 1UK2A 1MD8A 1OP2A 1DXWA 2VIVA 2AH4X 2DE9A 4E06H 2BD3A 2FM2A 1GHAG 2W7SA 3RXIA 1SGFA 2ESTE 4X8UH 2D1JA 2XYAA 1ZYOA 3BEUA 2BQ6B 3KQEA 3PYHA 5GNDA 1BB0B 2VH0A 5TJXA 3SNBA 2A1DB 1V6DA 1AMHA 1C2MA 1G32B 3NRLA 1F0SA 2HGTH 1UTKA 3SHCH 2ZFFH 2FESH 4GVUA 1GHZA 1S81A 3I29A 4OGXA 2QY0B 1C5UA 1Y3YA 3A82A 2VWLA 1MZAA 1BTUA 2HNTE 5EQRA 3BG4C 1O2WA 1IQJA 2PP6A 3A80A 1TWXB 1OWEA 1TA6A 1FUJA 2AIPA 5EG4A 1DITH 1GG6B 2Y80A 5FPTA 3SV7A 3SZNA 3P92A 2FTLE 3NK8A 1MTVA 3DA9B 4HI3A 1ANEA 4O3TA 4CRDA 4H4FA 1GI1A 3LGYA 4THNH 4DGJA 2HPPH 4YLUA 1YBWA 4ZAEA 3OE7D 1FY5A 1HYLA 5F8TA 1KY9A 3ATIA 1EP5A 1ZSLA 5JB8S 1BBRH 1C2EA 3QZRA 3A7WA 1S85A 1GHBF 2KZ4A 1SL3A 1GGDB 2OBOA 2UUYA 3R3GB 2HPQH 1XXDA 2GT7A 2BDBA 1TNJA 2GGVB 3UR9A 2H2ZA 3LH1A 4JZEH 4QT8C 1PFXC 4UFEH 4D9QA 4RN6A 1BRCE 1EKBB 1SR5C 1PPZA 2P16A 5IK2D 3SUEA 4LOYH 3TNSA 2TBSA 2Q6DA 2EC9H 4AG2A 4JMYA 1DWCH 1DUAA 1LCYA 4U2WA 2OC8A 1MU6B 3Q76A 3QTVH 1EJMA 2YNAA 1NS3A 2OQ5A 1IQKA 1C5VA 3LDXH 2W6JD 1TRMA 2SGFE 2VWMA 3BIVH 1GJAB 2BZAA 2XW9A 3SNEA 2Y5FA 2ZDMA 4DOQA 1K28D 3EAJA 4IGDA 4I8GA 2NU2E 3ZZ7A 2BD8A 1TNGA 3TJNA 3M5LA 4I86A 5C1YA 1MKXK 3IITA 2G55A 2GV7A 1CT4E 2ZA5A 2V6NA 4IBLH 1FV9A 3FVFB 3TGJE 1CGIE 2WPHS 5CHAB 2THFB 2ZGCA 1IQGA 1HAVA 1T4UH 1NRRH 4TYDA 5EOKA 1CSOE 4JK6A 1M9UA 3LKWA 1GI4A 1UVTH 2EY4C 5ESBA 2BY6X 1O3NA 2ZU4A 1S6FA 2Z94A 3WWFA 1T8MA 3EE0B 1YPKH 3LONA 4ACBA 4X8SH 1QNJA 1C5MD 2BVXH 1P10A 1QRWA 1FN8A 2BHGA 1P3CA 2C8WB 3SJ9A 2ZHDA 1LHFH 1P9SA 2QIQA 5CHAC 3QO6A 1JOUB 3FOAA 2G5VA 2Z7FE 2O8UA 2ZEBA 1HAOH 1AY6H 2CMYA 1NT1A 1TONA 1O2UA 1LKAA 3VG8A 8GCHG 1F0UA 1O3BA 1K1IA 1W8BH 4WH6A 1LVMA 5EW1H 5L6NH 4CRCA 2GVFA 1YPGH 1S84A 3PMJA 1AU8A 1HAGE 1HAXB 5C2ZA 1BBRE 4CREA 1C2HA 1ORFA 4FUJA 1FQ3A 1VJAU 3SNCA 3ZZBA 4BNRA 1ESBA 3AW1A 3ZVGA 1O3OA 2Y7XA 1GJ4H 2BQWB 5AFYH 1AFQB 4WXVA 1BTWA 3B9FH 3RXEA 1GI6A 1VGCC 4I8HA 1DSTA 1DX5M 3F2GA 3LIWA 3FFGA 1L1NA 5DSFA 1O36A 4Y8ZA 1VKYA 1W0KD 1K1MA 2J38A 4E05H 1PQ8A 1O34A 2QF0A 3S7KB 4K1EA 4BAKB 1QRXA 1AB9B 1O5AB 4XRNA 5T6DA 1TBQH 4YOGA 1WXRA 1H8IH 2BLVA 1K0HA 1TGSZ 4JZIA 1K9OE 2YMSB 4XOJA 4ZUHA 4Q63A 7ESTE 1H8ED 1Z1IA 1AFQC 2P3FH 1BTPA 3U1JB 3DUXH 1YF4A 4ACAA 1Y5BT 3MU5A 1MD7A 4NIYA 1SGRE 1TGCA 2GCHG 2ZHEH 1GMCG 3NUMA 4X2WA 4A6LA 3M3TA 1H4WA 2F91A 1EZUC 1O39A 5TCCA 3VXEH 1FY4A 1J9CH 1MQ6A 1V2MT 3T5FH 1GL1A 1LPGB 1V2JT 2GDDA 3L33A 1AB9C 2PHBA 4AYVB 2H6MA 1VR1H 2VIWA 2PUXB 5E0HA 1FDPA 1EFRD 1C5WB 2IPHA 3RUOA 2PKAA 3RXQA 5K0HA 2ZI2H 2PSYA 2V7QD 1ZZZA 2GZ8A 1KLIH 1RD3B 4BTUB 1XKAC 2UUJB 1T8NA 1O30A 3TU7H 3VB6A 2NU0E 3MOCA 4MNWA 3T27A 5CE1A 1WU1A 1YY3A 3BIUH 1ZGIA 7LPRA 3SU4A 1MTUA 1W7GH 2Y81A 1GL0E 1P8VC 1HJAB 4RT0A 1V2OT 1O2JA 3RXTA 1E1RD 4LXBH 1RGQA 2GZ9A 4KP0A 1L1JA 1YPLH 1KXCA 5F03A 1MAYA 2BD9A 2BX3A 2FX6A 3EYDA 1CGHA 2D2DA 1O3PB 1GDQA 2ZDLA 2PKSB 4B1TA 5JBTA 1E79D 4H42U 1OYQA 2V0BA 4MQAA 3F6UH 1BRAA 1FXYA 1BDAA 1A0LA 1LDTT 4Q7ZA 4HG6A 2W5EA 1VCPA 1JBUH 5HM9A 1G37A 3UFAA 4TSFD 4MLFB 1DY9A 1DS2E 3LGTA 2WPJS 1V2NT 1GMHG 2GV6A 2FEQH 3LH3A 1QY6A 1YC0A 3D49H 1BMAA 4KTCA 1ZOMA 2FS9A 2BMGB 2ZF0H 2PKSC 1MCVA 5A8XA 4YM9A 2VVUA 1T8LA 3MWIU 5CHBA 2OBQA 1TAWA 1Y3XA 4MVNA 2B9LA 1LHGH 3PTNA 1UVUH 2BDIA 3ZIAD 2F4LA 1BIOA 3BF6H 2VB0A 2CF8H 2EA3A 2Z3DA 2WV9A 1L0ZA 1A3BH 4PROA 1GDNA 1ZHPA 3BTGE 4BAMB 2C4FH 4FU8A 2RA3A 4K5ZA 5C3NA 2A2QH 3GS9A 4Q4LA 1LHCH 2JKHA 2BDHA 3DCLA 5DG6A 3SQHE 5DKMA 1INCA 1Y59T 1BOQA 1HAIH 3PLBA 2KR7A 3ITIA 1D3PB 1QL8A 3CENA 4JZ1A 2AERH 2QF4A 2CHAB 2QA9E 1SLWB 1BCUH 5JBCS 5C1UA 1FAXA 1EB2A 1MKWH 1GJ5H 3W94A 4MNYA 4Y8YA 1AGJA 1W11U 2G00A 2QV1A 3F2HA 1ELCA 2C90B 1BHXF 1ANBA 2GJGA 1E1QD 2PUQH 2XC0A 1QGFA 3LPRA 4UD9H 1YYY1 3OX7U 2KAIB 3C1KA 2ZCHP 1ELAA 2IOTA 1XUGA 3GYLB 1QTFA 2P94A 4ISOA 4YXWD 3SV2H 2QXJA 1HAYB 4TPYA 1BMMH 1P0SH 4FUDA 1OP0A 2W3KA 3MU1A 5DP4A 2CHAC 4Q2KA 2UUKB 4DCDA 5DJ7A 1P11E 1Z8JB 2ZPRA 1HIAA 4B75A 5FCRA 3WY8A 5EW2H 5FXLA 2BDCA 1QJ1B 3V3MA 1GBIA 2KM0A 4NSYA 2H9HA 4NWLA 3O8CA 1IOEA 1V2QT 2A4OA 4XFQA 5T1VA 3VXFH 1AKSA 1EZQA 2BDAA 3C27B 3WW7A 2HWLB 1AIXH 1K22H 2BYAX 3UNQA 1SLUB 1EAWA 4DURA 4F4OC 1BZXE 1QQ4A 3M7QA 2ZECA 2ZTZA 1ESTA 4XDEA 2RDLA 3RP2A 1CHOF 1V2VT 1D4PB 1QRZA 2AIQA 4H6TA 1UTPA 2VH6A 1GCDA 4Y8XA 2V3HH 1JIRA 4DIIH 2XRCA 2ZDAH 4F49A 1WYKA 2CF9H 2F9UA 4OS6A 5CDFE 1SGQE 2B7DH 4MPUA 4FOUC 1YCPK 4X8TH 2J97A 4X1QU 1W12U 3OTPA 2BVSH 1D3QB 2WPLS 5EQQA 5JYIA 1L1GA 3M3SA 2AMPA 1ELTA 3PV4A 4D8NA 1WCZA 1LVBA 2OXSA 1TPPA 2BZ6H 2R3UA 5FHTA 1SQAA 2XC5A 1GI8B 1NFYA 3SUGA 3U69H 1H9LB 2D26C 3UNSA 5HM2A 7GCHG 9LPRA 5LPEA 1T31A 5EJLA 2OLGA 2BLQA 3OSYA 2BD5A 3HKIB 3ZVAA 5GIBA 3SBKA 3F68H 1MBQA 1U6QA 2DE8A 1DFPA 2VU8E 5C0UA 1F5RA 1QBNA 3UWIA 4ABAA 1GVZA 1PYTC 2O8MA 3AAUA 4FUEA 3F9EA 5EJ1A 3HATH 4Y10E 4JYTA 3VFEA 3D23A 3KQCA 4FU7A 1AE5A 4Y11E 3QLPH 1SGPE 4XE4A 1P2MA 4WJG2 3RXBA 2BM2A 3HKJB 2XBVA 5EPNA 1QJ6B 3MQKC 1H8DH 2ZU1A 2Z3CA 2KX4A 1EAUA 3UOUA 1F92A 1TQ7B 1V2ST 3LU9B 3HK6B 4B2BA 4M9FA 4ABHA 2CXVA 1O35A 3KF2A 2XC4A 2H5CA 2O8WA 1BT7A 1O3EA 1ZPCA 2R3YA 1PPFE 3EDXB 1NBMD 3CS7A 4OS4A 3QX5H 2GT8A 1WAYB 4UFGH 5I25A 2QCYA 1S83A 2OC1A 5GCHG 5C5NA 3BTHE 2NU4E 3P95A 3SJ8A 2GCTB 1TE0A 2OC0A 1AD8H 1DANH 4MPWA 4P02A 5LGOA 3RXSA 2I6SA 3OYPA 1CA0B 2WPDD 1O5DH 1HAVB 1MU8B 3KIDU 2WV4A 1TNLA 5J4SA 5JPMH 1IQEA 1OX1A 1W2KH 2JH0D 1O0DH 1TB6H 2ANWA 3U8OH 2NWNA 2ASUB 4XSKU 2Z6BD 1C5LH 5C5OA 3QGJA 4AC9A 4BANB 1YPJH 2IJOB 1HDTH 2BY5X 2AFQB 1GBFA 3UWJH 3TK5A 2BY8X 1WOFA 3LT3A 3BEIB 4UE7H 1UCYK 1K1OA 4E7NA 1TX8A 2QF3A 1KSNA 8LPRA 1HAZB 2BTCE 1OWIA 4VGCC 1GBKA 1KTTB 2H5DA 3BG4B 3BTEE 1NPMA 4FUIA 1PQAA 1UO6A 2HLCA 2FOCA 2H9TH 1IQNA 1W14U 2HVYB 5GWZA 1UHBB 3ELAH 2G51A 1HXEH 3MH7A 1O2RA 3KL6A 3AW0A 3M3VA 4I7YH 2A5IA 4AFQA 1TYNA 2AGIX 4X6MA 1IQMA 2SGEE 1XM1A 3OAAD 3V13A 3OEED 3URCA 2PLXA 2OINA 3M36A 3VPKA 1GVKB 3MNCA 1TA2A 6CHAC 1YLNA 3RMMH 3U28C 3ZZ3A 3U9AH 4FVBA 4TWWA 1FX0B 1CE5A 3N7EA 1SOZA 1TMBH 3SHAH 3TH3H 1KDQB 4A1TA 1A5HA 5C0TA 1TPOA 2EI6A 1C5QA 5EXMA 4B73A 4NZLA 1RXPA 3E91A 4X2XA 3MU8A 4KKDA 5HGGA 2ZPSA 3EA8A 1ETRH 2YNBA 5EXNA 5FPSA 1ZMNA 1X7AC 2KCOA 4OGYA 1S6LA 1IQIA 2A5KA 1FY1A 2RDEA 3T2NA 4R8TB 2ZGHA 3E3TA 1VITF 5I46H 1W0JD 3SGBE 2YOLA 4U32A 4R0IA 3M5OA 2ZTXA 2GKVE 1PPBH 1MTWA 2VJ1A 4KTUA 3GCTG 1Q2WA 1YPMH 1CHGA 1E34B 3P6ZB 2WZQA 3PLKA 1ZSKA 2PKAB 3I77A 5PTPA 1EASA 3OY5U 1HUTH 3OFND 2L74A 3L6PA 1HBTH 3P8NA 3RXOA 4ZKSU 1O2GH 3V12A 5A0CA 1NTPA 1RFNA 1A1RA 2ZCLP 1C2IA 1JMOH 1KTSB 4I32A 3STIA 3BTDE 3EGKH 1HCGA 3RU4E 1DVAH 2XCFA 1NROH 3B8JA 2PW8H 3LGIA 5CMXH 2ZTYA 1HB0B 1SGDE 1XMNB 3F0OA 3LJOA 4JK5A 1GI3A 1GHVH 3UPEA 4Q80A 4I8JA 2WSSD 1L2EA 1YLDA 3F9FA 2F9OA 3KYGA 4X1NU 2JJ1D 3MNSA 1DT2A 1JRTA 4XBCA 5FL7D 2PGQB 2ODQA 1S0RA 3M7TA 1J17T 1AUJA 3OEHD 5HKKD 1D3TB 3N99A 5AHGH 1EPTA 1F7ZA 2GDEH 1G2LA 4Y71A 1ZHMA 4WY3A 2FLRH 2G5NA 1E35B 1W7XH 1A5GH 3QUMP 4KTSA 2KCYA 5EJZA 1GBCA 1SB1H 2K0QA 3V7TA 1MH0A 1EP6A 1HAHH 2J34A 1PPCE 4INLA 1EUFA 1K1LA 1WTHD 4ABFA 4Y6DA 1Z8IB 4F48B 3PO1B 3GY4A 1MCTA 1OSSA 1TLDA 5DPAA 3L3TA 1RRKA 3DT0H 2LNCA 3TIUA 1O31A 3AVZA 4AZ2B 4IN1A 1O2MA 4GPGA 1VGCB 1ELBA 2BB4A 3ESTA 3U8TH 1THSH 1C1UH 4X2YA 3SORA 1GI0A 5A8YA 3A8AA 1IQHA 1QB1A 3KQBA 2CGAA 3K65B 4ABIA 1SGIB 1SBWA 1GHAF 3RMNH 5J4QA 1O3IA 3PO1C 2J95A 1VZQH 1SVPA 2FODA 2VBCA 1C1PA 2VWNA 1K1NA 1GVLA 3I78A 1O5FH 4CH2B 3ZZ8A 3BTME 5AFZH 2FOMB 1ELDE 5E2OA 2JJ2D 1ANCA 2F3CE 2VIPA 3BTTE 3T25A 1GJ6A 3VGCB 3UQOA 4Q7YA 1BHXB 1C5YB 4I8KA 1KLJH 1XVOA 3F3BA 1TFXA 1QBVH 4UFDH 4WMFA 3PMAB 2HVXA 4X1SU 3TH2H 2CK3D 1C5PA 3M35A 5B6LA 2AGEX 1ZTKA 2BD2A 1K2I1 4A7IB 1OYTH 1AUTC 1UTMA 1TIOA 4YESB 1OP8A 1SC8U 3GDSA 5B6OA 1UTOA 2AYWA 2XBWA 3TPIZ 1HIAB 1O2OA 1TNKA 4GCHG 4X6PA 3RXGA 3VGCC 1C2GA 1DWEH 3MFJA 2BDYA 5DGJA 4LK4A 3F9GA 4ISNA 1TMUH 1O2QA 1WBGB 4ABDA 1AWHB 5DK1A 2FIRH 2EI7A 1PPEE 1ETTH 1C5ZB 1FONA 4P00A 5JB9S 2A2XH 4YOIA 2TGPZ 3A88A 8ESTE 3U1IB 1DICA 2LELA 4ZCNA 1J8AA 1ZLRA 5KGOA 4BOHA 3SNAA 5E8EH 4AN7A 1AVWA 1GJ9B 2HALA 1ELEE 4FXGH 1ANDA 3SW2B 3A87A 2BOKA 3BEFB 4U30A 2FTMA 1YM0A 2ZG0H 4XBDA 1AZ8A 4YZUA 2FOFA 3ZVFA 1W10U 2EEKA 2SNWA 4ABJA 4UONA 2FI3E 3ZZ5A 1O3HA 2FWWA 2FXRA 4LZ4B 3BTQE 2AMDA 2XBXA 1SFIA 2BD4A 4CBNA 3SU1A 2JETC 1SOTA 3S0NA 1V2WT 3BV9B 1A0JA 2G81E 1DM4B 1XKBC 1SQOA 5DP5A 1C9PA 2FOEA 2SGQE 5F8ZA 8KME2 2Q1JA 4I33A 1GHXH 1WQSA 4MNVA 2Z9LA 5GPIB 4CBOA 2R9PA 1ZJKA 3NWUA 2ZNKH 1BMFD 3UREA 1O3JA 2W26A 1GI9B 1PQ5A 1D6WA 4TY6A 5E2PA 1KIGH 3HGNA 2QE7D 5DP3A 3VB7A 1HLTH 1NN6A 4FUHA 3GISB 1V3XA 2ZQ1A 3ZVEA 3T62A 1T4VH 3A7XA 3O8RA 1HJ8A 2FDAA 3DSPA 4ZROA 3MU0A 1CU1A 3SI4H 4ZHLU 1WDIA 4AGJA 1GMDG 3TK6A 1F2SE 3EA9A 1C1RA 1XUJA 1AZZA 1K21H 4NFFA 1TPAE 1QZ8A 1V2RT 1MMJN 1D9IA 3ATLA 4XD7D 2VVVA 2UWPA 2Q6FA 1L4ZA 1T32A 3RXRA 1ZGVA 3BTFE 1QURH 1EX3A 1TPSA 1AQ7A 2KFWA 3STJA 3PM3A 1XUHA 2WPMS 4AX9H 1P2KA 4CH8B 1LKBA 2F9PA 2AMQA 4OS5A 4Y76A 1A2CH 3F2FA 4MDSA 2ANMH 3ZV9A 4D9RA 1IQLA 3T28A 2ZFPH 2OCVB 3R0FA 4X1RU 2A0QB 1ARBA 4K60A 3T29A 4FUGA 4A5TS 4RKJB 1B7XB 2J98A 3UY9A 3RXAA 3ZZ9A 3A7VA 1O38A 2FZZA 4ZKRU 2GD4B 5FX6A 1B0FA 2F83A 5HXFA 1O2LA 4E7RG 4ESTE 1NRNH 2FI4E 4FU9A 5AVDA 2PR3A 4MPVA 5SGAE 1HRTH 2RFKC 1NC6A 5BRRE 3F9HA 4NIVA 1O2PA 3SI3H 1GJBB 2G4UA 5EODA 2PTCE 3SU2A 3GCNA 1GJ7B 1DLEA 1KXEA 3OY6U 2TGDA 3UAIC 1YWUA 2HLDD 1UTNA 3BG8A 2TRMA 2A7HA 2FOGA 1G3BA 2ALPA 2ZPQA 4MNXA 1O3DA 1WUNH 2GCHF 2XOKD 6GCHG 1GMCF 4BTTB 4GAWA 3Q3YA 4BAOB 4CR9A 1OPHB 5HMAA 4KGAA 3SYJA 1FNIA 2ZDVH 2B5TB 4X2VA 3GYMA 3SZEA 3DFLA 4Y0ZE 1GBLA 3E8LA 5DN6D 1Z8GA 1C5XB 1CGJE 1PPHE 1EZSC 2M5TA 3MO6A 3S9AA 5DP6A 3SO3A 2W7UA 3SQEE 5FBEA 4A1VA 2V3OH 3IWMA 9ESTA 3SU0A 1G2MA 2XTTB 6LPRA 2VGCC 1LHEH 2ANKH 4D7FA 1O3FA 1YP9A 1Y3WA 1UTQA 1XUIA 1YCPM 1NRPH 3RXHA 1S0QA 1ELGA 3DSOA 4WF8A 2FMJA 2CN0H 2PTNA 4TPIZ 1H1BA 2A4RA 3ATWA 3QZQA 3T26A 5DP9A 2BLOA 3MO9A 1TRYA 1S82A 1W0ZU 3ZVBA 5F8XA 1QFKH 4X0WU 3UTUH 1VJ9U 1ARCA 4UDWH 1ZRBA 1IQFA 1O2XA 5ETXA 3Q3KA 1GHYH 1MTSA 1ABJH 2HNTC 2FOHA 3PV5A 3GY3A 1O37A 2ZP0H 1O3AA 1L4DA 3H5CB 4TT3D 1RTLA 3M61U 1TMTH 3SNDA 1PJPA 2Y5GA 1QR3E 1F5KU 2C8YB 1NZQH 1EOLA 1GHBG 2RA0A 2STAE 2I6QA 2UUFB 5L30H 1JXPA 1ZTJA 3NZIA 3HGPA 1C2LA 1WTGH 3B23B 3CNRA 1HGTH 4CHAC 1ZR0A 1LQDB 2R0KA 2Z3EA 4ISIH 3NPSA 2SFAA 1GBEA 2B8OH 4JZFH 3ZZ6A 1GMHF 2XNDD 3N7DA 4AFSA 1IHTH 1TGTA 1AN1E 2ODYB 1GBHA 1FPHH 1SI5H 2LPRA 2WYGA 5FX5A 5EPYA 1LMWB 1UVSH 3EQ0H 4YOJA 3GY7A 1EXFA 3QTOH 2TIOA 3VB4A 1LO6A 4K1TA 1LHDH 1ELVA 1GCTC 1THRH 3LGWA 4I8LA 2FOAA 2F9VA 1ZRKA 2XWAA 2G52A 3GCHB 3TGKE 2OD3B 1OXGA 1MZDA 1SGCA 1EAXA 5DP7A 4JYVH 4GHQA 1ELFA 1G3EA 4B76A 1EOJA 1EPTB 2ZGXH 4IN2A 1BTYA 1NRSH 1OWKA 4DIHH 4AGKA 3A89A 1COWD 4NZQA 2J92A 4ABGA 4RSPA 1O2ZA 4Z1MD 4NFEA 2GX4A 5A09A 4JZDH 2A4GA 1NFUA 3VEQB 3GCHC 3MH4A 2ZC9H 4VGCB 1Q3XA 5F53A 3ZZCA 4B71A 3RXLA 2P95A 2KAIA 1FMGA 2BY7X 4X1PU 4ABBA 3UB0A 1RJXB 5JDUB 3Q77A 1EPTC 2Y82A 1O5GH 1RTFB 2PV9B 4DT4A 5G4BA 4NSVA 1QQUA 1P01A 1V2LT 2LP6A 3UQVA 3SV8A 4UFFH 1C5OH 1O3KA 2Y6TA 1C5NH 2GZ7A 1YKTA 2ZZUH 1GBMA 2J2UA 4GHTA 2AHME 1Z8RA 4BXSA 3MTYA 4OS1A 3UIRA 2K1QA 3E90B 1T8OA 2ZFQH 1MBMA 4K69A 6CHAB 3FN8A 1SMFE 2PGBB 3VB5A 1O32A 2L6OA 2J4IA 2FO9A 2KCAA 1B5GH 2JH5D 2QF5A 3PLPA 1LTOA 2ANYA 4RI0A 2R0LA 2ZU2A 3AASA 4AFZA 3TK9A 1RS0A 1TALA 1TABE 2HNTF 4K8YA 2F9BH 5HYOA 4B2CA 4IMZA 1C1SA 1J15A 1XUFA 3ZV8A 1Z6EA 1P2NA 2C93B 5T3HA 3A7YA 4Z0KA 2BXUH 1O3GA 3RXKA 1Z71A 2A7JA 4GUXA 3LC5A 4WMDA 3SJOA 3KYFA 3RMLH 2ZHQH 1BTHH 3K9XB 3LOXA 3A8CA 5FCKA 4Q7XA 3RMOH 2QXIA 4HFPB 2J9NA 1NU9A 4X6OA 4ZXYH 1GJ8B 2SNVA 1TRNA 4FVDA 3W1EA 2H9EH 1CBWB 3ZVDA 1SHYA 5ESTE 3RC6A 1XUKA 4ZKNU 3P8FA 1O5BB 1AHTH 1PQ7A 5EIYA 1BBRK 7GCHF 1A5IA 1YGCH 3P17H 3TJVA 4J2YB 1Y3VA 2UWOA 3Q00A 1Z6JH 5FPYA 1H9HE 1OWHA 1ZSJA 2IPQX 3RXUA 2G8TA 4ISHH 5GXPA 3URDA 4INHA 1V2KT 2SGDE 4YTAA 1V2UT 4WVPE 2FS8A 3K2UA 1KXDA 3FZZA 1Z1JA 3AAVA 1MAXA 1CBWC 4D7GA 5K7RA 3HK3B 1GG6C 2YMSD 1BA8B 2P3UB 6ESTA 1ZJDA 1F0TA 1O2NA 3CP7A 3PTBA 1KXAA 1THPB 1D3DB 5E0GA 2R2WU 3U98H 2VIOA 5C1XA 3SV6A 1OHHD 1YPEH 1AVGH 2Z9IA 3Q3XA 1P09A 4A92A 1EATA 5E0JA 4INKA 3NXPA 5C94A 1FAKH 1BITA 1O3MA 3GOVB 1NRQH 2FYRA 2VNTA 2G4TA 3A8DA 4HZHA 3A7TA 1ETSH 4DG4A 2A45B 1GGDC 1FN6A 1PPGE 2OK5A 2RG3A 4MPXA 3UR6A 2V35A 2BQ7B 4Y7BA 4DW2U 2ZIQH 4IC6A 4AORA 1QCPA 5GCHF 1ACBE 1Y5AT 2RCEA 1MKXH 1UCYE 2Y7ZA 4OS2A 3E6PH 3U8RH 1XX9A 2VWOA 2ULLA 5LH8A 3H09A 3GCOA 2B0FA 3AK5A 2WPIS 1GJCB 1OS8A 2BVRH 3W95A 1C5SA 1KXBA 1H8HD 1K1JA 4WXIA 1UTJA 1C4V2 2SGPE 3TJUA 2QXHA 3KNXA 3ENSB 3V0XA 2WINI 1GI2A 3KEEA 1KXFA 1EZXC 4BXWA 2IJD1 1G9IE 5TCAA 3PROA 4AG1A 1SPJA 5HIYA 3PMHB 4Z6AH 3ZVCA 4GSOA 1DE7H 1HPGA 1Y3UA 2ZDNA 1BUIA 1FPCH 2D8WA 5GDSH 1VCQA 2QAAA 1NY22 1DWDH 1ZMLA 3M7UA 4YT6H 1QA7A 1KLTA 2ZHWH 1P02A 3ZYEA 3VB3A 1UVOA 2A4QA 1ZHRA 4M7GA 4O9VA 3LGUA 3D62A 4KELA 4MTBA 3QDZB 1C4Y2 1BQYA 3EE7A 3H7OA 1O33A 2AS9A 1BRBE 5L2ZH 2ZKSA 4LZ1H 1D6RA 3GY6A 4BAQB 3ZZ4A 1SQRA 2PWXA 3FP8E 2Q6GA 1Y5UT 4FUBA 3E0NB 3RXPA 3PRDA 2J98B 3SGAE 3GY2A 5HIZA 1FY8E 3PRBA 4SGBE 3E16B 4JCNA 1FIWA 3ZYDA 1UHBA 3PWBA 2WV5A 2ZGBH 1TNHA 2O8LA 3PWCA 4TWYA 1C1MA 1EJNA 1P3EA 1BTXA 1UVPA 3SOSA 3SUFA 3KHVA 2Z9JA 5GJ4B 1LQEA 1HV7A 2GMTB 1JRSA 1QIXB 1CT0E 3DFJA 4SGAE 1OWDA 4Y79A 3ZZAA 2WUBA 3RXJA 1KDQA 1K1PA 1N6XA 1P04A 1WQVH 4ZKOU 1AKSB 2ZWLH 3PV2A 2WPKS 3DD2H 2ODPA 1DLKB 3E1XB 4CRAA 4O03A 4DJZB 1FZZA 4GLYA 3SUDA 5A8ZA 2BOHB 2QC2A 3M37A 1C1OA 5JBBS 1DXPA 4CRFA 4O97A 1N6YA 4NA9H 4AYYB 1QHRB 2JETB 1O2SA 5EXLA 1E37B 3SV9A 2GMTC 1MUEB 1EB1H 1C5TA 3RU4T 1TBRH 2ZCKP 3FP6E 3GCTF 1CA8B 3A86A 2XWBI 1Z7KA 4YLQH 2ZU5A 5EQSA 3P8OA 5LPFA 2EQNA 3RC4A 4BTIB 1SGEE 2YMSC 4JYUH 1DSUA 3MH5A 1BTZA 3TH4H 1CHOG 5KEDA 1C2JA 4MG3A 1TNIA 2ALVA 1BMLA 1SGTA 1E38B 4O3UA 1NFXA 3SU5A 2OC7A 4B6FA 4DVAU 4CRBA 1NBME 5C17A 1A7SA 5C20A 3RXCA 1EAIA 2P59A 5T6GA 2OTVA 3BTKE 3RXDA 1J16A 2XCNA 3KQ5A 1TX6A 1E36B 3M5MA 3TVJB 1V2TT 4WH8A 1A4WH 1AO5A 3FO8D 1GBJA 4ZHAA 3GY8A 2J5UA 4ZMAH 3QN7A 3PMBB 2Z9GA 5IYTA 2O9QA 4X6NA 4ZH8A 2JIZD 2ZFRH 2BDGA 1MTNB 4Y7AA 3WWBA 1O2TA 1YPHC 2FX4A 5DO4H 1NM6A 3FP7E 5DP8A 3SU3A 1TBZH 4B2AA 4FUFA 5FAHA 1MQ5A 2ZDKA 3PB1E 3K6YA 4RT1A 3F0PA 1UJ1A 5FBIA 1HAPH 3RM2H 3LGVA 1DUEA 3TNTA 3QGNB 4DY7B 3O8DA 3RLYH 1S6HA 1HJAC 1A3EH 1SGYE 5BPEA 3RDZA 2C3SA 2FYQA 1PYTD 3FAOA 3JZ1B 1SG8B 1MTNC 3BTWE 2HRVA 4TY7A 2A5AA 4FUCA 4AOQA 1GI7B 3S69A 8GCHF 2A31A 4IS5A 3RXFA 1C2DA 1QJ7B 3CS0A 4HTCH 4NIWA 1SHHB 1F5LA 1J14A 2P8OB 2ZO3H 2M2AA 1TGBA 1LVYA 3ATKA 3QK1A 3K6ZA 5EGMA 3SJIA 1O2KA 2WUCA 2A7CA 2EI8A 1KMHB 4BAHB 1O2VA 3RU4D 2ZGJA 2A32A 4K1SA 1DWBH 1G36A 1AI8H 5T6FA 1MKWK 4WWYA 4ZXXH 1QB9A 2W3IA 3IG6B 3BSQA 4IC5A 3A84A 2FP7B 1S5SA 1P05A 1RIWB 1T7CA 2NU3E 3A83A 4ASUD 1A0HB 3MU4A 2P8OC 1YLCA 1AWFH 1P2IA 1IHSH 2C8ZB 2V3MA 5A2MH 1F0RA 2AGGX 3BN9A 1B0EA 2ILNA 4NCYA 1NFWA 1ID5H 2WYJA 2XBYA 4XBBA 2FPZA 2PSXA 4NA8A 2XNIA 5JBAS 3KQDA 1GBAA 1FJSA 2ZFTA 2FI5E 2STBE 1Q31A 4OS7A 3TLOA 4NIXA 1WSSH 3MNBA 1O2IA 1UMAH 2GP9B 5H4IB 1BJVA 1RIWC 2FOBA 3RC5A 4GCHF 1C2FA 2BD7A 1SGNE 3A81A 2VGCB 1KYNA 1ZPBA 1ZPZA 3KN2A 4DT7B 1RTKA 1VCWA 3TITA 1C2KA 2O8TA 2OUAA 1EJAA 1Y8TA 2C8XB 1SGFG 3FKSD 3N7OA 3SJKA 3EA7A 3KGPA 2OQUA 1UTLM 2JH6D 4FETA 3GICB 3O8BA 2NU1E 2QN5T 2VVCA 3FANA 2ZHFH 4IW4E 4J1YA 4ISLA 1UK3A 1H9IE 3RLWH 4F55A 3G01A 3RXVA 4WMEA 1TGNA 1ZMJA 2H1UA 1DY8A 3MH6A 4AB8A 1WV7H 4U01A 4B6EA 1BMNH 1C1TA 1C1VH 4Y0YE 3QWCH 2F9NA 1DOJA 2VIQA 4NG9H 1GBBA 1OOKB 4CRGA 3S7HB 3S9CA 1GI5A 1O2YA 1XVMA 1C1NA 2BLWA 1DDJA 1N1LA 1O5EH 1QBOA 1SLVB 1UW7A 3MHWU 4NGAH 1HJ9A 4A1XA 1A46H 1YCPH 1P9UA 4CHAB 3TJOA 2FLBH 1SLXB 3OTJE 4ABEA 2BY9X 1G3DA 3ZZDA 1GWAA 4ZHMU 1TQ0B 1GDUA 2CJIA 3ODDA 1SSXA 1YPHE 2IN2A 1V2PT 1BRUP 3H7TA 5A0AE 1O5CB 2BXTH
chains in the Genus database with same CATH topology
3RXMA 5A0BA 2ZFSA 1EQ9A 3A7ZA 3SU6A 3UUZA 1CT2E 1DPOA 1OWJA 2P3TB 4AB9A 1QA0A 1VITG 2QXGA 1O2HA 1C5RA 4YO9A 3GDUA 1GCTB 3RM0H 1C4U2 3SN8A 1GPZA 4UEHH 1P2JA 3FZDA 2R2MB 3F1SB 4HGCA 5C67A 5F6MA 5IDKA 2AEIH 1GMDF 4K3JA 1HNEE 3UOPA 3MYWA 5L2YH 1GBDA 2QYIA 1C1WH 4ASHA 1QL9A 2UWLA 1AE8H 3HPTB 2QGRA 1JWTA 2ZQ2A 1UK4A 4K8BA 1GHWH 2TPIZ 1W0YH 1O3LA 1W3CA 1N8OB 1C9TA 3MI4A 1P03A 3A8BA 3OU0A 1IAUA 1P2QA 1SQTA 2J94A 1TOMH 1QB6A 1HXFH 4CR5A 3JZ2B 3MO3A 3TGIE 1SFQB 1AVXA 1FIZA 4IMQA 1P2OA 2Y5HA 1TOCB 4D76A 2VIDA 7KMEH 1ABIH 3DHKH 2TGAA 1BJUA 2VINA 1A61H 1FLEE 3M5NA 1P57B 3GY5A 2TGTA 1OKXA 4B74A 4NWKA 3MNXA 2BX4A 1LVOA 1CQQA 3D65E 1N8OC 2XXLA 1W13U 3KCGH 2DUCA 1G30B 2CV3A 1P06A 1NO9H 1NU7B 3MMGA 1G3CA 1VITH 1FI8A 2SGAA 5ABWA 1ESAA 2Z9KA 3A85A 1LPZB 4YT7H 2ZU3A 1CO7E 4I31A 5AF9H 3S9BA 1E0FD 1FY3A 2OP9A 3LJJA 5EU8A 3P70B 3ATMA 1JIMA 4X8VH 4AFUA 4K2YA 2GCTC 3LC3A 1P12E 1XXFA 3ODFA 4RKOB 5LPRA 2GTBA 3P8GA 3UNRA 3E0PB 2HOBA 1CA0C 1AFEH 2P93A 4H6SB 1UCYH 3SGQE 2PFEA 1QL7A 1TX7A 6GCHF 1GJDB 3NKKA 1GBTA 1LPKB 1NESE 1O3CA 3GDVA 1HFDA 1CVWH 1ZTLA 1C1QA 3NCLA 4NA7A 1UK2A 1MD8A 1OP2A 1DXWA 2VIVA 2AH4X 2DE9A 4E06H 2BD3A 2FM2A 1GHAG 2W7SA 3RXIA 1SGFA 2ESTE 4X8UH 2D1JA 2XYAA 1ZYOA 3BEUA 2BQ6B 3KQEA 3PYHA 1BB0B 2VH0A 5TJXA 3SNBA 2A1DB 1V6DA 1AMHA 1C2MA 1G32B 1F0SA 2HGTH 1UTKA 3SHCH 2ZFFH 2FESH 4GVUA 1GHZA 1S81A 3I29A 4OGXA 2QY0B 1C5UA 1Y3YA 3A82A 2VWLA 1MZAA 1BTUA 2HNTE 5EQRA 3BG4C 1O2WA 1IQJA 3A80A 1TWXB 1OWEA 1TA6A 1FUJA 2AIPA 5EG4A 1DITH 1GG6B 2Y80A 5FPTA 3SV7A 3SZNA 3P92A 2FTLE 3NK8A 1MTVA 3DA9B 4HI3A 1ANEA 4O3TA 4CRDA 4H4FA 1GI1A 3LGYA 4THNH 4DGJA 2HPPH 4YLUA 1YBWA 4ZAEA 1FY5A 1HYLA 5F8TA 1KY9A 3ATIA 1EP5A 1ZSLA 5JB8S 1BBRH 1C2EA 3QZRA 3A7WA 1S85A 1GHBF 1SL3A 1GGDB 2OBOA 2UUYA 3R3GB 2HPQH 1XXDA 2GT7A 2BDBA 1TNJA 2GGVB 3UR9A 2H2ZA 3LH1A 4JZEH 4QT8C 1PFXC 4UFEH 4D9QA 4RN6A 1BRCE 1EKBB 1SR5C 1PPZA 2P16A 3SUEA 4LOYH 3TNSA 2TBSA 2Q6DA 2EC9H 4AG2A 4JMYA 1DWCH 1DUAA 1LCYA 4U2WA 2OC8A 1MU6B 3Q76A 3QTVH 1EJMA 2YNAA 1NS3A 2OQ5A 1IQKA 1C5VA 3LDXH 1TRMA 2SGFE 2VWMA 3BIVH 1GJAB 2BZAA 2XW9A 3SNEA 2Y5FA 2ZDMA 4DOQA 1K28D 3EAJA 4IGDA 4I8GA 2NU2E 3ZZ7A 2BD8A 1TNGA 3TJNA 3M5LA 5C1YA 1MKXK 3IITA 2G55A 2GV7A 1CT4E 2ZA5A 2V6NA 4IBLH 1FV9A 3FVFB 3TGJE 1CGIE 2WPHS 5CHAB 2THFB 2ZGCA 1IQGA 1HAVA 1T4UH 1NRRH 4TYDA 5EOKA 1CSOE 4JK6A 1M9UA 3LKWA 1GI4A 1UVTH 5ESBA 2BY6X 1O3NA 2ZU4A 1S6FA 2Z94A 1T8MA 3EE0B 1YPKH 3LONA 4X8SH 1QNJA 1C5MD 2BVXH 1P10A 1QRWA 1FN8A 2BHGA 1P3CA 2C8WB 3SJ9A 2ZHDA 1LHFH 1P9SA 2QIQA 5CHAC 3QO6A 1JOUB 2G5VA 2Z7FE 2O8UA 2ZEBA 1HAOH 1AY6H 2CMYA 1NT1A 1TONA 1O2UA 1LKAA 8GCHG 1F0UA 1O3BA 1K1IA 1W8BH 4WH6A 1LVMA 5EW1H 5L6NH 4CRCA 2GVFA 1YPGH 1S84A 3PMJA 1AU8A 1HAGE 1HAXB 5C2ZA 1BBRE 4CREA 1C2HA 1ORFA 4FUJA 1FQ3A 1VJAU 3SNCA 3ZZBA 4BNRA 1ESBA 3AW1A 3ZVGA 1O3OA 2Y7XA 1GJ4H 2BQWB 5AFYH 1AFQB 4WXVA 1BTWA 3B9FH 3RXEA 1GI6A 1VGCC 4I8HA 1DSTA 1DX5M 3LIWA 3FFGA 1L1NA 1O36A 4Y8ZA 1K1MA 2J38A 4E05H 1PQ8A 1O34A 2QF0A 3S7KB 4K1EA 4BAKB 1QRXA 1AB9B 1O5AB 5T6DA 1TBQH 4YOGA 1H8IH 2BLVA 1TGSZ 4JZIA 1K9OE 4ZUHA 4XOJA 7ESTE 1Z1IA 1AFQC 2P3FH 1BTPA 3U1JB 3DUXH 1YF4A 1Y5BT 3MU5A 1MD7A 4NIYA 1SGRE 1TGCA 2GCHG 2ZHEH 1GMCG 3NUMA 4X2WA 4A6LA 3M3TA 1H4WA 2F91A 1EZUC 1O39A 5TCCA 3VXEH 1FY4A 1J9CH 1MQ6A 1V2MT 3T5FH 1GL1A 1LPGB 1V2JT 2GDDA 3L33A 1AB9C 2PHBA 4AYVB 2H6MA 1VR1H 2VIWA 2PUXB 5E0HA 1FDPA 1C5WB 2IPHA 3RUOA 2PKAA 3RXQA 5K0HA 2ZI2H 2PSYA 1ZZZA 2GZ8A 1KLIH 1RD3B 4BTUB 1XKAC 2UUJB 1T8NA 1O30A 3TU7H 3VB6A 2NU0E 3MOCA 4MNWA 3T27A 5CE1A 1WU1A 3BIUH 1ZGIA 7LPRA 3SU4A 1MTUA 1W7GH 2Y81A 1GL0E 1P8VC 1HJAB 1V2OT 1O2JA 3RXTA 4LXBH 1RGQA 2GZ9A 4KP0A 1L1JA 1YPLH 1KXCA 5F03A 1MAYA 2BD9A 2BX3A 2FX6A 3EYDA 1CGHA 2D2DA 1O3PB 1GDQA 2ZDLA 2PKSB 4B1TA 5JBTA 4H42U 1OYQA 2V0BA 4MQAA 3F6UH 1BRAA 1FXYA 1BDAA 1A0LA 1LDTT 4Q7ZA 2W5EA 1VCPA 1JBUH 5HM9A 1G37A 3UFAA 4MLFB 1DY9A 1DS2E 3LGTA 2WPJS 1V2NT 1GMHG 2GV6A 2FEQH 3LH3A 1QY6A 1YC0A 3D49H 1BMAA 4KTCA 1ZOMA 2FS9A 2BMGB 2ZF0H 2PKSC 1MCVA 5A8XA 4YM9A 2VVUA 1T8LA 3MWIU 2OBQA 1TAWA 1Y3XA 4MVNA 2B9LA 1LHGH 3PTNA 1UVUH 2BDIA 1BIOA 3BF6H 2VB0A 2CF8H 2EA3A 2Z3DA 1L0ZA 1A3BH 4PROA 1GDNA 1ZHPA 3BTGE 4BAMB 2C4FH 4FU8A 2RA3A 4K5ZA 5C3NA 2A2QH 1LHCH 2JKHA 2BDHA 5DG6A 3SQHE 5DKMA 1INCA 1Y59T 1BOQA 1HAIH 3PLBA 3ITIA 1D3PB 1QL8A 3CENA 4JZ1A 2AERH 2CHAB 2QA9E 1SLWB 1BCUH 5JBCS 5C1UA 1FAXA 1EB2A 1MKWH 1GJ5H 3W94A 4MNYA 4Y8YA 1AGJA 1W11U 2G00A 2QV1A 1ELCA 2C90B 1BHXF 1ANBA 2PUQH 2XC0A 1QGFA 3LPRA 4UD9H 1YYY1 3OX7U 2KAIB 3C1KA 2ZCHP 1ELAA 2IOTA 1XUGA 3GYLB 1QTFA 2P94A 4ISOA 3SV2H 2QXJA 1HAYB 4TPYA 1BMMH 1P0SH 4FUDA 1OP0A 2W3KA 3MU1A 5DP4A 2CHAC 4Q2KA 2UUKB 4DCDA 5DJ7A 1P11E 1Z8JB 2ZPRA 1HIAA 4B75A 5FCRA 3WY8A 5EW2H 5FXLA 2BDCA 1QJ1B 3V3MA 1GBIA 4NSYA 4NWLA 2H9HA 3O8CA 1IOEA 1V2QT 2A4OA 4XFQA 3VXFH 1AKSA 1EZQA 2BDAA 3C27B 2HWLB 1AIXH 1K22H 2BYAX 3UNQA 1SLUB 1EAWA 4DURA 4F4OC 1BZXE 1QQ4A 3M7QA 2ZECA 2ZTZA 1ESTA 4XDEA 2RDLA 3RP2A 1CHOF 1V2VT 1D4PB 1QRZA 2AIQA 4H6TA 1UTPA 2VH6A 1GCDA 4Y8XA 2V3HH 1JIRA 4DIIH 2XRCA 2ZDAH 4F49A 1WYKA 2CF9H 2F9UA 4OS6A 1SGQE 2B7DH 4MPUA 1YCPK 4X8TH 4X1QU 1W12U 2BVSH 1D3QB 2WPLS 5EQQA 5JYIA 1L1GA 3M3SA 2AMPA 1ELTA 3PV4A 4D8NA 1WCZA 1LVBA 2OXSA 1TPPA 2BZ6H 2R3UA 5FHTA 1SQAA 2XC5A 1GI8B 1NFYA 3SUGA 3U69H 1H9LB 2D26C 3UNSA 5HM2A 7GCHG 9LPRA 5LPEA 1T31A 2OLGA 2BLQA 3OSYA 2BD5A 3HKIB 3ZVAA 5GIBA 3SBKA 3F68H 1MBQA 1U6QA 2DE8A 1DFPA 2VU8E 1F5RA 1QBNA 3UWIA 4ABAA 1GVZA 1PYTC 2O8MA 3AAUA 4FUEA 3F9EA 3HATH 4Y10E 4JYTA 3VFEA 3D23A 3KQCA 4FU7A 1AE5A 4Y11E 3QLPH 1SGPE 4XE4A 1P2MA 4WJG2 3RXBA 2BM2A 3HKJB 2XBVA 5EPNA 1QJ6B 1H8DH 2ZU1A 2Z3CA 1EAUA 3UOUA 1F92A 1TQ7B 1V2ST 3LU9B 3HK6B 4B2BA 4ABHA 2CXVA 1O35A 3KF2A 2XC4A 2H5CA 2O8WA 1BT7A 1O3EA 1ZPCA 2R3YA 1PPFE 3EDXB 3CS7A 4OS4A 3QX5H 2GT8A 1WAYB 4UFGH 5I25A 2QCYA 1S83A 2OC1A 5GCHG 5C5NA 3BTHE 2NU4E 3P95A 3SJ8A 2GCTB 1TE0A 2OC0A 1AD8H 1DANH 4MPWA 5LGOA 3RXSA 2I6SA 3OYPA 1CA0B 1O5DH 1HAVB 1MU8B 3KIDU 2WV4A 1TNLA 5J4SA 5JPMH 1IQEA 1OX1A 1W2KH 2JH0D 1O0DH 1TB6H 2ANWA 3U8OH 2NWNA 2ASUB 4XSKU 2Z6BD 1C5LH 5C5OA 3QGJA 4BANB 1YPJH 2IJOB 1HDTH 2BY5X 2AFQB 1GBFA 3UWJH 3TK5A 2BY8X 1WOFA 3LT3A 3BEIB 4UE7H 1UCYK 1K1OA 4E7NA 1TX8A 2QF3A 1KSNA 8LPRA 1HAZB 2BTCE 1OWIA 4VGCC 1GBKA 1KTTB 2H5DA 3BG4B 3BTEE 1NPMA 4FUIA 1PQAA 1UO6A 2HLCA 2FOCA 2H9TH 1IQNA 1W14U 5GWZA 1UHBB 3ELAH 2G51A 1HXEH 3MH7A 1O2RA 3KL6A 3AW0A 3M3VA 4I7YH 2A5IA 4AFQA 1TYNA 2AGIX 4X6MA 1IQMA 2SGEE 1XM1A 3V13A 3URCA 2PLXA 2OINA 3M36A 3VPKA 1GVKB 3MNCA 1TA2A 6CHAC 3RMMH 3ZZ3A 3U9AH 4FVBA 4TWWA 1CE5A 1SOZA 1TMBH 3SHAH 3TH3H 1KDQB 4A1TA 1A5HA 1TPOA 2EI6A 1C5QA 5EXMA 4B73A 4NZLA 1RXPA 3E91A 4X2XA 3MU8A 4KKDA 5HGGA 2ZPSA 3EA8A 1ETRH 2YNBA 5EXNA 5FPSA 1ZMNA 1X7AC 4OGYA 1IQIA 2A5KA 1FY1A 3T2NA 4R8TB 2ZGHA 3E3TA 1VITF 5I46H 3SGBE 2YOLA 4U32A 4R0IA 3M5OA 2ZTXA 2GKVE 1PPBH 1MTWA 2VJ1A 4KTUA 3GCTG 1Q2WA 1YPMH 1CHGA 1E34B 3P6ZB 3PLKA 1ZSKA 2PKAB 3I77A 5PTPA 1EASA 3OY5U 1HUTH 3L6PA 1HBTH 3P8NA 3RXOA 4ZKSU 1O2GH 3V12A 5A0CA 1NTPA 1RFNA 1A1RA 2ZCLP 1C2IA 1JMOH 1KTSB 4I32A 3STIA 3BTDE 3EGKH 1HCGA 3RU4E 1DVAH 2XCFA 1NROH 3B8JA 2PW8H 3LGIA 5CMXH 2ZTYA 1HB0B 1SGDE 1XMNB 3LJOA 4JK5A 1GI3A 1GHVH 3UPEA 4Q80A 4I8JA 1L2EA 1YLDA 3F9FA 2F9OA 4X1NU 3MNSA 1DT2A 1JRTA 4XBCA 2PGQB 2ODQA 1S0RA 3M7TA 1J17T 1AUJA 1D3TB 5AHGH 1EPTA 1F7ZA 2GDEH 1G2LA 4Y71A 1ZHMA 4WY3A 2FLRH 2G5NA 1E35B 1W7XH 1A5GH 3QUMP 4KTSA 1GBCA 1SB1H 3V7TA 1MH0A 1EP6A 1HAHH 2J34A 1PPCE 4INLA 1EUFA 1K1LA 1WTHD 4ABFA 4Y6DA 1Z8IB 3PO1B 3GY4A 1MCTA 1OSSA 1TLDA 5DPAA 3L3TA 1RRKA 3DT0H 2LNCA 3TIUA 1O31A 3AVZA 4AZ2B 4IN1A 1O2MA 4GPGA 1VGCB 1ELBA 2BB4A 3ESTA 3U8TH 1THSH 1C1UH 4X2YA 3SORA 1GI0A 5A8YA 3A8AA 1IQHA 1QB1A 3KQBA 2CGAA 3K65B 4ABIA 1SGIB 1SBWA 1GHAF 3RMNH 5J4QA 1O3IA 3PO1C 2J95A 1VZQH 1SVPA 2FODA 1C1PA 2VWNA 1K1NA 1GVLA 3I78A 1O5FH 4CH2B 3ZZ8A 3BTME 5AFZH 2FOMB 1ELDE 5E2OA 1ANCA 2F3CE 2VIPA 3BTTE 3T25A 1GJ6A 3VGCB 3UQOA 4Q7YA 1BHXB 1C5YB 4I8KA 1KLJH 1XVOA 1TFXA 1QBVH 4UFDH 4WMFA 3PMAB 2HVXA