1WCZA

Crystal structure of an alkaline form of v8 protease from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
215
Chain Sequence
b'VILPNNDRHQITDTTNGHYAPVTYIQVEATGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl endopeptidase
publication title Crystal structure of an alkaline form of v8 protease from Staphylococcus aureus
rcsb
molecule tags Hydrolase
total genus 58
structure length 215
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wczA02
3OTJE 2BDHA 1GBTA 2CJIA 3MO3A 2J95A 1H8DH 4NFFA 3LGUA 1DXPA 4UE7H 1C1PA 1OXGA 1K1OA 3ZVCA 8GCHG 1A46H 2FI4E 2Y7XA 1HAHH 4NIXA 1AWHB 6CHAB 1PPEE 3RXIA 1UCYH 2QAAA 2Z9IA 4Y71A 2QF3A 1NU7B 3S9CA 4Y7AA 2A7JA 1TMTH 3KGPA 2TPIZ 2Q6GA 3EYDA 2VIOA 2BOHB 1AD8H 4AYVB 3F68H 5DO4H 1FDPA 3SU4A 1TABE 1L0ZA 4GUXA 1EX3A 1HRTH 1HGTH 3RXSA 1QBVH 1J15A 5JBAS 4ZHMU 2G00A 1ZSLA 1NFXA 3BTTE 3GDVA 1GBMA 3VGCB 2TIOA 3UWJH 2A7HA 3MNXA 4AG2A 2P8OC 4YM9A 1UTLM 1V3XA 3M3SA 4OGXA 4F4OC 3FAOA 3MI4A 5EG4A 3UOUA 1J14A 1BHXF 2QA9E 4ZXYH 2VWLA 5EOKA 3SGAE 4ISNA 3NXPA 4MPWA 1QJ6B 1BJVA 2BY7X 4BAHB 1HXFH 4ISOA 3TJNA 3K65B 2OCVB 1AFQB 1TA6A 1IQKA 1V2ST 1O35A 1O2GH 1O2HA 5FHTA 4M7GA 1P11E 4Y79A 2HRVA 2SGQE 3VXEH 2SGPE 1N6XA 1EOLA 1MBQA 2EI8A 2ZGJA 3S0NA 4LZ1H 1VGCC 4X6MA 4BNRA 3KQEA 2TRMA 2PTNA 3P8OA 4J1YA 4NSYA 5EXLA 3F1SB 4ASHA 4X1QU 2QCYA 9ESTA 1SPJA 2ZKSA 3V13A 1KLJH 1C2LA 2OTVA 3SJIA 1P01A 4FUCA 1GDUA 1PJPA 1NZQH 1A5IA 3DHKH 4X8VH 1UHBA 3SV2H 1KTSB 2VIPA 1AO5A 1KYNA 1GVZA 3LDXH 3NZIA 3EE0B 1DE7H 5DP6A 3PO1B 5IYTA 4DURA 2FTMA 2FM2A 3ATLA 1NN6A 2HNTE 2Y5FA 3DT0H 1E0FD 1EPTA 3A86A 1DFPA 1GVKB 3SU6A 1TONA 1AN1E 1FI8A 1GMHG 1AIXH 1O5AB 1ZZZA 1H9IE 1BHXB 3KIDU 1CT0E 4JYUH 2FYRA 4K1TA 4Y8ZA 1YGCH 3A8BA 2THFB 1C5NH 1BITA 1HPGA 3HKIB 3IWMA 3QLPH 1GBFA 3A8DA 2A31A 3KQDA 4YLUA 5G4BA 4U30A 1TPSA 1MMJN 5EQRA 3ZVGA 4ZH8A 3ESTA 1DSUA 1ELCA 2LNCA 4SGBE 2A5IA 2ZF0H 3T27A 4AG1A 2FOGA 1ELFA 1RIWB 3UIRA 3UFAA 3SHAH 1VCQA 1SSXA 1O3DA 2WPLS 4X8SH 4X1RU 2Y7ZA 2HGTH 4I8LA 3URDA 1UVUH 3OU0A 4Y11E 3FP6E 1F0RA 4FUGA 1GHAF 3UUZA 2Y82A 3LGTA 1H8IH 3PMJA 1K1IA 1GBEA 5EXMA 4ZKNU 2F91A 2RCEA 2FOBA 2GP9B 5DK1A 2NU1E 4ABHA 1EQ9A 1A61H 1CVWH 1IAUA 4AYYB 1CA0C 2G55A 1V2VT 3PLPA 5DG6A 2F9PA 1BTZA 3LC3A 1D3PB 2QY0B 1GBAA 1TNJA 4NCYA 1C2FA 3O8RA 1O3AA 1KXDA 1NRPH 2B5TB 1J8AA 2H9TH 2BDBA 4X8UH 1DUAA 3RXJA 4INKA 3AVZA 5C1UA 3STJA 5JPMH 3EA8A 2ASUB 3RXAA 1GCTC 1Z1JA 4DOQA 1LVBA 1O2WA 1Y3XA 1J17T 1MZDA 5T6FA 1CHOF 4IMQA 3SO3A 2ZTZA 5AFZH 1SQTA 3A82A 2AMPA 2J4IA 2XBXA 1QCPA 2QN5T 2IOTA 3SQHE 4HGCA 1P2NA 1LHFH 1WUNH 2QC2A 4GPGA 3LC5A 1IQJA 3VB6A 2Z9KA 1AE5A 1N6YA 1G37A 3FANA 3QZQA 2FEQH 3P8FA 2FOAA 5FXLA 1C5LH 1NU9A 1ZGVA 3E8LA 2KAIB 2FLBH 2BD5A 3ATMA 5A8ZA 2ZECA 2XWBI 1O3GA 1OSSA 1C5WB 1ZLRA 1HXEH 1ZTJA 3BTKE 5LGOA 4OGYA 3T62A 4BXWA 3H7TA 4MQAA 1D6WA 1Z8IB 2C4FH 4ESTE 2OINA 1V2RT 1C4Y2 1EOJA 4CBNA 2ZCHP 2W7UA 1HJAC 3KEEA 1A7SA 2ZHWH 3A8CA 4I32A 3TJUA 3CENA 1MD7A 1YPHC 4CREA 1LDTT 2H1UA 4VGCB 4ISLA 1P10A 4Z6AH 1FPHH 4YT6H 1MKWH 4A1XA 2PWXA 1C2MA 1UK3A 4ABIA 2W26A 4UFEH 1P2MA 3TH4H 3MWIU 2VGCC 4TPYA 1XUKA 2Q6DA 2CF8H 3SV9A 1MKXK 2ZGHA 4CH8B 1HB0B 3ATIA 1K1LA 1SOTA 2HOBA 4MPVA 5GPIB 1GL0E 1O3NA 4A7IB 1SGEE 3K6YA 3M37A 4QT8C 3M7UA 1TALA 5AFYH 3NUMA 1SFIA 4AB8A 1T4VH 2QGRA 3AAUA 1F5RA 1C1MA 1EPTC 1ZPBA 1D3QB 2ZDLA 4JK6A 1GBKA 1N8OB 1O2KA 2UUKB 1TX7A 3UOPA 1PQ5A 3MH5A 2PKSC 1GG6C 5A2MH 1MBMA 1C9TA 3RLYH 4FUIA 2I6QA 3DD2H 3T2NA 1EZUC 1TA2A 2C93B 1NPMA 2FZZA 3QTOH 1QL7A 3BTWE 1ORFA 1ZJKA 1LHDH 2NU2E 3LGYA 3V12A 2A0QB 3RC6A 1MD8A 1IQNA 3LH3A 3U8OH 1O3FA 1OS8A 4GLYA 3EAJA 4YLQH 2AGGX 1P57B 3AAVA 3MNBA 4K60A 5A09A 1OOKB 3L3TA 5EW2H 3UWIA 3OY6U 1TX6A 1F0UA 1ELVA 3RC4A 1KXAA 2GMTC 4FUEA 1C5MD 2GZ9A 3KF2A 5AVDA 3GCTF 2WYJA 3ATWA 4DT7B 5HM2A 1EAIA 4BOHA 3A81A 1PPHE 2F9OA 4LK4A 2BOKA 2AIPA 3SNBA 4A6LA 4BAOB 2B9LA 2PGBB 5DP8A 1GDQA 3A89A 3GCNA 2ODQA 1A5HA 1RD3B 1GVLA 5ESBA 4Y0YE 2P94A 2H5DA 1G32B 1L1JA 1JOUB 1C5UA 1W0YH 3GY5A 5LPEA 1CHGA 1MCVA 3ZVDA 2XTTB 1DM4B 2C90B 1QRZA 3RMNH 1O5EH 4X2XA 1DWEH 4ZKSU 1GHAG 1W7GH 1ZHMA 2V35A 1XKBC 1C1NA 3E6PH 3EQ0H 1TQ0B 1EAXA 4JK5A 1NFWA 4MPUA 3GOVB 1PPFE 1Y3YA 2PW8H 1ELBA 1DANH 1O2JA 1FQ3A 3ZZ7A 3RUOA 4ZAEA 3ZZBA 4Y0ZE 3ODFA 1FNIA 1U6QA 5JBTA 2AEIH 1K9OE 1ELEE 1JIRA 5DP3A 1BTHH 5JBCS 1G3DA 1H1BA 1FN8A 1WAYB 3O8DA 2VIWA 4UEHH 3BEIB 3NCLA 4INLA 2PV9B 3TGIE 2R2WU 4BANB 5DJ7A 4O97A 1TGSZ 3ZYEA 2H9HA 1AB9C 3RXCA 5DKMA 2JKHA 2KAIA 3EA7A 4Y10E 1O3PB 3GY2A 1HJ9A 2QIQA 2ZA5A 1O2OA 3ZVEA 3BEUA 1CHOG 4MNWA 4NFEA 1YPJH 2O8MA 3R0FA 1V6DA 1YPGH 1Q2WA 5FPSA 3QTVH 4MVNA 1QHRB 1TOCB 1AFQC 1WBGB 4B2CA 1E34B 4NWLA 2W5EA 5L2ZH 3HKJB 1MQ5A 1TMBH 2OP9A 2BVSH 3U98H 1SGFG 3OSYA 4IGDA 2FPZA 8KME2 1O2NA 3ZZ3A 4UFFH 2FX6A 2BD4A 2ZPRA 1EP6A 4GSOA 4BAKB 4MG3A 2BDIA 1T8OA 1BCUH 2VWOA 5A0CA 3A7XA 1C1QA 4NZQA 2ZZUH 2P59A 2OC0A 2FP7B 1EZSC 3CP7A 3I29A 2GZ7A 1OWJA 2BDYA 5FBIA 1V2JT 4OS7A 1UMAH 1JMOH 1NC6A 2FTLE 1VJ9U 2P93A 1RJXB 2ZNKH 3UR9A 1A2CH 1DUEA 2BLVA 1UJ1A 1FIZA 1O5CB 3SORA 4ZHLU 2DE9A 3LPRA 3PO1C 1P3EA 1FY8E 2GCHF 2A5AA 2QV1A 3DFLA 1G9IE 1C5TA 1MTSA 1GBJA 1A5GH 1SGFA 4I33A 1C2DA 2W3IA 1WU1A 1KXBA 2V3OH 1C2JA 3GY8A 1LPZB 1WSSH 1SLUB 2VIQA 1Z6EA 1BBRK 1C1VH 3E90B 1E37B 2GT8A 4THNH 3RU4E 2J2UA 4TYDA 4GAWA 3UNRA 2AERH 1S84A 1O3OA 1DWCH 2ALPA 2TGDA 4XBCA 1YLCA 1W0ZU 1Z1IA 1EJNA 1KDQB 2ZP0H 4BAMB 1THSH 5A8YA 4ABJA 3SNEA 1SB1H 2ZCLP 2O8LA 1IHTH 1GBHA 1TE0A 1OX1A 2AYWA 4D9RA 3UY9A 1C5SA 2VVUA 1GGDB 1A3BH 6GCHF 1T8NA 1UCYK 1D3DB 1AVGH 1SFQB 1A0LA 1WYKA 3H5CB 4E7NA 4D7FA 6ESTA 2O8UA 1O38A 1SGCA 3HGNA 1NROH 3K6ZA 1EASA 4SGAE 4B75A 2FS8A 5TJXA 2OD3B 5GCHF 1BTWA 2YNBA 4AFSA 2WPIS 2BHGA 5HXFA 1SQAA 1BUIA 2UWOA 1C4V2 1WQSA 4AZ2B 5C5NA 4I8HA 4UONA 2ZI2H 1NFUA 2SNVA 1GI4A 3A7WA 9LPRA 1ESTA 1S0RA 1UVTH 5FBEA 1ZRKA 3A8AA 3UQOA 2P16A 1TNHA 2WPHS 4WMDA 4IW4E 1RTFB 4ISHH 3RM2H 2R3YA 4Q80A 1OWKA 4A92A 3BEFB 3GCTG 1CT2E 1H9LB 3UQVA 5LPFA 4YTAA 5LH8A 3F9EA 3SJ9A 3BTGE 2CF9H 4CRFA 2VH6A 1O34A 2PFEA 1K1NA 3NWUA 1O30A 1AI8H 3SUGA 1O5GH 5FAHA 2BX4A 4NSVA 1LKBA 1LTOA 2ZDNA 1MU6B 2C8XB 1C1TA 3QK1A 3VEQB 3S9BA 4WMEA 1ETRH 1TPAE 4YESB 1DOJA 4MTBA 1QBNA 3ITIA 1CBWC 1PFXC 4E05H 1XUFA 2ULLA 1KSNA 3OY5U 1SGPE 4AGJA 1ZRBA 1O2IA 2OLGA 1RTKA 3M5LA 1KLTA 3CS0A 5C1XA 4KTCA 3TLOA 5GDSH 4DY7B 4NA7A 1F0TA 2VVCA 2BDGA 1O3EA 5GIBA 4KGAA 1GHXH 2F9NA 1SC8U 1C1SA 2BY8X 3BG4C 3VB5A 2XBWA 1C9PA 1EZXC 1ZR0A 1ZJDA 5HM9A 4WWYA 3Q3YA 1FXYA 1UVPA 1W14U 1ZYOA 4HZHA 3MH7A 1K21H 1DXWA 5I25A 3M61U 1BRBE 2AH4X 3D62A 3HATH 1P04A 2FS9A 2BMGB 1IQGA 2D26C 1ARBA 2PR3A 2ZDMA 2ZHEH 3MMGA 4IMZA 2RDLA 5B6OA 2BXUH 3EA9A 2A2XH 4RN6A 4CHAC 4LOYH 2FDAA 1MAYA 1UVSH 2BY6X 1MUEB 1YPMH 2STAE 2OXSA 1HJ8A 1RXPA 1GL1A 1DWDH 3MOCA 1NY22 2SGDE 3PTBA 3SBKA 1QL8A 2FIRH 4HI3A 2HWLB 3OYPA 4NIVA 4ABBA 3ODDA 4XBDA 5GXPA 1SI5H 3SU1A 3RXMA 1SVPA 3PB1E 1AE8H 2P95A 3D65E 5FCRA 5FPYA 1FZZA 1XX9A 1O2MA 1TLDA 2ESTE 1ZPCA 1TGNA 3GDUA 4WVPE 3SNCA 1NTPA 2JH5D 4E06H 5SGAE 1PPCE 3VB7A 2CN0H 2BD2A 2QXGA 5CHAB 3SN8A 3U8RH 2BLQA 2A45B 1C1OA 4BAQB 1AZ8A 2GGVB 1GJ4H 3RXHA 4DG4A 4JYVH 3SZNA 2ZPSA 2GCHG 1FJSA 1A3EH 1TAWA 2YOLA 1KDQA 1HAIH 4IS5A 1G3EA 1AKSB 1W3CA 5J4QA 4DCDA 5JDUB 3S7HB 3TIUA 3MYWA 1RFNA 1SHHB 2ZFFH 3OX7U 1HUTH 1GI6A 1L1GA 2W7SA 3MNCA 1ELGA 4DIIH 1JRSA 2BQ6B 2VJ1A 2XC0A 4RKJB 3M5OA 2ZG0H 4ABGA 1ELDE 4TPIZ 3RM0H 1G3CA 1XVMA 1VR1H 5FPTA 1QQUA 3LH1A 3O8BA 3U9AH 1A4WH 1O33A 2JH6D 3SV7A 1MTVA 1DY8A 1XM1A 1F2SE 1OWDA 4NG9H 1F7ZA 2GCTB 1GBDA 4K1EA 2G52A 3FP8E 2PTCE 2TGPZ 4GHTA 1W11U 1NRSH 1SLWB 1QIXB 6GCHG 5ESTE 1J9CH 5FX6A 5T6DA 7ESTE 3P17H 5EODA 1CU1A 3GY7A 1C5RA 4UD9H 1FY4A 1M9UA 1UTPA 5C20A 1FN6A 2R9PA 2WPKS 5GCHG 4AFUA 3ZZ4A 1C1UH 1NRRH 2FOFA 1C2KA 1QURH 2F3CE 3SU2A 3TK6A 1XUIA 4Q7ZA 1BDAA 3RXRA 2O8TA 4JMYA 1DS2E 2GV6A 3BV9B 4HFPB 4GCHF 3RXBA 3SV6A 1MKWK 4X1PU 4U01A 2XXLA 2CMYA 2Z6BD 5EQQA 1J16A 3W94A 3SNAA 1ZHPA 4K2YA 1ETTH 3MO6A 4IN1A 1P8VC 1WTGH 3S9AA 1OYTH 3WY8A 1X7AC 4X2YA 2FOEA 2J92A 4Q7YA 1Y3VA 3VB3A 1OWIA 3I78A 5GJ4B 4ZUHA 7KMEH 4XBBA 4O03A 4YOJA 3GICB 2XBVA 3RP2A 3Q76A 5F6MA 1YCPH 1GJ6A 1NRQH 4MNXA 4H6SB 4DGJA 1CE5A 1BJUA 2GDEH 3P8NA 1MTNC 5BRRE 5F03A 5EW1H 1Q3XA 1SR5C 2Z9GA 1XXFA 2HLCA 2JH0D 3UNQA 3BTQE 2CHAB 2ANWA 3QWCH 3EGKH 1PYTD 4CRBA 3LKWA 2ZGCA 1NS3A 1IQFA 1O3KA 1GI2A 1YP9A 4JZDH 4XE4A 2ZEBA 3B8JA 1TNGA 2HVXA 2Y5GA 2VB0A 1G30B 4LXBH 1ANDA 1O5BB 3F9GA 3ZZ6A 2GKVE 3ZZ9A 3GY4A 2OBQA 1BTPA 4MNYA 1TGBA 2DUCA 3TJVA 2OC7A 2FMJA 5EPNA 4NA8A 4BTIB 3GCHC 1T8LA 3VFEA 1LHGH 1GJ9B 1YPEH 1ZOMA 4K3JA 1DICA 1DPOA 2UWPA 1WV7H 3DA9B 1TPPA 5GWZA 5DPAA 4YT7H 1BB0B 5DGJA 2XRCA 2B7DH 2ZDVH 4D8NA 2QYIA 1LVMA 2XBYA 1T31A 1G2LA 1IQMA 1UK4A 4HTCH 2ZFTA 1HDTH 4WY3A 1SGTA 4DVAU 4I8KA 1DDJA 2PSXA 3LOXA 5A0BA 1VCWA 2SGFE 2BLOA 1O2YA 1BMLA 1E35B 1P06A 1GBBA 3LONA 1D4PB 5HGGA 1TIOA 1VITF 1C5VA 3RMLH 1FY1A 3HK3B 2WINI 1OP0A 2H5CA 4X1NU 1GJDB 4IBLH 1XMNB 1AKSA 1JRTA 2BTCE 4FU8A 4KELA 1H4WA 1TYNA 3TPIZ 1KXFA 4I7YH 3RXFA 2GTBA 1TFXA 2ZU1A 4O9VA 2AIQA 1EP5A 2Z3DA 1T8MA 2J9NA 1W10U 2BXTH 4CRAA 5JB8S 2Z3EA 1ZSJA 1DY9A 1AY6H 2PGQB 2ZIQH 1K1JA 3QO6A 6CHAC 1QJ1B 3PMHB 2ZHFH 3SUEA 1C4U2 4XSKU 3SGQE 1RTLA 1OPHB 3P6ZB 1GBCA 1S83A 3H7OA 4AFZA 1CT4E 1PPBH 3T28A 1O2PA 1CA0B 3N7OA 4B74A 1GJAB 4K1SA 2P3TB 4WMFA 5FCKA 3MU0A 3AW1A 1BRCE 2OC1A 3DUXH 2ZFQH 4ABDA 1B0FA 3CS7A 1Q31A 1O2TA 1KIGH 4IC5A 1EXFA 1Y5UT 1ZTKA 1W8BH 4WF8A 1QR3E 2GD4B 1HIAB 3VGCC 2BDCA 1GJ8B 1V2NT 1P9SA 5E0GA 2EI6A 1P09A 3LIWA 3PTNA 3QX5H 1DX5M 2HNTC 3M7QA 4FUDA 2Q6FA 4XFQA 4KKDA 1HLTH 1P05A 2VWNA 3SJOA 2EC9H 3V3MA 2H9EH 2VU8E 1UTKA 2Y6TA 4ZROA 1A0JA 2ODYB 1D3TB 1AQ7A 2ZHQH 1AFEH 2NU3E 3GY6A 1GI5A 4GCHG 3BTEE 1MCTA 1TB6H 1DSTA 3SU0A 4NA9H 4ZMAH 2JETB 3BTHE 3QGJA 3GYMA 2A4GA 1UTMA 1ZSKA 4CR9A 1Z8RA 2HALA 5L6NH 1MQ6A 1RS0A 2ZQ1A 3SUFA 4H4FA 5L30H 1YPLH 5C5OA 1ESBA 1EATA 2O8WA 3RDZA 1C1RA 1Y59T 1ETSH 3A87A 1HAVB 1O5DH 3PWCA 3DFJA 4K8BA 3VB4A 3RXEA 4I31A 1QFKH 3TU7H 1MZAA 1P2IA 1AMHA 7GCHF 3ATKA 3RXKA 3LGVA 2LPRA 1GMCG 2VGCB 3TH3H 3ZVAA 1GJCB 1HV7A 3P92A 4DJZB 3M5MA 1F5KU 1FY5A 1HAZB 1BT7A 2A1DB 2VVVA 1GJ7B 1LQDB 3U1JB 4JZEH 1TOMH 4X1SU 5K0HA 4I8GA 1HAPH 4AFQA 1LPKB 1EZQA 1GCDA 3E91A 4U32A 1TRNA 3W95A 1B5GH 4X6PA 2OC8A 1FV9A 3ZV9A 4GHQA 4TY6A 1GWAA 1Y3UA 1S81A 1QL9A 8ESTE 3SW2B 1FUJA 2ANYA 2UUFB 1PQAA 2PKSB 1GG6B 2NWNA 2W3KA 3K9XB 1C1WH 2C3SA 1JBUH 1Z8JB 2AMDA 1BMNH 3BIVH 5C3NA 1CO7E 3ZV8A 2VINA 1YLDA 1UK2A 1RIWC 3RMMH 4KTUA 1YPHE 1ID5H 1GI0A 3Q00A 1LHCH 1C2IA 1P2OA 4I8JA 1C5OH 1NM6A 3HGPA 2ZU5A 1GI8B 2WV4A 2Z94A 1HYLA 5E8EH 2XWAA 4ZHAA 1L1NA 4K69A 1SGQE 1THRH 3QN7A 2BZAA 8LPRA 2FOCA 1ELAA 1TBZH 4INHA 1CQQA 1FAXA 1XUJA 1ELTA 4WXVA 3MU4A 2FLRH 3T26A 3SOSA 4X6OA 1V2KT 3QDZB 1AU8A 4CH2B 1YBWA 2EA3A 4AORA 2QXHA 3A84A 1QBOA 2V6NA 2A7CA 2GCTC 2Q1JA 2GMTB 1UTOA 1ZGIA 1O2QA 3SU5A 1EAWA 1XKAC 2TGAA 3KN2A 1E36B 1P2QA 1W13U 1HCGA 1QY6A 5EU8A 2XNIA 5DP9A 3M7TA 1GMDG 1VITG 3EDXB 3IITA 4B76A 3UPEA 1T32A 4CRDA 2PUXB 1VJAU 1QRXA 4OS1A 2UWLA 4WJG2 1LKAA 3FP7E 4B73A 3FVFB 3L6PA 1KTTB 1OWEA 4X6NA 1Y3WA 2SFAA 2BDAA 3A7ZA 3RXGA 4X2WA 1ANBA 1GHBF 2ANKH 5FX5A 4NZLA 4JZFH 4OS4A 2Y80A 1HFDA 2XCFA 1GJBB 5K7RA 1C5YB 2G51A 1S82A 4TWYA 4J2YB 3FZZA 2ZFSA 5DP4A 3Q77A 4KP0A 2GV7A 3AASA 1MTWA 2Z3CA 2WV5A 3RXUA 3NK8A 2C8WB 2BD7A 4ZKRU 4O3TA 1NO9H 2H2ZA 3MU5A 1HIAA 2ANMH 4AOQA 1SGYE 2BD3A 3D49H 4ZXXH 4AX9H 1ZPZA 3PMAB 2GT7A 2XCNA 1KXCA 1BTYA 1NT1A 2BD9A 2R2MB 1GI9B 4VGCC 1QB6A 1FY3A 2BYAX 5F8ZA 2BZ6H 4FUFA 3UREA 1ZMLA 2I6SA 3MTYA 3E16B 1GHWH 2AFQB 2AGIX 1AB9B 3BTFE 1K1MA 4FVDA 4FUBA 3SI3H 1TBQH 1GJ5H 1WQVH 4BTUB 1BRUP 4YO9A 1S5SA 1VITH 1W7XH 5E2OA 1HAOH 1V2WT 2CHAC 1QJ7B 1GBLA 3GCOA 2J34A 4MLFB 4B1TA 4K8YA 1HAVA 5DP5A 1NFYA 3TNTA 1O32A 3GDSA 1GBIA 1K22H 5JB9S 3GISB 5TCCA 3JZ2B 1GHVH 1N8OC 1WTHD 3RU4T 3RU4D 1YYY1 3PLKA 1TMUH 1C2GA 3VXFH 4O3UA 2ILNA 3A83A 4ABAA 2AS9A 3C27B 3E0PB 2A4OA 4CRGA 4NGAH 3RC5A 3U69H 5LPRA 1P3CA 2AGEX 1AUTC 4B71A 3M5NA 1C5ZB 1AGJA 1VZQH 2BX3A 2PHBA 1PQ8A 1PPZA 2J94A 1EUFA 1UVOA 3KCGH 1O37A 7GCHG 2ZCKP 1ANEA 3GYLB 1Z8GA 3STIA 3U8TH 5HMAA 1SL3A 2OUAA 3BG8A 1G36A 3PV4A 3TGJE 3RXOA 3S7KB 2BQWB 2C8YB 4OS2A 1FMGA 2BY5X 2ZWLH 4D9QA 3BTME 1RRKA 1PPGE 2GX4A 2BB4A 3M3VA 1XVOA 1QTFA 3I77A 1D6RA 1AWFH 1BMMH 3T29A 1INCA 4ISIH 1S0QA 3PLBA 2WPMS 2STBE 3MH4A 3KNXA 1TNKA 1GI3A 3GY3A 2ZGXH 4Z0KA 1IQIA 5CE1A 1TRMA 3RLWH 3ZVFA 2FO9A 4FU9A 2PKAB 1NESE 1V2PT 2ZFRH 1DWBH 1SLXB 3PWBA 5ABWA 1TNLA 2C8ZB 1UTJA 1ZTLA 1O36A 1TQ7B 1P12E 1L4ZA 1UTQA 4UFGH 1Y5AT 1ABJH 2F9VA 1Z7KA 1DT2A 1CSOE 1O39A 4KTSA 3MFJA 3MNSA 3D23A 2D8WA 4XOJA 1YKTA 1OP8A 2XC5A 3NPSA 2PLXA 3B23B 1KY9A 2D2DA 4B2AA 1BZXE 5T3HA 4U2WA 4IC6A 1ABIH 1IQLA 1GI1A 1LVYA 3A7TA 4MNVA 4Q2KA 1GDNA 3A7YA 1YCPK 2F9UA 2TBSA 2H6MA 3A85A 3HPTB 2UUYA 4WXIA 1V2TT 1LPGB 3BN9A 4JZ1A 3VPKA 3MHWU 1KXEA 3SQEE 1OYQA 4YOIA 1Z6JH 1F5LA 2CXVA 1O3HA 3BTDE 3LU9B 4A5TS 3K2UA 2RA3A 4OS6A 4R0IA 2FI3E 2G4TA 1TGCA 4XDEA 4AB9A 1TWXB 1IHSH 1O2XA 1IQEA 1HAXB 1C5QA 3M36A 5TCAA 2FOMB 4GVUA 1V2QT 3RXTA 1MTUA 1HNEE 3RXPA 2CGAA 1VCPA 1A0HB 1GHBG 1GMCF 3F6UH 1QGFA 1CBWB 2XYAA 3A80A 3TNSA 1PQ7A 1QQ4A 2P8OB 5CMXH 3TGKE 1TPOA 1W12U 1SBWA 1DLEA 1O2LA 3ZVBA 1BA8B 1AUJA 1FIWA 2A2QH 1C2HA 1LCYA 2JETC 4NWKA 4RSPA 3FFGA 3T5FH 1B7XB 1OP2A 1UO6A 1L4DA 4ABFA 2UUJB 1GI7B 1O2VA 1W2KH 1BTUA 2ZPQA 1BTXA 4JZIA 1EJAA 5ETXA 3RMOH 3SGBE 1K2I1 4Q7XA 3ZZDA 1O5FH 3MO9A 3HK6B 3SJ8A 3SHCH 3BG4B 1SLVB 2O9QA 1YM0A 1O3MA 3B9FH 2B8OH 2ZU2A 2ZC9H 1XUGA 2BQ7B 1EJMA 3ZZ5A 3V0XA 3TK5A 2OQUA 2QF0A 2YNAA 3TJOA 5H4IB 4MPXA 1D9IA 1UTNA 1SMFE 2RG3A 1VGCB 1CGHA 3SUDA 5A8XA 4DIHH 3JZ1B 3IG6B 1T7CA 4CHAB 1ZMJA 1O3IA 2FX4A 2V0BA 4YOGA 3PMBB 1C5PA 4D7GA 4ZKOU 4FU7A 1QA0A 2J38A 2R0KA 3QZRA 3Q3KA 4R8TB 5C1YA 3KHVA 1BRAA 1HAGE 1S6FA 1Z71A 2PSYA 2G5VA 2F9BH 5E0JA 1GPZA 1MKXH 1YC0A 2Z7FE 2ZU4A 1GHZA 1P02A 3RXQA 4TY7A 1T4UH 3E0NB 3QUMP 1WOFA 5EPYA 2VIDA 2G4UA 1GGDC 2ZTXA 3LGWA 2ZU3A 1AVWA 1CA8B 2IPHA 5JBBS 3SJKA 2K1QA 1GMDF 4FUHA 1O2SA 1C5XB 3BSQA 5AHGH 1CGJE 3RXLA 2Y81A 1O3BA 3BIUH 4PROA 1V2MT 2EI7A 1JWTA 3U1IB 3ENSB 1O3JA 3SI4H 1ANCA 2FODA 8GCHF 1JXPA 6LPRA 1A1RA 3Q3XA 4X0WU 4FVBA 3V7TA 3NKKA 4UFDH 2OQ5A 2OBOA 4JYTA 5T6GA 3ZZAA 3T25A 2ODPA 4FXGH 2NU0E 3UNSA 2PKAA 2AMQA 1OKXA 4AN7A 2RA0A 1KLIH 3AW0A 3P70B 1OWHA 2M5TA 1F92A 1Y5BT 1L2EA 4D76A 2Z9JA 1SHYA 5IDKA 3QGNB 2VWMA 2V3HH 2HPQH 4OS5A 2WPJS 3ZZ8A 1P9UA 2ZTYA 2FXRA 4NIYA 2SNWA 5JYIA 1ZHRA 3G01A 1E38B 2FI5E 4CBOA 3MH6A 2XC4A 2ZO3H 1G3BA 1BBRE 2ZQ2A 2FWWA 1FONA 3PROA 7LPRA 3PM3A 1IQHA 4IN2A 3URCA 1EB2A 5DP7A 3MU1A 1B0EA 2GVFA 4RKOB 3P8GA 2P3UB 1HAYB 1GCTB 2XW9A 5HYOA 2G81E 1QA7A 4H42U 1DLKB 1V2OT 2A32A 1PYTC 3UTUH 3A7VA 1NRNH 1UCYE 1LO6A 1JIMA 5AF9H 2Z9LA 4A1TA 1TBRH 1EAUA 4Y76A 3FZDA 4JCNA 1LHEH 1O0DH 2GDDA 2R0LA 3KL6A 4X8TH 4DW2U 2ZDAH 1YF4A 4B2BA 5C67A 2PUQH 5EQSA 2P3FH 2TGTA 3O8CA 3SU3A 3PYHA 4AGKA 1S85A 1MH0A 1YPKH 2BM2A 5E2PA 3E3TA 4H6TA 3TK9A 1TX8A 3SV8A 3BF6H 1G2MA 2BY9X 5F8TA 2SGEE 4Y7BA 3KQCA 1ZMNA 2Y5HA 1LMWB 1SGNE 2VH0A 4Y8YA 2G5NA 1HJAB 3SNDA 1SGIB 1AVXA 4E7RG 3RXVA 5EXNA 4Y6DA 1FLEE 3TVJB 2FOHA 4UDWH 3LJOA 1SG8B 4K5ZA 4CRCA 1LQEA 1TGTA 4WH8A 2VNTA 1K28D 1EKBB 2QXJA 1K1PA 1MTNB 2HPPH 3ELAH 2FYQA 1Y8TA 5BPEA 3F9HA 1GMHF 1GHYH 2SGAA 3RXDA 3KQBA 3S69A 2BVRH 3C1KA 4A1VA 4CR5A 2GZ8A 1F0SA 1O31A 4NIWA 3TH2H 1QB1A 4FUJA 5L2YH 1SOZA 1UHBB 4BTTB 5PTPA 1SGDE 2CV3A 4LZ4B 2EEKA 1SGRE 1C2EA 2IN2A 5J4SA 1AZZA 1O2RA 3TITA 1AHTH 1O2UA 1EPTB 2D1JA 2A5KA 2R3UA 3A88A 2ZGBH 3R3GB 3F9FA 3MU8A 1IOEA 1P2KA 5CHAC 1V2UT 1O3CA 4MDSA 4TWWA 3M3TA 1SQOA 2BVXH 2A4QA 1DITH 1N1LA 3GCHB 4F49A 1ARCA 1P03A 2DE8A 5F8XA 3E1XB 5A0AE 1DVAH 1P2JA 1O3LA 2B0FA 1FPCH 1THPB 1ACBE 1ESAA 1XUHA 5I46H 3M35A 1BIOA 1TNIA 2NU4E 2WUCA 4X2VA 1QNJA 1V2LT 1H9HE 4WH6A 1S6HA 1CGIE 2IJOB 2WYGA 2ZDKA 2QXIA 3LJJA 4ABEA 1BQYA 2A4RA 5E0HA 3L33A 1EB1H 2FESH 2ZHDA 5C2ZA 3UR6A 3P95A 2VIVA 2F83A 1QB9A 5EGMA 1RGQA 1XXDA 3LGIA 4YZUA 4BXSA 1QRWA 1HBTH 1TRYA 3ZZCA 4Y8XA 2BD8A 1O2ZA 1YCPM 1FAKH 1BMAA 1BOQA 1BBRH 2ALVA 2HNTF 3ZYDA 1MAXA 1P0SH 2G8TA 2WUBA 2BLWA 1MU8B 3LT3A 1WCZA 1LVOA 2ZFPH
chains in the Genus database with same CATH superfamily
3OTJE 2BDHA 1GBTA 2CJIA 3MO3A 2J95A 1H8DH 4NFFA 3LGUA 3DSOA 1DXPA 4UE7H 1C1PA 1OXGA 1K1OA 3ZVCA 8GCHG 1A46H 2FI4E 2Y7XA 1HAHH 4NIXA 1AWHB 6CHAB 1PPEE 3UAIC 3RXIA 1UCYH 2QAAA 3FKSD 2Z9IA 1YWUA 4Y71A 2QF3A 1NU7B 3S9CA 2IJD1 4Y7AA 2A7JA 1TMTH 3KGPA 2J98B 2TPIZ 2Q6GA 3EYDA 2VIOA 2BOHB 1AD8H 1UW7A 4AYVB 3F68H 5DO4H 1FDPA 3SU4A 1TABE 1L0ZA 4GUXA 3FO8D 1EX3A 1HRTH 1HGTH 3RXSA 1QBVH 1J15A 5JBAS 4ZHMU 2G00A 5KEDA 1ZSLA 1NFXA 3BTTE 3GDVA 1GBMA 2JJ2D 3VGCB 2TIOA 3UWJH 2A7HA 3MNXA 4AG2A 2P8OC 4YM9A 1UTLM 1V3XA 3M3SA 4OGXA 4F4OC 3FAOA 3MI4A 5EG4A 3UOUA 1J14A 1BHXF 2QA9E 4ZXYH 2VWLA 5EOKA 3SGAE 4ISNA 3NXPA 4MPWA 1QJ6B 1BJVA 2BY7X 4BAHB 1HXFH 4ISOA 3TJNA 1E1RD 3K65B 2OCVB 1AFQB 1TA6A 1IQKA 1V2ST 1O35A 3F2HA 1O2GH 1O2HA 5FHTA 4M7GA 1P11E 4Y79A 2HRVA 2SGQE 3VXEH 2SGPE 1N6XA 1EOLA 1MBQA 2EI8A 2ZGJA 3S0NA 1E1QD 4LZ1H 1VGCC 4X6MA 4BNRA 3KQEA 2TRMA 2PTNA 3P8OA 2RFKC 4J1YA 4NSYA 5EXLA 3F1SB 4ASHA 4X1QU 2QCYA 9ESTA 1SPJA 2ZKSA 3V13A 1KLJH 1C2LA 2OTVA 3SJIA 1P01A 4FUCA 1GDUA 1PJPA 1NZQH 1A5IA 3DHKH 4X8VH 1UHBA 3SV2H 1KTSB 2VIPA 1AO5A 1KYNA 1GVZA 3H09A 3LDXH 3NZIA 3EE0B 1DE7H 5DP6A 3PO1B 5IYTA 4DURA 2FTMA 2W6ID 2FM2A 3ATLA 1NN6A 2HNTE 2Y5FA 3DT0H 1E0FD 1EPTA 3A86A 1DFPA 1GVKB 3SU6A 1TONA 1AN1E 1FI8A 1GMHG 1AIXH 1O5AB 1ZZZA 1H9IE 1BHXB 3KIDU 1CT0E 4JYUH 2FYRA 4K1TA 4Y8ZA 1YGCH 3A8BA 2THFB 1C5NH 1BITA 1HPGA 3HKIB 3IWMA 3QLPH 1GBFA 3A8DA 2A31A 3KQDA 4YLUA 5G4BA 4U30A 1TPSA 1MMJN 5EQRA 3ZVGA 4ZH8A 3ESTA 1DSUA 1ELCA 2LNCA 3EE7A 4SGBE 2A5IA 2ZF0H 3T27A 4AG1A 2FOGA 1ELFA 1RIWB 3UIRA 4ZCNA 3UFAA 3SHAH 1VCQA 1SSXA 1O3DA 2WPLS 4X8SH 4X1RU 2Y7ZA 2HGTH 4I8LA 3URDA 1UVUH 3OU0A 4P00A 4Y11E 3FP6E 1F0RA 4FUGA 1GHAF 3UUZA 4TSFD 2Y82A 3LGTA 1H8IH 3PMJA 1K1IA 1GBEA 5EXMA 4ZKNU 2F91A 2RCEA 2KFWA 2FOBA 2GP9B 5DK1A 2NU1E 4ABHA 1EQ9A 1A61H 3AK5A 1CVWH 1IAUA 4AYYB 1CA0C 2G55A 1V2VT 3PLPA 5DG6A 2F9PA 1BTZA 1H8HD 3LC3A 1D3PB 2QY0B 1GBAA 1TNJA 4NCYA 1C2FA 3O8RA 1O3AA 1KXDA 1NRPH 2B5TB 1J8AA 2H9TH 2BDBA 4X8UH 1DUAA 3RXJA 4INKA 3AVZA 5C1UA 3STJA 5JPMH 3EA8A 2ASUB 3RXAA 1GCTC 1SQRA 1Z1JA 4DOQA 1LVBA 1O2WA 1Y3XA 1J17T 1MZDA 5T6FA 1CHOF 4IMQA 3SO3A 2ZTZA 5AFZH 1SQTA 3A82A 2J98A 2AMPA 2J4IA 2XBXA 1QCPA 2QN5T 2IOTA 3SQHE 2AHME 4HGCA 1P2NA 1LHFH 1WUNH 2QC2A 4GPGA 3LC5A 1IQJA 3F2GA 3VB6A 2Z9KA 1AE5A 1N6YA 1G37A 3FANA 3QZQA 2FEQH 3P8FA 2FOAA 5FXLA 1C5LH 1NU9A 1ZGVA 3E8LA 2KAIB 2FLBH 2BD5A 3ATMA 5A8ZA 2ZECA 2XWBI 5T1VA 1O3GA 1OSSA 1C5WB 4Q4LA 1ZLRA 1HXEH 1ZTJA 3BTKE 5LGOA 4OGYA 3T62A 4BXWA 3H7TA 3PRDA 4MQAA 1D6WA 1Z8IB 2C4FH 2YMSB 4ESTE 2OINA 1V2RT 1C4Y2 1EOJA 4CBNA 2ZCHP 2W7UA 3GS9A 1HJAC 3KEEA 1A7SA 2ZHWH 3A8CA 4I32A 3TJUA 3CENA 1MD7A 1YPHC 4CREA 1LDTT 2H1UA 4VGCB 4ISLA 1P10A 4Z6AH 1FPHH 4YT6H 1MKWH 4A1XA 2PWXA 1C2MA 1UK3A 5HIZA 4ABIA 2W26A 4UFEH 1P2MA 3TH4H 3MWIU 2VGCC 4TPYA 1XUKA 2Q6DA 2CF8H 3SV9A 1MKXK 2ZGHA 4CH8B 1HB0B 3ATIA 3DSPA 1K1LA 1SOTA 2HOBA 4MPVA 5GPIB 1GL0E 1O3NA 4A7IB 1SGEE 3K6YA 3M37A 4QT8C 3M7UA 1TALA 5AFYH 3NUMA 3OTPA 4ACAA 1SFIA 4AB8A 1T4VH 2QGRA 2M2AA 3AAUA 1F5RA 1C1MA 1EPTC 1ZPBA 1D3QB 2ZDLA 4JK6A 1GBKA 1N8OB 1O2KA 2KM0A 2UUKB 1TX7A 3UOPA 1PQ5A 3MH5A 2PKSC 1GG6C 5A2MH 1MBMA 1C9TA 3RLYH 4FUIA 2I6QA 3DD2H 3T2NA 1EZUC 1TA2A 2C93B 1NPMA 2FZZA 3QTOH 1QL7A 3BTWE 1ORFA 1ZJKA 1LHDH 2NU2E 3LGYA 3V12A 2A0QB 3RC6A 1MD8A 1IQNA 3LH3A 3U8OH 1O3FA 1OS8A 5IK2D 4GLYA 3EAJA 4YLQH 2AGGX 1P57B 3AAVA 3MNBA 4K60A 5A09A 1OOKB 3L3TA 5EW2H 3UWIA 3OY6U 1TX6A 1F0UA 1ELVA 3RC4A 1KXAA 2GMTC 4FUEA 1C5MD 2GZ9A 3KF2A 4F48B 5AVDA 3GCTF 3F2FA 2WYJA 3ATWA 4DT7B 5HM2A 1SKYE 1EAIA 4BOHA 3A81A 1PPHE 2F9OA 4LK4A 2BOKA 2AIPA 3SNBA 4A6LA 4BAOB 2B9LA 2PGBB 5DP8A 1GDQA 3A89A 3GCNA 2ODQA 1A5HA 1RD3B 1GVLA 5ESBA 4Y0YE 2P94A 2H5DA 1G32B 1L1JA 1JOUB 1C5UA 1W0YH 3GY5A 5LPEA 1CHGA 1MCVA 3ZVDA 2XTTB 1DM4B 2C90B 1QRZA 3RMNH 3N99A 1O5EH 4X2XA 1DWEH 4ZKSU 1GHAG 1W7GH 1ZHMA 2V35A 1XKBC 1C1NA 3E6PH 3EQ0H 1TQ0B 1EAXA 4JK5A 1NFWA 4MPUA 3GOVB 1PPFE 1Y3YA 2PW8H 1ELBA 1DANH 1O2JA 1FQ3A 3ZZ7A 3RUOA 4ZAEA 3ZZBA 4Y0ZE 3ODFA 1FNIA 1U6QA 2EY4C 5JBTA 2AEIH 1K9OE 1ELEE 1JIRA 5DP3A 1BTHH 5JBCS 1G3DA 1H1BA 1FN8A 1WAYB 3O8DA 2VIWA 4UEHH 3BEIB 3NCLA 4INLA 2PV9B 3TGIE 2R2WU 4BANB 5DJ7A 4O97A 1TGSZ 3ZYEA 2H9HA 1AB9C 3RXCA 5DKMA 2JKHA 2KAIA 3EA7A 4Y10E 1O3PB 3GY2A 1HJ9A 2QIQA 2ZA5A 1O2OA 3ZVEA 3BEUA 1CHOG 4MNWA 4NFEA 1YPJH 2O8MA 3R0FA 1V6DA 1YPGH 1Q2WA 5FPSA 3QTVH 4MVNA 5C17A 1QHRB 1TOCB 1AFQC 1WBGB 4B2CA 1E34B 4NWLA 2W5EA 4OM9A 5L2ZH 3HKJB 1MQ5A 1TMBH 2OP9A 2BVSH 3U98H 1SGFG 3OSYA 4IGDA 2FPZA 8KME2 1O2NA 3ZZ3A 4UFFH 2FX6A 2BD4A 2ZPRA 1EP6A 4GSOA 4BAKB 4MG3A 2BDIA 1T8OA 1BCUH 2VWOA 5A0CA 3A7XA 1C1QA 4NZQA 2ZZUH 2P59A 2OC0A 2FP7B 1EZSC 3CP7A 3I29A 2GZ7A 1OWJA 2BDYA 5FBIA 1V2JT 2YMSD 4OS7A 1UMAH 2CK3D 1JMOH 1NC6A 2FTLE 1VJ9U 2P93A 1RJXB 2ZNKH 3UR9A 1A2CH 1DUEA 2BLVA 1UJ1A 1FIZA 1O5CB 3SORA 4ZHLU 2W6JD 2DE9A 3LPRA 3PO1C 1P3EA 1FY8E 2GCHF 5DN6D 2A5AA 2QV1A 3DFLA 1G9IE 1C5TA 1MTSA 1GBJA 1A5GH 1SGFA 4I33A 1C2DA 2W3IA 1WU1A 1KXBA 2V3OH 1C2JA 3GY8A 1LPZB 1WSSH 1SLUB 2VIQA 1Z6EA 1BBRK 1C1VH 3E90B 5F53A 1E37B 2GT8A 4THNH 3RU4E 2J2UA 4TYDA 4GAWA 3UNRA 2AERH 1S84A 1O3OA 3KYFA 1DWCH 2ALPA 2TGDA 4XBCA 1YLCA 1W0ZU 1Z1IA 1EJNA 1KDQB 2QF5A 2ZP0H 4BAMB 2KR7A 1THSH 5A8YA 4ABJA 3SNEA 1SB1H 2ZCLP 2O8LA 1IHTH 1GBHA 1TE0A 1OX1A 2AYWA 4D9RA 3UY9A 1C5SA 2VVUA 1GGDB 1A3BH 6GCHF 1T8NA 1UCYK 1D3DB 1AVGH 1SFQB 1A0LA 1WYKA 3H5CB 2KCAA 4E7NA 5HIYA 4D7FA 6ESTA 2O8UA 1O38A 1SGCA 3HGNA 1NROH 3K6ZA 1EASA 4SGAE 4B75A 2FS8A 5TJXA 2OD3B 5GCHF 1BTWA 2YNBA 4AFSA 2WPIS 2BHGA 5HXFA 1SQAA 1BUIA 2UWOA 1C4V2 1WQSA 4AZ2B 5C5NA 4I8HA 4UONA 2ZI2H 1BMFD 1NFUA 2SNVA 1GI4A 3F0OA 3F3BA 3A7WA 9LPRA 1ESTA 1S0RA 1UVTH 5FBEA 1ZRKA 3A8AA 3UQOA 2P16A 1TNHA 2WPHS 4WMDA 4IW4E 1RTFB 4ISHH 4F55A 3RM2H 2R3YA 4Q80A 1OWKA 4A92A 3BEFB 3GCTG 1CT2E 1H9LB 3UQVA 5LPFA 4YTAA 5LH8A 3F9EA 3SJ9A 3BTGE 2CF9H 4CRFA 2VH6A 1O34A 2PFEA 1K1NA 3NWUA 1O30A 1AI8H 3SUGA 1O5GH 5FAHA 2BX4A 4NSVA 1LKBA 1LTOA 2ZDNA 1MU6B 2C8XB 1C1TA 3QK1A 3UB0A 3VEQB 3S9BA 4WMEA 1ETRH 1TPAE 4YESB 1DOJA 4MTBA 1QBNA 3ITIA 1CBWC 1PFXC 1W0KD 4E05H 1XUFA 2ULLA 1KSNA 3OY5U 1SGPE 4AGJA 1ZRBA 1K0HA 1O2IA 5GNDA 2OLGA 1RTKA 3M5LA 1KLTA 3CS0A 5C1XA 4KTCA 3TLOA 5GDSH 4DY7B 4NA7A 1F0TA 2VVCA 2BDGA 1O3EA 5GIBA 4KGAA 1GHXH 2F9NA 1SC8U 1C1SA 2BY8X 4B6FA 3BG4C 3VB5A 2XBWA 1C9PA 1EZXC 1ZR0A 1ZJDA 5HM9A 4WWYA 3Q3YA 1FXYA 1UVPA 1W14U 1ZYOA 4HZHA 3MH7A 3OFND 1K21H 2WPDD 1DXWA 5I25A 3M61U 1BRBE 2AH4X 3D62A 3HATH 1P04A 2FS9A 2BMGB 1IQGA 2D26C 1ARBA 2PR3A 2ZDMA 2ZHEH 2WZQA 3MMGA 4IMZA 2RDLA 5B6OA 2BXUH 3EA9A 2A2XH 4RN6A 4CHAC 4LOYH 2FDAA 1MAYA 1UVSH 2BY6X 1MUEB 1YPMH 3W1EA 2STAE 1HJ8A 1RXPA 2OXSA 1GL1A 1DWDH 3MOCA 1NY22 2SGDE 3PTBA 4RT1A 3SBKA 1QL8A 2FIRH 4HI3A 2HWLB 3OYPA 4NIVA 4ABBA 3ODDA 2KX4A 4XBDA 5GXPA 1SI5H 3SU1A 3RXMA 1H8ED 1SVPA 3PB1E 1AE8H 2P95A 3D65E 3WW7A 5FCRA 5FPYA 1FZZA 1XX9A 1O2MA 1TLDA 2ESTE 2JIZD 1ZPCA 1TGNA 3GDUA 4WVPE 3SNCA 1NTPA 2JH5D 4E06H 5SGAE 1PPCE 3VB7A 2CN0H 1S6LA 2WHXA 2BD2A 2QXGA 5CHAB 3SN8A 3U8RH 2BLQA 5EJZA 2A45B 1C1OA 4BAQB 1AZ8A 2GGVB 1GJ4H 3RXHA 4DG4A 4JYVH 3SZNA 2ZPSA 2GCHG 1FJSA 3KQ5A 1A3EH 1TAWA 2YOLA 1KDQA 1HAIH 4IS5A 1G3EA 1AKSB 1W3CA 4FOUC 5J4QA 4DCDA 5JDUB 4ASUD 3S7HB 3TIUA 3MYWA 1RFNA 1SHHB 2ZFFH 3OX7U 1HUTH 1GI6A 1L1GA 2W7SA 2V3MA 1ELGA 3MNCA 4DIIH 1JRSA 2BQ6B 2VJ1A 2XC0A 4RKJB 3M5OA 2ZG0H 5C94A 4ABGA 1ELDE 4TPIZ 3RM0H 1G3CA 1XVMA 1VR1H 5FPTA 1QQUA 3LH1A 3O8BA 3U9AH 1A4WH 1O33A 2JH6D 3SV7A 1MTVA 1DY8A 1XM1A 1F2SE 1OWDA 4NG9H 4RT0A 1F7ZA 5KGOA 2GCTB 1GBDA 4K1EA 2G52A 3FP8E 2PTCE 2TGPZ 2K0QA 4GHTA 1W11U 1NRSH 1SLWB 1QIXB 6GCHG 5ESTE 1J9CH 5FX6A 5T6DA 1EFRD 7ESTE 3P17H 5EODA 1CU1A 3GY7A 1C5RA 4UD9H 1FY4A 1M9UA 1UTPA 5C20A 1FN6A 2R9PA 2WPKS 5GCHG 4AFUA 3ZZ4A 1C1UH 1NRRH 2FOFA 3DCLA 1C2KA 1QURH 2F3CE 3SU2A 3TK6A 1XUIA 4Q7ZA 1BDAA 3RXRA 2O8TA 4JMYA 1DS2E 2GV6A 3BV9B 4HFPB 4GCHF 3RXBA 3SV6A 1MKWK 4X1PU 4U01A 3SYJA 2XXLA 2CMYA 2WSSD 2Z6BD 5EQQA 1J16A 3ZIAD 3W94A 4Q63A 3SNAA 1ZHPA 4K2YA 1ETTH 3MO6A 4IN1A 1P8VC 1WTGH 3S9AA 1OYTH 3WY8A 1X7AC 4X2YA 2FOEA 2J92A 4Q7YA 1COWD 1Y3VA 3VB3A 1OWIA 3I78A 5GJ4B 4ZUHA 7KMEH 4XBBA 4O03A 4XD7D 4YOJA 3GICB 2XBVA 3RP2A 3Q76A 5F6MA 1YCPH 1GJ6A 1NRQH 4MNXA 4H6SB 4DGJA 1CE5A 1BJUA 2GDEH 3P8NA 1MTNC 5BRRE 5F03A 5EW1H 1Q3XA 1SR5C 2Z9GA 1XXFA 2HLCA 2JH0D 3UNQA 3BTQE 4TT3D 2CHAB 2KCPA 2ANWA 3QWCH 3EGKH 1PYTD 4CRBA 2HVYB 3LKWA 2ZGCA 1NS3A 1IQFA 1O3KA 1GI2A 1YP9A 4JZDH 4XE4A 2ZEBA 3B8JA 1TNGA 1YY3A 2HVXA 2Y5GA 2VB0A 1G30B 4LXBH 1ANDA 1O5BB 3F9GA 3ZZ6A 2GKVE 3ZZ9A 4YXWD 3GY4A 2OBQA 1BTPA 4MNYA 1TGBA 2DUCA 3TJVA 2OC7A 2FMJA 5EPNA 5HKKD 4NA8A 4BTIB 3GCHC 1T8LA 3VFEA 1LHGH 1GJ9B 1YPEH 1ZOMA 4K3JA 1DICA 1DPOA 2UWPA 1WV7H 3DA9B 1TPPA 5GWZA 5DPAA 4YT7H 1BB0B 5DGJA 2XRCA 2B7DH 2ZDVH 4D8NA 2QYIA 1LVMA 2GJGA 2XBYA 1T31A 1G2LA 1IQMA 1UK4A 4HTCH 2ZFTA 3MQKC 1HDTH 4WY3A 1SGTA 4DVAU 4I8KA 1DDJA 2PSXA 4RI0A 3LOXA 2LP6A 5A0BA 2QF4A 1VCWA 2SGFE 2BLOA 1O2YA 1BMLA 1E35B 1P06A 1GBBA 3LONA 1D4PB 5HGGA 1TIOA 1VITF 1C5VA 3RMLH 1FY1A 3HK3B 2WINI 1OP0A 2H5CA 3OAAD 4X1NU 1GJDB 4IBLH 1XMNB 1AKSA 1JRTA 2BTCE 4FU8A 4KELA 5C0TA 1H4WA 1TYNA 3TPIZ 1KXFA 4I7YH 3RXFA 2GTBA 1TFXA 2ZU1A 4O9VA 4DT4A 2AIQA 1EP5A 2Z3DA 1T8MA 2J9NA 4HG6A 1W10U 2PP6A 2BXTH 4CRAA 5JB8S 1WDIA 2Z3EA 1ZSJA 1DY9A 1NBME 1AY6H 2PGQB 2ZIQH 1K1JA 3QO6A 6CHAC 1QJ1B 3PMHB 2ZHFH 3SUEA 1C4U2 4XSKU 3SGQE 1RTLA 1OPHB 3P6ZB 1GBCA 1S83A 3H7OA 4AFZA 1CT4E 1PPBH 3T28A 1O2PA 1CA0B 3N7OA 4B74A 1GJAB 4K1SA 2P3TB 4WMFA 5FCKA 3MU0A 3AW1A 1BRCE 2OC1A 3DUXH 2ZFQH 4ABDA 1B0FA 3CS7A 1Q31A 1O2TA 1KIGH 4IC5A 1EXFA 1Y5UT 1ZTKA 1W8BH 4WF8A 1QR3E 2GD4B 1HIAB 3VGCC 2BDCA 2V7QD 1GJ8B 1V2NT 1P9SA 5E0GA 2EI6A 1P09A 3LIWA 3PTNA 3QX5H 1DX5M 2HNTC 3M7QA 4FUDA 2Q6FA 4XFQA 4KKDA 5KECA 1HLTH 1P05A 2VWNA 3SJOA 2EC9H 3V3MA 2H9EH 2VU8E 1UTKA 2Y6TA 4ZROA 1A0JA 2ODYB 1D3TB 1AQ7A 2ZHQH 1AFEH 2NU3E 3GY6A 4Z1MD 1GI5A 4GCHG 3BTEE 1MCTA 1TB6H 1DSTA 3SU0A 4NA9H 4ZMAH 2JETB 3BTHE 3QGJA 3GYMA 2A4GA 1UTMA 1ZSKA 4CR9A 1Z8RA 2HALA 5L6NH 1MQ6A 1RS0A 2XOKD 2ZQ1A 4H4FA 3SUFA 5L30H 5CHBA 1YPLH 3N7DA 5C5OA 1ESBA 1EATA 2KZ4A 2O8WA 1C1RA 3RDZA 1Y59T 4M9FA 1ETSH 3A87A 1HAVB 1O5DH 3PWCA 3DFJA 4K8BA 3VB4A 3RXEA 4I31A 1QFKH 1VKYA 3TU7H 1MZAA 1P2IA 1AMHA 7GCHF 3ATKA 3RXKA 3LGVA 2LPRA 1GMCG 2VGCB 3TH3H 3ZVAA 1GJCB 1HV7A 3P92A 4DJZB 3M5MA 1F5KU 1FY5A 1HAZB 1BT7A 2A1DB 2VVVA 1GJ7B 1LQDB 3U1JB 4JZEH 1TOMH 4X1SU 5K0HA 4I8GA 1HAPH 4AFQA 1LPKB 1EZQA 1GCDA 3E91A 4U32A 1TRNA 4XRNA 3W95A 1B5GH 4X6PA 2OC8A 1FV9A 3ZV9A 4GHQA 4TY6A 1GWAA 3F0PA 1Y3UA 1S81A 1QL9A 8ESTE 3SW2B 1FUJA 2ANYA 2UUFB 1PQAA 2PKSB 1GG6B 2NWNA 2W3KA 3K9XB 1C1WH 2C3SA 1JBUH 1Z8JB 2AMDA 1BMNH 3BIVH 5C3NA 1CO7E 3ZV8A 2VINA 1YLDA 1UK2A 1RIWC 3RMMH 4KTUA 1YPHE 1ID5H 1GI0A 3Q00A 1LHCH 1C2IA 1P2OA 4I8JA 1C5OH 1NM6A 3HGPA 2ZU5A 1GI8B 2WV4A 2Z94A 1HYLA 5E8EH 2XWAA 2IPQX 2L74A 2F4LA 4ZHAA 1L1NA 4K69A 1SGQE 1THRH 3QN7A 2BZAA 8LPRA 2FOCA 2EQNA 1ELAA 1TBZH 4INHA 1CQQA 1FAXA 1XUJA 2WV9A 1ELTA 4WXVA 3MU4A 2FLRH 3T26A 3SOSA 4X6OA 1V2KT 3QDZB 1AU8A 1E79D 2L6OA 1YBWA 2EA3A 4AORA 2QXHA 4CH2B 3A84A 1QBOA 2V6NA 2A7CA 2GCTC 2Q1JA 2GMTB 1UTOA 1ZGIA 1O2QA 3SU5A 1EAWA 1XKAC 2TGAA 3KN2A 4I86A 1E36B 1P2QA 1W13U 1HCGA 1QY6A 5EU8A 2XNIA 5DP9A 3M7TA 1GMDG 1VITG 3EDXB 3IITA 4B76A 3UPEA 1T32A 4CRDA 2PUXB 1VJAU 1QRXA 4OS1A 2UWLA 4WJG2 1LKAA 2OK5A 3FP7E 3OEHD 4B73A 3FVFB 3L6PA 1KTTB 1OWEA 4X6NA 1Y3WA 4ACBA 2SFAA 2BDAA 2QE7D 3A7ZA 3RXGA 4X2WA 1ANBA 1GHBF 2ANKH 5FX5A 4NZLA 4JZFH 4OS4A 2Y80A 2VBCA 1HFDA 2XCFA 1GJBB 5K7RA 1C5YB 2G51A 1S82A 4TWYA 4J2YB 3FZZA 2ZFSA 5DP4A 3Q77A 4KP0A 2GV7A 3AASA 1MTWA 2Z3CA 2WV5A 3RXUA 3U28C 3NK8A 2C8WB 2BD7A 4ZKRU 4O3TA 1NO9H 2H2ZA 4FETA 3MU5A 1HIAA 2ANMH 2YMSC 4AOQA 1SGYE 2BD3A 3D49H 4ZXXH 4AX9H 1ZPZA 3PMAB 2GT7A 2XCNA 1KXCA 1BTYA 1NT1A 2BD9A 2R2MB 1GI9B 4VGCC 1QB6A 1FY3A 2BYAX 5F8ZA 2BZ6H 4FUFA 3UREA 1ZMLA 2I6SA 3MTYA 3E16B 1GHWH 2AFQB 1FX0B 2AGIX 1AB9B 3BTFE 1K1MA 4FVDA 4FUBA 3SI3H 1TBQH 1GJ5H 1WQVH 4BTUB 1KMHB 1BRUP 4YO9A 1S5SA 1VITH 1W7XH 5E2OA 1HAOH 1V2WT 2CHAC 1QJ7B 1GBLA 3GCOA 2J34A 4MLFB 4B1TA 3OEED 4K8YA 1HAVA 5DP5A 2K8IA 1NFYA 3TNTA 1O32A 3GDSA 1GBIA 1K22H 5JB9S 3GISB 5TCCA 3JZ2B 1GHVH 1N8OC 1WTHD 3RU4T 3RU4D 1YYY1 3PLKA 1TMUH 2LELA 1C2GA 3VXFH 4O3UA 2ILNA 3A83A 4ABAA 2AS9A 3C27B 3E0PB 2A4OA 4CRGA 4NGAH 3RC5A 4P02A 3U69H 5EJ1A 5LPRA 1P3CA 2AGEX 1AUTC 4B71A 3M5NA 1C5ZB 1AGJA 1VZQH 2BX3A 2PHBA 1PQ8A 4AC9A 1PPZA 2J94A 1EUFA 1UVOA 3KCGH 1O37A 7GCHG 2ZCKP 1ANEA 3GYLB 1Z8GA 3STIA 3U8TH 5HMAA 5C0UA 1SL3A 2OUAA 3BG8A 1G36A 3PV4A 2J97A 2J5UA 3TGJE 3RXOA 3S7KB 2BQWB 2C8YB 4OS2A 1FMGA 2BY5X 2ZWLH 4D9QA 3BTME 1RRKA 1PPGE 2GX4A 2BB4A 3M3VA 1XVOA 1QTFA 3I77A 1D6RA 1AWFH 1BMMH 3T29A 1INCA 4ISIH 1S0QA 3PLBA 2WPMS 2STBE 3MH4A 3KNXA 1TNKA 1GI3A 3GY3A 1W0JD 2ZGXH 4Z0KA 1IQIA 5CE1A 1TRMA 3RLWH 3ZVFA 2FO9A 3PRBA 3N7EA 4FU9A 2PKAB 1NESE 1V2PT 2ZFRH 1DWBH 1SLXB 3PWBA 5ABWA 1TNLA 2C8ZB 1UTJA 1ZTLA 1O36A 1TQ7B 1P12E 1L4ZA 1UTQA 4UFGH 1Y5AT 1ABJH 2F9VA 1Z7KA 1DT2A 1CSOE 1O39A 4KTSA 3MFJA 3WWBA 3MNSA 3D23A 2D8WA 4XOJA 1YKTA 1OP8A 2XC5A 3NPSA 3CNRA 2PLXA 3B23B 1KY9A 2D2DA 4B2AA 1BZXE 5T3HA 4U2WA 4IC6A 1ABIH 1IQLA 1GI1A 1LVYA 3A7TA 4MNVA 4Q2KA 1GDNA 3A7YA 1YCPK 2F9UA 2TBSA 2H6MA 3A85A 3HPTB 2UUYA 4WXIA 1V2TT 1LPGB 3BN9A 4JZ1A 3VPKA 3MHWU 1KXEA 3SQEE 1OYQA 4YOIA 1Z6JH 1F5LA 2CXVA 1O3HA 3BTDE 3LU9B 4A5TS 5DSFA 3K2UA 2RA3A 4OS6A 4R0IA 1OHHD 2FI3E 2G4TA 1TGCA 4XDEA 4AB9A 1TWXB 1IHSH 3PV2A 1O2XA 1IQEA 1HAXB 1C5QA 3M36A 5TCAA 2FOMB 4GVUA 1V2QT 3RXTA 1MTUA 1HNEE 3RXPA 2CGAA 1VCPA 1A0HB 1GHBG 1GMCF 3F6UH 1QGFA 1CBWB 2XYAA 3A80A 3TNSA 1PQ7A 5B6LA 1QQ4A 2P8OB 5CMXH 3TGKE 1TPOA 1W12U 1SBWA 1DLEA 1O2LA 3ZVBA 1BA8B 1AUJA 1FIWA 2A2QH 1C2HA 1LCYA 2JETC 4NWKA 4RSPA 3FFGA 3T5FH 1B7XB 1OP2A 1UO6A 1L4DA 4ABFA 2UUJB 1GI7B 1O2VA 1W2KH 1BTUA 2ZPQA 1BTXA 4JZIA 1EJAA 5ETXA 3RMOH 3SGBE 1K2I1 4Q7XA 3ZZDA 1O5FH 3MO9A 3HK6B 3SJ8A 3SHCH 3BG4B 1SLVB 2O9QA 1YM0A 1O3MA 3B9FH 2B8OH 2ZU2A 2ZC9H 1XUGA 2BQ7B 1EJMA 3ZZ5A 3V0XA 3TK5A 2OQUA 2QF0A 2YNAA 3TJOA 3FOAA 5H4IB 4MPXA 1D9IA 1UTNA 1SMFE 2RG3A 1VGCB 2JDID 1CGHA 3SUDA 5A8XA 4DIHH 3JZ1B 3IG6B 1T7CA 4CHAB 1ZMJA 1O3IA 2FX4A 2V0BA 4YOGA 3PMBB 3KYGA 1C5PA 4D7GA 4ZKOU 4FU7A 1YLNA 1QA0A 2J38A 2R0KA 3QZRA 3PV5A 3Q3KA 4R8TB 5C1YA 3KHVA 1BRAA 1HAGE 1S6FA 1Z71A 2PSYA 2G5VA 2F9BH 5E0JA 1GPZA 1MKXH 1YC0A 2Z7FE 2ZU4A 1GHZA 1P02A 2JJ1D 3RXQA 4TY7A 1T4UH 3E0NB 3QUMP 1WOFA 5EPYA 2VIDA 2G4UA 1GGDC 2ZTXA 3LGWA 2ZU3A 1AVWA 1CA8B 2IPHA 5JBBS 3SJKA 2K1QA 1GMDF 4FUHA 1O2SA 1C5XB 3BSQA 5AHGH 1CGJE 3RXLA 2Y81A 1O3BA 3BIUH 4PROA 1V2MT 2EI7A 1JWTA 3U1IB 3ENSB 1O3JA 3SI4H 1ANCA 2FODA 8GCHF 1JXPA 2XNDD 6LPRA 1A1RA 3Q3XA 4X0WU 4FVBA 3V7TA 3NKKA 4UFDH 2OQ5A 2OBOA 4JYTA 5T6GA 3ZZAA 3T25A 2ODPA 4FXGH 2NU0E 3UNSA 2PKAA 2AMQA 1OKXA 4AN7A 2RA0A 1KLIH 3AW0A 3P70B 1OWHA 2M5TA 1F92A 2KCOA 1Y5BT 1L2EA 4D76A 2Z9JA 1SHYA 5IDKA 3QGNB 2VWMA 2V3HH 2HPQH 4OS5A 2WPJS 3ZZ8A 1P9UA 2ZTYA 2FXRA 4NIYA 2SNWA 5JYIA 1ZHRA 3G01A 1E38B 2FI5E 4CBOA 3MH6A 2XC4A 2ZO3H 1G3BA 1BBRE 2HLDD 2ZQ2A 2FWWA 1FONA 3PROA 7LPRA 3PM3A 1IQHA 4IN2A 3URCA 1EB2A 5DP7A 3NRLA 3MU1A 1B0EA 2GVFA 4RKOB 3P8GA 2P3UB 1HAYB 1GCTB 2XW9A 5HYOA 2G81E 1QA7A 2RDEA 4H42U 1DLKB 1V2OT 2A32A 1PYTC 3UTUH 3A7VA 1NRNH 1UCYE 1LO6A 1JIMA 5AF9H 2Z9LA 4A1TA 1TBRH 1EAUA 4Y76A 3FZDA 4JCNA 1LHEH 1O0DH 2GDDA 2R0LA 3KL6A 4X8TH 4DW2U 2ZDAH 1YF4A 4B2BA 5C67A 2PUQH 5EQSA 2P3FH 2TGTA 4B6EA 3O8CA 3SU3A 3PYHA 4AGKA 1S85A 1MH0A 1YPKH 2BM2A 5E2PA 3E3TA 4H6TA 3VG8A 3TK9A 1TX8A 3SV8A 1MABB 1G2MA 2BY9X 2F43B 3BF6H 5F8TA 2SGEE 4Y7BA 3KQCA 1ZMNA 2Y5HA 1LMWB 1SGNE 2VH0A 4Y8YA 2G5NA 1HJAB 3SNDA 1SGIB 1AVXA 4E7RG 5CDFE 3RXVA 3FN8A 5EXNA 4Y6DA 1FLEE 3TVJB 2FOHA 4UDWH 3LJOA 1SG8B 4K5ZA 4CRCA 1LQEA 1TGTA 4WH8A 2VNTA 1K28D 1EKBB 2QXJA 1K1PA 1MTNB 2HPPH 3ELAH 2FYQA 1Y8TA 5BPEA 3F9HA 1GMHF 1GHYH 2SGAA 3RXDA 3KQBA 3S69A 2BVRH 3C1KA 4A1VA 4CR5A 1QZ8A 2GZ8A 2KCYA 1F0SA 1O31A 4NIWA 3TH2H 1QB1A 4FUJA 5L2YH 1SOZA 1UHBB 4BTTB 5PTPA 1SGDE 2CV3A 4LZ4B 3WWFA 2EEKA 1SGRE 1C2EA 2IN2A 3SZEA 5J4SA 1AZZA 1O2RA 3TITA 1AHTH 1O2UA 1EPTB 2D1JA 2A5KA 2R3UA 3A88A 2ZGBH 3R3GB 3F9FA 3MU8A 1IOEA 1P2KA 5CHAC 1V2UT 1O3CA 4MDSA 4TWWA 3M3TA 1SQOA 2BVXH 2A4QA 1DITH 1N1LA 3GCHB 4F49A 1ARCA 1P03A 2DE8A 5F8XA 3E1XB 5A0AE 1DVAH 1P2JA 1O3LA 2B0FA 1FPCH 1THPB 1ACBE 1ESAA 1XUHA 5I46H 3M35A 1BIOA 1TNIA 2NU4E 2WUCA 4X2VA 1QNJA 1V2LT 1H9HE 4WH6A 1S6HA 1CGIE 2IJOB 2WYGA 2ZDKA 5EJLA 2QXIA 3LJJA 4ABEA 1NBMD 1BQYA 2A4RA 5E0HA 3L33A 1EB1H 2FESH 3OE7D 2ZHDA 5C2ZA 3UR6A 3P95A 2VIVA 2F83A 1QB9A 5EGMA 1RGQA 1XXDA 3LGIA 3DSGA 4YZUA 4BXSA 1QRWA 1HBTH 1TRYA 3ZZCA 1WXRA 4Y8XA 5FL7D 2BD8A 1O2ZA 1YCPM 1FAKH 1BMAA 1BOQA 1BBRH 2ALVA 2HNTF 3ZYDA 1MAXA 1P0SH 2G8TA 2WUBA 5EIYA 2BLWA 1MU8B 3LT3A 1WCZA 1LVOA 2ZFPH
chains in the Genus database with same CATH topology
3OTJE 2BDHA 1GBTA 2CJIA 3MO3A 2J95A 1H8DH 4NFFA 3LGUA 1DXPA 4UE7H 1C1PA 1OXGA 1K1OA 3ZVCA 8GCHG 1A46H 2FI4E 2Y7XA 1HAHH 4NIXA 1AWHB 6CHAB 1PPEE 3RXIA 1UCYH 2QAAA 2Z9IA 4Y71A 2QF3A 1NU7B 3S9CA 4Y7AA 2A7JA 1TMTH 3KGPA 2TPIZ 2Q6GA 3EYDA 2VIOA 2BOHB 1AD8H 4AYVB 3F68H 5DO4H 1FDPA 3SU4A 1TABE 1L0ZA 4GUXA 1EX3A 1HRTH 1HGTH 3RXSA 1QBVH 1J15A 5JBAS 4ZHMU 2G00A 1ZSLA 1NFXA 3BTTE 3GDVA 1GBMA 3VGCB 2TIOA 3UWJH 2A7HA 3MNXA 4AG2A 2P8OC 4YM9A 1UTLM 1V3XA 3M3SA 4OGXA 4F4OC 3FAOA 3MI4A 5EG4A 3UOUA 1J14A 1BHXF 2QA9E 4ZXYH 2VWLA 5EOKA 3SGAE 4ISNA 3NXPA 4MPWA 1QJ6B 1BJVA 2BY7X 4BAHB 1HXFH 4ISOA 3TJNA 3K65B 2OCVB 1AFQB 1TA6A 1IQKA 1V2ST 1O35A 1O2GH 1O2HA 5FHTA 4M7GA 1P11E 4Y79A 2HRVA 2SGQE 3VXEH 2SGPE 1N6XA 1EOLA 1MBQA 2EI8A 2ZGJA 3S0NA 4LZ1H 1VGCC 4X6MA 4BNRA 3KQEA 2TRMA 2PTNA 3P8OA 4J1YA 4NSYA 5EXLA 3F1SB 4ASHA 4X1QU 2QCYA 9ESTA 1SPJA 2ZKSA 3V13A 1KLJH 1C2LA 2OTVA 3SJIA 1P01A 4FUCA 1GDUA 1PJPA 1NZQH 1A5IA 3DHKH 4X8VH 1UHBA 3SV2H 1KTSB 2VIPA 1AO5A 1KYNA 1GVZA 3LDXH 3NZIA 3EE0B 1DE7H 5DP6A 3PO1B 5IYTA 4DURA 2FTMA 2FM2A 3ATLA 1NN6A 2HNTE 2Y5FA 3DT0H 1E0FD 1EPTA 3A86A 1DFPA 1GVKB 3SU6A 1TONA 1AN1E 1FI8A 1GMHG 1AIXH 1O5AB 1ZZZA 1H9IE 1BHXB 3KIDU 1CT0E 4JYUH 2FYRA 4K1TA 4Y8ZA 1YGCH 3A8BA 2THFB 1C5NH 1BITA 1HPGA 3HKIB 3IWMA 3QLPH 1GBFA 3A8DA 2A31A 3KQDA 4YLUA 5G4BA 4U30A 1TPSA 1MMJN 5EQRA 3ZVGA 4ZH8A 3ESTA 1DSUA 1ELCA 2LNCA 4SGBE 2A5IA 2ZF0H 3T27A 4AG1A 2FOGA 1ELFA 1RIWB 3UIRA 3UFAA 3SHAH 1VCQA 1SSXA 1O3DA 2WPLS 4X8SH 4X1RU 2Y7ZA 2HGTH 4I8LA 3URDA 1UVUH 3OU0A 4Y11E 3FP6E 1F0RA 4FUGA 1GHAF 3UUZA 2Y82A 3LGTA 1H8IH 3PMJA 1K1IA 1GBEA 5EXMA 4ZKNU 2F91A 2RCEA 2FOBA 2GP9B 5DK1A 2NU1E 4ABHA 1EQ9A 1A61H 1CVWH 1IAUA 4AYYB 1CA0C 2G55A 1V2VT 3PLPA 5DG6A 2F9PA 1BTZA 3LC3A 1D3PB 2QY0B 1GBAA 1TNJA 4NCYA 1C2FA 3O8RA 1O3AA 1KXDA 1NRPH 2B5TB 1J8AA 2H9TH 2BDBA 4X8UH 1DUAA 3RXJA 4INKA 3AVZA 5C1UA 3STJA 5JPMH 3EA8A 2ASUB 3RXAA 1GCTC 1Z1JA 4DOQA 1LVBA 1O2WA 1Y3XA 1J17T 1MZDA 5T6FA 1CHOF 4IMQA 3SO3A 2ZTZA 5AFZH 1SQTA 3A82A 2AMPA 2J4IA 2XBXA 1QCPA 2QN5T 2IOTA 3SQHE 4HGCA 1P2NA 1LHFH 1WUNH 2QC2A 4GPGA 3LC5A 1IQJA 3VB6A 2Z9KA 1AE5A 1N6YA 1G37A 3FANA 3QZQA 2FEQH 3P8FA 2FOAA 5FXLA 1C5LH 1NU9A 1ZGVA 3E8LA 2KAIB 2FLBH 2BD5A 3ATMA 5A8ZA 2ZECA 2XWBI 1O3GA 1OSSA 1C5WB 1ZLRA 1HXEH 1ZTJA 3BTKE 5LGOA 4OGYA 3T62A 4BXWA 3H7TA 4MQAA 1D6WA 1Z8IB 2C4FH 4ESTE 2OINA 1V2RT 1C4Y2 1EOJA 4CBNA 2ZCHP 2W7UA 1HJAC 3KEEA 1A7SA 2ZHWH 3A8CA 4I32A 3TJUA 3CENA 1MD7A 1YPHC 4CREA 1LDTT 2H1UA 4VGCB 4ISLA 1P10A 4Z6AH 1FPHH 4YT6H 1MKWH 4A1XA 2PWXA 1C2MA 1UK3A 4ABIA 2W26A 4UFEH 1P2MA 3TH4H 3MWIU 2VGCC 4TPYA 1XUKA 2Q6DA 2CF8H 3SV9A 1MKXK 2ZGHA 4CH8B 1HB0B 3ATIA 1K1LA 1SOTA 2HOBA 4MPVA 5GPIB 1GL0E 1O3NA 4A7IB 1SGEE 3K6YA 3M37A 4QT8C 3M7UA 1TALA 5AFYH 3NUMA 1SFIA 4AB8A 1T4VH 2QGRA 3AAUA 1F5RA 1C1MA 1EPTC 1ZPBA 1D3QB 2ZDLA 4JK6A 1GBKA 1N8OB 1O2KA 2UUKB 1TX7A 3UOPA 1PQ5A 3MH5A 2PKSC 1GG6C 5A2MH 1MBMA 1C9TA 3RLYH 4FUIA 2I6QA 3DD2H 3T2NA 1EZUC 1TA2A 2C93B 1NPMA 2FZZA 3QTOH 1QL7A 3BTWE 1ORFA 1ZJKA 1LHDH 2NU2E 3LGYA 3V12A 2A0QB 3RC6A 1MD8A 1IQNA 3LH3A 3U8OH 1O3FA 1OS8A 4GLYA 3EAJA 4YLQH 2AGGX 1P57B 3AAVA 3MNBA 4K60A 5A09A 1OOKB 3L3TA 5EW2H 3UWIA 3OY6U 1TX6A 1F0UA 1ELVA 3RC4A 1KXAA 2GMTC 4FUEA 1C5MD 2GZ9A 3KF2A 5AVDA 3GCTF 2WYJA 3ATWA 4DT7B 5HM2A 1EAIA 4BOHA 3A81A 1PPHE 2F9OA 4LK4A 2BOKA 2AIPA 3SNBA 4A6LA 4BAOB 2B9LA 2PGBB 5DP8A 1GDQA 3A89A 3GCNA 2ODQA 1A5HA 1RD3B 1GVLA 5ESBA 4Y0YE 2P94A 2H5DA 1G32B 1L1JA 1JOUB 1C5UA 1W0YH 3GY5A 5LPEA 1CHGA 1MCVA 3ZVDA 2XTTB 1DM4B 2C90B 1QRZA 3RMNH 1O5EH 4X2XA 1DWEH 4ZKSU 1GHAG 1W7GH 1ZHMA 2V35A 1XKBC 1C1NA 3E6PH 3EQ0H 1TQ0B 1EAXA 4JK5A 1NFWA 4MPUA 3GOVB 1PPFE 1Y3YA 2PW8H 1ELBA 1DANH 1O2JA 1FQ3A 3ZZ7A 3RUOA 4ZAEA 3ZZBA 4Y0ZE 3ODFA 1FNIA 1U6QA 5JBTA 2AEIH 1K9OE 1ELEE 1JIRA 5DP3A 1BTHH 5JBCS 1G3DA 1H1BA 1FN8A 1WAYB 3O8DA 2VIWA 4UEHH 3BEIB 3NCLA 4INLA 2PV9B 3TGIE 2R2WU 4BANB 5DJ7A 4O97A 1TGSZ 3ZYEA 2H9HA 1AB9C 3RXCA 5DKMA 2JKHA 2KAIA 3EA7A 4Y10E 1O3PB 3GY2A 1HJ9A 2QIQA 2ZA5A 1O2OA 3ZVEA 3BEUA 1CHOG 4MNWA 4NFEA 1YPJH 2O8MA 3R0FA 1V6DA 1YPGH 1Q2WA 5FPSA 3QTVH 4MVNA 1QHRB 1TOCB 1AFQC 1WBGB 4B2CA 1E34B 4NWLA 2W5EA 5L2ZH 3HKJB 1MQ5A 1TMBH 2OP9A 2BVSH 3U98H 1SGFG 3OSYA 4IGDA 2FPZA 8KME2 1O2NA 3ZZ3A 4UFFH 2FX6A 2BD4A 2ZPRA 1EP6A 4GSOA 4BAKB 4MG3A 2BDIA 1T8OA 1BCUH 2VWOA 5A0CA 3A7XA 1C1QA 4NZQA 2ZZUH 2P59A 2OC0A 2FP7B 1EZSC 3CP7A 3I29A 2GZ7A 1OWJA 2BDYA 5FBIA 1V2JT 4OS7A 1UMAH 1JMOH 1NC6A 2FTLE 1VJ9U 2P93A 1RJXB 2ZNKH 3UR9A 1A2CH 1DUEA 2BLVA 1UJ1A 1FIZA 1O5CB 3SORA 4ZHLU 2DE9A 3LPRA 3PO1C 1P3EA 1FY8E 2GCHF 2A5AA 2QV1A 3DFLA 1G9IE 1C5TA 1MTSA 1GBJA 1A5GH 1SGFA 4I33A 1C2DA 2W3IA 1WU1A 1KXBA 2V3OH 1C2JA 3GY8A 1LPZB 1WSSH 1SLUB 2VIQA 1Z6EA 1BBRK 1C1VH 3E90B 1E37B 2GT8A 4THNH 3RU4E 2J2UA 4TYDA 4GAWA 3UNRA 2AERH 1S84A 1O3OA 1DWCH 2ALPA 2TGDA 4XBCA 1YLCA 1W0ZU 1Z1IA 1EJNA 1KDQB 2ZP0H 4BAMB 1THSH 5A8YA 4ABJA 3SNEA 1SB1H 2ZCLP 2O8LA 1IHTH 1GBHA 1TE0A 1OX1A 2AYWA 4D9RA 3UY9A 1C5SA 2VVUA 1GGDB 1A3BH 6GCHF 1T8NA 1UCYK 1D3DB 1AVGH 1SFQB 1A0LA 1WYKA 3H5CB 4E7NA 4D7FA 6ESTA 2O8UA 1O38A 1SGCA 3HGNA 1NROH 3K6ZA 1EASA 4SGAE 4B75A 2FS8A 5TJXA 2OD3B 5GCHF 1BTWA 2YNBA 4AFSA 2WPIS 2BHGA 5HXFA 1SQAA 1BUIA 2UWOA 1C4V2 1WQSA 4AZ2B 5C5NA 4I8HA 4UONA 2ZI2H 1NFUA 2SNVA 1GI4A 3A7WA 9LPRA 1ESTA 1S0RA 1UVTH 5FBEA 1ZRKA 3A8AA 3UQOA 2P16A 1TNHA 2WPHS 4WMDA 4IW4E 1RTFB 4ISHH 3RM2H 2R3YA 4Q80A 1OWKA 4A92A 3BEFB 3GCTG 1CT2E 1H9LB 3UQVA 5LPFA 4YTAA 5LH8A 3F9EA 3SJ9A 3BTGE 2CF9H 4CRFA 2VH6A 1O34A 2PFEA 1K1NA 3NWUA 1O30A 1AI8H 3SUGA 1O5GH 5FAHA 2BX4A 4NSVA 1LKBA 1LTOA 2ZDNA 1MU6B 2C8XB 1C1TA 3QK1A 3VEQB 3S9BA 4WMEA 1ETRH 1TPAE 4YESB 1DOJA 4MTBA 1QBNA 3ITIA 1CBWC 1PFXC 4E05H 1XUFA 2ULLA 1KSNA 3OY5U 1SGPE 4AGJA 1ZRBA 1O2IA 2OLGA 1RTKA 3M5LA 1KLTA 3CS0A 5C1XA 4KTCA 3TLOA 5GDSH 4DY7B 4NA7A 1F0TA 2VVCA 2BDGA 1O3EA 5GIBA 4KGAA 1GHXH 2F9NA 1SC8U 1C1SA 2BY8X 3BG4C 3VB5A 2XBWA 1C9PA 1EZXC 1ZR0A 1ZJDA 5HM9A 4WWYA 3Q3YA 1FXYA 1UVPA 1W14U 1ZYOA 4HZHA 3MH7A 1K21H 1DXWA 5I25A 3M61U 1BRBE 2AH4X 3D62A 3HATH 1P04A 2FS9A 2BMGB 1IQGA 2D26C 1ARBA 2PR3A 2ZDMA 2ZHEH 3MMGA 4IMZA 2RDLA 5B6OA 2BXUH 3EA9A 2A2XH 4RN6A 4CHAC 4LOYH 2FDAA 1MAYA 1UVSH 2BY6X 1MUEB 1YPMH 2STAE 2OXSA 1HJ8A 1RXPA 1GL1A 1DWDH 3MOCA 1NY22 2SGDE 3PTBA 3SBKA 1QL8A 2FIRH 4HI3A 2HWLB 3OYPA 4NIVA 4ABBA 3ODDA 4XBDA 5GXPA 1SI5H 3SU1A 3RXMA 1SVPA 3PB1E 1AE8H 2P95A 3D65E 5FCRA 5FPYA 1FZZA 1XX9A 1O2MA 1TLDA 2ESTE 1ZPCA 1TGNA 3GDUA 4WVPE 3SNCA 1NTPA 2JH5D 4E06H 5SGAE 1PPCE 3VB7A 2CN0H 2BD2A 2QXGA 5CHAB 3SN8A 3U8RH 2BLQA 2A45B 1C1OA 4BAQB 1AZ8A 2GGVB 1GJ4H 3RXHA 4DG4A 4JYVH 3SZNA 2ZPSA 2GCHG 1FJSA 1A3EH 1TAWA 2YOLA 1KDQA 1HAIH 4IS5A 1G3EA 1AKSB 1W3CA 5J4QA 4DCDA 5JDUB 3S7HB 3TIUA 3MYWA 1RFNA 1SHHB 2ZFFH 3OX7U 1HUTH 1GI6A 1L1GA 2W7SA 3MNCA 1ELGA 4DIIH 1JRSA 2BQ6B 2VJ1A 2XC0A 4RKJB 3M5OA 2ZG0H 4ABGA 1ELDE 4TPIZ 3RM0H 1G3CA 1XVMA 1VR1H 5FPTA 1QQUA 3LH1A 3O8BA 3U9AH 1A4WH 1O33A 2JH6D 3SV7A 1MTVA 1DY8A 1XM1A 1F2SE 1OWDA 4NG9H 1F7ZA 2GCTB 1GBDA 4K1EA 2G52A 3FP8E 2PTCE 2TGPZ 4GHTA 1W11U 1NRSH 1SLWB 1QIXB 6GCHG 5ESTE 1J9CH 5FX6A 5T6DA 7ESTE 3P17H 5EODA 1CU1A 3GY7A 1C5RA 4UD9H 1FY4A 1M9UA 1UTPA 5C20A 1FN6A 2R9PA 2WPKS 5GCHG 4AFUA 3ZZ4A 1C1UH 1NRRH 2FOFA 1C2KA 1QURH 2F3CE 3SU2A 3TK6A 1XUIA 4Q7ZA 1BDAA 3RXRA 2O8TA 4JMYA 1DS2E 2GV6A 3BV9B 4HFPB 4GCHF 3RXBA 3SV6A 1MKWK 4X1PU 4U01A 2XXLA 2CMYA 2Z6BD 5EQQA 1J16A 3W94A 3SNAA 1ZHPA 4K2YA 1ETTH 3MO6A 4IN1A 1P8VC 1WTGH 3S9AA 1OYTH 3WY8A 1X7AC 4X2YA 2FOEA 2J92A 4Q7YA 1Y3VA 3VB3A 1OWIA 3I78A 5GJ4B 4ZUHA 7KMEH 4XBBA 4O03A 4YOJA 3GICB 2XBVA 3RP2A 3Q76A 5F6MA 1YCPH 1GJ6A 1NRQH 4MNXA 4H6SB 4DGJA 1CE5A 1BJUA 2GDEH 3P8NA 1MTNC 5BRRE 5F03A 5EW1H 1Q3XA 1SR5C 2Z9GA 1XXFA 2HLCA 2JH0D 3UNQA 3BTQE 2CHAB 2ANWA 3QWCH 3EGKH 1PYTD 4CRBA 3LKWA 2ZGCA 1NS3A 1IQFA 1O3KA 1GI2A 1YP9A 4JZDH 4XE4A 2ZEBA 3B8JA 1TNGA 2HVXA 2Y5GA 2VB0A 1G30B 4LXBH 1ANDA 1O5BB 3F9GA 3ZZ6A 2GKVE 3ZZ9A 3GY4A 2OBQA 1BTPA 4MNYA 1TGBA 2DUCA 3TJVA 2OC7A 2FMJA 5EPNA 4NA8A 4BTI