1WD6A

Crystal structure of jw1657 from escherichia coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
ATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of JW1657 from Escherichia coli
rcsb
molecule keywords Protein ydhR
molecule tags Structural genomics, unknown function
source organism Escherichia coli
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08803 ydhR Putative mono-oxygenase ydhR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wd6A00
2HFOA 3F44A 1KQKA 1TL5A 2BJDA 4Q2MA 2BJEA 5B0EA 1N5TA 2IYIA 2IYGA 3FMBA 2HQIA 4HI1A 3KG1A 1TZ0A 2GFFA 3DCAA 3HHLA 3LGNA 4OJGA 2GA7A 2K7JA 3QMQA 1P8GA 5B0DA 3HHLC 4QOTA 2QLWA 3TNVA 2XMUA 2OFHX 1CPZA 2ACYA 4A4JA 2BBEA 2RSQA 2XMKA 2EW9A 3CJKA 4A47A 2FB0A 2KT3A 4YEAA 3HX9A 4HH0A 2ASYA 3VTIA 1AW0A 3CJKB 4OJ3A 1OQ3A 1K0VA 2OP5A 2GGPB 1Q8BA 1FEEA 1YG0A 2LXFA 2KT2A 3FRYA 4A46A 3BR8A 2VV5A 2G9OA 2BYCA 1SI9A 2FHMA 3HDSA 1YJRA 5B0FA 2ZDOA 4FNIA 1VQSA 2GV1A 5T7LA 4U9RA 5B0CA 1S6OA 5T7LB 2BUNA 2ROGA 2FTRA 2JDJA 3BF4A 1FVQA 2HLTA 1YJVA 2N7YA 1OPZA 2XMMA 1IUJA 2N4DA 3IWLA 3GZ7A 2K2PA 2QLXA 3LGMA 3MCSA 1TR0A 4Q2LA 3FGVA 2OD6A 2ROPA 2L3MA 2XMTA 3LO3A 1FE0A 1W2IA 2K1RB 2OMOA 2XMWA 1YJTA 1YRXA 4OIXA 1Q8LA 1TL4A 2GGPA 2LDIA 3KG0A 1S6UA 2AJ1A 3I9ZA 5A6WA 1APSA 1KVJA 2W4PA 4OJ1A 4DPOA 2RMLA 1N5QA 1OSDA 1SB6A 1X8DA 1N5SA 2HLUA 3E8OA 3BDEA 3KKFA 3BM7A 4HI2A 1AFIA 1SQEA 1V3ZA 3MZIA 3KNGA 4Y2MA 2N4CA 1FE4A 2ZDPA 1OQ6A 4NL5A 2AP6A 1QUPA 1U7LA 1TUVA 1MWZA 2AJ0A 4EFAC 1WD6A 2OD4A 2QIFA 2VH7A 2HIQA 1VQYA 2OFGX 2W4CA 2K7KA 2CRLA 4HH1A 3HHLD 1MWYA 4ZA1A 3TOQA 5A6PA 1KVIA 2K1RA 2PGCA 1Y3KA 1CC8A 2XMVA 1URRA 3BB5A 5F0WA 1FESA 1JK9B 2AW0A 2IFXA 1FD8A 2Q3PA 1CC7A 5B0GA 1ULRA 2GCFA 5F0UA 4YDXA 2RU9A 1N5VA 2KYZA 3BN7A 5B0BA 1AFJA 5B0AA 1X7VA 1FVSA 2HFNA 2FIUA 4OJHA 2OAUA 4FNHA 2KKHA 1P6TA 1X0PA 3WDOA 2LQBA 2OKQA 4HL9A 2W4DA 1GXUA 4Y2IA 3HHLB 3TRGA 3UDCA 4Y2KA 2PD1A 3K7RA 5B09A 3DXSX 2XMJA 4DN9A 4NPOA 1XBWA 1Y3JA 2RILA 1Q4RA 1Q53A 1R6YA 2ROEA 3QGPA 3T9NA 3BGUA 4ZOSA 5K9FA 1Y0HA 3HFKA 1Y9OA 2QYCA 1LQ9A 4A48A 4F67A 5IXUA 2LQ9A 1JWWA 5KAKA 1GXTA 4DL0C 5B08A 1YJUA 3HF5A 1RJJA 3IWXA 2GO8A
chains in the Genus database with same CATH superfamily
4IFVB 1PAEX 2C2NA 3M8PA 3PKYA 1B7FA 1H7WA 2QG9B 1XNQF 3H20A 1S9EA 5AJ3J 3HHLA 1Q95G 2QLJB 3C3LA 2QLWA 4ZLPA 4M94A 3J80Y 4JI1J 3G4SS 4R5PA 1U8SA 2HMIB 3M8QA 1YK9A 4P72A 1XJWB 3KK1B 4DV2F 3L95X 4LF7J 5E0OA 3THPA 3HHKA 4DN0A 1M5PC 2ALZA 4CLLA 2GC8A 1QSYA 3KHRA 3GWCA 1RT7B 4OI2A 3VAHA 5KT4A 3KLEA 2NREA 1N6QB 1DQ8A 3T1HF 1DLOA 2XSJB 4UOFA 4YDXA 3PDNA 1WSVA 2LVWA 4R0EA 1T11A 2VKZG 4K4ZA 3FFIB 3J81U 4MYUA 1Y00A 2VPYB 1RAAB 4GO7X 2DITA 1HI1A 1HMVB 1URNA 5CABA 3AFGA 1VBZA 1SKSA 2X7IA 1NPPA 1B0VA 4PXCA 3EGWB 3OHAA 3OJSA 1GMWA 3KUGA 2V63A 3D1HA 3BQ0A 3DOLB 2XGQA 2RT3A 4BDPA 1Q5YA 3CJ4A 4PG8A 1DRZA 4DX8H 2UZAA 3GJQB 3UDLA 3Q83A 2KYXA 2ZC3A 4DF8A 2FJBB 2YH0A 4KSEB 4OZ0A 5BXIA 1Y11A 4WIQA 2JL9A 4HYKA 2QC3A 4CLUA 3B54A 1OPIA 2GQCA 1N34F 1M90T 4JI8F 2D7SA 1VQ6S 4BWMA 2QSFA 2MSSA 4TN2A 5KFTA 5F8JA 4O3QA 1SH2A 1KP6A 2BANB 3C16B 3CDAA 3DC2A 1MG7A 2EKNA 2E5GA 2MQNA 4TXSA 2NPFA 3BKFA 4BC7A 1MN7A 4DV3J 2BVZA 3M8PB 4C98A 3N5BA 2XLJA 1S9EB 3TO8A 1FO1A 2NR0A 1Q7LB 4GVLA 2W2PP 3MR5A 2B7CB 4NLUA 1RAHB 4DL5A 4NCAA 4R5PB 3Q89A 2XI3A 3M8QB 5DQGA 5JVHQ 3RRHA 3CD6S 1IUJA 1IKVA 1HNZJ 1RT6A 1XN9A 3LO3A 5LXYA 1SIZA 3NWRA 4DXLA 2B0GA 5KT2A 4DPOA 2QFJA 2HHUA 3PXGa 2OO4A 2A18A 3LAKA 3EUNA 3DLJA 3GJRB 2V69A 2OEJA 1HL6A 3KLEB 1VHFA 3N6NA 4N77A 3MECA 4OHXA 1LWEB 4OZ3A 3HP6A 2F65A 3TZYA 4U7CA 2FIUA 3TEHB 4FVMA 1HI8A 1UVKA 5C2GA 3ELHA 2C2ZB 3CE8A 1JLGA 1NSPA 1I51B 2H48B 1RHJB 1M1GA 3OJUA 4ED6A 2CPHA 1S10A 1K73T 2OMLA 2VL1A 4DL4A 5K5MA 3OSNA 3ZTQA 1AUSL 1KFDA 2R7QA 3TP2A 3CJTA 6AT1B 2MQPA 3GLJA 3MAAA 3FRYA 5J2MA 3CDEA 1ZAVA 2VQEJ 3RB3A 2VBWA 5DG9A 3T5KA 3ENWA 2DNMA 3CDBA 3GYXB 1UA1A 2PIIA 2IHR1 1KVJA 2W4PA 3VR1A 3P96A 2GVZA 2ZDPA 4C8OA 3PZPA 1A0OB 4C11A 4ELUA 2NLWA 4B3TF 4DDFA 2Z2MA 3A4TA 4IG3A 2ZBRA 4WYWA 1UP1A 5A8WA 2GJIA 3PHEA 1WHVA 2W4DA 5HBMA 3V6HA 2DO0A 2YX1A 3FCHA 4P71A 3FQKA 3R9LA 4YY3J 4D3GA 2HFOA 5I3UB 4DUYJ 5D8HB 4P75A 4JYAJ 1FWLA 3MM7A 1S1WB 1F1BB 1C0TA 2DRDA 5KFXA 2DCUB 1IR2A 3AY0A 4YB5A 1OQ3A 3KLFA 4HT5A 1UZDA 2RKIB 1UTAA 2H54B 1SKUB 2MZJA 3LGMA 3NEKA 3V6DA 1RT6B 3O5TB 5K8PA 2AJ1A 3MR6A 4JI5F 1K1SA 5KFHA 3TVZA 2BJ8A 4DU7A 1M5KC 3HZGA 4C9DA 5ADZA 2N3LA 3EXCX 5I3QA 1YZ7A 1AT1B 3Q8SB 1IVZA 4NEYA 4X62F 1SQFA 3MECB 5DLFA 3WIUA 1TFYA 3G87A 3KUHA 4G6VB 3KFWX 4RWXA 5KFCA 4NCGB 4ZHRB 1JLGB 4BWJA 2KN4A 1JLAA 2IRYA 2H51B 2OPQA 4AQYF 2P5VA 1HBNB 2NYHA 3QWUA 4CZCA 1B7YB 4ES2A 2JSXA 4USWA 4LBPA 4ZJQA 2J0WA 4YEAA 3I9V9 2ZZMA 2C1EB 4NZ0A 4Y0FA 2DY9A 4FYYB 4RO0A 4LF2A 3QT5A 4GKJF 3T6BA 2PO4A 4J9RA 2FJDB 3SFGA 1S1VB 1HIYA 3CCUS 2O3DA 3R97A 2CKWA 2GVZB 1FRMA 2HZAA 4C11B 2KVQE 2BA9A 3ISZA 1WUUA 4IG3B 5F8MA 2E44A 3M2RA 1NDPA 4IO1A 1NK5A 2NZCA 1BE4A 3ZTPA 4UZBA 3JAMY 1VJQA 4C8LA 2FLNA 5A8KA 3RB4A 3K7RA 5HBMB 1JX4A 4HACA 4NZ7A 2KO1A 4NWBA 5GMEA 4NLDA 4JI2J 1RJJA 1WOOA 5AE3A 5FLXU 1OJ4A 1S99A 1UFKA 1BQNA 3CD5A 4L72B 1T9YA 3MM7B 3TA1A 1C0TB 1YIJS 3NCPA 1NKCA 3R6LB 3KLFB 4K0KJ 2MQMA 4Q2LA 2DNYA 3KYLA 2K1RB 3V6DB 2J7WA 1AA1B 1QY7A 5IT9Y 4LRFA 2EG2A 1VQ8S 1JLQA 1I1GA 1SCJB 1X8DA 3CDUA 2HLUA 3C66A 3KOAA 1CSJA 1FKPA 3LANA 3K58A 3DRSA 2HFZA 1B70B 4HT7A 2BXJA 5IV4A 3NKYA 2F1FA 2XB2D 3TJAA 1X7VA 1NJWA 4JOUA 5CHCB 4JI6F 2XQCA 1NB2A 5F41A 2PEHA 1HBOB 5KG5A 3ZXWA 1YVFA 2NS1B 2QN6B 2VFTA 3N79A 2HHHJ 2XG8A 1C2PA 3T9NA 4AE5A 1S5ZA 3BBFA 2KVIA 5FIIA 3K2YA 4OZLA 2F8MA 5D77A 3DMJB 2AJQA 3AOCA 1S79A 1N0UA 1JLAB 2Y3YA 4MJKA 4OZ5A 2OPQB 1KQKA 4QIEA 4I2QB 4PEOA 3VALA 1T9UA 4B9NA 2WBRA 1VBXA 3VAGA 3RR7A 4I64A 4OI6A 2Z57B 2ZDOA 5B0CA 3P3DA 4I4BA 3CD0A 2CVEA 2V2QA 1J5EJ 4P6QA 2F4FA 1NLKL 4YN3B 4X64J 2YNFA 1FRLA 4I6AA 4ED7A 2WHOA 2EFOA 3GFHA 3TVYA 3BKTA 4XDCA 1TELA 1YITS 4DR7J 4DR5J 3MF5A 3EXYA 2FY8A 2ATLA 2B9EA 4KGZB 2FVRA 1JJHA 2DNGA 3M2RB 4NLVA 4CLYA 3L7UA 4NEZA 4ZJOA 4WE1A 2HNZB 2OAUA 1KDNA 2YQ1A 3B82A 3LPEA 2YNHA 3MM5A 5A8KB 3ZNUA 1H7XA 5U47A 2EC2A 2MKYA 3CCLS 1NXIA 3BBCA 2HKEA 3ZTRA 4U96A 1BQNB 1P8GA 3HHLC 2KHCA 4IRCA 2HHSA 1ZBTA 2ZZNA 3RAXA 5HVFA 2KT2A 1MW7A 3A1YG 1Q86T 5DS7A 2EFPA 1YX2A 4K7QA 3TZWA 1RB0A 3FZ2A 1M5SA 4DR3F 1EP4A 2B3TB 2FGCA 2V68A 1ELOA 2GGPA 2G2OA 2KU7A 2YWGA 1N5QA 1OSDA 2CVIA 2F7VA 1JLQB 5DGAA 1BLUA 1UPMB 2HGMA 1YKWA 2V0NA 1TUVA 4RKUC 4DL3A 2PI5A 1Q82T 1FKPB 2JLFA 3DRSB 3CW2C 4HKQA 2A2CA 2VB6A 3KXDA 2UXDF 1I94F 5CYQA 4OV6A 4WFAQ 1DAXA 2DGSA 2XTJP 4Y2KA 3OV7A 3GP9A 1XEZA 4OX7A 4YB7A 1RXOB 1VFJA 2RRNA 5HO4A 4C8YA 1R0CB 3FSXA 1NK8A 4QW9A 2HVIA 1YJUA 4QYRA 1RAIB 1Z1ZA 2IYIA 3TQEA 5C2CA 3DLLQ 3M8SA 4JB8B 2RS8A 1FDBA 2ASYA 4HHJA 1FERA 2W9CB 1QE1A 2V2KA 4C6AA 4OX9J 3S7RA 4QR2A 3QSYB 1QSLA 4DUTA 1YSJA 3CCVS 1ZTWA 4E0DA 3IC1A 2XBPA 2PMHA 1TQLA 3OFEA 2V4RA 4DV5F 5E3AA 5HMWA 4F4AA 2QZ8A 2LLZA 3M2UA 3N01A 4B3MJ 2XLKA 4B3OA 4TLRA 1S6QA 4CO2A 5HLFA 3IG1A 2AMCB 4GVBA 1HQEA 4K4XA 2ZH7A 3GMGA 1GNKA 2W8LA 4KHPJ 2MQOA 3HJFA 2HAIA 2FPHX 1T9WA 4FF3A 2W1BA 3IWNC 3PY8A 1NHUA 2J9EA 2YNHB 4USHA 4UQTA 4RW9B 5IM0A 4BHQA 3BEGB 3WBZA 5A76A 3W7BA 4ZLLA 4G1IA 5B08A 2CWXA 1GX5A 2CZ4A 3JTNA 5GAGU 4RUHA 4LR8A 4Z7CA 2D74B 3EGNA 3VGTA 3J7A1 2VV5A 1ZPVA 2QL7B 2HHXA 2PMZD 1R8CA 1UKUA 2XI2A 4A8OA 2VBZA 2KJWA 1EP4B 4A8MP 4F04B 1LW2A 1NH8A 1PYSB 3IGVA 2VFVA 3LP1A 2BE9B 2J0SD 3CMES 1RLDA 4PG7A 2KHDA 3IS9A 2ZVSA 3F41A 3QJPA 3HFVA 3MPDA 5J1PA 4OHWA 2QTWA 3TUPA 2GVDA 3P5TL 5AXLA 2Q6BA 4NYPA 2V50A 2H65B 2C2KB 3HT0A 1VCTA 1KEKA 2DR6A 4L76A 5KG1A 2QEXS 3DYAA 4D3HA 4IO9Q 4GKKF 1TKTA 2CPFA 1N32F 2ZNYA 1FRKA 3ILLA 4OZJA 4JI0J 2KG0A 1JXLA 1B3TA 3OR1A 2BJ9A 1SI9A 1HQUA 2R8IA 1GQEA 2D69A 2AHOB 5JVGQ 4WFXA 1DQAA 2J9DE 2PDAA 5HVHA 2R9LA 3DLHA 2OPSB 2H4YB 1QAIA 4ES3A 3M2UB 3BYPA 4DLEA 2OEMA 2J6TA 4DSIA 4NMLA 4B3OB 4NMXA 4B3RJ 5ETLA 3QZ8A 2CQ1A 5D0EA 1S6QB 2H5IB 4HEA9 2Z30B 5HLFB 3I56S 3GE9A 4X4UA 2CNKB 4MKAA 1HQEB 2O66A 5F0WA 1IQZA 4LF8J 1VHIA 4MKBA 1H74A 3HKZD 2JFDA 2M88A 1YWXA 5GAHU 1GXUA 1HD0A 2QLFB 3M8YA 2DR8A 4QU6A 5IM0B 1R27B 3M32B 4DQPA 2G2ZA 4ED1A 2ZOMA 2B9XA 2MDAA 4P9SA 2CPEA 2ILZA 4J9LA 1TZ0A 5FD1A 2CNLB 4USKA 2MHEA 3K5NA 5KOXA 2DHHA 2LEAA 3FDSA 4B9MA 2EI5A 4JI3J 1XMQF 1YGYA 5GMDA 3JS9A 5KTQA 1U2RA 1HNWJ 3CJ5A 4EYIB 4DZDA 1TKXB 2RQCA 2PC6A 3G6ES 4DJBA 1HNIA 2G0IA 4ZMMA 1X9WA 1X4AA 2MKKA 4JI7F 3BSAA 1HKAA 2ZHAA 4KKOA 2GHVC 3IS9B 2HGNA 5L9NA 3MR7A 3TWZA 4TYAA 3EGZA 3MMJA 4DFKA 2GVDB 3KK2A 3TW0A 1VJWA 1GMWD 1VOMA 5E2QA 1LQ9A 3K57A 5ETTA 3T1YJ 3DYAB 2CDRB 1TKTB 3QZ7A 4YHHJ 4F50A 1SC1B 2F5GA 4DEZA 3I87A 4FKXA 1HHQA 1FNMA 2COLA 3TNVA 2J6SA 2GNKA 3HHEA 2EW9A 2GJFA 1DTQA 2AEJA 3ZZTA 3C15B 5B0FA 3W61A 3OR1B 3U02A 1UW9A 2IAJA 1TAQA 1WNEA 1SC6A 2LXIA 1CEZA 2C2OB 4ES1A 1N5YB 2Q6CA 1IKYA 2HS0A 2J8SA 1I3OB 3SCLE 5KFMA 2VD3A 3FBFA 3QT8A 4ED3A 1K0TA 2BQ3A 1R7IA 2XY7A 1RTJA 4C8NA 5AE1A 1MMDA 1FTRA 2RU9A 4QZVB 3D3CJ 3AQOA 4F4ZA 1T05A 3CC2S 4YS2A 5LMNJ 2VQFF 3P45B 4DHVA 2JWNA 2ZH1A 3C6TB 2MMYA 1XNRF 1JLCA 1MN9A 1VQOS 1C0UB 2IVMA 3KG0A 2V8DA 4RW8B 2XMKA 5F8NA 3AJ1A 4DV7F 1PILA 4OYMA 3W9JA 3D0HE 3VAKA 3BGRA 1ROFA 2LECA 1RCOB 5M2PA 3K8VA 2OTLS 1O0PA 2RNEA 5DDRC 1C1CB 2N3OA 1F5AA 4QWDA 5C25B 1UZHA 1T9TA 2NXEA 1ZOTA 1YHQS 2X3DA 2E5LF 2DEJA 3FCVA 4E98A 3VGUA 1BD6A 4X84A 5DM7Q 4UOHA 4JV5F 4AL6A 2CJKA 2BR0A 1WORA 4KKOB 1EARA 2W7AA 3UFCX 5DQHA 5JMNA 4O3OA 1ZETA 1G6BA 4XDDA 3NWGA 3BN4A 1SV5A 3MEGB 4B3SJ 3KK2B 2IA0A 3WHIA 2BE2A 4F7VA 3EZUA 1S9FA 4HDHA 1OYDA 1Y3JA 3D7SB 1BMQB 1X5TA 2Z4PA 1Z2LA 1UWBA 2CZ9A 3VZIA 4QQBA 3A8EA 3A3NB 4I68A 3GJTB 1B4SA 3VHQA 2GA7A 1PGZA 3Q8PB 1HNVA 4F3MA 4BS2A 2AYGA 3PR5B 2OP5A 1DTQB 4YR2A 3UR0A 2ADCA 2CAJA 5CA5A 3MFHA 2IAJB 3O44A 1KHWA 3MEDB 4ALZA 2LEPA 4ECRA 1IKXA 3MMCA 1F3VA 1YRXA 1JNRB 2YH1A 3UD5A 4C97A 4LF9F 3CCWA 5KFNA 1U7LA 1TP7A 1NAQA 3RB0A 2QIFA 3AA9A 1D9AA 1BWVA 3HM9A 4AUKA 1MMLA 4P2SA 1RTJB 2FLPA 4RNMA 3PX0A 1OO0B 3R5DA 1T05B 5GAHI 3ENAA 4U8YA 2BRLA 3L4BC 1S6PA 5K9FA 1VS3A 3IBWA 3AD9C 3ITHB 1JLCB 2HRYA 2V4JA 1FJGJ 2M4MA 5EHHA 2KT5A 2VKRA 2AWZA 3HKWA 3HJVA 1LWFA 2M8HA 1RTZA 2PEBA 4OI3A 4YR3A 3OBIA 4WPAA 2E5IA 1U49A 3SBMA 4EFAC 3R5AA 2ZBCA 1RYRA 4MH8A 3BGRB 4IRKA 3M05A 9ATCB 1WTBA 2ZE2B 4HTJA 2BM1A 3PG9A 3ZZZA 1TUWA 4MAKA 2DY1A 2OTJS 3DLEB 3WX4A 4G1PA 1S0OA 3JQMA 1WC5A 2BOAA 3HZEA 5L8RC 2BQUA 4ZPVR 1OQ6A 2MKCA 1LKZA 2I38A 2Z8QA 2LEBA 3VWSA 4PXDA 3UO0A 2QL5B 5HP1A 4WFBQ 3K17A 2PI4A 1H2UX 3BJYA 3EX7B 4DWIA 1AFJA 2RDDA 3GILA 4AD6A 3OUYA 4GRSA 3UNGC 3GSIA 2V94A 2HNYA 1I6JA 4IH5A 1S0NA 3FRZA 4CNZA 4IFYB 4NLSA 3L09A 1UWBB 1FDNA 4RWWA 4WP3A 4DR2J 2HPUA 2Y1IA 1HNVB 2Z58B 3LP2A 2P8IA 3CJQA 4DV2J 4OYZA 1PSDA 1DHMA 5KFKA 5SUHA 2DTJA 3WIVA 3W3SA 4DX5A 4NLWA 1IKXB 3VGVA 4EBDA 4ZITA 2ZKUA 3MMCB 2CPJA 1K1QA 2LQ5A 1TAUA 1Y10A 2YWWA 5DDQC 1MMNA 4M5LA 1GAOA 5E3PA 4MYTA 2XCPA 3R27A 1U0SA 1HNXF 1WOPA 2MKSA 1L5UA 2DO4A 1NH7A 1SUQA 3I5AA 3SFUA 2B4OA 1RWXB 1F5BA 1G3OA 3MDFA 3NXZA 3B78A 3GR0A 4I6WA 4QBUA 3H5UA 4K4VA 3MI7X 1RAGB 1L3KA 1REGX 5CXTA 1S6PB 3PW5A 5KAKA 2I2YA 2JFKA 2YWKA 5GMKa 1N56A 4Q8FA 5FDLA 2BJDA 3V5RA 7AT1B 1PBAA 2MLYA 4ZPTR 4QR0A 1LWFB 1ITPA 2BX6A 4O3NA 2W8KA 4OYPA 1NPRA 4EBEA 3FK4A 5D3GA 4NYOA 4F36A 4OYBA 4E2FB 5GADU 2WK4A 3M2VA 2GIQA 2VDIA 1CQMA 5HQ8A 2HS3A 3MCSA 3O1LA 3I55S 1Z2ZA 1WDTA 3TX0A 3IXQA 3HSZA 4RW4A 4NXMJ 2CQ2A 2BZ2A 3MD3A 3J80U 1MNEA 1KNZA 4JI8J 3TUJC 3MFIA 1U2FA 3RRKA 4USVA 2MB0B 3M30A 5HP1B 4B9VA 1RHUB 2CG8A 2HQCA 4CO3A 1XIQA 3TA2A 4C0OC 4I7FA 1LWCB 4DG1B 4Z2XA 2HNYB 1XK8A 4CLKA 2CADA 4MTPA 4WXWA 2HQFA 4J9KA 3HI9A 2VPWB 2IM2A 3TJ8A 3OTOJ 2CQ4A 2QYGA 3MEEA 1XMOF 2ASJA 4AL5A 1WHWA 2VICA 2DGXA 3LGNA 2FJVA 4PYDA 4A8QA 2RSQA 1OSCA 4NZ6A 2XHCA 4DQQA 1RACB 1RDRA 4MK9A 4DV4F 1SH0A 3THVA 2VJVA 4JBCA 2KZMA 1VBKA 1XR5A 2UXCJ 3GU0A 4CO0A 5KFBA 5HK4A 4ECWA 4O3PA 2C3MA 1FKOA 3P5BP 1RBOB 2X3GA 4I69A 4MMOA 2W2QP 4M1KA 4EI2A 2FZGB 4M5DA 1SUQB 4Q7AA 1C1BA 3HK2A 3H42A 4ZKAA 2KXNB 5L1LA 1IWAA 7FD1A 4F25A 4LSNA 1U47A 2DPIA 2R7TA 3EWGA 2YPZA 3EDRB 1RKJA 2SXLA 3CCZA 3PW7A 2B9YA 2NQPA 2ZWOA 2JEIA 1FKAF 4DI6A 4KGMA 3N5FA 1GK8A 5FDLB 4HI1A 3RG6A 2M70A 3LWMA 1CJTA 2XS2A 3QFWA 1NNDA 2DNRA 4F3QA 3BV8A 3RAQA 4ZP6A 4Y2CA 5T7LA 3SV3A 4ANEA 2UVRA 2XMMA 2FZCB 3M2VB 3H4DA 2YY3A 1YTYA 1YBUA 2GO9A 5AJ3F 3I9ZA 2M7SA 2RDJA 2O01C 2HURA 3OT9A 4JI1F 1WI6A 4PR6A 4B3TJ 2AGQA 2E9TA 4DSKA 2VH7A 3IAS9 4M5KA 3M30B 4C2MA 5IWAF 2GCFA 3M8RA 4NCBA 3OD2A 3OXLA 4I7FB 1D8ZA 3G2XA 3MM9B 2VASA 2FY1A 3OXFA 1RHMB 3OLAA 1T03A 2E7XA 3FKBA 5K14A 2DXFA 1D1UA 1IBCB 4FF4A 4Q5VA 5IFMA 3MEEB 1R3NA 2BV3A 4WBFA 4Q2MA 2C2DA 1PIEA 1RBAA 5ETSA 3KDOA 4EBCA 3DOKA 4ZPBA 2GMHA 2ZZTA 2MQLA 3ZZUA 4EZ6A 1CVJA 1EQ0A 1HBMA 2FZKB 3BQ2A 3ZZYA 4H4MA 4PAAA 3D1QA 2WSEC 1RT3B 4LRAA 1V3RA 3M7VA 1U1QA 4QPXA 4EEYA 1WKKA 1J2VA 4J5OA 3A8KA 3KKFA 2GZOA 3KMQA 4MIBA 3M6VA 3PX4A 1DJ0A 1QUPA 5D0RA 2IRXA 3EZOA 2R8JA 1EETA 4ZA1A 1VQPS 2QA1A 4N7TA 1CC8A 2OUGA 3H5SA 1EKRA 1Q78A 4M5DB 3PIPQ 3HVTA 1NEEA 1C1BB 2JHEA 4X4SA 1QAYA 3EM1A 3HXMA 2MEWA 1AZSB 1N36J 3O8WA 4LSNB 3EVOA 3QWPA 2KDOA 4C0BA 3PFOA 3VVTA 4FBUA 1HLWA 3BH7B 2G1HA 1U1RA 2CIMA 1MWYA 1KQSR 1JLBA 2FQQB 4XPEA 3HSGA 5CQGA 1RTDA 3L3CA 4MKVA 1U6ZA 1IJEB 2XS7A 4YP3A 2W01A 3HX9A 3DOMA 1AYEA 4E8UA 2MYFA 2ZH6A 1NJIT 1Y5LB 3DN9A 4GKJJ 5GADI 5T7LB 1VC6A 2GHPA 4K8RA 2MTLA 4TY8A 3ZTSA 3H5XA 1TR0A 3GG0A 1CG2A 1UAWA 1RHKB 1KFSA 2F40A 4PXBA 4LFAF 4ZJLA 3KLHA 3LPYA 5DG8A 3PFEA 2G2YA 1QUVA 1CJVA 1CULA 4HHHA 2HQDA 1PYTA 2EEYA 1RT2A 3T5JA 3QAUA 4XO0A 4N5SA 2EFGA 3HVWA 1V6HA 5KFSA 3W2WA 1JLFB 4NX9A 4W4MA 3F56A 2YKNA 3IRWP 1T03B 1YZ6A 2RIJA 1GMUA 5K14B 1U1NA 2JZ5A 1SL0A 2R2RA 2OI2A 5B0EA 1FTCA 3QGIA 4LF4F 2MY7A 3CJSA 5DM6Q 2VFSA 1NO8A 2LKZA 1VK3A 3MTJA 1NHVA 4WZMA 1Q8IA 1UA0A 3TEGA 3F73A 4HVZA 4H4MB 2R2UA 1GTEA 3U1LA 4DF4A 4WJBA 5HJXA 4G1QA 2WSCC 1RT1A 5HI7A 4G65A 4O0IA 2V2VA 3IFEA 4OYOA 4TU7A 2DGWA 2IDLA 3NGDA 5ETKA 4CLZA 2WVFA 2VDHA 1U1MA 1YJ7A 4ZP7A 4ZVHA 3BH6B 2W24A 4QIGA 2CJ9A 4WCEQ 2KFYA 2OELA 4JI6J 2QA4S 2M52A 5C7PA 3BN7A 1RU1A 3KHGA 1U1LA 2GIFA 3K5OA 4MK8A 2EFQA 4TYBA 4UY8T 3ZZOA 1MSWD 4JV0A 2NXNA 3ISND 2E1MC 1RWUA 5CH7B 1LK5A 1JLBB 2BJEA 2VPXB 1FJCA 2VA2A 2Z2LA 2AYEA 3BYRA 2ASLA 1FDAA 3BO3A 3JAMU 4LRBA 2BBEA 2YNIA 1HR0F 2DIVA 4X2BA 3DOMB 4DFMA 3VQSA 1YJWS 1VQSA 1D0EA 3RYLA 1PAUB 3CIMA 4QWAA 4FYVB 3GIIA 3FGVA 1E6VB 2WB1D 4DUYF 4U7UD 4JYAF 2OMOA 2WSFC 1APSA 4JUZA 3KLHB 4EZ9A 5KT7A 2GAHC 4H4KA 2LDYA 2UV8G 4WYLA 1CJVB 1WC3A 3H7HB 2L41A 4M95A 2LQJA 3D6MB 5IT9U 1RT2B 3POTB 3SIPB 5DQIA 2Y1LB 4J9VA 1ZZNA 2MHNA 2HSEB 2XO7A 2VZ9A 3NG8A 2DGQA 3I5BA 1KLNA 4EU0A 2YKNB 4RUAA 4A8YA 4Y2AA 2DIUA 5FLXY 3H59A 4X65F 4QYZJ 5GAEU 3NGUA 3NGSA 4LRDA 1N8RT 4DQRA 5CYJA 2PSZA 4WU3A 1LXNA 2G9OA 3MD1A 4ZVPB 1PBUA 3S1TA 2P6SA 3PVXA 4DR3J 4NXNJ 3D67A 3CCQS 1ZM9A 5T41A 1FA0A 2L3MA 3S8SA 1G2EA 3MWBA 1YJTA 2W2NP 1EIYB 4I6YA 1P27B 4G1QB 3LOUA 2DXEA 1QSSA 5KG2A 2DH8A 3GSDA 4TVAB 2BW7A 2J6UA 3FZBA 1DTTA 3BSNA 1WD6A 1IWGA 1AUDA 5LSOA 1I94J 1OWXA 2B4VA 2CJAA 2BJ7A 5B0GA 1CC7A 3OTBA 2CPYA 5KG3A 2O67A 4IKAA 3R7NB 2LA4A 4QJVA 5D4LA 3L9ZA 3DLBA 4OMFG 2MQQA 2HEKA 1HQ2A 2ZOGA 2HVZA 2OKQA 4K4WA 4Y2IA 3UWTA 3CJ8A 3QRPA 1FRXA 1BXNA 5BR8F 4PUOB 1EQMA 2CJQA 4DSEA 3PYEA 4O23A 2MPUA 2YKAA 3HCXA 2GO8A 4EWTA 1JJCB 3G86A 3JTPA 2P2CB 4LSZB 2HW3A 1XC9A 1QTNB 3D28A 4M5GA 2ACYA 2HBZB 5F3TA 2LQ8A 5KG6A 2CQ3A 3GPAA 3TVKA 1L3UA 1FXRA 1OPZA 4OI1A 3JXOA 4Q45A 4LFCF 1DARA 4TU9A 2ZHOA 1R6VA 3CJ0A 2IC3A 1S9GA 2MJUA 2DNZA 4QPTA 4J9NA 1RT5A 5IOLA 2XHWA 2N4CA 1WC1A 2BJ1A 4I2PA 2CJYB 1D3WA 1VQYA 2W4CA 3AJ2A 4RUCA 5ETRA 1IBMJ 2HNDB 4K0KF 4NLQA 3SQGB 1H73A 3KHLA 3E01B 2B4PA 4ELTA 3N0VA 2GIRA 1JIHA 5KT6A 1ZH5A 3AHPA 4FN5A 1VRTB 1SKWA 4ZN3A 5B09A 4X4NA 2AZ1A 2QMUB 3PYDA 4P73A 3CCTA 1RWVB 5L1KA 4DSFA 2BKOA 1YJ9S 1Q1KA 2VBXA 3G82A 4DX6A 2MY8A 5DJBA 2CQHA 2H9ZA 4ZPCA 2CPXA 2KJVA 2J7UA 1FHTA 4DSJA 3D2WA 2VG7A 3E51A 5KFZA 2QMWA 5HJYA 3Q22A 2XMWA 3G96A 2HRTA 1LW0A 3MTKA 2XCAA 5BYQA 3N4WA 2WBMA 3U1NA 4CTAB 5HN0A 1RGVA 2HQGA 3QYYA 4ECSA 3NY0A 4TY9A 2W2MP 4QIWD 1DTTB 4YUDA 5KFQA 2AYMA 4ANDA 4WFZA 4KE5A 1J5EF 3UDVA 1KSPA 1N52B 2VG6B 1HBUA 2DRAA 3IMQJ 4AXIA 1UVNA 3HHNB 3QGHA 4ECQA 1N32J 1SJRA 3JSYA 1TMJA 3F0NA 4LT6A 4DR7F 4DR5F 3DLKA 2RHQB 3MPVA 1EX8A 3KJVB 3W5ZA 2UUAF 5B0DA 2GS8A 1VIXA 3MUMP 2QT7A 3R6GB 5ETMA 4O44A 4K4UA 4ILLA 2ZH3A 2E66A 2Q1LA 8RUCA 2FTRA 3DDNA 4IRDA 1HWJA 3LWLA 3A3OB 4KH0B 4CLPA 3FCWA 1X0FA 4DL6A 2DPJA 1RT5B 5ETQA 3M1VA 4ANCA 2XM3A 4I2PB 4DBQA 2AEFA 2JNJA 4MIWA 2KM8C 3J7Z5 5CAAA 4R25A 3V81A 3DGPA 1ULRA 1VISA 5E41A 3JB9k 3TAMA 3ZC4A 3NLCA 3FMWA 3HHLB 1SJQA 4K59A 4UUWA 3A8IA 5E3RA 2YX7A 5GAEI 2FUG9 5HMYA 4B9UA 4HTIA 3HT3A 5I4MA 3M9OB 1S4FA 1XMQJ 1RAOA 1BY9A 3BSCA 4IH7A 5CYMA 3RW6A 3EJMA 1U1OA 1ACMB 1IBKJ 4URGA 2Z2ZA 2NSCA 3PTWA 3U7JA 2UXBF 2RU3A 1BHNA 3ICLA 5DLGA 2IDEA 4RW6A 3OXGA 1DLOB 4DCJB 4JI7J 2MZQA 1XMBA 2HZVA 3DRRA 2D41A 2ABYA 2XO6A 1Z4UA 3M6WA 2POKA 3MEKA 1IXKA 2AP6A 2CQGA 5EWGA 1QM9A 4ED4A 1FJEB 3IR7B 5HATA 2CQCA 3IRXA 1HWUA 2QLBB 1KQFB 2C2EA 1JLEA 4ECZA 2ZUAA 1PG5B 2H1YA 1LEOA 1HBUB 4B3MF 2Z2YB 5CZXA 3HO1A 1OY8A 2KB2A 4NLGA 3C6UA 2OGUA 4W98A 5EX0A 1I5OB 4PG5A 4UOCA 2DD8S 1R0BG 2R7WA 3DLKB 3NOCA 3NRBA 4CT9A 5J2NA 5J2PA 4KHPF 1BGXT 1MROA 4EMDA 3NP5A 4LBIA 1WELA 2C3UA 1AW0A 3A12A 5IV3A 2A1BA 2ZUGA 2VOOA 2FHMA 3NL0A 4OZ1A 2ROGA 2B7BB 1NDKA 4J91A 4BC9A 4ZCIA 2I5JA 5EN1A 2L9DA 2BKNA 1RSCA 1V5VA 2XZWA 1NK9A 3NGTA 5LMUF 1RAEB 3M1VB 2DNKA 2CRLA 1NUEA 2PGCA 1T7PA 1T02A 1NJYA 2Y1JA 3GIMA 3DGPB 2X1FA 4Q44A 2VQFJ 3H40A 1FX4A 1BC6A 1UL3A 2DNPA 3TAMB 1XNRJ 4RLEA 1O5JA 1VC0A 5A2QU 3D54A 3GG1A 3I0SA 3CCMS 2PA8D 1VQKS 2XNQA 3I6PA 4DL2A 3C46A 3BS9A 2P9EA 1NK7A 3JSMA 4DL7A 1IKVB 4DV7J 3QMQA 3LH2S 5IQQA 2W9AA 4N8NA 3L7OA 5CYMB 1Q8KA 4U9RA 5GVQA 1FFWB 2IBOA 3HVRA 2HLTA 2JEGA 3IWLA 2QLXA 2YQ0A 5F9LA 2LP4A 2LFVA 3DXBA 3UE2A 2NUUG 2CG4A 2BABA 4KFBA 4WFYA 1Q7YT 2ZWPA 1LFPA 4JI0F 3DRRB 1FCAA 4JV5J 5L46A 5HL7Q 2HHPA 3TR5A 2OFGX 2OPRA 2CNNB 1NKBA 1QAXA 1NSAA 3IRXB 2YKPA 4JV2A 2OSQA 4ILMA 4WP9A 3EICA 3FSYA 1JLEB 2RAQA 3TZXA 4IR1A 3C2PA 1S59A 4OI0A 2E1CA 2HQ3A 2F3JA 4B3RF 3C6UB 4Y28C 2WZ1A 1R8AA 4PYAA 3MAAB 4N76A 5J2MB 4KPYA 3CB4A 5BYSA 4KH1B 4LF8F 1BUXA 3NCRA 3MM6A 3UVJA 1A9NB 2HVEA 5J2NB 2X51A 2MGZA 3BO4A 2KT3A 4LIRA 2A10A 5HQMA 2PA3A 4P2XA 4ILRA 2ZJQQ 4K4YA 2DXDA 4FPIA 2UUWA 2RHSB 5IC6B 2XWXA 2YQ3A 2OD6A 1HPZA 3GIKA 2DR9A 3G6VA 3W63A 2K8GA 4LF9J 1VDHA 2I5JB 3GV5B 1DBDA 4B9TA 4Y00A 3PV8A 5A8WB 4G3IA 3D68A 2R8HA 4AL7A 4C4WA 1KS2A 3QRRA 4LMZA 4H4KC 4X66J 1IR0A 1GMVA 4ED8A 3Q8YA 1JJ4A 2D9PA 1HNWF 2CQIA 2H3EB 1FF2A 5L38A 3Q8RB 3WQPA 1WOSA 4H54A 2E7VA 3RRGA 2K3IA 1IM4A 1OMSA 1N33J 2GW8A 2DH9A 1H0HB 4CDIA 2Y8YA 3TQ1A 3IN5A 2JH3A 4KV8A 2HHWA 4BBYA 4F2SA 2IYGA 3JSMB 1R8HA 4EUVA 4WTOB 4IQXA 2FVQA 1VLYA 4NA1A 4S0MA 3RBZA 5H1SV 1YG0A 4DS5A 3UN3A 1HHTP 3DHXA 4DUZJ 1PO6A 2E7WA 4KHRA 3T1YF 3Q2TC 4IUFA 1VQ5S 4PPZA 2UUCJ 4DV6J 2BM0A 2RF2A 1RYSA 1UJ4A 4KFBB 2BMBA 4KO0A 1U24A 5KG7A 3H90A 3R7BB 2MZTA 4L75A 2R7RA 4WK1A 1X4DA 2OPRB 2B5JA 5DRKA 1RWOB 1Q81T 2AW0A 3V2UC 2ZM6F 2WONA 3R5GA 4X4PA 2DHAA 2IY5B 4CQ1A 4QIVA 1RU2A 2ZC4A 3OTCA 2XMJA 3FBBA 2NYIA 1R6YA 2D3OR 3DHWC 3DNCA 1TL1A 3P6YC 3MCOA 1X5SA 3M8WA 2MJNA 5A8RA 2JVRA 3UR3C 4F4XA 3QSIA 4HDGA 4TKTA 3MM6B 3CCES 5LMNF 3VTIA 2CJXB 1Q8BA 5EDWA 2F4VJ 2KZZA 2L48A 2H5JB 2LMIA 2QRRA 3RBEA 3AB2B 3LUYA 5EWEA 2XNRA 3IAM9 1ZZFA 1HPZB 1IQTA 2BKPA 4LVOP 3PJ9A 5A6WA 2OIHA 4TQSA 2JC1A 2AJFE 4PG4A 3NAHA 5D6GA 1HNXJ 1S7HA 1IBLF 4RL1A 2Y1RI 3TI0A 3I4HX 3J7YU 2V4QA 4HACB 2DJWA 1N54B 4DCPB 2XS5A 3E3XA 5B0AA 3GFYA 4FNHA 2VC0A 4UT4A 2G13A 1SJ4P 4B08A 2IA6A 2F63A 3DRYA 4QWCA 4JP8A 2RRBA 4XAKA 3CCJS 3U1MA 4V19X 3W9HA 3MMBA 2M5YA 3T3FA 3PJWA 4A46A 2CUYA 4ER8A 3PIOQ 3K5PA 4FNIA 1IR1A 1QD1A 4EO6A 5KFEA 3CWJA 2D3UA 4URQU 2CNOB 2MKIA 1UEVA 4AXJA 4P7VA 1D09B 3EMTA 5IQ6A 2RF2B 1S72S 2BDPA 3E8OA 3RW7A 5CD4H 3KK1A 2JC0A 4KO0B 3IM9A 2ZH5A 2DH7A 5D4PA 3O2IA 3I5CA 2W9BA 4LR9A 4J9SA 4KGXB 2B5JB 3BB5A 4ETZA 2DRBA 1RHRB 1HFEL 3VZHA 2XC9A 1T95A 3W65A 1RT7A 4PG6A 3W9IA 4XIUA 3IP0A 1N6QA 3AOAA 3R1HA 1IKWA 4A48A 2BQRA 4UW2A 4OZNA 1WTFA 2O5DA 2DNHA 4JI4F 2IVYA 1TKZA 1TUGB 2DGUA 5DO2A 5A8RB 2RRAA 1M1KT 2R3VA 2I1RA 3AJDA 4M5HA 2RB7A 2YKOA 5K8MA 4DV4J 5KFPA 2YNFB 3T5HA 3CEDA 5KOWA 4DFPA 2Y0BB 1EJ7L 3BF4A 1FVQA 3MR3A 1FJGF 5F8GA 4ECVA 4DV0J 3PKMA 5K8NA 4NA3A 1KD1T 2A2DA 3DKDA 3SCIE 4WE1B 2MKJA 2MZRA 4P52A 3Q8QB 4USUA 1VMBA 1ZPWX 3HD1A 4FZVA 3ZO7A 3MM5B 1FXLA 4RPFA 2NXUA 2V9WA 4WTYA 2DHXA 2CYYA 3TA0A 3WC0A 4O3SA 2A6MA 1J5OA 2HG4A 3Q8UA 2CQPA 4CWBA 4DR4F 5E7OB 2C22A 3GIRA 5DDPC 1UPPA 2OH2A 3HPOA 2U2FA 4DPWA 2UVWA 4P74A 4A8WA 4DR6F 3OL9A 3MMBB 3C16A 2UU9J 3ADAC 4U6PA 3UCUP 2GGPB 4ICLA 2KXHA 4WIIA 1A6LA 3R5JB 1W7WA 2FC8A 3FBCA 2N7YA 1E6YA 4ZCMA 1B64A 1NK6A 1G7CB 2LYVA 4DR2F 2O1PA 2R2SA 5D4OA 3H2UB 5CYQB 5J2QA 2XEXA 4IG0A 1X5PA 3PRBA 5THWA 2IVFB 1QLNA 5IWAJ 1W26A 5HROA 3KDNA 1XQIA 2W9BB 4PCQA 3R8YA 1JK9B 5DGBA 4AFFA 4C3KA 2VF3A 2GHWA 4K4SA 2JX2A 3R2DJ 3BREA 3D1OA 1LWEA 1IKWB 1QE1B 3EGVA 4CM2A 2E29A 1T3OA 1TKZB 2W7OA 2AJ2A 1KBRA 3D66A 2K7JA 1FX2A 5KG4A 5EX3A 2QV6A 2BACA 4N56A 1KHVA 3RTVA 3PJXA 4DPUA 2JDJA 4ID5A 3P49B 2YKMA 2XGPA 3IG1B 3PYFA 4F4WA 1YDLA 3V4MA 4GVBB 3DRXA 4P2FA 3RUBL 4A8KA 1TMMA 2R4FA 3FNNA 3GQCA 5HVGA 3UCGA 3PR4A 3J7YI 3ENQA 2FC9A 3HHLD 1NM2A 2WTFA 1RZMA 4L3KA 2RQKA 1PC5A 3NGKA 2R7OA 3MUVP 4KHMA 3G8SA 1YRUA 2DNQA 2ZH2A 3MOZA 1J5OB 1X4HA 1B99A 4NXMF 4YR0A 3GCXP 2LU2A 3QGPA 5CZVA 1Y9OA 3H25A 3T5LA 4U7UK 2KI2A 3IWXA 1S57A 1XR6A 2LA6A 3DI6A 1H6KX 2B4UA 4DPYA 3CMQA 4A47A 1NJZA 2H5EA 1LW2B 2VHGA 4F02A 1S7IA 4PWUA 4ICLB 1VRUA 1YJRA 3LP1B 5KFJA 3CTRA 5LT5A 1VBYA 5I3UA 2ZH8A 3OTOF 1Q0NA 3BGFA 5HMZA 1YJVA 1S1WA 4WXOA 3DDIA 4KPCA 1E6YB 4LFAJ 4RNFA 1SKRA 2VBYA 3GFXA 1LFWA 3LP0A 3LF0A 3H98A 2ZITA 3GR1A 2J8AA 2RKIA 5J2QB 4ZPAA 4IG0B 3I96A 4U67Q 4LJMA 3W62A 1YLXA 5HROB 3PM9A 2JLGA 4FVCA 1DZ5A 4NI2A 3WC2A 4C48A 1XR7A 3QBCA 2UXCF 1PKUA 2AZ3A 2CQBA 4LSLA 3JYTA 1ICEB 3UDEA 5DETA 4WP8A 4X4RA 3HFKA 1DQ9A 3M9MB 2LQ9A 3ILJA 1QAJA 3I31A 1HQUB 5G0RA 4LF4J 3SZ2A 2UVUA 4U95A 2QFIA 4PQUA 4NCGA 2A0FB 3UI3A 3ET6A 4ZHRA 5DDOC 3THTA 2GQ2A 2DR5A 1H72C 4WK3A 3H8YA 2IM1A 2DEIA 3FBEA 1W2BR 4LVNP 4NRUA 4I0WA 1L3VA 1O8BA 2HIYA 3KG4A 3VCDA 1HBNA 3GFZA 1S4EA 1TTHB 1M5HA 2YTCA 4DOZA 4ID5B 3CO0P 2YKMB 5MAOA 1QTMA 1PYOB 1VQ9S 4ZVGA 4CLFA 3I0RA 1UVIA 2DVIA 4RBVA 1WF2A 3MZIA 3PRVA 1WACA 1X4GA 1RBLA 1SBRA 2VUGA 3EE3A 2EBGA 3C8YA 2M0GB 4WWSA 4HLBA 1WF0A 2WVEA 3T9ZA 1S1VA 2Q3PA 5LM7E 1RQ0A 3TYTA 4YFUA 3H0PA 4ECXA 4NLTA 2FJEB 2PD1A 3AXKA 3W64A 5T14A 2EBEA 5IC4B 3OHBA 4BCAA 3RAMA 3MCNA 2X1GA 3FVYA 1HARA 1SPBP 4ZVTB 4DL0C 1RTHA 3MPYA 6FDRA 5IT0A 4PWDA 1HR0J 3DI6B 4YOEA 1SXLA 3ZFVA 5H9FJ 3S6EA 3P8BB 3HVAA 5H9EJ 3KLIA 4F0KA 3MOJB 1HNIB 3ENVA 1VRUB 1QVFR 4DPTA 2F8HA 4TLQA 3J7ZT 4LF5F 5BYRA 3LP0B 2G1DA 2B43A 4DR1F 2HBYB 1MLAA 4DS4A 3R5BA 3CT9A 3MUTP 5C42A 2RQMA 1SQEA 1T9XA 4RZRA 4Y34A 5A6PA 1DURA 2K1RA 2RD5C 4K5SA 1B0TA 1HW8A 2QMXA 1VR6A 4RU2A 4LQ3A 4NI2B 2YKQA 2AEMA 1SL1A 1U2CA 4LSLB 3JYTB 4X65J 4DV1F 1RHQB 2N7CA 3GONA 5IXUA 2X1BA 5L39A 3BKUA 1YBAA 1K44A 3TZZA 5G0RB 2Z56B 1HBOA 1KN6A 4LUBA 4PQUB 1FEHA 4LFBJ 1OS5A 2XMUA 5LJ5Y 4FXVA 4NLYA 2VFUA 3ET6B 2MZ1A 1TL7A 1N36F 1JJ2R 2C3PA 2B56A 1OY9A 2FDNA 3AD7C 3DMJA 1VK8A 1IKYB 5LOQA 4J9MA 3SI8A 5LJ3Y 1CS4A 4I2QA 1NZ8A 5KT3A 1TK8A 3OW2R 1RA6A 4ENOA 3SEOA 4C8ZA 2ZVIA 1FFGB 4IH6A 3H2VE 3I0RB 3JQKA 3RBDA 1UWAA 1O6XA 5KFGA 2AJ0A 3CIZA 4UOGA 2HHQA 4QU7A 1NSQA 1S48A 4NYZA 2VOPA 1HYSA 3B4DA 2MSTA 3VV2B 3MURP 4LF1A 4O3RA 5BR8J 3CD7A 4LRCA 4OQJA 3ILOA 4HR2A 3KJNB 2QX0A 2M9KA 1UFWA 5LSRA 4ZOSA 1C4AA 4L74A 4R8UA 4EO8A 2QL9B 3ONQA 5LSLA 3HF5A 2HNZA 3JQJA 3CO9A 2V67A 1TL5A 1RTHB 3CDWA 5F8HA 4PWDB 4I56A 2DCLA 2RJZA 3VAJA 3CJKA 2YWEA 2CWKA 5DZ7A 3EDQB 1HHSA 4J7CA 1KWMA 3KLIB 4LFCJ 4KJIA 2LCWA 4CH0S 2ATCB 1VQNS 2J0QD 3W60A 4OX8A 4LF6F 3GYNA 1W2IA 1OIAA 1WKJA 4OJ1A 4QIFA 1VQ4S 1GTHA 5KFYA 1V3ZA 1SV5B 5C42B 2BE2B 2XZTB 4KC5A 4CIOA 1XNQJ 2KH9A 3BPSP 3SMZA 1WDDA 3LQVA 2V2ZA 2V8PA 2E1PA 3ULHA 3QFHA 3QPIA 3TRGA 4LQ9A 2IM3A 1KOOA 4WKRA 3NGRA 3MAQA 3UCZP 2DYAA 1OY6A 1J27A 2NUHA 3DCAA 2AX0A 1NB7A 4A4JA 1PJ5A 2YX4A 4FKYA 1X9MA 1TL7B 2LXFA 4OYIA 4J90A 1SL2A 2DISA 1CS4B 4O4GA 2KFNA 2PMWA 8ATCB 3T1HJ 1X9SA 3MMAA 2XMTA 4PXEA 2W9CA 3BSOA 1MWQA 3PW2A 2WVDA 3QRQA 4OV1A 3B6BA 1L3SA 3KMSA 3M6UA 3ZZ0A 1RWWB 2YVSA 2EWHA 3IGNA 3IM8A 1TVRA 3T41A 3PACA 4NE9C 1FD8A 2V4JB 3AAWB 1HYSB 4RBTA 2M3DA 3H5YA 2C2RA 3DXSX 2XY5A 2HHVA 4OL8A 2EPIA 2VU5A 1IN0A 4M5NA 2QYCA 2UUAJ 4NASA 4R8UB 2R2TA 1U26A 5D15A 1AB8A 1F5CA 4FYXB 4RW9A 2OFHX 3TARA 2E5JA 2ZD1A 3CJKB 2B51A 2EXUA 4PABA 3ETOA 2ZKTA 4MKYA 1GH8A 3OTEA 1IJFB 1N34J 1DFDA 1S77D 2HFUA 2HVHA 2XY6A 2H4WB 1KVKA 2HK3A 4OFZA 2UUBF 3QJLA 2KRBA 3QNWB 1D9DA 4CCHA 4A8SA 2E1RA 1TK0A 3A8JA 1S6UA 4HHUA 2NCKL 4OX6A 1T3NA 2E1AA 1AFIA 5KFVA 1FE4A 2P9GA 3GJSB 4DMZA 2KXFA 3OUYB 4WU2A 2NPIA 4P2MA 1R43A 1M0SA 1LOUA 2PFDA 3BZQA 2CQ0A 4NXNF 1S97A 5H9FK 1H98A 2EG1A 3RB6A 4AT1B 4RNHA 5F3ZA 5H9EK 4UZCA 4ZCLA 3G9CA 1YJNS 1RKIA 1ZM3A 2QJ3A 1A7GE 2DGOA 1FXDA 2ZBIA 1V5IB 5E3CA 1RAJA 2EK1A 4F67A 3LP2B 2D3O1 1ZM4A 4GC7A 4F0MA 2IJRA 2QA4G 4B9LA 5C5JA 1WC4A 2KRRA 2CJBA 2OHDA 1Y4ZB 2WVBA 4X4OA 3LW5C 5ETPA 1UVMA 3LALA 2ILYA 3TJ9A 3K5MA 2UXBJ 5KFAA 4EYHB 3D3BJ 4ZP8A 2XWYA 4KT0C 3CJ3A 1P1LA 1RWMB 3D0IE 4O4GB 4Q43A 4C8KA 3MMAB 9RUBA 4CH7A 3I32A 3O6QA 4ED2A 4M5MA 3J81Y 4HI2A 1FWPA 2GMLA 3DU5A 3VAMA 1UW4A 2DNNA 1Y3KA 4GC6A 1TVRB 2OPSA 3V6JA 2FJWA 3RGIA 1U02A 4OZ2A 4ECTA 2MKHA 1QVGR 2RVJA 2JRSA 3D5MA 4TQRA 2Y0SD 2WB4A 1IBMF 1NK4A 1FRHA 5CD4A 2YBVA 5D3GB 4ECYA 2AJ4A 3FMBA 2LXUA 3QT6A 2IIHA 3NMRA 3JTOA 4OJGA 3NCQA 2AYBA 3M32A 1F9HA 2ZD1B 4YQWA 4RW4B 2GV1A 2B6AA 3Q8VA 4DQIA 5KFWA 1ZYQA 4YDDB 2CPZA 3GYGA 3CMAS 2VJUA 2GJ2A 4Q0BA 1SJ1A 1WEZA 3L7PA 2UUTA 3R5CA 1FD2A 4LF7F 5LMUJ 1NZAA 3J81j 4QR1A 2HVDA 3OFHA 1U6BA 3FQLA 5AXMA 3FJ2A 2OD4A 1TKXA 3K8WA 5KG0A 2DT9A 4UUXA 3FEYB 2VODA 2IFXA 2RQ4A 5JXSA 1EAYC 2EKYA 1P6TA 3AB4B 1R31A 5HSPA 3IA0A 1HWKA 3BGUA 3OVSA 1NHKL 4UTGA 2J9DA 1JWWA 3QAEA 2W2OP 5E3QA 3OTDA 5F8IA 4X4VA 1N5TA 3PX6A 2GFFA 4JI5J 2HFVA 4QOTA 3UNYA 1F3FA 3QQCD 3ZZRA 1WHYA 4HH0A 4KIAA 2KFZA 4N8OA 2CFXA 4KQZA 3NNCA 3TAPA 4FDFA 2V34A 4ZVSB 3OPKA 2FHJA 2JEFA 4OLPA 4X62J 1BWEA 3W2VA 3NNAA 1FKOB 4B17A 2E5HA 3C15A 4FF1A 3KJFB 2UV8A 4UY85 2ZBQA 2WCXA 1M5OC 1T8EA 3HSDA 3QO9A 1N5YA 4AQYJ 2QE5A 3OFFA 2R8KA 4QW8A 1X31C 4DFJA 3CXCR 3AA8A 1SIWB 2XLIA 2HK2A 2ZOFA 4C3MA 4QWEA 1KLMA 3WX8A 2ROEA 1CJTB 2J76E 3O3LA 1PJ6A 2RUGA 4CYUA 3KHHA 4CRJA 1WKLA 4DV3F 3C6TA 1CPZA 3FEZA 4CO4A 2UVVA 1K0VA 3Q86A 1R8PA 3LGHA 4P7TA 3G71S 1VQMS 1C0UA 1OYEA 4N41A 1IM6A 1JKHA 3H4BA 1P9YA 2B6AB 1K9MT 4RW8A 1EKSA 1X4FA 4MIAA 4TNOA 4PRFA 3B8HA 3KTQA 2KM8B 4Q0BB 4Y65A 1CJUA 2LDIA 1HNZF 3CC4S 2ZH4A 3OQ2A 2KTQA 1RISA 1QJHA 4NL5A 3OVAA 4CO5A 1IBKF 3ETMA 2AIRB 1C1CA 4CNYA 3I82A 3SCKE 2V8GA 5EGYA 1KTVA 5C25A 1TL3A 2OEKA 4N47A 4RR5A 4PPDA 1KR4A 5A2QY 5KFRA 4DN9A 1XBWA 3PEJA 3CGIA 3DOKB 3PO5A 1Y0HA 1KOHA 2NXCA 3DU6A 4KGVB 2ZJPQ 1HBMB 3MEGA 1H2VZ 2AU0A 3KG1A 4M5JA 3C19A 4ZCKA 4FF2A 2AGOA 4OJ3A 3JSRA 2I0XA 3EYZA 2F8EX 5AXKA 2IJNA 3R1LA 3MM8A 1N4LA 2MLZA 5MLCV 2AX1A 3UN5A 3V4IA 1U48A 1EETB 2VQEF 2L08A 1ZA2B 3W2VB 1X4CA 4KAIA 4W92B 2Q79A 1L3TA 2FYXA 3T19A 4USTA 2CZVC 3HVTB 2DR7A 2J0XA 1D8YA 3BM7A 4KB7A 3MEDA 1JXVA 2BW2A 1KVIA 4M5IA 2ZM6J 4BLGA 5ETNA 3QO9B 3D6TB 2XYGB 4ATNA 1YI2S 2LU1A 1N5VA 2C2MB 2W7PA 1UETA 1RTDB 2HGLA 1C4CA 3CULA 1KLMB 4ZVOB 1RUSA 4Q8EA 4NA2A 3HMJG 4CYUB 4TY8B 4F3OA 4YY3F 3QATA 1CLFA 2PT0A 2HRUA 1AXQA 3ITHA 2ADBA 5LL6d 3MPWA 1TKDA 1WG4A 1JKHB 2HWTA 3MR2A 1NJXA 4EGLA 5GAGI 1RP5A 3DLGA 4P10A 1CULB 4CT8A 1FE0A 2YNGA 1NBEB 3S01A 1CJUB 1Q8LA 2EVZA 1T9VA 3J7AN 3UQSA 4XTTA 1IBLJ 2MQ8A 1WHXA 4X4QA 1FRIA 2ZE2A 3W2WB 1WEYA 1F2GA 4IOCQ 3DLEA 1TL3B 2VC1A 4NOHA 5B0BA 4RJVA 1XTZA 1YQHA 3EPIA 1S1XA 2W25A 2GX8A 2DGVA 3ZTOA 2LQBA 3QJJA 4ZVQB 1GFWB 2ZEJA 3UDCA 3DGVA 4LREA 3HD2A 4GO5X 5EUHA 3GB0A 3CCRS 3SXLA 3X3UA 3OSPA 4LBHA 1VQ7S 1PC4A 1SC4B 3PNIA 2XYPB 1F60B 2V8VA 2R42A 4O0NA 2YWFA 4IFYA 1RT1B 2Q43A 5IS2A 2BYCA 3QIPA 4I1TA 3KNAA 3NS6A 3MM8B 1TU0B 2PN6A 4IDKA 2UXDJ 3V4IB 1HWLA 2DBBA 1VRQC 1FFSB 5KFDA 2OLWA 4F2RA 3DRPA 4URSA 2IJFA 1U6FA 5HAOA 1FT8A 1V3SA 2V5HG 4FXWA 2ZJRQ 2XMVA 3X1LB 1RABB 1VIOA 2IMOA 2KYZA 1F6TA 1R8BA 1X4EA 5FJ4A 4M8LA 3NMAA 3BDPA 1RE1B 2AD9A 3TANA 3WDOA 4HL9A 4CLSA 4KBIA 1U0HA 1HW9A 5HANA 4JI4J 2YWHA 2YNIB 1QDUB 2DKOB 2DHSA 4X66F 2DHGA 4ZPWR 1KQGB 3VAIA 4DV5J 2EFNA 2RE1A 1WC0A 4ZLJA 4JI2F 4RX6A 4DLGA 2VPZB 5CCLA 1N33F 1X5OA 5C24A 4WZQA 1CQNA 5KFOA 1RLCL 3W8PA 2I9SA 3CC7S 2AKWB 2P6TA 2VIHA 4FYDA 4K2XA 2R7XA 1NCLA 2R7VA 1GEHA 3DLGB 4EK2A 1BQXA 1HWIA 2YNGB 3M8ZA 1UJ6A 1U4BA 3NS5A 2IBKA 1SB6A 5AXNA 3US5A 3SQOP 3KNGA 1UVLA 1WSRA 5AT1B 4DUZF 2HIQA 2B8PA 2FHOB 5I3PA 1FWKA 4UQGA 2JJ4D 4ITSA 1P1TA 2UUCF 4DV6F 4DR4J 1FVSA 2E9RX 1S1XB 3AXMA 3FEXB 1U25A 3OVBA 2VONA 2ASDA 3SSSA 1WF1A 2CPIA 3PO4A 3Q24A 4DR6J 4DSLA 1R89A 2AGPA 3TAQA 2HHHF 1ZAWA 4K4TA 1WJ9A 1LWCA 4DG1A 2MXYA 3FUYA 1NK0A 1MU2A 4NLPA 1BQMA 2ZH9A 5KFUA 5J1EA 2HYIB 2HWIA 2IRUA 3KLGA 1FEEA 3QGGA 3BR8A 3U27A 2K3KA 3BPDA 4O4RA 3QIPB 4ZVUB 3VAFA 3SDEA 4ERDA 1TK5A 2K2PA 4IDKB 3RZAA 5I42A 3OL6A 3SCJE 5DG7A 1XWLA 2HBQB 1LXJA 3DRPB 2C3YA 3EVMA 4NLOA 1N0VC 1SC3B 1GT8A 4X64F 4Y2MA 1CJKA 2F4VF 2XMAA 5G4DA 2ERRA 2WRMA 4GKKJ 1RTIA 4NRTA 3K5LA 3A13A 3G8TA 2EFVA 3HLUA 2HFNA 5JJBA 1K47A 1F2HA 4ZDNA 1H3DA 2EK6A 4I67A 2Y9HA 2A6OA 1U0HB 2G0CA 4ZP9A 2V6AA 4FXDA 2IPOB 4KYZA 4RBUA 3QT7A 3Q23A 2AF6A 5A0YA 1UJ5A 4RW7A 2HQIA 3NOGA 2IC3B 4ELVA 1CBKA 5C24B 1S9GB 1WI8A 2M8DB 2D1CA 4K5RA 3AT1B 1REVA 5F9NA 4JV1A 3OR2A 4R0JA 2Q66A 2HWHA 4LIWA 1VI7A 4OYWA 3GV8B 4FBTA 2FHKA 2DB1A 4ZIWA 2FVPA 4A8FA 2RMLA 4IYQA 2J7KA 1D9FA 5ETOA 4KRWA 4MT1A 5KT5A 3T6JA 4A8XA 2RS2A 1X60A 3QIDA 2HZCA 3UPFA 1URRA 5KFIA 1WWHA 3PW4A 1RWKB 4C8MA 3OL8A 1F9EB 2OJ3A 2B9WA 2WW4A 3G6XA 3G82B 1T94A 3MCMA 3VQTA 3AD8C 3BGLA 3D4JA 2QA2A 3MGJA 5AE2A 1U45A 2FLOA 2VG7B 3R7SB 1V9OA 3MM9A 2YPYA 1MU2B 4F4YA 4ED0A 1BQMB 1UEUA 1B0PA 3W5YA 2P9CA 2WOMA 2OSRA 5J1EB 5HQLA 3D0GE 1LK7A 1LW0B 4CH1A 4QYZK 3KLGB 3AH6A 3EVWA 3BQ1A 4USJC 7FDRA 4OX9F 3SDEB 4XPCA 2L9WA 3VF0B 4ZS6A 3P4UB 2HS4A 1Y5NB 3MPUB 4QCLA 3HSJA 1RCXB 5I42B 1DY3A 3R3TA 3ZZPA 5CCMA 4MFBA 5KFFA 5IT4A 1CJKB 3VGSA 1RT3A 1RTIB 1NDLA 1P9QC 3R2CJ 4DV0F 3OFGA 4KGKA 5E5NA 2C28A 3PYGA 3H2LA 1F9FA 4KY3A 1FDDA 2DNLA 3E2EA 1S49A 5D0HA 3BBBA 2CQDA 4O44B 3VVUA 3KWMA 3KUEA 1KONA 3IO1A 3QLHA 3F44A 4CO1A 5A0YB 1AZSA 4DPXA 2J5AA 4RW7B 5E33A 3D6FB 2BJ3A 1XERA 4U8VA 1GX6A 2HFSA 1X4BA 1U8WA 1WG1A 2VG5A 3W66A 1REVB 4V19J 3W1YC 3K0JA 3OR2B 4C0HA 4XK8C 3SYZA 3T1AA 4NLXA 1S1UA 1UCNA 1UFLA 2UU9F 4X4TA 3ISNC 3V81B 2JLEA 1ZS6A 1S0MA 1WG5A 4F4KA 3UN2A 4MK7A 4RNNA 1NPKA 1KC8T 3GCWP 3MHYA 3MXHP 5F0UA 4ZVFA 2FJXA 3NAIA 1VC5A 3IR6B 4ZVRB 4ZK7M 5IZHA 4NLRA 3AQPA 6FD1A 2WAQD 5D78A 2AV5A 1HA1A 3C14A 2FVSA 4USMA 1S76D 3KJQB 1JLFA 3KLVA 3CNQP 4RW6B 5L1JA 4GMKA 4C3LA 3FC9A 2YXLA 2E5LJ 2WOMB 4ZVEA 3NNHA 3WZ0A 5RUBA 4LR7A 2Z0GA 4ZIVA 2NZ4A 4LF5J 1VLOA 3G6YA 1O51A 1FK9A 2ROPA 4ZN1A 4DR1J 1GXLA 1FNOA 3UW1A 1YBTA 4OIXA 4F0HA 2MLXA 3RJMB 4YMEA 2V8HA 1ZTTA 2GQQA 4OHZA 2JVOA 1Q5VA 5L1IA 1T0TV 4MFBB 1SJFA 2WW8A 4OHVA 2RUSA 3IBCB 4IOAQ 3CJ2A 1NMEB 1X0PA 4UF4A 2VFRA 4DV1J 2KL8A 3N6LA 5J2PB 1NRKA 1ZA1B 2F9JA 4ED5A 3D9BA 1MROB 5J1NA 3RR8A 2C42A 3V6KA 5M2UA 2GAGC 2Y8WA 2ZNZA 4WF9Q 4FS2A 3DDKA 3QLHB 4H4OA 1EHWA 3CCSS 5D4NA 3NBPA 3I4PA 4F26A 4IQMA 3N6MA 4Y6IA 4ETXA 1EB0A 4JI3F 1ZAXA 1W25A 5LXRA 1LWXA 2VG5B 1VQLS 1SVDA 4C7QA 2CPDA 1F0XA 4ZPDA 2FGOA 1TL4A 4B02A 1S1UB 2CA9A 1PCAA 3BDEA 1AROP 1VYAA 2XYHB 1FRJA 1Y7PA 2AT1B 2NXJA 1E6VA 3ZNJ1 4CP5A 3KK3A 3CUNA 3I0SB 2MZSA 3LAMA 3GIJA 1NKEA 2OPPA 4M63A 4OJHA 4L73A 3EZ5A 3AOBA 2FLLA 3MAHA 4J9PA 1FNXH 1S0VA 4RUBA 4CLTA 5ITHA 3K89A 4YB1P 1Q53A 4CI0B 3G8QA 4PZVA 3LTOA 3POTA 5SZTA 3NS7B 3C14B 4K2JA 3TUIC 4ECUA 2N82B 3BR9A 3UD3P 4YHHF 2FHJD 1N88A 1G4CA 1S1TA 1Q16B 1PJ7A 2PE8A 4CLWA 2ZHBA 1G1XA 2QGFB 4WFNQ 3HFZB 4Y3CA 3OL7A 2I6WA 3GTYX 4DZ6A 4LF6J 2CXEA 4RNOA 1KKHA 3B4MA 3GZ7A 2X1AA 3CF5Q 1FK9B 5L9XA 4PQAA 3LA0A 1TV6A 1RI7A 2RH3A 4L3NA 2JOQA 3CSKA 2HHTA 4KR0B 4USIA 2D9OA 2IMWP 3PW0A 4RU9A 1R0AA 1FJ7A 1U1KA 3A3PB 1UVJA 4PKDB 2DNOA 2U1AA 3SSRA 2RDIA 3UVJB 2VA3A 1HD1A 2MGZB 1SJ3P 2J9CA 2BE7D 2AQ4A 5JUMA 3M6XA 1UEKA 3OLBA 4DX7A 3Q0AA 1NU4A 2CDQA 4H4OB 4KTQA 2G0JA 2NSBA 4PUOA 2FB0A 4IOBA 3NBPB 3BGOP 2ZFHA 3RU0A 3HULA 1RADB 4OHYA 2FD2A 5EWFA 3PHTA 2A3JA 2FVCA 1N48A 3RBXA 2N4DA 5F8LA 2M2BA 1RT4A 2HAFA 1EZZB 4B9SA 5DZ6A 3N28A 3PEHA 4OI4A 3DFEA 4FP9A 4CM0A 3DM2A 1VGYA 4WKYA 2R8GA 2PFFB 1ZM2A 5M2RA 3Q2SC 4PWWA 1FESA 1Y5IB 3KK3B 2EC0A 1M1HA 3CVKA 2XZDB 4KV8B 2KKHA 2OPPB 4DCOB 5D0GA 3AODA 1JXEA 3K59A 1Q79A 4FYWB 1H2TZ 4B3SF 2HNDA 2V9KA 3SQGA 1WEXA 4ID8A 1Q4RA 3E01A 1UMJA 3PCOB 4IFVA 1VRTA 4Z7YA 1K8AT 1S1TB 5HMXA 4OYAA 3CPWR 2HMIA 3HDSA 1WC6A 2UUBJ 1M5VC 4DQSA 4J9QA 3UD4P 8AT1B 2KG1A 1LNQA 4LFBF 1TV6B 3TX8A 1KTQA 2QO3A 2R7UA 4FS1A 2UP1A 2WONB 1HI0P 2JEJA 1SH3A 2C3OA 5K8OA 2ZBPA 3BO2A 2K7KA 4HH1A 2FJAB 1R0AB 2ACMA 2XSJA 1XMOJ 2R7SA 4OYXA 3IR5B 4CTAA 1TL1B 3M4XA 1FI4A 1S12A 4J9UE 3FFIA 2XSFA 3TUZC 1TFWA 1H38A 3EPGA 5KFLA 5BJRA 1HMVA 2E9ZA 2RILA 1RWPB 1RK8A 3GV7B 4DU8A 4TU8A 2I8EA 1GXTA 4W90B 2K06A 2VG6A 2APOA 1JNZB 1LV5A 3M9NB 1SQGA 5B7WA 3PRDA 3DOLA 2QSWA 2DK2A 2HBRB 3W8GA 1JMTA 4OLOA 4FPRA 1U1PA 4IR9A 1S6OA 2IM0A 1RA7A 2BUNA 4ZLNA 4Z37A 3KJVA 3SV4A 2BOPA 1NSKL 3SSQA 3FSIA 2GMJA 1RT4B 3D6HB 2BRKA 2DGTA 1U09A 3N9UC 1N5SA 1NDCA 4V1Ak 3IBFB 1KRPA 4YB6A 2WVCA 1MWZA 4QWBA 3DM2B 1RAFB 3TOQA 4J37A 3ILIA 2G4BA 3W5XA 3JSBA 1JB0C 1RWNB 4J9OA 1YRTA 1JQGA 4AYBD 2L9NA 2F9DA 2BEFA 3HHDA 4K50A 5ETVA 2D3ZA 2BANA 2ALYB 2B8QA 4F8RA 4NPOA 4L6V3 3CJRA 2XULA 5K20B
chains in the Genus database with same CATH topology
4IFVB 5EHHA 3M8PA 3PKYA 1B7FA 5F8IA 4X4VA 4LF8F 1H7WA 1N5TA 2KT5A 3NCRA 1XNQF 3PX6A 3H20A 3MM6A 1S9EA 1A9NB 2GFFA 3HHLA 2VKRA 2AWZA 3HKWA 5J2NB 4QOTA 2QLWA 3C3LA 1LWFA 2M8HA 2X51A 2MGZA 3BO4A 3ZZRA 1WHYA 2KT3A 4OI3A 4ZLPA 4HH0A 4KIAA 4LIRA 4M94A 2KFZA 4YR3A 4N8OA 2A10A 3J80Y 3OBIA 2PA3A 4ILRA 3G4SS 2E5IA 2CFXA 4KQZA 1U49A 3NNCA 4R5PA 4EFAC 1U8SA 2ZJQQ 3TAPA 2HMIB 4K4YA 3R5AA 3M8QA 2ZBCA 3KK1B 1RYRA 2UUWA 3OPKA 3BGRB 4MH8A 4DV2F 3L95X 4IRKA 2FHJA 2JEFA 3M05A 1WTBA 4OLPA 2XWXA 2ZE2B 2YQ3A 2OD6A 4HTJA 3W2VA 1HPZA 3NNAA 1FKOB 1BWEA 2BM1A 4B17A 2E5HA 3GIKA 5E0OA 2DR9A 3THPA 3ZZZA 3G6VA 4FF1A 4MAKA 2K8GA 3HHKA 2UV8A 3DLEB 4UY85 2OTJS 2WCXA 2I5JB 4G1PA 3WX4A 4DN0A 3GV5B 1DBDA 1S0OA 1M5PC 4B9TA 2ALZA 4Y00A 3PV8A 3HZEA 5L8RC 2BQUA 4ZPVR 1OQ6A 2MKCA 5A8WB 1LKZA 2I38A 4G3IA 2Z8QA 2R8HA 4AL7A 2GC8A 2LEBA 1M5OC 1KS2A 3VWSA 3KHRA 3GWCA 1RT7B 1QSYA 4C4WA 4LMZA 4OI2A 3VAHA 4PXDA 1T8EA 4H4KC 5KT4A 3KLEA 5HP1A 4WFBQ 1IR0A 1N6QB 2NREA 1DQ8A 2PI4A 4ED8A 1H2UX 3QO9A 1JJ4A 2D9PA 3BJYA 1HNWF 3EX7B 1N5YA 2CQIA 1FF2A 5L38A 3T1HF 1DLOA 2QE5A 4DWIA 2XSJB 3Q8RB 3OFFA 2R8KA 4QW8A 4YDXA 4DFJA 1AFJA 4H54A 3PDNA 3CXCR 2LVWA 3RRGA 4R0EA 3AA8A 3GILA 2K3IA 1IM4A 3OUYA 1SIWB 2VKZG 2XLIA 3UNGC 4K4ZA 2V94A 2GW8A 2HNYA 2DH9A 3FFIB 4IH5A 1I6JA 2ZOFA 4C3MA 4MYUA 1S0NA 1Y00A 2VPYB 1H0HB 3FRZA 4GO7X 4QWEA 2DITA 1KLMA 1HI1A 2ROEA 1HMVB 4CNZA 1URNA 3TQ1A 3IN5A 4IFYB 2J76E 2JH3A 4NLSA 3L09A 3O3LA 4KV8A 1VBZA 1SKSA 2HHWA 1UWBB 1B0VA 4BBYA 2RUGA 1FDNA 4RWWA 4PXCA 3EGWB 4F2SA 3OHAA 3KHHA 2HPUA 2IYGA 3JSMB 3OJSA 1R8HA 2Y1IA 4EUVA 4DV3F 3C6TA 3D1HA 1CPZA 3BQ0A 3DOLB 1HNVB 3FEZA 4CO4A 2FVQA 2XGQA 1VLYA 2UVVA 4IQXA 4NA1A 1K0VA 1R8PA 2RT3A 5H1SV 3LP2A 4P7TA 3G71S 1YG0A 4DS5A 4BDPA 1VQMS 3CJ4A 1C0UA 4N41A 1PSDA 1HHTP 3DHXA 1DHMA 1JKHA 3H4BA 4PG8A 2B6AB 5KFKA 1K9MT 1PO6A 4RW8A 5SUHA 1DRZA 2E7WA 2DTJA 4KHRA 4DX8H 3T1YF 3W3SA 3Q2TC 2UZAA 1X4FA 1VQ5S 4NLWA 3UDLA 4MIAA 4IUFA 1IKXB 2KYXA 4TNOA 4EBDA 2ZC3A 4PRFA 3B8HA 3KTQA 2ZKUA 2KM8B 4Y65A 4PPZA 4Q0BB 4DF8A 3MMCB 2CPJA 2FJBB 2YH0A 1K1QA 4KSEB 2LQ5A 2BM0A 2LDIA 2RF2A 1HNZF 1TAUA 3CC4S 4OZ0A 1RYSA 1UJ4A 2ZH4A 4KFBB 3OQ2A 2KTQA 5DDQC 1MMNA 1RISA 2JL9A 4KO0A 1GAOA 4HYKA 1U24A 5KG7A 1QJHA 5E3PA 4MYTA 4NL5A 3OVAA 2XCPA 2MZTA 3R27A 4CO5A 1IBKF 2R7RA 1OPIA 1C1CA 4CNYA 2GQCA 3I82A 4WK1A 1HNXF 1N34F 1M90T 1X4DA 4JI8F 2D7SA 2B5JA 2MKSA 2OPRB 2V8GA 3SCKE 1L5UA 2DO4A 1NH7A 5EGYA 1KTVA 1SUQA 5DRKA 3I5AA 5C25A 1TL3A 1VQ6S 4BWMA 1Q81T 2AW0A 2QSFA 2MSSA 3SFUA 2B4OA 3V2UC 2ZM6F 4N47A 4TN2A 5KFTA 2WONA 4X4PA 5F8JA 2DHAA 4O3QA 1F5BA 1SH2A 1G3OA 3MDFA 3B78A 2BANB 4PPDA 1KR4A 4CQ1A 4QIVA 5A2QY 5KFRA 3CDAA 3DC2A 3GR0A 4I6WA 2ZC4A 3OTCA 4QBUA 2XMJA 4DN9A 2NYIA 1XBWA 2E5GA 3H5UA 4K4VA 3PEJA 1R6YA 3MI7X 2D3OR 3CGIA 3DHWC 3DOKB 3PO5A 1L3KA 1Y0HA 3DNCA 5CXTA 1S6PB 1KOHA 2MQNA 3DU6A 3PW5A 5KAKA 4TXSA 1TL1A 2I2YA 2NPFA 2JFKA 2YWKA 5GMKa 3P6YC 1X5SA 2ZJPQ 2MJNA 1HBMB 3MEGA 1N56A 4Q8FA 4BC7A 5FDLA 5A8RA 2JVRA 3UR3C 1H2VZ 2BJDA 4F4XA 2BVZA 3M8PB 4HDGA 4TKTA 3V5RA 4C98A 2AU0A 3N5BA 2XLJA 3KG1A 3MM6B 1S9EB 3TO8A 1FO1A 4ZPTR 4QR0A 3CCES 2NR0A 1Q7LB 4ZCKA 3MR5A 1LWFB 4FF2A 5LMNF 3VTIA 2B7CB 2AGOA 4OJ3A 4O3NA 2W8KA 5EDWA 1Q8BA 4NLUA 4DL5A 3JSRA 4EBEA 2I0XA 3EYZA 2F8EX 2KZZA 2L48A 5D3GA 5AXKA 4NCAA 2LMIA 4R5PB 2IJNA 2QRRA 3R1LA 3RBEA 3MM8A 4NYOA 2XI3A 3M8QB 5DQGA 1N4LA 3AB2B 3LUYA 5GADU 5MLCV 2WK4A 3M2VA 2AX1A 5JVHQ 3RRHA 3CD6S 2GIQA 1IUJA 1IKVA 3V4IA 1CQMA 5HQ8A 1U48A 2HS3A 3MCSA 1EETB 2VQEF 3O1LA 1RT6A 2L08A 5EWEA 3I55S 2XNRA 1Z2ZA 3IAM9 1XN9A 1ZZFA 3LO3A 3W2VB 1HPZB 1X4CA 1IQTA 4KAIA 4W92B 5LXYA 1SIZA 2Q79A 4LVOP 2B0GA 1L3TA 3T19A 5A6WA 2OIHA 2CZVC 3IXQA 5KT2A 4TQSA 4DPOA 2JC1A 3HVTB 4RW4A 2DR7A 2QFJA 2J0XA 2CQ2A 2BZ2A 3MD3A 2AJFE 4PG4A 3PXGa 3NAHA 1D8YA 2OO4A 5D6GA 1MNEA 3BM7A 4KB7A 2A18A 3MEDA 3LAKA 1KNZA 1S7HA 3TUJC 3MFIA 1IBLF 1U2FA 3EUNA 3DLJA 2Y1RI 3RRKA 3TI0A 3I4HX 2BW2A 3J7YU 2MB0B 3M30A 1HL6A 1KVIA 3KLEB 2V4QA 5HP1B 4B9VA 3QO9B 2DJWA 1VHFA 3N6NA 4N77A 3MECA 4OHXA 1LWEB 1N54B 4CO3A 4ATNA 3TA2A 1YI2S 2LU1A 3HP6A 2XS5A 1N5VA 3E3XA 4U7CA 5B0AA 4C0OC 2FIUA 4I7FA 3GFYA 1LWCB 4FNHA 2VC0A 4DG1B 4Z2XA 2W7PA 1UETA 4FVMA 2G13A 1HI8A 1SJ4P 1RTDB 1UVKA 2HNYB 1XK8A 2HGLA 3CE8A 4MTPA 1JLGA 1C4CA 4WXWA 4J9KA 3HI9A 4B08A 3CULA 1KLMB 2VPWB 2IM2A 2IA6A 2CQ4A 4QWCA 3DRYA 3MEEA 4Q8EA 2RRBA 3OJUA 4NA2A 4ED6A 1XMOF 2CPHA 4XAKA 3CCJS 2ASJA 3HMJG 3U1MA 4V19X 1S10A 3MMBA 2M5YA 1K73T 1WHWA 3T3FA 2OMLA 4AL5A 2VL1A 4TY8B 4F3OA 2DGXA 4YY3F 3PJWA 4DL4A 5K5MA 3LGNA 3OSNA 2FJVA 4A8QA 1CLFA 2PT0A 2HRUA 2RSQA 1AXQA 1KFDA 1OSCA 2R7QA 3TP2A 3ITHA 2MQPA 4NZ6A 2ADBA 5LL6d 3MPWA 3FRYA 4A46A 4DQQA 3PIOQ 1TKDA 3K5PA 5J2MA 4FNIA 3CDEA 1ZAVA 1WG4A 4EO6A 5KFEA 1JKHB 1RDRA 4MK9A 4DV4F 1SH0A 2HWTA 2VBWA 5DG9A 3MR2A 3T5KA 3RB3A 3ENWA 4EGLA 3THVA 1NJXA 5GAGI 1RP5A 3CWJA 3DLGA 2DNMA 2D3UA 3CDBA 4JBCA 2KZMA 4URQU 3GYXB 1XR5A 2MKIA 4CT8A 1UA1A 1FE0A 2YNGA 3S01A 1UEVA 1Q8LA 2PIIA 2EVZA 2IHR1 4AXJA 4P7VA 4CO0A 3UQSA 5KFBA 5IQ6A 2W4PA 1KVJA 2RF2B 1S72S 2BDPA 3VR1A 3E8OA 3RW7A 5CD4H 3KK1A 2JC0A 4ECWA 3P96A 4KO0B 1WHXA 2ZDPA 4C8OA 2ZH5A 4X4QA 1FRIA 2DH7A 3PZPA 4O3PA 2ZE2A 5D4PA 2C3MA 4C11A 4ELUA 1FKOA 3O2IA 3I5CA 3W2WB 2W9BA 2NLWA 1WEYA 4B3TF 2X3GA 4I69A 4MMOA 4DDFA 2Z2MA 4M1KA 4J9SA 1F2GA 4IG3A 2B5JB 3BB5A 4M5DA 4ETZA 4IOCQ 1SUQB 3DLEA 4Q7AA 1TL3B 2VC1A 4WYWA 4NOHA 1UP1A 1C1BA 1VQKS 5B0BA 2DRBA 3HK2A 1HFEL 1XTZA 3VZHA 1YQHA 4ZKAA 2KXNB 3EPIA 1S1XA 2W25A 2XC9A 5A8WA 5L1LA 1T95A 2GJIA 7FD1A 2GX8A 4F25A 1RT7A 2DGVA 1WHVA 3PHEA 4PG6A 2LQBA 3QJJA 2W4DA 5HBMA 4LSNA 3V6HA 1U47A 2DO0A 2YX1A 3FCHA 3UDCA 2DPIA 2R7TA 4XIUA 1N6QA 3FQKA 1RKJA 4GO5X 3R1HA 2SXLA 1IKWA 5EUHA 4A48A 3CCZA 4UW2A 4OZNA 3GB0A 2BQRA 1WTFA 3CCRS 3SXLA 3PW7A 3X3UA 2B9YA 2O5DA 2DNHA 2NQPA 4JI4F 2JEIA 4D3GA 2IVYA 1FKAF 1TKZA 2HFOA 5I3UB 2DGUA 4KGMA 3OSPA 5D8HB 3N5FA 5DO2A 5FDLB 5A8RB 3MM7A 1VQ7S 1S1WB 4HI1A 1PC4A 2RRAA 1M1KT 3PNIA 1C0TA 2I1RA 1F60B 5KFXA 2V8VA 2DCUB 2M70A 3AY0A 3LWMA 2RB7A 4YB5A 2XS2A 1OQ3A 2YWFA 4IFYA 1RT1B 1NNDA 2Q43A 2YKOA 5K8MA 5IS2A 4HT5A 2DNRA 4F3QA 5KFPA 3KLFA 2RKIB 2YNFB 3RAQA 2BYCA 3T5HA 4ZP6A 3QIPA 3CEDA 4Y2CA 5T7LA 5KOWA 4DFPA 3SV3A 4I1TA 3KNAA 2UVRA 3NS6A 3BF4A 1FVQA 3MM8B 2PN6A 2XMMA 3MR3A 4IDKA 3M2VB 1FJGF 2MZJA 3LGMA 5F8GA 3V4IB 4ECVA 1HWLA 2DBBA 3V6DA 3H4DA 3PKMA 1RT6B 2YY3A 1YTYA 3O5TB 5K8NA 5K8PA 2GO9A 5AJ3F 5KFDA 4NA3A 1KD1T 2OLWA 2AJ1A 3MR6A 3I9ZA 2M7SA 3DRPA 4F2RA 4JI5F 2A2DA 1K1SA 4URSA 2IJFA 5KFHA 3TVZA 1U6FA 2RDJA 2O01C 3SCIE 4WE1B 1FT8A 1V3SA 4JI1F 1WI6A 2V5HG 4PR6A 2MKJA 2MZRA 1M5KC 3HZGA 3Q8QB 2AGQA 4C9DA 4FXWA 5ADZA 2E9TA 1VMBA 4DSKA 1ZPWX 4FZVA 2N3LA 2VH7A 3EXCX 3IAS9 5I3QA 3MM5B 1FXLA 3M30B 2NXUA 3Q8SB 2XMVA 4C2MA 5IWAF 2ZJRQ 3X1LB 2V9WA 4WTYA 4X62F 2DHXA 2GCFA 1VIOA 3MECB 2CYYA 2IMOA 3TA0A 2KYZA 5DLFA 1R8BA 3WC0A 1X4EA 3M8RA 4O3SA 5FJ4A 4NCBA 1TFYA 4M8LA 3NMAA 3BDPA 3OXLA 1J5OA 2HG4A 4G6VB 2AD9A 3KFWX 4RWXA 4I7FB 2CQPA 3TANA 1D8ZA 3WDOA 5KFCA 4NCGB 4DR4F 4HL9A 3MM9B 2VASA 5E7OB 2C22A 2FY1A 4KBIA 3OXFA 1HW9A 5DDPC 3OLAA 2OH2A 4ZHRB 3HPOA 1T03A 2E7X