1WCZA

Crystal structure of an alkaline form of v8 protease from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
215
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEATGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an alkaline form of v8 protease from Staphylococcus aureus
rcsb
molecule tags Hydrolase
molecule keywords Glutamyl endopeptidase
total genus 58
structure length 215
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA02
2UUYA 1THSH 4YLUA 4THNH 1MQ6A 1Y3WA 3SU2A 2OC8A 4QT8C 1LPZB 1SGYE 1O2VA 3UUZA 5A09A 1V2RT 1TNIA 1XUFA 2SGEE 2H5DA 3WY8A 4O97A 3T26A 1IHTH 1MZDA 4Y76A 3UFAA 1WTHD 3RXRA 3ZZAA 2QXGA 1ELFA 1V2NT 2ZHFH 1QNJA 5FX5A 1DWCH 1KXAA 1OXGA 4XSKU 3U1IB 1GGDB 3LPRA 3U98H 1T8NA 2V3OH 1UCYE 1ZTLA 1EX3A 4R8TB 2TGAA 1GI2A 2OBOA 4UFEH 1ZJDA 4FU9A 1J9CH 1F5LA 4FXGH 3SUGA 1YYY1 2BVSH 1C5ZB 3BTEE 1OWJA 2FXRA 3UY9A 2VIWA 1GPZA 4ZAEA 2PKAB 4BTTB 1MBQA 3VB6A 1K21H 1IQIA 4CRGA 2FTMA 2GZ9A 4CRBA 2FOHA 2W26A 3C1KA 4YOIA 2ZIQH 3CS0A 1S0QA 3SZNA 1VGCB 3EA8A 2A0QB 1QJ7B 5B6OA 3RXVA 3GY8A 1A0JA 1YF4A 3AAVA 5FPTA 5E0JA 1O2OA 3H7TA 4MPVA 3RC5A 1TBZH 1GBAA 1TNHA 2BY9X 5C3NA 1MMJN 2UUKB 4WF8A 4SGBE 3V7TA 4F49A 2OINA 3E1XB 1P12E 2BOKA 1TPSA 1Y5UT 1HJ9A 5LGOA 4UDWH 3L33A 4U2WA 4ISLA 3VXEH 3M5NA 1EJNA 1C5LH 1C9TA 3RLYH 1OP0A 8GCHG 2QN5T 5EOKA 2HOBA 3GCNA 1GJ4H 4AGKA 1NO9H 4BNRA 1MD7A 4JZDH 1FAXA 1HXFH 1AO5A 3ZZDA 4H6SB 3Q3XA 1ZGIA 1NM6A 5JB9S 1OWEA 1ELEE 1JXPA 1MU8B 2FOBA 4M7GA 5A8ZA 1N1LA 3H7OA 1EKBB 5DP8A 3DA9B 4DG4A 1BA8B 2JH6D 5FHTA 4K60A 2QA9E 1G37A 2BZAA 5F8ZA 3ZZ6A 2WINI 1ANBA 3PWCA 5I46H 1VCWA 2ZQ1A 2PR3A 3RXKA 3A7ZA 4I8JA 3P8OA 3DD2H 1GDNA 1CA0C 3NUMA 1O3JA 2Y7ZA 1CGJE 1HAOH 1Z1JA 2W7UA 5EODA 1P06A 1MTSA 5ESBA 4GHQA 4DY7B 2WV5A 1SVPA 1G3CA 1O5DH 3OY5U 1TMTH 1O2SA 2XBVA 1BTWA 3ZV9A 3HKJB 3VXFH 1W8BH 5DK1A 2LNCA 4IS5A 2ZU5A 1Z6EA 1MD8A 3UPEA 1FN8A 3TIUA 3STJA 4Y0YE 4D9RA 2OD3B 2H5CA 4YT6H 5C1UA 4X8UH 2RDLA 5EU8A 2F9UA 4O03A 1O3DA 3M5LA 3Q3KA 3C27B 2ZDLA 1TQ7B 2JETB 1AD8H 2NU0E 3EA9A 1V2JT 1BTHH 3ZVGA 1O3IA 1JMOH 4NFEA 1MKXK 2TRMA 4ABJA 1NRQH 3ZZ7A 1O2YA 1B0EA 1SG8B 3A7YA 2G8TA 4YESB 1FY1A 2GMTC 3SQHE 4AORA 3A86A 5HM9A 1BRUP 3LGWA 1FPHH 3MTYA 4WXIA 5LH8A 5FPSA 3ZZ5A 3SU0A 2QXJA 1H8DH 1GI1A 2OTVA 1THPB 1TNKA 1H9IE 3UNQA 1GL0E 2J9NA 2M5TA 3SU1A 4AG1A 2UWOA 2KAIA 1ZOMA 3DHKH 1GMHF 1QY6A 1XUJA 3RC6A 1WQVH 1DX5M 5EGMA 5JB8S 4Y11E 3RXMA 2VNTA 3L6PA 7GCHG 1O3BA 2BLOA 1T4UH 1BJVA 2XXLA 2Z9JA 5LPFA 5T3HA 1MUEB 1HAYB 1YBWA 3STIA 2FX6A 3VEQB 3VGCC 1SOTA 2A7HA 1TABE 4ZXYH 3GY6A 4I32A 4A7IB 4FUHA 7KMEH 1DWDH 2CJIA 4OGXA 1WUNH 1MKXH 2BQ6B 1C9PA 3BTTE 1K1OA 1JIRA 1GBIA 2GDEH 1Z6JH 1AI8H 5E0HA 1NY22 1PPFE 2QXHA 1EAXA 2FP7B 5T6DA 2J94A 1O39A 5FXLA 3KQEA 1DITH 1UK3A 3KF2A 3UWJH 4RN6A 1C2GA 3TPIZ 2VGCB 1P9UA 3M35A 4K5ZA 3RP2A 1P2KA 2VIDA 1G36A 4GUXA 1XUHA 3A83A 1LCYA 1W0YH 6ESTA 2PUQH 2VVCA 3AASA 2BHGA 1AY6H 2G52A 1T4VH 4FU7A 4NSVA 2Y7XA 2R0KA 4TY7A 1C2FA 1IQFA 2ZDMA 3MO3A 1O3CA 1AKSA 5EXMA 1SLUB 1VGCC 4JK5A 1P2NA 1CA0B 2P3FH 2YNBA 5BRRE 2BXTH 4F4OC 2BM2A 3DFLA 3FFGA 4X2WA 1ZHMA 4NIXA 2NU2E 1HJAB 1F0RA 1C5YB 1BIOA 1Y3XA 3O8RA 2OCVB 1ID5H 3ESTA 2VWMA 1HIAA 4KKDA 2WYGA 2UWLA 4H42U 3RXUA 2FTLE 3HGNA 2STAE 2QY0B 1O3FA 1V2WT 3K9XB 1SGIB 2ZKSA 3ZVDA 1C2KA 1DWBH 2AS9A 4NZLA 3SV8A 2B9LA 1QHRB 2ZO3H 4FUFA 3MH6A 2FS9A 4AFQA 5TJXA 1MTWA 1ETSH 2ZFTA 3TH4H 5FCKA 1FNIA 4PROA 1VITG 7LPRA 1FI8A 1TX8A 1OX1A 3P92A 3RXFA 2FODA 3BF6H 2VWOA 5TCAA 1LO6A 3GOVB 1BRBE 2WYJA 1AHTH 4XOJA 3E90B 4CRAA 1EZUC 1ZMNA 2BTCE 4CREA 4RKOB 1O2WA 2CV3A 2O8TA 2OQUA 4ZHMU 3AW0A 2OC1A 1FV9A 5EW2H 1S83A 2BDBA 5L30H 1TGTA 1TNGA 3KQDA 1EATA 1O3MA 1KLJH 2BDCA 3KNXA 1H9LB 3KHVA 2BXUH 1GI3A 2ZQ2A 3TK6A 1SLWB 3GDUA 5C67A 4ZUHA 3LT3A 1P9SA 4OS7A 3SU4A 2AH4X 1IAUA 3OY6U 3GY5A 3BG8A 1GVLA 3KGPA 1GHVH 3U8TH 2Z3DA 3BV9B 3SGQE 1ARBA 2C4FH 2R3UA 4BOHA 1HPGA 1UTLM 2CN0H 2XNIA 1BTXA 2EC9H 2GCHF 4U30A 3SNAA 1BOQA 1TONA 3M7QA 3UQOA 3SQEE 1YPGH 1HAZB 1GBCA 2DE8A 1A0HB 1ZSKA 4XDEA 1HAGE 3IWMA 5G4BA 3TNTA 4FUDA 3OTJE 1LHEH 3SU6A 4AFZA 2WPIS 1FUJA 2A4RA 1DOJA 1O0DH 4CRDA 1EPTB 3RXCA 3LJJA 2FI4E 2AGEX 5GIBA 2STBE 1D3TB 1QB9A 2I6SA 3M37A 4GLYA 1O2LA 4X6MA 4FUIA 1FN6A 1ZHRA 1K1IA 4Y8ZA 1PQ8A 2HWLB 4H6TA 1QGFA 1GBKA 4OS2A 3U69H 1NTPA 2ZDAH 4BAHB 1QB6A 1SHHB 5ABWA 5EW1H 2HLCA 1THRH 2WPLS 3KQCA 2NWNA 4K8BA 1O2UA 4X2YA 1BMNH 1P0SH 4MTBA 1C2HA 5AFYH 1AIXH 1N6XA 3TJUA 4E05H 3F1SB 4ASHA 3I29A 1CGHA 4CRCA 2PWXA 1NPMA 4I33A 5ESTE 1ZHPA 3A8CA 2VVUA 3G01A 1FQ3A 2WPMS 1GMCG 1OS8A 1AVXA 1GHAF 1HCGA 3F9GA 4WVPE 1N8OB 1PQ5A 1OWKA 5LPRA 4HTCH 1YGCH 1P05A 4U32A 1ELGA 5CHAC 1C5SA 2AGGX 1LTOA 3RU4D 3EE0B 4Q7YA 5JYIA 4ABBA 3LC5A 1Z1IA 3SV9A 2FYQA 1V2OT 3LGUA 1AUTC 3KL6A 1O36A 3BEUA 1OSSA 1DM4B 4OS6A 5C5NA 1IOEA 1TMBH 4NIYA 4DW2U 1O31A 4NA9H 1VCPA 2RCEA 5EPNA 2V35A 1KIGH 3LONA 3GISB 3JZ2B 3S9BA 1GMDG 1EJMA 1PPBH 2Z9KA 2VB0A 2SFAA 1BBRE 4KGAA 1ACBE 2VINA 3URCA 4IGDA 4X8VH 2AIQA 1GDUA 2P16A 1UVOA 1T31A 1EAIA 4B73A 1WOFA 4FUCA 3UR9A 2ZU2A 1K2I1 2R2MB 4HFPB 2RG3A 2NU3E 2O9QA 2ZCHP 3RXGA 2D8WA 2GKVE 1O2TA 1MBMA 1MAYA 1JIMA 1XKBC 1UVTH 1QL9A 4X6OA 1C1RA 3I77A 1O35A 5EXLA 5A8XA 2XC4A 2BLWA 4Y71A 4D8NA 1UTOA 3LOXA 4WMDA 3PB1E 2SGPE 1K1NA 1H1BA 2PW8H 1ABIH 1Z8GA 4ABIA 1KXBA 2G5NA 1DT2A 2F9BH 1P3CA 3OU0A 4I8HA 2PSYA 1V2MT 1GBMA 4IMQA 1ZYOA 1HJAC 5E0GA 3O8CA 2SGDE 1ZRKA 3RXOA 1LKBA 3CP7A 2O8UA 2J95A 3CENA 2ZGBH 3GCTF 1MCTA 4LXBH 1C2EA 1SFIA 3RLWH 3B23B 2VJ1A 1ETRH 3LC3A 2ZU3A 4YM9A 1NS3A 1QJ6B 1XVOA 2G5VA 3MU5A 4ISOA 1BBRH 4DT7B 1TX7A 1NRRH 1Q2WA 2OQ5A 3FP8E 2PV9B 1P2MA 1C1OA 3LU9B 3MU0A 3S9CA 3VB7A 2A45B 3UQVA 1GBHA 3TJNA 1GBBA 1SGFA 1SHYA 4IW4E 2Y6TA 1PJPA 3S0NA 1NN6A 5HXFA 3SV7A 1DS2E 1H8IH 1YCPM 1RS0A 4WWYA 1GJCB 1AE5A 4LZ4B 3ZV8A 1IQMA 1LHFH 3A8BA 3BTWE 3QUMP 2F9VA 4ABDA 2CF8H 2ZHDA 1WU1A 1L1GA 1Y59T 4YTAA 1IQEA 4ZKRU 2BY8X 1ZTJA 2FWWA 3FZZA 3MHWU 1NZQH 1XKAC 4CBNA 1O30A 1SI5H 1O2JA 1ESTA 2QYIA 2HNTF 3MFJA 1FY4A 1GJDB 1IQNA 2XBYA 4Z0KA 1C2MA 1MTNB 1EZXC 1QBVH 4ABAA 2ZU1A 1PPHE 3HATH 2H9HA 2OC0A 2ZC9H 1BMMH 1H4WA 1Q31A 3KCGH 4ZKSU 1Y3UA 3VFEA 3PV4A 3E0NB 2ASUB 1O3NA 2PUXB 3GDSA 3FZDA 4K69A 1J15A 1OOKB 3SNDA 1WSSH 3E8LA 1BMAA 1JRSA 1NU7B 1PFXC 2A32A 3M5MA 4D9QA 4X2XA 1TGSZ 1PPZA 2F9OA 3M3TA 5CHAB 3MNXA 4YO9A 1E34B 5TCCA 4ZKOU 1EPTA 2FOEA 2ZCKP 1HAVA 2PSXA 3V12A 4DIHH 4Y10E 1C5MD 1KXCA 1GBLA 5EG4A 4GSOA 4X6NA 1QRWA 3P95A 4CR5A 5DJ7A 2JH5D 3RXJA 1UVSH 1LDTT 1A3EH 1AMHA 2WPKS 4ZKNU 1SGDE 1K28D 3NXPA 2F9PA 3K6YA 4TPYA 3SUDA 1V2VT 2H9EH 4TWWA 1EOJA 1A0LA 3A84A 1GHBF 2FYRA 1S5SA 4GCHF 1K1LA 3GDVA 5FX6A 2VH0A 1NC6A 4JYUH 1UTMA 1RIWC 3ENSB 3F9FA 3LKWA 1TAWA 1XM1A 3ATLA 1BUIA 3LDXH 5JBTA 2GD4B 3S69A 2FOGA 2BD4A 5GCHF 1SR5C 2Y5FA 1ZZZA 3TVJB 1F5KU 1KDQB 1ORFA 1LKAA 4D7FA 4MNVA 1O5GH 3UREA 4DJZB 1RTLA 5AHGH 3FAOA 1O3OA 2Y82A 2R3YA 3SNBA 3VB4A 5DP3A 1TNLA 1O3HA 2GX4A 2A4GA 2G4TA 3RXLA 3Q77A 1C4U2 4INLA 1YC0A 5T6GA 1TIOA 2GCTC 5HMAA 3TGIE 4ISHH 1GJ5H 3V13A 1BZXE 2D1JA 1MKWK 2CXVA 1KYNA 2FESH 1DUAA 2ZA5A 1KY9A 1SSXA 3T5FH 1AE8H 3BTDE 5DPAA 1P02A 5JBCS 4FVBA 1BTYA 1EP5A 3PO1C 1CO7E 1O37A 1YPHC 2VWNA 1HAVB 2AMDA 4ZHAA 1GG6C 1UO6A 1FXYA 2SGFE 4IC5A 1W11U 3HPTB 1Q3XA 2ZFFH 1RGQA 3QWCH 4BXWA 1W7XH 3Q00A 1CGIE 4UONA 2PFEA 4NCYA 1S6HA 2H1UA 1O3EA 3SJ9A 1C5WB 4B2BA 2BYAX 4Y8XA 3RXPA 1EQ9A 3RXDA 2XC0A 3P6ZB 4K3JA 1GVKB 2ZPRA 1GBTA 4DIIH 1TQ0B 4MPUA 1RTKA 1LVMA 3P70B 3PROA 1D6RA 1K9OE 4ABFA 1GJ7B 2PLXA 1O2XA 1O2QA 1EJAA 4GVUA 1UK4A 3D23A 2QCYA 1E37B 3F9EA 2ZHQH 1SQTA 1D3QB 5DP7A 1T8MA 1OWHA 1P2QA 3A82A 5J4QA 1ZGVA 4DURA 2WPHS 1A2CH 1WAYB 4AOQA 3E3TA 2QAAA 1DFPA 5DP9A 3ATMA 3V3MA 1SFQB 1OPHB 1SQOA 2W3IA 1ELTA 1W13U 4A6LA 5K0HA 2J2UA 3GCOA 1L1NA 3UR6A 1FAKH 1SGCA 1S84A 1QTFA 4IMZA 4NIVA 2UUJB 3SUEA 4AB8A 3RU4T 6GCHF 2BX4A 2VU8E 1G9IE 2P93A 3RMMH 5K7RA 1O5EH 4OS4A 1HJ8A 4HI3A 1TOCB 1E35B 4NIWA 1DY9A 1O5FH 1CHOG 1ANDA 1ELAA 1C2JA 1TPOA 2ODPA 3U9AH 3ZZ3A 2A4QA 4JZ1A 3UNSA 3RXEA 2BZ6H 1BITA 2A1DB 1GL1A 1DANH 1GVZA 5C2ZA 6CHAB 2B0FA 2FLRH 1AZ8A 1OYQA 2FMJA 3ZZ8A 3GY3A 1DDJA 2VIQA 5FBIA 3QN7A 4A1XA 2KAIB 4BAQB 3QTOH 1A5IA 4BAOB 2ALVA 1DSUA 3U8OH 1DLEA 2UWPA 2FM2A 3NCLA 2P3UB 2AMPA 3RM2H 1FJSA 1M9UA 3SO3A 4I8KA 4CH2B 1HV7A 3LH3A 2EEKA 1SQAA 1SBWA 3S7KB 5H4IB 5EQQA 3S9AA 1O5CB 4VGCB 2BMGB 1S81A 1WCZA 1VITH 1GHXH 2GTBA 1C5VA 1Z71A 3GY4A 1HAXB 3SOSA 5JPMH 2FOAA 3EQ0H 1ZPBA 3E91A 4HZHA 3BEIB 1P04A 1AWHB 1C1MA 1SGEE 3HKIB 2ZWLH 4MG3A 3EA7A 5LPEA 4NWKA 1O2KA 2Z3CA 3BSQA 4KTSA 1G3DA 3H5CB 3SJ8A 2ZTYA 1C1QA 1UCYH 1SL3A 3TJVA 1E38B 2ZTXA 4MDSA 5ETXA 2ZDKA 3TK9A 3ODFA 3BTME 1BT7A 1PPEE 1TBQH 4AZ2B 3QGJA 1DICA 5CMXH 2Y5HA 1T32A 5GJ4B 2Z9GA 3EDXB 3MH4A 5E2PA 2FLBH 1E36B 2BDHA 1FY3A 1GI7B 3DFJA 3MU8A 5L2YH 2ZHEH 1LVYA 1GI4A 1PQAA 2XYAA 2VVVA 2XRCA 2F83A 3MI4A 1D3PB 1UCYK 4YT7H 2VIVA 3OYPA 3N7OA 3AAUA 1A7SA 4HGCA 1QA7A 1QR3E 1LHGH 1VZQH 2SNVA 3T29A 2JETC 4K1SA 4OS1A 1SGFG 3I78A 1RTFB 3QDZB 3GCHB 1TGNA 3K6ZA 1ANEA 1HGTH 4D76A 3E6PH 3T62A 2ZNKH 2PTNA 1B5GH 4B75A 5GPIB 5A8YA 2F9NA 2ZDNA 2H6MA 4Y8YA 4K1TA 1QQ4A 4BTIB 3SW2B 2TGTA 1DE7H 3A7WA 8GCHF 2Z94A 1HIAB 3ZVBA 3RXQA 1FIZA 1MAXA 5GDSH 3GY7A 1LHCH 1Y3YA 2FS8A 4JMYA 5DP5A 4J1YA 2XC5A 1GJ6A 2GV6A 2Z6BD 1B0FA 4IN2A 2VWLA 1JRTA 1O3LA 4CR9A 1TX6A 1TBRH 1XUGA 2W7SA 1S85A 1INCA 2HPQH 4UFGH 4AFUA 2BB4A 1CA8B 1EZSC 4ZHLU 1Z8JB 1YM0A 3ZYDA 1GJ9B 4X0WU 3MU4A 4JZFH 4MLFB 1MH0A 1TE0A 1HNEE 2O8MA 1TYNA 2A5IA 2FOMB 2B7DH 2ZF0H 3TGJE 4NZQA 1RIWB 3HK6B 4LK4A 2SNWA 1DPOA 2A31A 2RA3A 4ISIH 1QQUA 1L4ZA 1UTPA 2VH6A 3FP7E 1V2QT 4KTUA 4RKJB 1OYTH 2Y81A 3SN8A 2ZGHA 1UVPA 2GZ8A 2ANKH 3SV2H 3L3TA 1LVOA 4UD9H 1PQ7A 1C5UA 3RC4A 3NKKA 1O33A 1K22H 4X8TH 3SU5A 1F7ZA 3PTBA 3SJKA 1C5QA 1UK2A 3QK1A 1FIWA 4TY6A 1UJ1A 1E0FD 2FOCA 1O32A 1C1NA 4FUGA 5C1XA 1F5RA 5GWZA 1C5TA 5FBEA 1P8VC 2ANYA 4X6PA 3MOCA 3A89A 2ODQA 5EQRA 1F2SE 1A3BH 1BTPA 3SI4H 3QX5H 3PMHB 5C5OA 4NGAH 2PGQB 5IDKA 3KQBA 1GMHG 4AYVB 3TH3H 4B74A 4Y7AA 2ZECA 1L4DA 7GCHF 1ELDE 5DGJA 1C5OH 1TPPA 3KIDU 4Y79A 1SOZA 1W2KH 3RMLH 4UFFH 1CU1A 1GCTB 1C5XB 3A7XA 5DG6A 1TA6A 2ALPA 1Y3VA 3SI3H 3RMOH 1AUJA 3UOPA 5A0CA 3BIUH 2P8OC 2C3SA 1CQQA 1QBOA 1Z7KA 4ESTE 1C2IA 2BDIA 1NESE 1IQGA 3Q3YA 5FCRA 2BOHB 1FY8E 1MKWH 1YLDA 2YOLA 2FO9A 3QZRA 4X1PU 4WH6A 1C5NH 4BTUB 4ABGA 1CVWH 2CHAB 5A0BA 1O2HA 1G2LA 4CBOA 1P11E 2W3KA 3SNCA 3O8DA 5EXNA 1O2IA 2GT7A 1GHWH 5GXPA 1FMGA 1PYTD 1ZJKA 4FUJA 4J2YB 2EI8A 4AN7A 1HAHH 1YKTA 4B2CA 3BEFB 1AGJA 1EUFA 2GZ7A 1HAPH 1KTTB 4MNXA 3MO6A 2HVXA 3SHAH 2TBSA 2V6NA 1MCVA 4UE7H 1IQJA 1HDTH 2BD3A 2A7CA 4RSPA 1A46H 1XMNB 1XXFA 1MU6B 1PPGE 1ZPCA 3KEEA 1HB0B 1DY8A 1ESBA 1GBJA 1XUKA 1NRSH 4NA7A 4YZUA 1EPTC 1QBNA 1KXDA 2ZU4A 1GJAB 4CHAC 1O34A 4MVNA 5F8XA 1OWDA 5DP4A 4YOGA 2XCNA 5EPYA 2AIPA 1CBWB 2GV7A 3ZZBA 1O2ZA 1SGTA 1GG6B 2DUCA 1Y5AT 5SGAE 2C93B 1BJUA 2AMQA 3TNSA 2ZP0H 1RJXB 2ZFPH 1A4WH 1P2JA 1BRCE 1NT1A 4GAWA 5IYTA 1RFNA 3CS7A 2IJOB 4JCNA 2WUBA 3EYDA 5E2OA 3ATKA 1HUTH 3A81A 1UTJA 1VITF 1LQDB 1YPMH 2O8WA 3A87A 2ZZUH 3M3VA 2BVRH 2FPZA 1CT2E 3BTQE 1DWEH 1D6WA 1UHBA 3M36A 3DUXH 3SJOA 4FU8A 4UEHH 2BQ7B 1CHGA 1CSOE 3MO9A 1O3AA 5PTPA 1YLCA 2BD7A 3LGYA 1TGBA 4JZIA 3BG4C 3BG4B 1O2RA 1YCPK 3GYLB 2ANWA 3P8FA 5FAHA 1QL8A 4Q7ZA 3ZVEA 1KTSB 2B5TB 3RM0H 3O8BA 1C1VH 2A4OA 2GVFA 4MNWA 2A5AA 1BBRK 1ZTKA 2GDDA 1BDAA 1MQ5A 4Y0ZE 5A0AE 1IHSH 3LIWA 3MMGA 4I31A 4K8YA 4KELA 2XWAA 1ZLRA 1ZMJA 1ZR0A 2P59A 1H9HE 1KDQA 5F03A 2XBWA 1A5GH 1A1RA 3QTVH 4I7YH 4BAMB 2CHAC 4E7RG 4JZEH 2ZCLP 1GI0A 1OKXA 3TGKE 1P3EA 4FUBA 1KSNA 1LHDH 1SGRE 3NWUA 2RA0A 2GCHG 1SLVB 1RXPA 1DSTA 1AN1E 4YOJA 1V6DA 1SGPE 2ESTE 3RUOA 2ZGXH 2GCTB 2A5KA 5AVDA 4R0IA 4OGYA 3FP6E 2V3HH 1J16A 1ETTH 1EP6A 1GJ8B 5JBBS 3PM3A 3RDZA 3MNSA 2ZI2H 1GCTC 1Y8TA 1C1PA 4K1EA 1C1SA 3T28A 2QXIA 4E7NA 1EB2A 1F92A 3B8JA 2HNTC 3SBKA 3VB3A 1YPJH 3MNBA 2Z3EA 2PGBB 2WPJS 1HBTH 1L2EA 1NFXA 1P57B 3BTGE 4JYVH 1O3KA 2B8OH 4WY3A 4D7GA 2BD8A 2Z9IA 2ZPQA 2GT8A 5FPYA 1CT0E 3ATIA 3U8RH 1O2MA 2BDAA 1QFKH 2P95A 3MNCA 2BVXH 2IPHA 3SHCH 4O3UA 4DGJA 1TFXA 4LOYH 3RMNH 1T8OA 2WV4A 1FONA 3ZZ4A 2FI5E 3BIVH 1K1MA 3NPSA 4SGAE 2Q1JA 2ANMH 1L1JA 1T7CA 2H9TH 1KLTA 2ZGJA 4Y6DA 2P3TB 4XE4A 3T2NA 1V2PT 4NWLA 1GHYH 4AG2A 4GPGA 2EA3A 3QZQA 1AKSB 1TRNA 3NK8A 1GMCF 2C8ZB 2W5EA 5DO4H 3LGIA 1GHAG 2FZZA 3JZ1B 3ODDA 5EQSA 1GI5A 3RXIA 2ZFSA 4Q80A 4LZ1H 1LQEA 1TMUH 1JBUH 2PKAA 4IN1A 1A5HA 4WJG2 1FPCH 4B71A 5F6MA 2CGAA 1O2GH 1Z8RA 1K1JA 2F91A 3VB5A 1BTZA 1GHZA 4AFSA 1RD3B 2BLVA 2BX3A 1AU8A 1UTQA 1SGNE 3TITA 3OX7U 1ARCA 4WMFA 1HAIH 1TPAE 3GY2A 1XUIA 3SGAE 1JWTA 4H4FA 2BY5X 4CHAB 1O5BB 1QIXB 1UTKA 1GMDF 2PKSB 3QGNB 1BHXF 3MYWA 2EI6A 2G55A 2GMTB 3UIRA 1MTNC 5CE1A 1GBEA 1KLIH 3RXTA 1ZSJA 1W0ZU 2HPPH 3D62A 3DT0H 2A7JA 3M7TA 3F68H 1SLXB 2ZEBA 4A1TA 1GJBB 3W95A 1O38A 4O3TA 1VJ9U 1D3DB 5L6NH 4IC6A 2TPIZ 5AFZH 3PYHA 1IQKA 1AFQB 1G32B 3GICB 1LVBA 4TWYA 2BY7X 3PWBA 1TNJA 3FANA 3BTFE 3LH1A 3T27A 1QA0A 1V2KT 2ZPSA 3AVZA 2BLQA 3PLBA 2OBQA 2Q6FA 2C8YB 1LPKB 1S0RA 3PO1B 2VGCC 4WMEA 1BHXB 1IQLA 3GCHC 1V2UT 2JKHA 4MPXA 2EI7A 1W12U 4X8SH 2OXSA 2AYWA 4MNYA 2HGTH 2IN2A 5F8TA 4A1VA 3V0XA 4K2YA 2R0LA 2BD2A 2BDYA 3EGKH 4AGJA 4U01A 3SV6A 1AQ7A 3BTHE 2Y80A 3F6UH 1WV7H 3BN9A 1G2MA 2ZFRH 1V2LT 1EASA 1ELCA 1QJ1B 4AB9A 2WUCA 4X1RU 2ZFQH 3M7UA 3GCTG 1KXFA 1U6QA 1AZZA 1C5PA 1F0SA 2ODYB 3UTUH 1TALA 2BDGA 2XW9A 2HRVA 1XXDA 3PTNA 3K65B 1V2TT 1UMAH 5E8EH 3BTKE 1C2LA 1C4V2 2HALA 2OUAA 3R0FA 2GGVB 5L2ZH 1RRKA 3E16B 5A2MH 1UHBB 3TH2H 1N8OC 1LPGB 1BTUA 3SORA 1SC8U 3U1JB 3M5OA 4KTCA 4E06H 1GBFA 2FDAA 1BB0B 1DXPA 2Z7FE 1PYTC 1G30B 3P8NA 2G51A 2AERH 1AVGH 3GYMA 1QL7A 3A88A 3Q76A 4XBBA 1CE5A 1SGQE 1HFDA 1C1TA 4X1QU 2VIOA 2XBXA 3OSYA 1ESAA 3IG6B 1MZAA 3ZYEA 1MTUA 2ZDVH 4TPIZ 1NFWA 1BRAA 1ELVA 3FVFB 3A7TA 4B2AA 1YP9A 1XVMA 4Q2KA 5AF9H 3URDA 2PKSC 2D26C 3RU4E 3SUFA 2FEQH 3ZZCA 3M61U 1YPLH 3HGPA 2QV1A 2J34A 4O9VA 3A85A 1YCPH 2G4UA 4YLQH 2K1QA 3A8AA 1O3PB 4WH8A 1DUEA 2FX4A 1OP8A 3IITA 4BANB 4Q7XA 4NSYA 1GGDC 3SGBE 1DLKB 3E0PB 1EXFA 1YPEH 2F3CE 5DP6A 2ULLA 2BQWB 4DCDA 1MTVA 1NRPH 5C1YA 4CRFA 1ZSLA 2OLGA 1TWXB 4A92A 1GDQA 2HNTE 1FLEE 3R3GB 3PMBB 2FIRH 1J14A 2YNAA 2O8LA 3UNRA 2J38A 2OC7A 3S7HB 2JH0D 1C1UH 1O2NA 1P09A 2A2XH 3ATWA 4ZROA 1C2DA 1W10U 4FVDA 3PMAB 3TLOA 1AWFH 1G3BA 1GBDA 1W3CA 1GHBG 1OP2A 2CMYA 2R2WU 1ABJH 1GI6A 1TGCA 4GCHG 1JOUB 3TJOA 3MH5A 1NU9A 1VJAU 3ZVAA 2QIQA 2C90B 1UTNA 1NFUA 2V0BA 1S82A 2TGPZ 3AW1A 2R9PA 1F0TA 1AFQC 2J92A 1QURH 4XFQA 2AGIX 1C5RA 6LPRA 2I6QA 3RXBA 2XTTB 3TK5A 5GCHG 2PTCE 1AFEH 1P2OA 2SGAA 1QCPA 3LGVA 3D49H 1SPJA 3PMJA 3P17H 2QC2A 4BXSA 4ZMAH 1HLTH 5HYOA 1BMLA 1Y5BT 2ZGCA 4ABHA 1WBGB 1DVAH 3UOUA 1GI8B 2UUFB 3ZZ9A 2LPRA 2FOFA 3W94A 4I8GA 2NU4E 3RXHA 2NU1E 4NG9H 5HGGA 5I25A 2G81E 4XBDA 1EAWA 3UWIA 1SB1H 4X1SU 1K1PA 1V2ST 3PLPA 1TRMA 1D4PB 1KXEA 2SGQE 2G00A 8ESTE 2BD9A 2QF3A 3ZVCA 3B9FH 4XBCA 1WYKA 1J8AA 3F9HA 4Z6AH 4MQAA 3ELAH 1AVWA 1HYLA 1HRTH 1DXWA 2QF0A 1F0UA 1ANCA 4BAKB 1QRXA 2IOTA 3RXSA 1GI9B 2AEIH 3LJOA 1IQHA 1W14U 3MH7A 1BQYA 4NA8A 4UFDH 4OS5A 1HXEH 2P94A 3MWIU 1O3GA 2CF9H 8LPRA 4ABEA 1TLDA 1TOMH 2TIOA 1PPCE 2BY6X 2DE9A 4IBLH 4VGCC 4FUEA 5BPEA 2THFB 1GWAA 1C1WH 3SJIA 2ZHWH 2D2DA 1W7GH 1P2IA 1GCDA 4AYYB 7ESTE 4JYTA 2GP9B 4MPWA 1P01A 2ILNA 2ZG0H 2ZTZA 3QLPH 2Y5GA 1A61H 1P03A 1G3EA 1FY5A 4KP0A 1FDPA 1QB1A 6CHAC 5JBAS 1ZPZA 3RXAA 1J17T 4DOQA 4NFFA 4ZXXH 1XX9A 1SMFE 2C8WB 1QRZA 3A7VA 3K2UA 4ZH8A 4AX9H 1UVUH 1VR1H 2QGRA 1T8LA 2FI3E 9LPRA 3NZIA 1AB9C 1TB6H 1NFYA 1Z8IB 3SNEA 1EB1H 1NROH 1WTGH 4DVAU 4CH8B 5C20A 3T25A 3SU3A 1TA2A 6GCHG 2P8OB 2C8XB 1CBWC 4X2VA 4INHA 1BCUH 3VGCB 1C4Y2 2TGDA 1YPKH 4B76A 2Q6GA 5JDUB 3ZVFA 2BD5A 2VIPA 1CT4E 2OP9A 1D9IA 1S6FA 1ZRBA 4I8LA 1O5AB 1FZZA 1L0ZA 1AB9B 1CHOF 1WQSA 3TU7H 1NRNH 3A8DA 2H2ZA 5HM2A 3D65E 2Z9LA 4TYDA 4X1NU 4ISNA 3HK3B 4B1TA 2AFQB 1YPHE 1ZMLA 3VPKA 1VCQA 3QO6A 1EZQA 1X7AC 3A80A 1B7XB 4A5TS 3PLKA 3KN2A 9ESTA 1EAUA 1N6YA 2A2QH 1TRYA 1ELBA 4JK6A 5J4SA 1O2PA 1OWIA 3EAJA 1V3XA 3ITIA 3LGTA 4GHTA 1EOLA 5DKMA 2XWBI 3M3SA 1LMWB 4WXVA 3MU1A 1P10A 2PHBA 3P8GA 4INKA 8KME2 2J4IA 2Q6DA 4Y7BA 2XCFA 5T6FA
chains in the Genus database with same CATH superfamily
2UUYA 1THSH 4YLUA 4THNH 1MQ6A 1Y3WA 3SU2A 2OC8A 4QT8C 1LPZB 1SGYE 1O2VA 3UUZA 5A09A 1V2RT 1TNIA 1VKYA 1XUFA 2SGEE 2H5DA 3WY8A 4O97A 3T26A 3WW7A 1IHTH 1MZDA 4Y76A 3UFAA 1WTHD 3RXRA 3ZZAA 2QXGA 1ELFA 1V2NT 2ZHFH 1QNJA 3SYJA 5FX5A 1DWCH 1KXAA 1OXGA 4XSKU 3U1IB 1GGDB 3LPRA 3U98H 1T8NA 2V3OH 1UCYE 1ZTLA 1EX3A 4R8TB 2TGAA 1GI2A 2OBOA 4UFEH 1ZJDA 4FU9A 1J9CH 1F5LA 1NBME 4FXGH 3SUGA 1YYY1 2BVSH 1C5ZB 3BTEE 1OWJA 2FXRA 3UY9A 2VIWA 1GPZA 4ZAEA 3ZIAD 2PKAB 4BTTB 1MBQA 3VB6A 1K21H 1IQIA 4CRGA 2FTMA 2GZ9A 4CRBA 2FOHA 2W26A 3C1KA 4YOIA 2ZIQH 3CS0A 1S0QA 3SZNA 1VGCB 3EA8A 2A0QB 1QJ7B 5B6OA 3RXVA 3GY8A 5CDFE 1A0JA 1YF4A 3AAVA 5FPTA 5E0JA 1O2OA 3H7TA 4MPVA 3RC5A 1TBZH 1GBAA 1TNHA 2BY9X 5C3NA 1MMJN 2UUKB 4WF8A 4SGBE 3V7TA 4F49A 2OINA 3E1XB 1P12E 2BOKA 1TPSA 1Y5UT 1HJ9A 5LGOA 4UDWH 3L33A 4U2WA 4ISLA 3VXEH 4F48B 3CNRA 3M5NA 1EJNA 1C5LH 1C9TA 3RLYH 5C0TA 1OP0A 5C0UA 2QN5T 8GCHG 5EOKA 2HOBA 3GCNA 1GJ4H 4AGKA 1NO9H 4BNRA 1MD7A 4JZDH 1FAXA 1HXFH 1AO5A 3ZZDA 4H6SB 3Q3XA 1ZGIA 1NM6A 5JB9S 1OWEA 1ELEE 1JXPA 1MU8B 2FOBA 2XNDD 4M7GA 5A8ZA 1N1LA 3H7OA 1EKBB 5DP8A 3DA9B 4DG4A 1BA8B 2JH6D 5FHTA 4K60A 2QA9E 1G37A 2BZAA 5F8ZA 3ZZ6A 2WINI 1ANBA 3PWCA 5I46H 1VCWA 2ZQ1A 2PR3A 3RXKA 2HVYB 3A7ZA 4I8JA 3P8OA 3DD2H 1GDNA 1CA0C 3NUMA 1O3JA 2Y7ZA 1CGJE 1HAOH 1Z1JA 2W7UA 5EODA 1P06A 1MTSA 5ESBA 4GHQA 4DY7B 2WV5A 1SVPA 1G3CA 1O5DH 3OY5U 1TMTH 1O2SA 2XBVA 1BTWA 3ZV9A 3HKJB 3VXFH 1W8BH 5DK1A 2LNCA 4IS5A 2ZU5A 1Z6EA 1MD8A 3UPEA 1FN8A 3TIUA 3STJA 3U28C 4Y0YE 4D9RA 2OD3B 2H5CA 4YT6H 5C1UA 4X8UH 2RDLA 5EU8A 2F9UA 4O03A 1O3DA 3M5LA 1H8ED 3Q3KA 3C27B 2ZDLA 1TQ7B 2JETB 1AD8H 2NU0E 3EA9A 1V2JT 1BTHH 3ZVGA 1O3IA 1JMOH 4NFEA 1MKXK 2XOKD 2TRMA 4ABJA 1NRQH 3ZZ7A 1O2YA 1B0EA 4TT3D 1SG8B 3A7YA 2G8TA 4YESB 1FY1A 2GMTC 3SQHE 2KZ4A 5T1VA 4AORA 3A86A 5HM9A 1BRUP 3LGWA 1FPHH 3MTYA 4WXIA 5LH8A 5FPSA 3ZZ5A 3SU0A 2QXJA 1H8DH 1GI1A 2OTVA 1THPB 1TNKA 1H9IE 3UNQA 1GL0E 2J9NA 2M5TA 3FOAA 3SU1A 4AG1A 2UWOA 3PRBA 1K0HA 2KAIA 1ZOMA 3DHKH 1GMHF 1QY6A 5B6LA 1XUJA 3RC6A 1WQVH 1DX5M 5EGMA 5JB8S 4Y11E 3RXMA 2VNTA 3L6PA 7GCHG 1O3BA 2BLOA 1T4UH 1BJVA 2XXLA 2Z9JA 5LPFA 5T3HA 1MUEB 5KGOA 1HAYB 1YBWA 3STIA 3PRDA 2FX6A 3VEQB 3VGCC 1SOTA 2A7HA 1TABE 4ZXYH 3GY6A 4I32A 4A7IB 4FUHA 7KMEH 1DWDH 2CJIA 4OGXA 1WUNH 1MKXH 2BQ6B 1C9PA 3BTTE 1K1OA 1JIRA 1GBIA 2GDEH 1Z6JH 1AI8H 5E0HA 1NY22 1PPFE 2QXHA 1EAXA 2FP7B 5T6DA 2J94A 1O39A 5FXLA 3KQEA 1DITH 1UK3A 3KF2A 3UWJH 4RN6A 1C2GA 3TPIZ 2M2AA 2VGCB 1P9UA 3M35A 4K5ZA 3RP2A 1P2KA 2VIDA 1G36A 2L6OA 4GUXA 1XUHA 3A83A 1LCYA 1W0YH 6ESTA 2PUQH 2VVCA 3AASA 2BHGA 1AY6H 2G52A 1T4VH 4FU7A 4NSVA 2Y7XA 3N99A 2R0KA 4TY7A 3DSOA 1C2FA 1IQFA 2ZDMA 3MO3A 1O3CA 1AKSA 5EXMA 1SLUB 1VGCC 4JK5A 1P2NA 1CA0B 2P3FH 2YNBA 5BRRE 2BXTH 4F4OC 2KM0A 2BM2A 3DFLA 3FFGA 4X2WA 1ZHMA 4NIXA 2NU2E 1HJAB 5F53A 1F0RA 1C5YB 3F2HA 1BIOA 1Y3XA 3O8RA 2OCVB 1ID5H 3ESTA 2VWMA 1HIAA 4KKDA 2WYGA 2UWLA 4H42U 3RXUA 2FTLE 3HGNA 2STAE 2QE7D 2QY0B 1O3FA 1V2WT 3K9XB 1SGIB 2ZKSA 3ZVDA 1C2KA 1DWBH 2AS9A 4NZLA 3SV8A 4Q4LA 2B9LA 1S6LA 1QHRB 2ZO3H 4FUFA 3MH6A 2FS9A 4AFQA 5TJXA 1MTWA 1ETSH 2ZFTA 3TH4H 5FCKA 1FNIA 4PROA 1VITG 7LPRA 1FI8A 1TX8A 1OX1A 3P92A 3RXFA 2FODA 3BF6H 2VWOA 5TCAA 1LO6A 3GOVB 1BRBE 2PP6A 2WYJA 1AHTH 4XOJA 3E90B 4CRAA 1EZUC 1ZMNA 2BTCE 4CREA 4RKOB 1O2WA 2CV3A 2O8TA 2OQUA 4OM9A 4ZHMU 3AW0A 2OC1A 1FV9A 5EW2H 1S83A 2BDBA 5L30H 1TGTA 1TNGA 3KQDA 1EATA 1O3MA 1KLJH 2BDCA 3KNXA 1H9LB 3KHVA 2BXUH 1GI3A 5C94A 2ZQ2A 3TK6A 1SLWB 3GDUA 5C67A 4ZUHA 3LT3A 1P9SA 4OS7A 3SU4A 2AH4X 1IAUA 3OY6U 3GY5A 3BG8A 1GVLA 3KGPA 1GHVH 3U8TH 2Z3DA 3BV9B 3SGQE 1ARBA 2C4FH 2R3UA 4BOHA 1HPGA 1UTLM 2CN0H 2XNIA 1BTXA 2EC9H 2GCHF 4U30A 3SNAA 1BOQA 1TONA 3M7QA 3UQOA 1MABB 3SQEE 1YPGH 1HAZB 1GBCA 2DE8A 1A0HB 1ZSKA 4XDEA 1HAGE 3IWMA 5G4BA 3TNTA 4FUDA 3OTJE 1LHEH 3SU6A 4AFZA 2WPIS 1FUJA 2A4RA 1DOJA 1O0DH 4CRDA 4Q63A 1EPTB 3RXCA 3LJJA 2FI4E 2AGEX 5GIBA 2STBE 1D3TB 1QB9A 2I6SA 3M37A 4GLYA 1O2LA 4X6MA 4FUIA 1FN6A 1ZHRA 1K1IA 4Y8ZA 1PQ8A 2HWLB 4H6TA 1QGFA 1GBKA 4OS2A 3U69H 1NTPA 2ZDAH 4BAHB 1QB6A 1SHHB 5ABWA 5EW1H 2HLCA 1THRH 5HIYA 2WPLS 3KQCA 2NWNA 4K8BA 2HLDD 1O2UA 4X2YA 1BMNH 1P0SH 4MTBA 1C2HA 5AFYH 3F2GA 1AIXH 1N6XA 3TJUA 4E05H 3F1SB 4ASHA 3I29A 1CGHA 4CRCA 2PWXA 1NPMA 1E79D 4I33A 5ESTE 1ZHPA 3UB0A 3A8CA 2VVUA 3G01A 2OK5A 1FQ3A 2WPMS 1GMCG 1OS8A 1AVXA 2VBCA 1GHAF 1HCGA 3F9GA 4WVPE 1N8OB 1PQ5A 1OWKA 5LPRA 4HTCH 1YGCH 1P05A 4U32A 1ELGA 5CHAC 1C5SA 2AGGX 1LTOA 3RU4D 3EE0B 4Q7YA 5JYIA 4ABBA 3LC5A 1Z1IA 3SV9A 2FYQA 1V2OT 3LGUA 1AUTC 3KL6A 1O36A 3BEUA 1OSSA 1DM4B 3KYFA 4OS6A 2KX4A 5C5NA 1IOEA 1TMBH 4B6EA 4NIYA 4DW2U 1O31A 4NA9H 1VCPA 2RCEA 2YMSC 5EPNA 2V35A 1KIGH 3LONA 3GISB 3JZ2B 3S9BA 1GMDG 1EJMA 1PPBH 2Z9KA 2VB0A 2SFAA 1BBRE 4KGAA 1ACBE 2VINA 3URCA 4IGDA 4X8VH 2AIQA 1GDUA 2P16A 1UVOA 1T31A 1EAIA 4B73A 1WOFA 4FUCA 3UR9A 2ZU2A 1K2I1 2R2MB 4HFPB 2RG3A 2NU3E 2O9QA 2ZCHP 2J5UA 3RXGA 2D8WA 2GKVE 1O2TA 1MBMA 1MAYA 1JIMA 1XKBC 1UVTH 1QL9A 2WZQA 1C1RA 4X6OA 3I77A 1O35A 5EXLA 5A8XA 2XC4A 2BLWA 4Y71A 4D8NA 1UTOA 3LOXA 4WMDA 3PB1E 2SGPE 1K1NA 1H1BA 2PW8H 1ABIH 1Z8GA 4ABIA 1KXBA 2G5NA 1DT2A 2F9BH 1P3CA 3OU0A 4I8HA 2PSYA 4P00A 1V2MT 3MQKC 1GBMA 4IMQA 1ZYOA 2WSSD 1HJAC 5E0GA 3O8CA 2SGDE 1ZRKA 3RXOA 1LKBA 3CP7A 2O8UA 2J95A 3CENA 2ZGBH 2F43B 3GCTF 1MCTA 4LXBH 1C2EA 1SFIA 3RLWH 3B23B 2VJ1A 1ETRH 3LC3A 2ZU3A 4YM9A 1NS3A 1QJ6B 1QZ8A 1XVOA 2G5VA 3MU5A 2YMSD 4ISOA 1BBRH 4DT7B 1OHHD 1NRRH 1TX7A 1Q2WA 2OQ5A 3FP8E 2PV9B 1P2MA 1C1OA 3LU9B 3MU0A 3VG8A 3S9CA 3VB7A 2A45B 3UQVA 1GBHA 3TJNA 1GBBA 1SGFA 1SHYA 4IW4E 2Y6TA 1PJPA 3S0NA 1NN6A 5HXFA 3SV7A 1DS2E 1H8IH 1YCPM 1RS0A 4WWYA 1GJCB 1AE5A 4LZ4B 3ZV8A 1IQMA 1BMFD 1LHFH 3A8BA 3BTWE 3QUMP 2F9VA 4ABDA 2CF8H 2ZHDA 1WU1A 1L1GA 1Y59T 4YTAA 4ZCNA 1IQEA 4ZKRU 2BY8X 1ZTJA 2FWWA 2WV9A 3FZZA 3MHWU 1NZQH 1XKAC 4B6FA 4CBNA 4I86A 1O30A 1SI5H 1O2JA 1ESTA 2QYIA 2HNTF 3MFJA 1FY4A 1GJDB 1IQNA 2XBYA 4Z0KA 1C2MA 1MTNB 1EZXC 1QBVH 4ABAA 2ZU1A 1PPHE 3HATH 2H9HA 2OC0A 2ZC9H 1BMMH 1H4WA 1Q31A 3KCGH 4ZKSU 1Y3UA 3VFEA 2QF5A 3PV4A 3E0NB 2ASUB 1O3NA 2PUXB 3GDSA 2KCOA 3FZDA 3AK5A 4K69A 1J15A 1OOKB 3SNDA 1WSSH 3E8LA 1BMAA 1JRSA 1NU7B 1PFXC 2A32A 3M5MA 4D9QA 4X2XA 1TGSZ 1PPZA 2F9OA 3M3TA 5CHAB 5EIYA 3MNXA 4YO9A 4RT1A 1E34B 2V7QD 5TCCA 4ZKOU 1EPTA 2FOEA 2ZCKP 1HAVA 2PSXA 3V12A 4DIHH 4Y10E 1C5MD 1KXCA 2V3MA 1GBLA 5EG4A 4GSOA 4X6NA 1QRWA 3P95A 4CR5A 5DJ7A 2JH5D 3RXJA 2KCYA 1UVSH 1LDTT 3KYGA 1A3EH 1AMHA 2WPKS 3H09A 4ZKNU 5HKKD 2J98B 1SGDE 1K28D 3NXPA 2F9PA 3K6YA 5DN6D 4TPYA 3SUDA 1V2VT 2H9EH 4TWWA 1EOJA 1A0LA 3A84A 1GHBF 2FYRA 1S5SA 4GCHF 1K1LA 3GDVA 5FX6A 2VH0A 3N7EA 1NC6A 4JYUH 1UTMA 1RIWC 3ENSB 3F9FA 3LKWA 2QF4A 1TAWA 1XM1A 3ATLA 1BUIA 3LDXH 2EY4C 5JBTA 2GD4B 3S69A 2FOGA 2BD4A 5GCHF 1SR5C 4FETA 2Y5FA 1ZZZA 2RFKC 3TVJB 1F5KU 1KDQB 1ORFA 1LKAA 4D7FA 1YWUA 1O5GH 4MNVA 3UREA 4DJZB 1RTLA 5AHGH 3FAOA 1O3OA 2Y82A 5C17A 2R3YA 3SNBA 3VB4A 5DP3A 1TNLA 1O3HA 2GX4A 2A4GA 2G4TA 3RXLA 3Q77A 1C4U2 4INLA 1YC0A 3OE7D 5T6GA 1TIOA 2GCTC 5HMAA 3DSGA 3TGIE 4ISHH 1GJ5H 3V13A 1BZXE 2D1JA 1MKWK 2CXVA 1KYNA 2FESH 1DUAA 2ZA5A 2GJGA 1KY9A 1SSXA 3T5FH 1AE8H 3BTDE 5DPAA 1P02A 2W6JD 5JBCS 4FVBA 1BTYA 1EP5A 3PO1C 1CO7E 1O37A 1YPHC 2VWNA 1HAVB 2AMDA 4ZHAA 1GG6C 1UO6A 1FXYA 2SGFE 4IC5A 1W11U 3HPTB 1Q3XA 2ZFFH 1RGQA 3QWCH 2K0QA 4BXWA 1W7XH 3Q00A 1CGIE 4UONA 2PFEA 4NCYA 1S6HA 2H1UA 1O3EA 3SJ9A 1C5WB 4B2BA 2BYAX 4Y8XA 3RXPA 1EQ9A 3RXDA 2XC0A 3P6ZB 4ACAA 4K3JA 1GVKB 2ZPRA 1GBTA 4DIIH 1TQ0B 4MPUA 1RTKA 1LVMA 3P70B 3PROA 1D6RA 1K9OE 4ABFA 1GJ7B 5FL7D 3SZEA 2PLXA 1O2XA 1O2QA 1EJAA 4GVUA 1UK4A 3D23A 2QCYA 1E37B 3F9EA 2ZHQH 1SQTA 1D3QB 5DP7A 3UAIC 1T8MA 1OWHA 1P2QA 3A82A 5J4QA 1ZGVA 4DURA 2WPHS 1A2CH 1WAYB 4AOQA 3E3TA 2QAAA 1DFPA 5DP9A 3ATMA 3V3MA 1SFQB 1OPHB 1SQOA 2W3IA 1ELTA 1W13U 4A6LA 5K0HA 2J2UA 3GCOA 1L1NA 3UR6A 1FAKH 1SGCA 1S84A 1QTFA 4IMZA 4NIVA 2UUJB 3SUEA 4AB8A 3RU4T 6GCHF 2BX4A 2VU8E 1G9IE 2P93A 3RMMH 4YXWD 5K7RA 1O5EH 2RDEA 1HJ8A 4OS4A 4HI3A 1TOCB 1E35B 4NIWA 1DY9A 1O5FH 1CHOG 1ANDA 1ELAA 1C2JA 1TPOA 2ODPA 3U9AH 3ZZ3A 2A4QA 4JZ1A 3UNSA 3RXEA 2BZ6H 1BITA 2A1DB 1GL1A 1DANH 1GVZA 5C2ZA 6CHAB 2B0FA 2FLRH 2KCAA 1AZ8A 1OYQA 2FMJA 3ZZ8A 3GY3A 1DDJA 2VIQA 5FBIA 3QN7A 4A1XA 2KAIB 4BAQB 3QTOH 1A5IA 4BAOB 2ALVA 1DSUA 2LP6A 3U8OH 1DLEA 2UWPA 2FM2A 1YY3A 2P3UB 2AMPA 3NCLA 3RM2H 1FJSA 1M9UA 3SO3A 4I8KA 4CH2B 1HV7A 3LH3A 2EEKA 1SQAA 1SBWA 3S7KB 5H4IB 5EQQA 3S9AA 1O5CB 3NRLA 4VGCB 2BMGB 1S81A 1WCZA 1VITH 1GHXH 2GTBA 1C5VA 1Z71A 3GY4A 1HAXB 3SOSA 5JPMH 2FOAA 3EQ0H 1ZPBA 3E91A 5HIZA 4HZHA 4XD7D 3BEIB 1P04A 1AWHB 1C1MA 1SGEE 3HKIB 2ZWLH 4MG3A 3EA7A 5LPEA 4NWKA 1O2KA 2Z3CA 3BSQA 4KTSA 1G3DA 3H5CB 3SJ8A 2ZTYA 1C1QA 1UCYH 2JIZD 1SL3A 3TJVA 1E38B 2ZTXA 4MDSA 5ETXA 2ZDKA 3TK9A 3ODFA 3BTME 1BT7A 1PPEE 1TBQH 4AZ2B 3QGJA 1DICA 2J98A 5CMXH 2Y5HA 1T32A 5GJ4B 2Z9GA 3EDXB 3MH4A 5E2PA 2FLBH 1E36B 2BDHA 1FY3A 1GI7B 3DFJA 3MU8A 5L2YH 2ZHEH 1LVYA 1GI4A 1PQAA 2XYAA 2VVVA 2XRCA 2F83A 3MI4A 1D3PB 1UCYK 4YT7H 2VIVA 3OYPA 3N7OA 3AAUA 1A7SA 4HGCA 1QA7A 1QR3E 1LHGH 1VZQH 2SNVA 3T29A 2JETC 4K1SA 4OS1A 1SGFG 3I78A 1RTFB 3QDZB 3GCHB 1TGNA 3K6ZA 1ANEA 1HGTH 4D76A 4M9FA 3E6PH 3T62A 2ZNKH 2WPDD 2PTNA 1B5GH 4B75A 5GPIB 5A8YA 5KEDA 2F9NA 2ZDNA 2H6MA 4Y8YA 4K1TA 1QQ4A 4RT0A 4BTIB 3SW2B 2TGTA 1DE7H 3A7WA 8GCHF 2Z94A 1HIAB 3ZVBA 3PV2A 3RXQA 1FIZA 1MAXA 5GDSH 3GY7A 1LHCH 1Y3YA 2FS8A 4JMYA 5DP5A 4J1YA 2XC5A 1GJ6A 2GV6A 2Z6BD 1B0FA 4IN2A 2VWLA 1JRTA 1O3LA 4FOUC 4CR9A 1TX6A 1TBRH 1XUGA 2W7SA 2W6ID 1S85A 1INCA 2HPQH 4UFGH 4AFUA 2BB4A 1CA8B 1EZSC 4ZHLU 1Z8JB 1YM0A 3ZYDA 1GJ9B 4X0WU 3MU4A 4JZFH 4MLFB 1MH0A 1TE0A 1HNEE 2O8MA 1TYNA 2A5IA 2FOMB 2B7DH 2ZF0H 3TGJE 4NZQA 1RIWB 3HK6B 4LK4A 2SNWA 1DPOA 2A31A 2RA3A 4ISIH 1QQUA 1L4ZA 1UTPA 2VH6A 3FP7E 1V2QT 4KTUA 4RKJB 1OYTH 2Y81A 3SN8A 2ZGHA 1UVPA 2GZ8A 2ANKH 3SV2H 3L3TA 1LVOA 4UD9H 1PQ7A 1C5UA 3RC4A 3NKKA 1O33A 1K22H 4X8TH 3SU5A 1F7ZA 3PTBA 3SJKA 1C5QA 1UK2A 3QK1A 1FIWA 4TY6A 1UJ1A 1E0FD 2FOCA 1O32A 1YLNA 1C1NA 4FUGA 5C1XA 1F5RA 5GWZA 1C5TA 5FBEA 1P8VC 2ANYA 4X6PA 3MOCA 3A89A 2ODQA 5EQRA 1F2SE 1A3BH 1BTPA 3SI4H 3QX5H 3PMHB 2KR7A 5C5OA 4NGAH 2PGQB 5IDKA 3KQBA 1GMHG 4AYVB 3TH3H 4B74A 4Y7AA 2ZECA 1L4DA 7GCHF 1ELDE 5DGJA 1C5OH 1TPPA 3KIDU 4Z1MD 4Y79A 1SOZA 1W2KH 3RMLH 4UFFH 1CU1A 1GCTB 1C5XB 3A7XA 5DG6A 1TA6A 2ALPA 1Y3VA 3SI3H 3WWBA 3RMOH 1AUJA 3UOPA 5A0CA 4RI0A 3BIUH 2P8OC 2C3SA 1CQQA 1QBOA 1Z7KA 4ESTE 1C2IA 2BDIA 2IPQX 1NESE 1IQGA 3Q3YA 5FCRA 2BOHB 1FY8E 1MKWH 1YLDA 2YOLA 2FO9A 3QZRA 4X1PU 4WH6A 4ASUD 1C5NH 4BTUB 4ABGA 1CVWH 2CHAB 5EJZA 4F55A 5A0BA 1O2HA 1G2LA 4CBOA 1P11E 2W3KA 3SNCA 3O8DA 5EXNA 1O2IA 2GT7A 1GHWH 5GXPA 1FMGA 1PYTD 1ZJKA 5EJ1A 4FUJA 4J2YB 2EI8A 4AN7A 1HAHH 1YKTA 4B2CA 3BEFB 1AGJA 1EUFA 2GZ7A 1HAPH 1KTTB 3W1EA 4MNXA 3MO6A 2HVXA 3SHAH 2TBSA 2V6NA 1MCVA 4UE7H 1IQJA 1HDTH 2BD3A 2A7CA 4RSPA 1A46H 1XMNB 1XXFA 1MU6B 1KMHB 1PPGE 1ZPCA 3KEEA 1HB0B 1DY8A 1ESBA 1GBJA 1XUKA 1NRSH 4NA7A 4YZUA 1EPTC 2IJD1 1QBNA 1KXDA 2ZU4A 1GJAB 3F3BA 4CHAC 1O34A 4MVNA 5F8XA 1OWDA 3F0OA 5DP4A 4YOGA 2XCNA 2YMSB 5EPYA 2AIPA 1CBWB 2GV7A 3ZZBA 1O2ZA 1SGTA 1GG6B 2DUCA 1Y5AT 5SGAE 2C93B 1BJUA 2AMQA 3TNSA 2ZP0H 1RJXB 2ZFPH 1SKYE 1A4WH 1P2JA 1BRCE 1NT1A 4GAWA 5IYTA 1RFNA 3CS7A 2IJOB 4JCNA 2WUBA 3EYDA 5E2OA 3ATKA 1HUTH 3A81A 1UTJA 1VITF 1LQDB 1YPMH 2O8WA 3A87A 2ZZUH 3M3VA 2BVRH 2FPZA 1CT2E 3BTQE 5KECA 1DWEH 1D6WA 1UHBA 3M36A 3DUXH 3SJOA 3EE7A 4FU8A 4UEHH 2BQ7B 1CHGA 1CSOE 3MO9A 1O3AA 5PTPA 1YLCA 2BD7A 3LGYA 1TGBA 4JZIA 3BG4C 3BG4B 1O2RA 1YCPK 3GYLB 2ANWA 3P8FA 5FAHA 1QL8A 4Q7ZA 3ZVEA 1KTSB 2B5TB 3RM0H 3O8BA 1C1VH 2A4OA 2GVFA 4MNWA 2A5AA 1BBRK 1ZTKA 2GDDA 1BDAA 1MQ5A 4Y0ZE 5A0AE 1IHSH 3LIWA 3MMGA 4I31A 4K8YA 4KELA 2CK3D 2XWAA 1COWD 1ZLRA 1ZMJA 1ZR0A 2P59A 1H9HE 1SQRA 1KDQA 5F03A 2XBWA 1A5GH 1A1RA 3QTVH 4I7YH 4BAMB 2CHAC 4E7RG 4JZEH 2ZCLP 1GI0A 1OKXA 3TGKE 1P3EA 4ACBA 4FUBA 1KSNA 1LHDH 1SGRE 3NWUA 2RA0A 2GCHG 4TSFD 1SLVB 1RXPA 1DSTA 1AN1E 4YOJA 1V6DA 1SGPE 2ESTE 3RUOA 2ZGXH 2GCTB 2A5KA 5AVDA 4R0IA 4OGYA 3FP6E 2V3HH 3OTPA 1J16A 1E1RD 1EP6A 1ETTH 1GJ8B 5JBBS 3PM3A 3RDZA 3OEED 3MNSA 2ZI2H 1GCTC 1Y8TA 1C1PA 4K1EA 1C1SA 3T28A 2QXIA 4E7NA 1EB2A 3WWFA 1F92A 3B8JA 2HNTC 3SBKA 3VB3A 1YPJH 3MNBA 2Z3EA 2PGBB 1L2EA 1HBTH 1NFXA 1P57B 2WPJS 3BTGE 4JYVH 1O3KA 2B8OH 4WY3A 4D7GA 2BD8A 2Z9IA 2ZPQA 2GT8A 5FPYA 1CT0E 3ATIA 3U8RH 1O2MA 2BDAA 1QFKH 2P95A 3MNCA 2BVXH 1E1QD 2IPHA 3SHCH 4O3UA 4DGJA 1TFXA 4LOYH 3RMNH 1T8OA 2WV4A 1FONA 3ZZ4A 2FI5E 3BIVH 1K1MA 3NPSA 4SGAE 2Q1JA 2ANMH 1L1JA 1T7CA 2H9TH 1KLTA 2ZGJA 4Y6DA 2P3TB 4XE4A 3T2NA 1V2PT 4NWLA 1GHYH 4XRNA 4AG2A 4GPGA 2EA3A 3QZQA 1AKSB 1TRNA 3NK8A 2KCPA 1GMCF 2C8ZB 2W5EA 5DO4H 3LGIA 1GHAG 2FZZA 3JZ1B 3ODDA 5EQSA 1GI5A 3RXIA 2ZFSA 4Q80A 4LZ1H 1LQEA 1TMUH 1JBUH 2PKAA 4IN1A 1A5HA 4WJG2 1FPCH 4B71A 5F6MA 2CGAA 1O2GH 1Z8RA 1K1JA 2F91A 3VB5A 1BTZA 1GHZA 4AFSA 1RD3B 2BLVA 2BX3A 1AU8A 1UTQA 1SGNE 3TITA 3OX7U 1ARCA 4WMFA 1HAIH 1TPAE 3GY2A 1XUIA 3SGAE 1JWTA 5EJLA 4H4FA 2BY5X 4CHAB 1O5BB 1QIXB 1UTKA 1GMDF 2PKSB 3QGNB 1BHXF 3MYWA 2EI6A 2G55A 2GMTB 3UIRA 1MTNC 5CE1A 1GBEA 1KLIH 3RXTA 1ZSJA 1W0ZU 2HPPH 3D62A 3DT0H 2A7JA 3M7TA 3F68H 1SLXB 2ZEBA 4A1TA 1GJBB 3W95A 1O38A 4O3TA 1VJ9U 1D3DB 5L6NH 4IC6A 2TPIZ 5AFZH 3PYHA 1IQKA 1AFQB 1G32B 3GICB 1LVBA 4TWYA 2BY7X 3PWBA 1TNJA 3FANA 3BTFE 3LH1A 3T27A 1QA0A 1V2KT 2ZPSA 3AVZA 2BLQA 3PLBA 2OBQA 2Q6FA 2C8YB 1LPKB 1S0RA 3PO1B 2VGCC 4WMEA 1BHXB 1IQLA 3GCHC 1V2UT 2JKHA 4MPXA 2EI7A 1W12U 4X8SH 2OXSA 2AYWA 4MNYA 1EFRD 2HGTH 2IN2A 5F8TA 4A1VA 3V0XA 4K2YA 2R0LA 2BD2A 2BDYA 3EGKH 4AGJA 4U01A 3SV6A 1AQ7A 3BTHE 2Y80A 3F6UH 1WV7H 3BN9A 1G2MA 2ZFRH 1V2LT 1EASA 1ELCA 1QJ1B 1H8HD 2K8IA 5CHBA 4AB9A 2WUCA 4X1RU 2ZFQH 3M7UA 3GCTG 1KXFA 2KFWA 1U6QA 1AZZA 1C5PA 1F0SA 2ODYB 3UTUH 1TALA 2BDGA 1W0JD 2XW9A 2F4LA 2HRVA 1XXDA 4AC9A 3PTNA 1WXRA 3K65B 1V2TT 1UMAH 5E8EH 3BTKE 1C2LA 1C4V2 2HALA 2OUAA 3R0FA 2GGVB 5L2ZH 1RRKA 3E16B 5A2MH 1UHBB 3TH2H 1N8OC 1LPGB 1BTUA 3PV5A 3SORA 1SC8U 3U1JB 3M5OA 4KTCA 4E06H 1GBFA 2FDAA 1BB0B 1DXPA 2Z7FE 1PYTC 1G30B 3P8NA 2G51A 2AERH 1AVGH 3GYMA 1QL7A 3A88A 3Q76A 4XBBA 5IK2D 1CE5A 1SGQE 1HFDA 1C1TA 4X1QU 2VIOA 2XBXA 5GNDA 3OSYA 1ESAA 3IG6B 1MZAA 3ZYEA 1MTUA 2ZDVH 4TPIZ 1NFWA 1BRAA 1ELVA 3N7DA 3FVFB 3A7TA 4B2AA 1YP9A 1XVMA 4Q2KA 5AF9H 3URDA 2PKSC 2D26C 3RU4E 3SUFA 2FEQH 3ZZCA 3M61U 1YPLH 3HGPA 2QV1A 2J34A 4O9VA 2JDID 3A85A 2LELA 1YCPH 2G4UA 4YLQH 2K1QA 3A8AA 1O3PB 4WH8A 2WHXA 1DUEA 2FX4A 1OP8A 3IITA 4BANB 4Q7XA 5DSFA 4NSYA 1GGDC 3SGBE 1DLKB 3E0PB 1EXFA 1YPEH 2F3CE 5DP6A 2ULLA 2BQWB 1NBMD 4DCDA 1MTVA 1NRPH 5C1YA 4CRFA 1ZSLA 2OLGA 1TWXB 4A92A 1GDQA 2HNTE 1FLEE 3R3GB 3PMBB 2FIRH 1J14A 2YNAA 2O8LA 3UNRA 3KQ5A 2J38A 2OC7A 3S7HB 2AHME 4P02A 3OFND 2JH0D 1C1UH 1O2NA 1P09A 2A2XH 3ATWA 4ZROA 1C2DA 1W10U 4FVDA 3PMAB 3TLOA 1AWFH 1G3BA 1GBDA 1W3CA 1GHBG 1OP2A 2CMYA 2R2WU 1ABJH 1GI6A 1TGCA 1W0KD 4GCHG 1JOUB 3TJOA 3MH5A 1NU9A 1VJAU 3ZVAA 2QIQA 2JJ1D 2C90B 1UTNA 1NFUA 2V0BA 1S82A 2TGPZ 3AW1A 2R9PA 1F0TA 1AFQC 2J92A 1QURH 4XFQA 2AGIX 1C5RA 6LPRA 2I6QA 3FN8A 2EQNA 3RXBA 2XTTB 3TK5A 5GCHG 3FKSD 2PTCE 1AFEH 1P2OA 2SGAA 1QCPA 3LGVA 1WDIA 3D49H 1SPJA 3PMJA 3P17H 2QC2A 4BXSA 4ZMAH 1FX0B 1HLTH 5HYOA 1BMLA 1Y5BT 2ZGCA 4ABHA 1WBGB 1DVAH 3UOUA 1GI8B 2UUFB 3ZZ9A 2LPRA 2FOFA 3W94A 4I8GA 2NU4E 3RXHA 2NU1E 3F0PA 4NG9H 5HGGA 5I25A 2G81E 4XBDA 1EAWA 3UWIA 1SB1H 4X1SU 1K1PA 1V2ST 3PLPA 1TRMA 1D4PB 1KXEA 2SGQE 2G00A 8ESTE 2BD9A 2QF3A 3ZVCA 3B9FH 4XBCA 1WYKA 1J8AA 3F9HA 4Z6AH 4MQAA 3ELAH 1AVWA 1HYLA 1HRTH 1DXWA 2QF0A 1F0UA 1ANCA 4BAKB 1QRXA 2IOTA 3RXSA 1GI9B 2AEIH 3LJOA 1IQHA 1W14U 3MH7A 1BQYA 4NA8A 4UFDH 4OS5A 1HXEH 2P94A 3MWIU 1O3GA 3OEHD 2CF9H 8LPRA 4ABEA 1TLDA 1TOMH 2TIOA 1PPCE 2BY6X 2DE9A 4IBLH 4VGCC 4FUEA 5BPEA 2THFB 1GWAA 1C1WH 3SJIA 2ZHWH 2D2DA 1W7GH 2J97A 1P2IA 1GCDA 4AYYB 7ESTE 4JYTA 3F2FA 2GP9B 4MPWA 1P01A 2ILNA 2ZG0H 2ZTZA 3QLPH 2Y5GA 3DSPA 1A61H 1P03A 3DCLA 1G3EA 1FY5A 4KP0A 1FDPA 1QB1A 6CHAC 5JBAS 1ZPZA 3RXAA 1J17T 4DOQA 4NFFA 4ZXXH 1XX9A 1SMFE 2C8WB 1QRZA 3A7VA 3K2UA 4ZH8A 4AX9H 1UVUH 1VR1H 2QGRA 1T8LA 2FI3E 9LPRA 3NZIA 4DT4A 1AB9C 1TB6H 1NFYA 1Z8IB 3SNEA 1EB1H 1NROH 1WTGH 4DVAU 2JJ2D 4CH8B 5C20A 3T25A 3SU3A 1TA2A 6GCHG 1UW7A 2P8OB 2C8XB 1CBWC 4X2VA 4INHA 1BCUH 3VGCB 1C4Y2 2TGDA 1YPKH 4B76A 2Q6GA 5JDUB 3ZVFA 2BD5A 2VIPA 1CT4E 2OP9A 1D9IA 1S6FA 1ZRBA 4I8LA 1O5AB 1FZZA 1L0ZA 1AB9B 1CHOF 1WQSA 3TU7H 1NRNH 4HG6A 3A8DA 2H2ZA 5HM2A 3D65E 2Z9LA 4TYDA 4X1NU 4ISNA 3HK3B 4B1TA 2AFQB 1YPHE 1ZMLA 3VPKA 1VCQA 3QO6A 1EZQA 1X7AC 3A80A 1B7XB 4A5TS 3PLKA 3KN2A 9ESTA 1EAUA 1N6YA 2A2QH 1TRYA 3FO8D 1ELBA 4JK6A 5J4SA 1O2PA 1OWIA 3EAJA 3GS9A 1V3XA 3ITIA 3LGTA 4GHTA 1EOLA 5DKMA 2XWBI 3M3SA 1LMWB 4WXVA 3OAAD 2L74A 1P10A 2PHBA 3MU1A 3P8GA 4INKA 8KME2 2J4IA 2Q6DA 4Y7BA 2XCFA 5T6FA
chains in the Genus database with same CATH topology
2UUYA 1THSH 4YLUA 4THNH 1MQ6A 1Y3WA 3SU2A 2OC8A 4QT8C 1LPZB 1SGYE 1O2VA 3UUZA 5A09A 1V2RT 1TNIA 1XUFA 2SGEE 2H5DA 3WY8A 4O97A 3T26A 1IHTH 1MZDA 4Y76A 3UFAA 1WTHD 3RXRA 3ZZAA 2QXGA 1ELFA 1V2NT 2ZHFH 1QNJA 5FX5A 1DWCH 1KXAA 1OXGA 4XSKU 3U1IB 1GGDB 3LPRA 3U98H 1T8NA 2V3OH 1UCYE 1ZTLA 1EX3A 4R8TB 2TGAA 1GI2A 2OBOA 4UFEH 1ZJDA 4FU9A 1J9CH 1F5LA 4FXGH 3SUGA 1YYY1 2BVSH 1C5ZB 3BTEE 1OWJA 2FXRA 3UY9A 2VIWA 1GPZA 4ZAEA 2PKAB 4BTTB 1MBQA 3VB6A 1K21H 1IQIA 4CRGA 2FTMA 2GZ9A 4CRBA 2FOHA 2W26A 3C1KA 4YOIA 2ZIQH 3CS0A 1S0QA 3SZNA 1VGCB 3EA8A 2A0QB 1QJ7B 5B6OA 3RXVA 3GY8A 1A0JA 1YF4A 3AAVA 5FPTA 5E0JA 1O2OA 3H7TA 4MPVA 3RC5A 1TBZH 1GBAA 1TNHA 2BY9X 5C3NA 1MMJN 2UUKB 4WF8A 4SGBE 3V7TA 4F49A 2OINA 3E1XB 1P12E 2BOKA 1TPSA 1Y5UT 1HJ9A 5LGOA 4UDWH 3L33A 4U2WA 4ISLA 3VXEH 3M5NA 1EJNA 1C5LH 1C9TA 3RLYH 1OP0A 8GCHG 2QN5T 5EOKA 2HOBA 3GCNA 1GJ4H 4AGKA 1NO9H 4BNRA 1MD7A 4JZDH 1FAXA 1HXFH 1AO5A 3ZZDA 4H6SB 3Q3XA 1ZGIA 1NM6A 5JB9S 1OWEA 1ELEE 1JXPA 1MU8B 2FOBA 4M7GA 5A8ZA 1N1LA 3H7OA 1EKBB 5DP8A 3DA9B 4DG4A 1BA8B 2JH6D 5FHTA 4K60A 2QA9E 1G37A 2BZAA 5F8ZA 3ZZ6A 2WINI 1ANBA 3PWCA 5I46H 1VCWA 2ZQ1A 2PR3A 3RXKA 3A7ZA 4I8JA 3P8OA 3DD2H 1GDNA 1CA0C 3NUMA 1O3JA 2Y7ZA 1CGJE 1HAOH 1Z1JA 2W7UA 5EODA 1P06A 1MTSA 5ESBA 4GHQA 4DY7B 2WV5A 1SVPA 1G3CA 1O5DH 3OY5U 1TMTH 1O2SA 2XBVA 1BTWA 3ZV9A 3HKJB 3VXFH 1W8BH 5DK1A 2LNCA 4IS5A 2ZU5A 1Z6EA 1MD8A 3UPEA 1FN8A 3TIUA 3STJA 4Y0YE 4D9RA 2OD3B 2H5CA 4YT6H 5C1UA 4X8UH 2RDLA 5EU8A 2F9UA 4O03A 1O3DA 3M5LA 3Q3KA 3C27B 2ZDLA 1TQ7B 2JETB 1AD8H 2NU0E 3EA9A 1V2JT 1BTHH 3ZVGA 1O3IA 1JMOH 4NFEA 1MKXK 2TRMA 4ABJA 1NRQH 3ZZ7A 1O2YA 1B0EA 1SG8B 3A7YA 2G8TA 4YESB 1FY1A 2GMTC 3SQHE 4AORA 3A86A 5HM9A 1BRUP 3LGWA 1FPHH 3MTYA 4WXIA 5LH8A 5FPSA 3ZZ5A 3SU0A 2QXJA 1H8DH 1GI1A 2OTVA 1THPB 1TNKA 1H9IE 3UNQA 1GL0E 2J9NA 2M5TA 3SU1A 4AG1A 2UWOA 2KAIA 1ZOMA 3DHKH 1GMHF 1QY6A 1XUJA 3RC6A 1WQVH 1DX5M 5EGMA 5JB8S 4Y11E 3RXMA 2VNTA 3L6PA 7GCHG 1O3BA 2BLOA 1T4UH 1BJVA 2XXLA 2Z9JA 5LPFA 5T3HA 1MUEB 1HAYB 1YBWA 3STIA 2FX6A 3VEQB 3VGCC 1SOTA 2A7HA 1TABE 4ZXYH 3GY6A 4I32A 4A7IB 4FUHA 7KMEH 1DWDH 2CJIA 4OGXA 1WUNH 1MKXH 2BQ6B 1C9PA 3BTTE 1K1OA 1JIRA 1GBIA 2GDEH 1Z6JH 1AI8H 5E0HA 1NY22 1PPFE 2QXHA 1EAXA 2FP7B 5T6DA 2J94A 1O39A 5FXLA 3KQEA 1DITH 1UK3A 3KF2A 3UWJH 4RN6A 1C2GA 3TPIZ 2VGCB 1P9UA 3M35A 4K5ZA 3RP2A 1P2KA 2VIDA 1G36A 4GUXA 1XUHA 3A83A 1LCYA 1W0YH 6ESTA 2PUQH 2VVCA 3AASA 2BHGA 1AY6H 2G52A 1T4VH 4FU7A 4NSVA 2Y7XA 2R0KA 4TY7A 1C2FA 1IQFA 2ZDMA 3MO3A 1O3CA 1AKSA 5EXMA 1SLUB 1VGCC 4JK5A 1P2NA 1CA0B 2P3FH 2YNBA 5BRRE 2BXTH 4F4OC 2BM2A 3DFLA 3FFGA 4X2WA 1ZHMA 4NIXA 2NU2E 1HJAB 1F0RA 1C5YB 1BIOA 1Y3XA 3O8RA 2OCVB 1ID5H 3ESTA 2VWMA 1HIAA 4KKDA 2WYGA 2UWLA 4H42U 3RXUA 2FTLE 3HGNA 2STAE 2QY0B 1O3FA 1V2WT 3K9XB 1SGIB 2ZKSA 3ZVDA 1C2KA 1DWBH 2AS9A 4NZLA 3SV8A 2B9LA 1QHRB 2ZO3H 4FUFA 3MH6A 2FS9A 4AFQA 5TJXA 1MTWA 1ETSH 2ZFTA 3TH4H 5FCKA 1FNIA 4PROA 1VITG 7LPRA 1FI8A 1TX8A 1OX1A 3P92A 3RXFA 2FODA 3BF6H 2VWOA 5TCAA 1LO6A 3GOVB 1BRBE 2WYJA 1AHTH 4XOJA 3E90B 4CRAA 1EZUC 1ZMNA 2BTCE 4CREA 4RKOB 1O2WA 2CV3A 2O8TA 2OQUA 4ZHMU 3AW0A 2OC1A 1FV9A 5EW2H 1S83A 2BDBA 5L30H 1TGTA 1TNGA 3KQDA 1EATA 1O3MA 1KLJH 2BDCA 3KNXA 1H9LB 3KHVA 2BXUH 1GI3A 2ZQ2A 3TK6A 1SLWB 3GDUA 5C67A 4ZUHA 3LT3A 1P9SA 4OS7A 3SU4A 2AH4X 1IAUA 3OY6U 3GY5A 3BG8A 1GVLA 3KGPA 1GHVH 3U8TH 2Z3DA 3BV9B 3SGQE 1ARBA 2C4FH 2R3UA 4BOHA 1HPGA 1UTLM 2CN0H 2XNIA 1BTXA 2EC9H 2GCHF 4U30A 3SNAA 1BOQA 1TONA 3M7QA 3UQOA 3SQEE 1YPGH 1HAZB 1GBCA 2DE8A 1A0HB 1ZSKA 4XDEA 1HAGE 3IWMA 5G4BA 3TNTA 4FUDA 3OTJE 1LHEH 3SU6A 4AFZA 2WPIS 1FUJA 2A4RA 1DOJA 1O0DH 4CRDA 1EPTB 3RXCA 3LJJA 2FI4E 2AGEX 5GIBA 2STBE 1D3TB 1QB9A 2I6SA 3M37A 4GLYA 1O2LA 4X6MA 4FUIA 1FN6A 1ZHRA 1K1IA 4Y8ZA 1PQ8A 2HWLB 4H6TA 1QGFA 1GBKA 4OS2A 3U69H 1NTPA 2ZDAH 4BAHB 1QB6A 1SHHB 5ABWA 5EW1H 2HLCA 1THRH 2WPLS 3KQCA 2NWNA 4K8BA 1O2UA 4X2YA 1BMNH 1P0SH 4MTBA 1C2HA 5AFYH 1AIXH 1N6XA 3TJUA 4E05H 3F1SB 4ASHA 3I29A 1CGHA 4CRCA 2PWXA 1NPMA 4I33A 5ESTE 1ZHPA 3A8CA 2VVUA 3G01A 1FQ3A 2WPMS 1GMCG 1OS8A 1AVXA 1GHAF 1HCGA 3F9GA 4WVPE 1N8OB 1PQ5A 1OWKA 5LPRA 4HTCH 1YGCH 1P05A 4U32A 1ELGA 5CHAC 1C5SA 2AGGX 1LTOA 3RU4D 3EE0B 4Q7YA 5JYIA 4ABBA 3LC5A 1Z1IA 3SV9A 2FYQA 1V2OT 3LGUA 1AUTC 3KL6A 1O36A 3BEUA 1OSSA 1DM4B 4OS6A 5C5NA 1IOEA 1TMBH 4NIYA 4DW2U 1O31A 4NA9H 1VCPA 2RCEA 5EPNA 2V35A 1KIGH 3LONA 3GISB 3JZ2B 3S9BA 1GMDG 1EJMA 1PPBH 2Z9KA 2VB0A 2SFAA 1BBRE 4KGAA 1ACBE 2VINA 3URCA 4IGDA 4X8VH 2AIQA 1GDUA 2P16A 1UVOA 1T31A 1EAIA 4B73A 1WOFA 4FUCA 3UR9A 2ZU2A 1K2I1 2R2MB 4HFPB 2RG3A 2NU3E 2O9QA 2ZCHP 3RXGA 2D8WA 2GKVE 1O2TA 1MBMA 1MAYA 1JIMA 1XKBC 1UVTH 1QL9A 4X6OA 1C1RA 3I77A 1O35A 5EXLA 5A8XA 2XC4A 2BLWA 4Y71A 4D8NA 1UTOA 3LOXA 4WMDA 3PB1E 2SGPE 1K1NA 1H1BA 2PW8H 1ABIH 1Z8GA 4ABIA 1KXBA 2G5NA 1DT2A 2F9BH 1P3CA 3OU0A 4I8HA 2PSYA 1V2MT 1GBMA 4IMQA 1ZYOA 1HJAC 5E0GA 3O8CA 2SGDE 1ZRKA 3RXOA 1LKBA 3CP7A 2O8UA 2J95A 3CENA 2ZGBH 3GCTF 1MCTA 4LXBH 1C2EA 1SFIA 3RLWH 3B23B 2VJ1A 1ETRH 3LC3A 2ZU3A 4YM9A 1NS3A 1QJ6B 1XVOA 2G5VA 3MU5A 4ISOA 1BBRH 4DT7B 1TX7A 1NRRH 1Q2WA 2OQ5A 3FP8E 2PV9B 1P2MA 1C1OA 3LU9B 3MU0A 3S9CA 3VB7A 2A45B 3UQVA 1GBHA 3TJNA 1GBBA 1SGFA 1SHYA 4IW4E 2Y6TA 1PJPA 3S0NA 1NN6A 5HXFA 3SV7A 1DS2E 1H8IH 1YCPM 1RS0A 4WWYA 1GJCB 1AE5A 4LZ4B 3ZV8A 1IQMA 1LHFH 3A8BA 3BTWE 3QUMP 2F9VA 4ABDA 2CF8H 2ZHDA 1WU1A 1L1GA 1Y59T 4YTAA 1IQEA 4ZKRU 2BY8X 1ZTJA 2FWWA 3FZZA 3MHWU 1NZQH 1XKAC 4CBNA 1O30A 1SI5H 1O2JA 1ESTA 2QYIA 2HNTF 3MFJA 1FY4A 1GJDB 1IQNA 2XBYA 4Z0KA 1C2MA 1MTNB 1EZXC 1QBVH 4ABAA 2ZU1A 1PPHE 3HATH 2H9HA 2OC0A 2ZC9H 1BMMH 1H4WA 1Q31A 3KCGH 4ZKSU 1Y3UA 3VFEA 3PV4A 3E0NB 2ASUB 1O3NA 2PUXB 3GDSA 3FZDA 4K69A 1J15A 1OOKB 3SNDA 1WSSH 3E8LA 1BMAA 1JRSA 1NU7B 1PFXC 2A32A 3M5MA 4D9QA 4X2XA 1TGSZ 1PPZA 2F9OA 3M3TA 5CHAB 3MNXA 4YO9A 1E34B 5TCCA 4ZKOU 1EPTA 2FOEA 2ZCKP 1HAVA 2PSXA 3V12A 4DIHH 4Y10E 1C5MD 1KXCA 1GBLA 5EG4A 4GSOA 4X6NA 1QRWA 3P95A 4CR5A 5DJ7A 2JH5D 3RXJA 1UVSH 1LDTT 1A3EH 1AMHA 2WPKS 4ZKNU 1SGDE 1K28D 3NXPA 2F9PA 3K6YA 4TPYA 3SUDA 1V2VT 2H9EH 4TWWA 1EOJA 1A0LA 3A84A 1GHBF 2FYRA 1S5SA 4GCHF 1K1LA 3GDVA 5FX6A 2VH0A 1NC6A 4JYUH 1UTMA 1RIWC 3ENSB 3F9FA 3LKWA 1TAWA 1XM1A 3ATLA 1BUIA 3LDXH 5JBTA 2GD4B 3S69A 2FOGA 2BD4A 5GCHF 1SR5C 2Y5FA 1ZZZA 3TVJB 1F5KU 1KDQB 1ORFA 1LKAA 4D7FA 4MNVA 1O5GH 3UREA 4DJZB 1RTLA 5AHGH 3FAOA 1O3OA 2Y82A 2R3YA 3SNBA 3VB4A 5DP3A 1TNLA 1O3HA 2GX4A 2A4GA 2G4TA 3RXLA 3Q77A 1C4U2 4INLA 1YC0A 5T6GA 1TIOA 2GCTC 5HMAA 3TGIE 4ISHH 1GJ5H 3V13A 1BZXE 2D1JA 1MKWK 2CXVA 1KYNA 2FESH 1DUAA 2ZA5A 1KY9A 1SSXA 3T5FH 1AE8H 3BTDE 5DPAA 1P02A 5JBCS 4FVBA 1BTYA 1EP5A 3PO1C 1CO7E 1O37A 1YPHC 2VWNA 1HAVB 2AMDA 4ZHAA 1GG6C 1UO6A 1FXYA 2SGFE 4IC5A 1W11U 3HPTB 1Q3XA 2ZFFH 1RGQA 3QWCH 4BXWA 1W7XH 3Q00A 1CGIE 4UONA 2PFEA 4NCYA 1S6HA 2H1UA 1O3EA 3SJ9A 1C5WB 4B2BA 2BYAX 4Y8XA 3RXPA 1EQ9A 3RXDA 2XC0A 3P6ZB 4K3JA 1GVKB 2ZPRA 1GBTA 4DIIH 1TQ0B 4MPUA 1RTKA 1LVMA 3P70B 3PROA 1D6RA 1K9OE 4ABFA 1GJ7B 2PLXA 1O2XA 1O2QA 1EJAA 4GVUA 1UK4A 3D23A 2QCYA 1E37B 3F9EA 2ZHQH 1SQTA 1D3QB 5DP7A 1T8MA 1OWHA 1P2QA 3A82A 5J4QA 1ZGVA 4DURA 2WPHS 1A2CH 1WAYB 4AOQA 3E3TA 2QAAA 1DFPA 5DP9A 3ATMA 3V3MA 1SFQB 1OPHB 1SQOA 2W3IA 1ELTA 1W13U 4A6LA 5K0HA 2J2UA 3GCOA 1L1NA 3UR6A 1FAKH 1SGCA 1S84A 1QTFA 4IMZA 4NIVA 2UUJB 3SUEA 4AB8A 3RU4T 6GCHF 2BX4A 2VU8E 1G9IE 2P93A 3RMMH 5K7RA 1O5EH 4OS4A 1HJ8A 4HI3A 1TOCB 1E35B 4NIWA 1DY9A 1O5FH 1CHOG 1ANDA 1ELAA 1C2JA 1TPOA 2ODPA 3U9AH 3ZZ3A 2A4QA 4JZ1A 3UNSA 3RXEA 2BZ6H 1BITA 2A1DB 1GL1A 1DANH 1GVZA 5C2ZA 6CHAB 2B0FA 2FLRH 1AZ8A 1OYQA 2FMJA 3ZZ8A 3GY3A 1DDJA 2VIQA 5FBIA 3QN7A 4A1XA 2KAIB 4BAQB 3QTOH 1A5IA 4BAOB 2ALVA 1DSUA 3U8OH 1DLEA 2UWPA 2FM2A 3NCLA 2P3UB 2AMPA 3RM2H 1FJSA 1M9UA 3SO3A 4I8KA 4CH2B 1HV7A 3LH3A 2EEKA 1SQAA 1SBWA 3S7KB 5H4IB 5EQQA 3S9AA 1O5CB 4VGCB 2BMGB 1S81A 1WCZA 1VITH 1GHXH 2GTBA 1C5VA 1Z71A 3GY4A 1HAXB 3SOSA 5JPMH 2FOAA 3EQ0H 1ZPBA 3E91A 4HZHA 3BEIB 1P04A 1AWHB 1C1MA 1SGEE 3HKIB 2ZWLH 4MG3A 3EA7A 5LPEA 4NWKA 1O2KA 2Z3CA