1WD6A

Crystal structure of jw1657 from escherichia coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
b'ATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ydhR
publication title crystal structure of JW1657 from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08803 ydhR Putative mono-oxygenase ydhR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wd6A00
2ZDOA 3BGUA 4HI1A 2RU9A 2GCFA 3FMBA 1X0PA 2BBEA 1AFIA 1YJVA 3LGNA 1P8GA 2Q3PA 1K0VA 1CC7A 1OSDA 1TL4A 1TL5A 4Q2LA 4OJHA 2FB0A 1OQ3A 4NL5A 2AW0A 1S6OA 4Y2KA 5A6WA 1AW0A 1Y0HA 3E8OA 3BB5A 2VH7A 4YDXA 5B08A 1Y9OA 3FRYA 4OJGA 3HHLB 2OMOA 4HL9A 1CPZA 4EFAC 2ACYA 2GO8A 2K1RB 1OQ6A 5IXUA 2QYCA 1XBWA 2BJEA 2HLTA 3QMQA 4Q2MA 1GXTA 1N5VA 2XMJA 2KYZA 3VTIA 2XMKA 3LO3A 5A6PA 5F0WA 2K7KA 2OD4A 3GZ7A 3KG0A 1FE4A 5K9FA 2OP5A 2XMTA 3HDSA 5F0UA 1V3ZA 2AJ1A 3MZIA 4Y2IA 5B0CA 1SB6A 4A4JA 3LGMA 5B09A 2OD6A 3KNGA 3QGPA 2K1RA 2ZDPA 1FE0A 2BJDA 1MWYA 2OFGX 2W4DA 2GGPB 4FNIA 4OIXA 1URRA 2OAUA 3I9ZA 3DCAA 2HFOA 2N7YA 5B0FA 2ROGA 2HQIA 1KQKA 2FIUA 2VV5A 5T7LB 3MCSA 1Q8LA 2OFHX 3KG1A 4ZA1A 2FTRA 1FD8A 2HIQA 3HHLA 1ULRA 1VQYA 2RSQA 4FNHA 3TOQA 1KVJA 3CJKB 2L3MA 4A48A 2OKQA 2KT2A 2CRLA 2JDJA 4ZOSA 1KVIA 2PGCA 2GFFA 2W4CA 2XMMA 4HI2A 1MWZA 2QIFA 3BM7A 4NPOA 2IFXA 3TRGA 2G9OA 2XMUA 1WD6A 2N4CA 3BDEA 3HX9A 4Y2MA 1X7VA 2ROEA 5B0GA 3IWLA 2LQ9A 5B0DA 1P6TA 1YJUA 1FVSA 3FGVA 2RILA 3KKFA 1OPZA 2RMLA 3HHLC 2N4DA 3BN7A 2GGPA 2IYIA 1Q8BA 3BF4A 3TNVA 2QLWA 1N5SA 1YJTA 1LQ9A 1Y3KA 2K7JA 4OJ1A 5T7LA 3HFKA 1SQEA 1FESA 1X8DA 3HF5A 2ASYA 2K2PA 2HLUA 2XMVA 2LXFA 4A46A 1GXUA 3HHLD 2HFNA 1TZ0A 1Q53A 1IUJA 3DXSX 5B0AA 3CJKA 1QUPA 1VQSA 1APSA 2AJ0A 2GV1A 1U7LA 4A47A 2FHMA 1CC8A 2QLXA 3BR8A 5B0EA 4F67A 2PD1A 1N5QA 1W2IA 1YG0A 2W4PA 2ROPA 4U9RA 1R6YA 2KKHA 2BYCA 2LQBA 1RJJA 2LDIA 2BUNA 2XMWA 3K7RA 4DL0C 5KAKA 3F44A 1JK9B 1S6UA 4HH1A 4OJ3A 1SI9A 1TUVA 2KT3A 3T9NA 3WDOA 2EW9A 4DN9A 4DPOA 4QOTA 1Q4RA 1TR0A 4HH0A 1YJRA 4YEAA 1AFJA 1N5TA 1JWWA 1YRXA 2GA7A 1Y3JA 1FEEA 2IYGA 1FVQA 5B0BA 3UDCA 2AP6A 3IWXA
chains in the Genus database with same CATH superfamily
3OR2B 4NLOA 3BO4A 1X4HA 5KFHA 4EYHB 1OSDA 1RCXB 3M2VB 1FRJA 4FXVA 3DLLQ 4WFZA 5ETSA 1VQNS 3Q8YA 4TU8A 1YZ7A 1SL1A 4P75A 6FDRA 2MQ8A 2WSCC 3NS7B 1XNRJ 4OZ3A 2Z8QA 3W66A 2V94A 2CNNB 3A12A 3DRSB 3W65A 3MUMP 1KP6A 5J1EA 4OZ5A 2XQCA 2F1FA 2C2EA 1YJUA 4EI2A 5DDRC 2VBYA 2KXFA 4HDHA 4M1KA 3CD5A 3SQGB 4YR2A 2ASLA 4Q45A 1UJ6A 2VC0A 2IM3A 1L3SA 2ZBCA 4R8UA 5AXMA 1WORA 4QBUA 4UUXA 4YFUA 2XGQA 4K0KJ 2IPOB 5GADI 3E01B 4ES2A 4LVNP 4I1TA 1BQNB 1S48A 3D0GE 3TA2A 1FX4A 3CD7A 3QLHA 3W2VB 1OQ3A 2VD3A 3PKMA 2M88A 3KLFA 3QMQA 3D9BA 4RNMA 1XR7A 3KG0A 3EVWA 5GAEU 2DPJA 2F4VJ 5B0CA 1FHTA 1RWOB 2EWHA 3EVMA 2AJ2A 2FGCA 2AEMA 3GJTB 2BE7D 2OAUA 2HFOA 4FVCA 1JNZB 3T1YF 2C3YA 1RAEB 5IC6B 3D54A 3I0SA 1ULRA 4FNHA 4JI4J 4G6VB 4RU9A 1FNMA 1DTQB 4IDKB 5KT6A 1UPMB 4LF4F 3S8SA 3LP0A 5JVGQ 5ETLA 4QU6A 3TW0A 1RAGB 1R43A 1S6QB 1EQ0A 2M7SA 2MPUA 2DGXA 3KHRA 2WONA 2BEFA 4LF7J 1IR1A 2CVEA 1SC3B 2FY8A 1FEHA 1L3UA 2RNEA 4DV2F 4K7QA 3C15A 2VG6A 4C8LA 4LF8F 4LFAF 3P8BB 5IS2A 1LXNA 4C0HA 2UXDJ 4DUYJ 3CCUS 2YNIB 4NLGA 3RAXA 1WOSA 2DR8A 1JLGA 3GQCA 1BD6A 1H74A 1DARA 1N56A 4DR5F 3Q8QB 2HFSA 5KG2A 2W9CB 3LP1B 3VF0B 3PDNA 2WW8A 5B09A 3J7Z5 3UW1A 1FE0A 2XO7A 6AT1B 2FYXA 4R5PA 4I69A 2RS8A 5HQMA 3CJ0A 1UWBA 3KMSA 2CZ9A 3I82A 3MI7X 4ZS6A 3OTOJ 2BXJA 4HLBA 3D5MA 1XQIA 2HQ3A 3AOAA 1F9HA 1S97A 1P6TA 2Q43A 2P9CA 5HP1A 4PRFA 1SQGA 2XEXA 2D3OR 1ZYQA 3A3PB 4RW4A 3VGSA 3M8QB 4O44A 5F8NA 2YVSA 4CQ1A 2GV1A 3OFGA 2WB1D 4H4OA 2LXIA 4L75A 4OZNA 2MQNA 3DU5A 1C4CA 5DJBA 3SDEB 2P9GA 2N82B 2EI5A 4RX6A 1RLDA 4FF4A 4LRCA 2EC2A 3JQKA 2XS2A 2B7CB 5L9NA 3QQCD 4NMXA 2AYBA 2XSFA 4DV1F 4JI2F 1R8AA 3TEGA 4EFAC 1S1VA 3C8YA 2L41A 4TNOA 4NYOA 4ZPDA 1JLCA 1M5KC 2RS2A 3E3XA 5F9NA 1IM4A 3GFXA 2YWGA 2RH3A 4LJMA 3DGVA 5C5JA 1WSVA 4CH0S 3FSXA 3MCSA 2RF2A 1Y11A 2OPQA 4KBIA 4GVBB 1WC0A 1J2VA 2KFNA 4FS2A 1SV5A 5C25A 3VVUA 1ZZNA 2GJIA 2LQ9A 1YI2S 1WC1A 1KD1T 4ECTA 1G4CA 1QSLA 3CWJA 2UUAJ 1X8DA 2YX4A 2IA0A 2V63A 5IT9U 3ITHA 2I2YA 4U7UD 2J0WA 1IKWA 5GAGI 1RK8A 1JLQA 3W5XA 2WVCA 5H9EJ 1D1UA 5LXYA 1IQZA 3ILLA 1PILA 1GQEA 3G82A 3OL7A 3WBZA 2E66A 4ZLPA 3CCVS 5J2NB 1T05B 2DXFA 3PW2A 4PWDB 4CM2A 2XULA 3HLUA 4PG6A 3WQPA 4PWWA 5D0EA 2VPYB 1VQPS 3BSOA 2HURA 4PUOB 1BGXT 1UVLA 1LW0B 4RZRA 1NSKL 2HAIA 4C4WA 3A8JA 1QLNA 4CYUA 5E5NA 2KU7A 2PSZA 2D3O1 1LWFA 1HMVA 3NY0A 1JJ4A 4LBHA 2QMWA 5HATA 2QEXS 3MECB 2HSEB 4CNZA 2RT3A 3V6JA 2J8AA 1VI7A 2ZKTA 1V5VA 3WX8A 2E5LJ 4HH1A 1LFWA 1T11A 3H7HB 2DPIA 4RBTA 2Y1LB 3Q8VA 2HZCA 5LJ5Y 4FPIA 1MROB 1TKXA 1NB7A 4AQYJ 1NPPA 2EPIA 2HYIB 3R27A 3GIMA 1AW0A 5M2UA 4USKA 1I5OB 3KOAA 2C3UA 5CYJA 1HBMA 1IKXA 4YHHF 1SJ1A 2XNRA 2JRSA 1SL2A 3QPIA 4OFZA 3ET6A 4ANEA 2RIJA 3PM9A 4BLGA 2R7QA 4MKYA 1X4EA 5KFUA 2W1BA 2QA2A 2OKQA 1FTCA 1KVKA 5KG7A 2BQ3A 2DNYA 4ED1A 3HI9A 1EZZB 2UVWA 2M4MA 1FTRA 1RT5A 4Z37A 3BO3A 3R2CJ 4DR3J 1M1KT 2HFZA 3Q8SB 4PYDA 2DIVA 2HLUA 3FFIA 1V5IB 2AEFA 3KLIA 2AZ1A 1S1UB 3C2PA 1AUSL 3HXMA 1FJGJ 1C0TA 1WHVA 4YB1P 4RNOA 1HNIB 2YNHA 4MK8A 5BYQA 1U26A 1HNZJ 3QIDA 3I5AA 4M95A 4ECWA 4YDDB 5AXNA 1Q78A 4M5DB 1TL5A 5AXLA 4C11A 1RA7A 3GYXB 2BACA 1VYAA 1VHIA 2QL5B 2M8HA 3K17A 5KG4A 4X64J 1JKHB 4DPWA 2JFKA 4C0OC 1FWPA 1ACMB 4DR7F 2GQQA 1OWXA 3MEDB 5DG9A 5B0GA 2F7VA 2FD2A 3A13A 1H98A 4F36A 3L7PA 2HPUA 2QLFB 4EBEA 4P7VA 2K7JA 1XMOJ 1FXRA 1DAXA 2QRRA 4LBPA 2FLNA 4PPDA 5DDPC 3J7AN 2C2MB 2CQ2A 4M5KA 4WIQA 3OL8A 4P2MA 3I31A 1HWKA 2BKPA 5SUHA 4OMFG 1RUSA 3TA0A 3C6UA 2G2OA 4AL7A 3PZPA 1HD1A 1EQMA 2HWTA 5IZHA 8AT1B 3P6YC 3DI6B 5JJBA 4Q7AA 3T5LA 3QIPB 1VC6A 3X1LB 3PTWA 4HT5A 3BR9A 3HD2A 1RE1B 2DGOA 4USTA 3LF0A 2DY1A 4P73A 2QMUB 2HHUA 3DM2A 2OFGX 5LMUJ 2HQIA 3CIZA 5IWAF 1S1XB 3M1VA 3KLEB 3IRWP 4RBUA 3K0JA 3D6FB 1HWIA 4M5HA 1FNXH 4I6YA 1U0SA 3FDSA 4KGMA 4J9LA 3QT5A 3BO2A 3OUYB 4ZVOB 2QT7A 3BS9A 3FCWA 3N5BA 1S0VA 5FJ4A 3C6TB 3M8PB 1OIAA 2PMHA 3IGNA 4JI1F 5A8WA 1HQEB 4WFAQ 3CXCR 4TN2A 2B8PA 1O8BA 2LQBA 4WFBQ 2CQ3A 3MEGA 2NREA 3ZZRA 2R8KA 4X4NA 2QV6A 4M5JA 5KT2A 4ZHRA 2NCKL 1M1GA 2QZ8A 1UA0A 1XMBA 4HACA 4URGA 4NZ0A 1WDTA 4B9NA 1H2VZ 3BDPA 3CTRA 2V8GA 3W2WB 3U1LA 3LPEA 3PYFA 5DQHA 4QZVB 2Z2ZA 4DL6A 1RYSA 4QIEA 1KKHA 3LP2A 1KHWA 2VKZG 3UNGC 1K44A 2HGNA 2DNKA 2KT2A 3QFWA 4B3RF 4LRDA 3OR1A 5DLFA 1SL0A 4N41A 3DXBA 3CMES 1GX6A 5T41A 4LR8A 3IXQA 4ZMMA 2ZNZA 3CJKA 1GXLA 2I5JB 3IGVA 2XYHB 1RBAA 2GQCA 5CD4H 4OJ3A 3VAMA 3CJTA 2HIYA 4NZ6A 2VFVA 1UCNA 1WI6A 2MQOA 2BE9B 1P1LA 2D74B 1TL1A 1Y0HA 5DS7A 1RAOA 3V4IA 3BPSP 2K06A 2YKQA 2OD4A 1WNEA 3DKDA 2MHNA 1RDRA 5L1IA 3D0HE 3KK1B 2GW8A 3SI8A 1I6JA 1BHNA 1F3VA 4NI2A 2JJ4D 1QE1A 3K5NA 4J9QA 3M8SA 1EETB 2L3MA 2WOMA 2LECA 5KFXA 3ZTQA 5A8KB 1SH3A 1S9EA 2FHJA 4EGLA 2D3ZA 4OX7A 4DS4A 4X4OA 3KMQA 3KKFA 2GHPA 4JI8J 4A8SA 1IKVA 1UTAA 3EXYA 2UVUA 3BYRA 1VQ9S 2HHVA 4R25A 5DQIA 3W62A 3DRRB 1NEEA 3SV4A 1RT6A 2OSQA 1MU2B 2C2KB 3TZWA 1HA1A 1IR2A 2CPDA 4OYBA 4PG5A 4F4WA 3MMCA 2Q3PA 3MPVA 4CLFA 5HJXA 1LFPA 2IJRA 3VQSA 1S1TA 3RR7A 1HNXJ 2MQPA 2HVZA 4X66F 2DISA 3FZBA 4YDXA 4IOCQ 1O6XA 2VONA 1TU0B 4ZPCA 3RRGA 5A0YB 4K2JA 3DOLA 1KQKA 1U02A 4E0DA 3KG1A 2HHSA 3V6HA 5AE3A 2I38A 3PO4A 3AJ2A 4DQIA 4MYTA 1I94F 1RXOB 2R8GA 4I2PA 5DO2A 3BF4A 2VFTA 1FDDA 5L46A 1GX5A 5T7LA 2ZUAA 1UW4A 4ZCIA 1HYSA 2DCUB 1F5BA 4HR2A 2LQJA 1M90T 5J1PA 1KTVA 4DX6A 5KFEA 3R3TA 1M5OC 2B56A 3CJ3A 1RKIA 2KM8C 1U25A 1Y7PA 2RQCA 4FNIA 1SUQB 4ZP8A 3NWRA 4K4UA 1VQLS 3BSCA 3H4BA 4ICLA 3MM6B 5DGAA 4RW6A 5KFTA 2QA4G 3TZYA 4JI3J 4H4KA 4Q44A 1TV6A 3UO0A 4EO8A 5KFDA 4F26A 3QRQA 4YP3A 4O3SA 3GR1A 2W7PA 2MZQA 2EKNA 1VC0A 1H6KX 4GKKJ 4LSZB 1GMWA 1PJ7A 1YITS 3OFFA 4CH1A 4RJVA 4NEYA 4DSIA 5HVHA 2EFQA 2QX0A 4F3QA 1HQUA 3FUYA 3FKBA 4H4MB 3BM7A 4ECRA 2EK1A 2ZOFA 3OVBA 2JFDA 1UJ5A 3DOKA 3FGVA 1Y10A 4Q5VA 3PX6A 3UPFA 3TO8A 1NDPA 4MKVA 3HF5A 3B6BA 4FYVB 1VQSA 2AZ3A 1L5UA 5I3UA 1X4DA 1CJTB 3Q8UA 2D7SA 2IAJA 2PN6A 4U8VA 2AD9A 3ADAC 2HHXA 1Y3JA 1LWEA 3DLEA 4CZCA 3VAIA 2V9WA 5ADZA 4DLEA 4DV0F 1K9MT 1IVZA 3ZNJ1 1GH8A 4DL3A 3MCMA 2MKSA 2V67A 1REVA 3CCQS 4LSNB 2ZEJA 5K8MA 2VASA 4YY3F 3UE2A 5KG1A 4X84A 3L7OA 1NSAA 1WG1A 2ZZMA 3V6DB 1F0XA 3TUIC 2XYGB 2JH3A 1X31C 3IR5B 4HHUA 3KK2A 4B17A 4IG0B 2VPZB 4P2XA 3GLJA 1HNWF 2KI2A 4RR5A 4O23A 4LF9F 3W60A 1M5VC 1U4BA 2UVRA 1PAUB 2F5GA 1DQ9A 2H51B 3HHLC 1TK0A 2AJ4A 3JYTB 2LDYA 2MQQA 3DLKB 4B3SJ 3H42A 2GC8A 4NXMF 5B0AA 1WHYA 3QO9A 2XMAA 1KWMA 2GIFA 1FI4A 4CLSA 2A6OA 3GE9A 2J9DE 3MM8B 4OV1A 4F0HA 4ZDNA 2V2KA 3T9ZA 5A2QU 3VAGA 4RL1A 5LMNF 3BBCA 5CHCB 3JS9A 4L73A 1F9EB 1TL3A 3UDCA 3HSZA 1T9YA 4IFYA 3UN3A 2JWNA 5DZ7A 1K0VA 2Q79A 4IG3B 3UFCX 5J2MA 1KHVA 1VHFA 4DR6F 3AD8C 4YB5A 1TMMA 1ZM3A 2JVOA 2VG5B 1CG2A 4K4XA 2DRDA 4OZLA 2LU2A 3CUNA 1TUGB 2J5AA 4BBYA 4HHHA 3IN5A 2ATLA 3QT6A 1N48A 3AA8A 1RTJB 4IRDA 2N3LA 5M2RA 2Y8WA 4NRUA 2B7BB 5GVQA 2DH9A 4C8KA 4X62J 2MKHA 2A2CA 4X4UA 1ELOA 1VRUB 1FJEB 2DTJA 4ZPAA 3V81B 4NLXA 4KC5A 4GC7A 3EZUA 3DHXA 2BM0A 1UZHA 4KFBA 3LPYA 5LSOA 1KDNA 2QLXA 2J6SA 2GAGC 2KKHA 3VWSA 3T1YJ 1D9DA 3F44A 1B70B 4C98A 5D3GA 1TAQA 3IM9A 4C3LA 3CJRA 1JLAB 3OT9A 1UETA 1S4EA 1S7HA 3K59A 3R5BA 4IOBA 2XMJA 3A1YG 3F56A 5FD1A 4A8FA 3LAMA 2P5VA 2HS0A 3TEHB 5G0RB 1XJWB 1E6YA 1HBUB 1N54B 3HZGA 4RW7B 2ZC3A 4N47A 1WEXA 2ZH3A 2HVIA 2JC1A 4K5SA 4DS5A 2BKNA 1XNRF 2ROEA 4F2RA 4MMOA 3TAMA 5EGYA 1R0AA 2ZJQQ 3FEZA 5A8RB 4A46A 5SZTA 4JI0J 4FS1A 1NK9A 3CIMA 4NCGA 2LFVA 1SJ4P 3SQOP 4CTAB 2NS1B 1AFJA 1V9OA 3A8EA 3UN5A 3DLJA 5KFMA 4LF5F 2ZHBA 2KVQE 2Z0GA 3OBIA 1CJKA 4YUDA 2VU5A 4TLRA 2QFJA 4K0KF 4NLVA 2DHAA 3N9UC 1D9FA 3HDSA 2ZDPA 3OR2A 1YX2A 1LXJA 4BS2A 3M2VA 5KFFA 2FVPA 3W63A 2ASDA 2M9KA 3SCLE 3IMQJ 4RUCA 4L3NA 1YZ6A 4B3MJ 3IFEA 4DV1J 3AT1B 5IM0B 1QM9A 4FDFA 4XK8C 3CULA 3EWGA 2DR6A 5IOLA 1QUVA 4DEZA 5HI7A 3ZNUA 1ZTWA 3DRSA 4JI4F 1MWQA 1R31A 2XZDB 1WHXA 1CSJA 5HVFA 5KFWA 3MM5B 5AE1A 1GMUA 5HLFB 2DNLA 2V69A 1NJIT 1WC3A 2BJ7A 1J27A 2CPHA 5FIIA 5I3PA 4HI1A 2K3KA 1AZSB 4HHJA 4LF7F 3SQGA 2ZH4A 4EZ9A 1TL4A 1VLOA 3S6EA 3C46A 2V8DA 3TJAA 1NK8A 3FRYA 2VBWA 1N5YB 2YNGB 3G87A 3OQ2A 3QGHA 2UXDF 2Y3YA 3DRYA 3E01A 1VIOA 3P4UB 4WXWA 4AE5A 1BQNA 4J9OA 5K20B 2AWZA 3ZZTA 4K59A 3W2VA 1OY8A 3QT8A 4PG7A 2MTLA 2DGSA 4F4YA 2ZH2A 4I67A 3NG8A 4Y6IA 3HCXA 6FD1A 3CC7S 1ZPVA 4A8KA 2UUBJ 4U67Q 1VIXA 3AA9A 1XTZA 1F5CA 2KJWA 4DL5A 3FSIA 4C3MA 5K14B 4CO4A 2R4FA 3OTOF 1DQ8A 5BYSA 3HM9A 1QUPA 2QLJB 1DTQA 4IDKA 3PJ9A 1UL3A 4CH7A 5JMNA 2C2OB 1KONA 2GNKA 4FYWB 5E33A 4LT6A 1S6QA 4OX9J 1T03B 2ZDOA 3BGUA 3RUBL 2XZWA 3TQEA 2E7VA 2J7KA 1KQGB 5L1LA 2AW0A 3O3LA 2HGLA 2DHGA 4IKAA 5DRKA 2O1PA 1PBAA 2QO3A 1IWAA 1NU4A 4CLUA 3D66A 3Q23A 1NNDA 3J80Y 1S4FA 1SJQA 5KT5A 1KQSR 2EVZA 5GMEA 3EVOA 4BC9A 2YNIA 1N0UA 1SQFA 5ETOA 2RVJA 4DX5A 1M1HA 1UMJA 2MSSA 1B64A 4RWWA 4E98A 3PKYA 3UDLA 4F04B 4K2XA 3SYZA 1IBLF 4P52A 5C2CA 2IMOA 4KIAA 1R8PA 2W9CA 4TLQA 1RTDB 3K57A 3LP1A 2CNLB 4TYAA 3OL6A 3HHKA 4KH0B 2ZOMA 3GIRA 1LKZA 5CYQB 2Z58B 3RB0A 3HK2A 1N5SA 2FHOB 4HDGA 3MEKA 3OFHA 2AHOB 3GTYX 3FBBA 2RB7A 2Z4PA 4LREA 3G86A 3PRVA 3EM1A 5F3ZA 4DL0C 4GO5X 2YKOA 4D3HA 3N79A 4YEAA 3VGUA 1UFLA 2UUAF 3AJDA 1VISA 5KOXA 3M8QA 3JSYA 4Y2KA 3J7A1 3DOMB 4J9NA 2BW7A 4X4RA 1WC6A 1UVMA 1KLMB 3SDEA 4UT4A 2CG8A 3HVAA 4C9DA 2JEJA 4A4JA 3JSMB 4IRCA 2X3GA 1ICEB 2WB4A 1VQ7S 2IY5B 2QSFA 5CZXA 3IRXB 2FDNA 3D28A 1WHWA 3RG6A 3R7SB 1RHRB 2DH7A 3HD1A 1HLWA 3GJSB 1JIHA 3NEKA 1NSPA 3N0VA 3H25A 4NA1A 3MXHP 2VG7B 4DBQA 5CD4A 4OYMA 4ZVQB 2NR0A 3M6VA 2HHQA 1RT4B 1XERA 4QPTA 4XDCA 1T9VA 3MPWA 4GVBA 1M0SA 1N6QB 3G8TA 3T19A 3I9V9 2AIRB 1N52B 3CDUA 4PQAA 2R7OA 2EW9A 3UCZP 4DQRA 2QL7B 4K4VA 2DGTA 4LQ9A 2H48B 2MLZA 1B7FA 2EBEA 5L8RC 4G3IA 4S0MA 2E1AA 4K4YA 1BXNA 2WVDA 2AMCB 3F41A 2L9NA 2E5LF 1BQMB 1J5EJ 4UZCA 1L3VA 2ZH1A 2D1CA 4AQYF 4RUAA 5EN1A 1FRXA 4K4SA 2C22A 2PT0A 3FBFA 4RNNA 3AD7C 4FKYA 2V8PA 1CEZA 4WWSA 4OI1A 4NMLA 1C4AA 3IBFB 3KJVB 4CO0A 5J2NA 2A10A 1T05A 1W25A 1U49A 5DM7Q 4PWDA 4ECZA 3BKUA 2QA4S 1V6HA 2YKNB 2E5HA 4MYUA 1HI0P 1T9UA 4Q43A 2XGPA 4PUOA 1SPBP 2VA2A 2GHVC 2DJWA 2J9EA 2XLJA 1TKTB 2X3DA 3NS6A 3KJNB 3M9NB 1LW0A 4DFPA 3FQKA 3QAUA 5KAKA 1ZAXA 2W7AA 2YX7A 3SCKE 1O5JA 2EG2A 3WDOA 4JOUA 2X1GA 4DR3F 1U1OA 2YWEA 3LGHA 4IH6A 2XYPB 4WP3A 3MECA 1FJGF 1Q7LB 4C0BA 4HL9A 4I64A 4O3RA 1D3WA 1U8SA 3MD1A 4OYOA 1HNZF 2IJNA 3QATA 4J9MA 2VPXB 3QBCA 1MROA 4FN5A 2H5JB 2CJYB 1URRA 1SBRA 3KTQA 3MPYA 1QD1A 4DCOB 4C8OA 2DR9A 4RPFA 3NS5A 4DX7A 4ZVTB 2DVIA 3R5CA 2DRBA 3CW2C 2CRLA 5HMZA 3GCXP 2EXUA 2W4CA 2KO1A 5D15A 4X64F 3BPDA 4QYZJ 2FHJD 2MKYA 2F9DA 3B54A 3CC4S 1VQKS 1NPKA 1R27B 3A3NB 2PFFB 5G4DA 1TMJA 3UD3P 3K8VA 2CJKA 5D78A 1L3KA 3EX7B 1R0CB 4B3RJ 1XMOF 3K5LA 5ETNA 5D0HA 4DSFA 4PXCA 4DXLA 3ZC4A 2HW3A 1IM6A 5KFNA 1CS4B 4OYWA 1RT2B 1S1UA 2VODA 4FYYB 3JAMU 1HKAA 1HNIA 5F0UA 4CT8A 2WSEC 3GU0A 2C2RA 5FLXY 1N32J 4M5DA 4NCBA 4K4TA 4GRSA 3UCGA 2KTQA 1SC6A 2PC6A 5CYMB 4PQUB 2KG1A 3HZEA 3ISZA 5E3AA 2ILYA 3TZXA 2FJEB 1FX2A 3I87A 1JKHA 3IWLA 3TAQA 1HWUA 3PEHA 2GS8A 2R8IA 5CA5A 2JLFA 3KJQB 5HK4A 2B4PA 5EX3A 3RAQA 5AE2A 2HQFA 2G0IA 1DTTB 3UDVA 1FXLA 4WFYA 5F3TA 2AF6A 1WI8A 4XPCA 2J6TA 3ULHA 2BABA 3MEDA 2BUNA 3M8YA 4J37A 2JSXA 1LWCB 4MKAA 4ATNA 2F40A 3MPDA 1WC5A 1X4AA 1AA1B 2CPYA 2WVBA 3VAKA 1OPIA 2J8SA 1YSJA 4DUTA 3CT9A 2HNDB 2FGOA 1F6TA 4MK9A 1BLUA 2O3DA 4ZVSB 2CQGA 5K9FA 2YQ3A 4Y2IA 4AXJA 4WE1B 3DI6A 2IRUA 1GMWD 3C16B 3QIPA 3R6GB 4C6AA 4KAIA 3HMJG 3M2UB 1S76D 1T9TA 1B4SA 2FZKB 2G4BA 4DN0A 1Y5IB 4J91A 1S1XA 4ZVEA 4WBFA 3G2XA 3MR3A 3HFKA 5K5MA 2FZGB 3KLEA 2M52A 1R0BG 2DNQA 4KV8B 1V3SA 2G1HA 2BJ1A 2GIQA 1RJJA 1S10A 5DZ6A 3OUYA 2NYIA 1C1BB 1I94J 4PABA 3C6TA 1TKDA 3M8PA 4QR0A 2NPFA 3NAIA 3ZO7A 1GMVA 3DDIA 2APOA 4ID8A 2Y0BB 3QFHA 4ELTA 3VZIA 1HQEA 3CCMS 2H4YB 1PO6A 2KYZA 3PV8A 3CJSA 4P6QA 4MJKA 3RB4A 1ZAWA 4ZVFA 2ZM6J 5D0RA 2OD6A 3FVYA 3VVTA 1KFDA 2QSWA 1C1CB 3THTA 4LF1A 4M5IA 4EMDA 1ZETA 3SCJE 2E1PA 5THWA 1JXVA 2XG8A 5AJ3J 2J9CA 1U1QA 4KHPF 3W2WA 4JV2A 3FCVA 2OPSB 2KL8A 1QY7A 1FVSA 3VALA 4JBCA 4NASA 3LWLA 2RU3A 3H5UA 3KLGB 5JVHQ 4DV4J 1HI1A 2BKOA 3CJQA 1NK4A 3EGWB 2F4FA 3MWBA 2AGQA 1FKAF 4Y3CA 1A7GE 3AY0A 3W5YA 1JLFB 2CZ4A 2BDPA 5C2GA 3I4HX 2W9AA 1X5TA 2IM0A 3T9NA 4O3NA 4X2BA 2YQ1A 3W8PA 4HH0A 1S1WB 4WK3A 3WX4A 4ERDA 5KG6A 2MZSA 1HL6A 4ILLA 2UUCJ 2MEWA 1CC7A 2HHHJ 4P9SA 3OTDA 2VH7A 1NPRA 2I5JA 2AYEA 1R8BA 4C8NA 4RU2A 3N4WA 5A6PA 3C3LA 4DDFA 2B9EA 1SC4B 2QMXA 5M2PA 2R2RA 2HVEA 4WYLA 4YB7A 1PC5A 1AXQA 1UVKA 4KB7A 1RU2A 4J9UE 1BY9A 2AX0A 4OI4A 3HP6A 4FPRA 4DV0J 2GHWA 3KK1A 3ISND 2QL9B 1DRZA 5LM7E 3TR5A 1U6BA 4OJ1A 1R3NA 1EETA 3NKYA 4XTTA 1NZ8A 1NO8A 3R6LB 4WXOA 4NLPA 1FWKA 5A8KA 1OYDA 1ROFA 1F1BB 3K7RA 3QWUA 1V3RA 3MEEB 2RD5C 3L9ZA 4QW8A 3MOJB 5DDOC 2WW4A 2UP1A 3SBMA 4HVZA 2UUTA 4CO3A 3DRRA 4X65J 1GAOA 2KN4A 3V2UC 1MU2A 1IJFB 2DO4A 4ZITA 3CGIA 4NXMJ 2B4UA 3MZIA 1TVRB 2ZE2B 4IOAQ 2DYAA 4DG1B 2BZ2A 1K1SA 4DF8A 3OFEA 2QFIA 2WCXA 3O6QA 3PO5A 1B3TA 2IHR1 1FRKA 1RWNB 4J9PA 5A0YA 2V0NA 4GKKF 1X4FA 4B3OB 1RWMB 3H2UB 3BQ1A 4N77A 4EU0A 1WUUA 1YG0A 1UKUA 3JTPA 3IS9B 4OQJA 2YWFA 2YKMB 4JI5J 1CQNA 5K8PA 2MJUA 3GIJA 4C48A 4ED8A 3GV7B 2V2ZA 3OTBA 1YJVA 3IM8A 1NH8A 2IBOA 1HBOB 2LU1A 4KHRA 1JXEA 3GZ7A 4QPXA 4C8ZA 1NBEB 4HYKA 3PCOB 1SVDA 2ZOGA 2D9OA 4DV6J 4ID5B 1SUQA 3DU6A 1IN0A 4ZN1A 4UF4A 4ZPVR 2GGPB 2OJ3A 1Q8LA 3MM6A 1RYRA 2UVVA 1J5OB 2OGUA 3Q24A 3B78A 1S0OA 5D4NA 1UWAA 3I32A 1VQ6S 2AYMA 2V4JB 3OVSA 3PG9A 1KN6A 2ADBA 4RBVA 2ZZTA 3R7BB 1TAUA 5KT3A 1TK5A 2ZH7A 2AJ0A 3NGTA 1XIQA 4H4MA 3PFOA 2LQ8A 1TKZB 4IQMA 4P7TA 5IT4A 2CQ0A 1ZOTA 4OX8A 4B3SF 4PEOA 4CO2A 2RU9A 4CIOA 4YOEA 4ELUA 4A8QA 4J7CA 1EJ7L 3GP9A 3HJVA 1F3FA 3KFWX 3HFZB 3TARA 1CJTA 1RWWB 3K58A 3IP0A 3KLHB 2WBRA 2NQPA 3SMZA 3KLVA 3C66A 4I6AA 1YRTA 4MIBA 1G1XA 5CQGA 2VQFJ 2B9YA 4RNFA 4LF5J 1PAEX 3NLCA 1K1QA 3CEDA 4WTYA 2EBGA 4LRFA 2R7XA 2XMMA 4LSNA 2QIFA 4NPOA 1JJHA 5IV4A 4OYPA 3V6DA 4F25A 1NKCA 3P45B 3WC0A 1S49A 3AH6A 1WKJA 3E51A 4IO9Q 4IG0A 3H5XA 2ASYA 4FP9A 3VGVA 1RAHB 5ETTA 1K73T 3GPAA 1UJ4A 4X62F 2FHKA 2KFZA 2KT3A 3U1NA 4KGKA 3H4DA 4WF9Q 2ZBQA 3JYTA 1DZ5A 5L38A 3DLKA 5LJ3Y 4DWIA 3GG0A 4N76A 3BGRB 1E6VB 1NK5A 2VBXA 3M8RA 5JXSA 3PW5A 1Y9OA 3LANA 1KR4A 2CQ4A 4HEA9 3MM8A 2RUSA 2NXNA 2VJVA 3OXFA 2K7KA 2LMIA 1PJ5A 2H1YA 1U1RA 2KHCA 2FLLA 3PJWA 4H4KC 1P1TA 2AGOA 4IG3A 3NXZA 4FYXB 2PI5A 3EYZA 3MMBB 2YX1A 1VK3A 3T3FA 5EWEA 1UVNA 3WHIA 4USWA 2AKWB 4NE9C 2XWXA 2PEHA 1R6VA 2VG5A 2NXJA 3HSGA 2BJ8A 5AT1B 2B5JB 3FRZA 1KEKA 2BRLA 2VIHA 4XO0A 2DITA 1RTJA 4I7FB 3W1YC 4DF4A 4ED0A 2KXHA 2Q6BA 4KJIA 3G71S 2ROPA 2H5EA 2BA9A 1QAJA 1SI9A 3SFGA 1VQOS 1FNOA 2R7VA 1VRUA 3IWXA 2XTJP 3V81A 3RAMA 4F4XA 5F9LA 2VBZA 1HHTP 4JI0F 4DL7A 1VRQC 2NUUG 1EKRA 1VGYA 4DV5J 4TYBA 2FVCA 2HK3A 4CM0A 4BWJA 1Z2ZA 2UXBF 2G2ZA 3TAPA 4NYZA 1JLAA 1ZAVA 3NCRA 2ZITA 2LYVA 3D3BJ 1PG5B 1PYSB 1FERA 1BQXA 3A8KA 2IRXA 2OFHX 1FD8A 3MR2A 2I1RA 2CJXB 3D2WA 3QZ7A 4HI2A 3W64A 4C7QA 5DM6Q 2M5YA 5B0DA 2XHCA 4DZDA 5G0RA 1Q8BA 1DBDA 3RJMB 4ZJQA 1OO0B 3QGIA 2YPZA 1HBUA 3M6XA 2ZHAA 1S5ZA 3FBEA 2E5JA 2DNZA 4RW7A 3CNQP 4B3MF 4KPYA 1FK9A 4KRWA 2XHWA 5C42B 2I6WA 1F2GA 2RRBA 2XS5A 3CO0P 1IBLJ 1RHUB 2KZZA 3QJJA 2BQRA 4W98A 4UOFA 5A8RA 1JLEB 4NWBA 2V9KA 4JV1A 3NGKA 5HAOA 1L3TA 1S12A 2EC0A 3A8IA 3VTIA 1CULB 1QAXA 2OLWA 2OP5A 3BGLA 4CTAA 3I96A 4TVAB 5KFLA 3UNYA 3BH6B 1UW9A 4TKTA 4MTPA 2ZH5A 5MAOA 3ENVA 2YY3A 4ENOA 1NCLA 2JDJA 2RRNA 2RDDA 2AU0A 4ZJLA 1VRTB 1R89A 4AFFA 5C24B 1U47A 2BANB 2WZ1A 4DFKA 1QDUB 1X5OA 1YJ9S 2IIHA 4DPYA 4QWDA 1ZM9A 3NOCA 5H9FJ 2IDEA 2H4WB 2OI2A 3VAHA 4JI7J 3CCWA 2Z56B 2Q66A 3M32B 4DUZF 1YJ7A 3POTB 3S1TA 3NBPB 1WG5A 3EGZA 1F60B 2UUBF 2GMJA 5IM0A 2QA1A 3THVA 3BKFA 2Y0SD 3VAFA 1PIEA 2IC3B 5HBMB 4OI6A 4WFNQ 3R5DA 2HBRB 3GONA 2CDQA 4LFBJ 3MM5A 3KG4A 4IO1A 2RDIA 3NNHA 5HLFA 5F0WA 3FMWA 1W7WA 4IH5A 4OX9F 2EFGA 3MUVP 3EICA 2X7IA 1AZSA 1ZS6A 3T1HF 1NKBA 4DFMA 2VV5A 2LEPA 1FRLA 4GVLA 2ZBPA 2V5HG 4RLEA 1N5YA 2YNGA 3OV7A 3OTEA 1S99A 3MFIA 1U1LA 2BM1A 3PR4A 4NLUA 3H5SA 3AHPA 3FZ2A 3GJRB 5RUBA 4KT0C 5HMXA 1HW8A 4UQGA 2AT1B 1JXLA 3G96A 4F4ZA 2D69A 3UWTA 1QAYA 4ZP6A 4CLKA 3RBZA 5IT0A 3ZXWA 4F2SA 1X5SA 4ER8A 2CPEA 4DPOA 1RHKB 1Q4RA 3EPIA 2X1BA 3SZ2A 1U1PA 2F8MA 5K14A 2W2OP 2MYFA 1YLXA 2VJUA 2E1MC 2FLPA 3BEGB 3MAQA 1S9GB 4J9SA 2XMTA 1YKWA 3MHYA 1T03A 3CPWR 3DDKA 3DCAA 4FBUA 4TQSA 2HEKA 4ZA1A 3NRBA 3NWGA 2LP4A 2OELA 2OEKA 2J7WA 1Q5YA 4WP8A 1MN9A 4MIAA 1OY9A 3KHLA 1AT1B 4L74A 1HNVB 1ZZFA 2JVRA 3B82A 3PHEA 4XAKA 4DV3J 4YR3A 4QIGA 4ZVUB 5ETQA 4C8MA 1NJXA 1WTBA 2R8JA 2FZCB 4I6WA 1RTDA 1TUWA 1NM2A 3TI0A 5L1JA 4PCQA 5CYQA 5ETPA 4NRTA 2G1DA 2HFUA 2NXEA 1XWLA 5LSRA 2GAHC 3TVYA 3TP2A 1VS3A 1X0FA 3CE8A 5KFQA 3RRKA 3BGOP 4C3KA 3ZTPA 2RJZA 1U2FA 1DY3A 1JX4A 1EARA 3L7UA 2DGQA 3D0IE 2PO4A 3Q22A 1J5EF 3DOMA 4UY85 1KLMA 4EEYA 4NXNF 3JSMA 4M5GA 5D77A 1A0OB 3KNAA 4PZVA 3IRXA 2HHTA 1NAQA 3W7BA 1A9NB 3PY8A 1FWLA 1NHKL 1S6UA 2Y9HA 1VJQA 1S59A 2VG7A 3I56S 2MGZB 1U6ZA 3DRXA 1BMQB 4Y65A 1RWUA 2V4RA 3CMQA 1RT4A 4MH8A 2R7UA 1P8GA 2ZD1B 4DU8A 1N6QA 4DMZA 1DLOB 3MM7B 3HVTB 1FD2A 2GVDB 3VAJA 2A18A 2V68A 2HRTA 3MAAB 2VFRA 4C8YA 4ECYA 2E7WA 2DEJA 1WACA 5F8HA 2W7OA 2HNYB 4KR0B 1LWXA 2QYGA 4LQ3A 3DNCA 4DSEA 1FRMA 3DLBA 2OHDA 2UV8G 2JLEA 1BQMA 1VBYA 2GZOA 2JNJA 4HTIA 4IFVB 3NGRA 1RTIB 1T3OA 1S6PB 3CF5Q 2QLWA 3U27A 1YTYA 2CZVC 3OHBA 4O3QA 4PXEA 4JI6J 1VR6A 4PG4A 3KJVA 3DLGB 4KGVB 4ZN3A 3GFYA 3OXLA 4WFXA 4X4SA 2YKNA 4LVOP 3SV3A 2OTLS 2CQ1A 1Q7YT 1FVQA 4RUHA 4NX9A 4DSLA 1TKTA 1FT8A 1JJCB 2CPXA 2OIHA 4GKJF 2PI4A 1XBWA 1T0TV 1FFGB 4B9UA 2J9DA 2YH1A 4PYAA 2BE2B 4L3KA 1FA0A 3MM9B 4TY8B 2YPYA 3AD9C 4N7TA 4DJBA 1Q95G 4LIWA 2DK2A 3L4BC 1EB0A 3LTOA 1FDNA 1S7IA 4A48A 2FJXA 3JQJA 2HFVA 2HHWA 3GILA 3SIPB 2E1RA 1NZAA 1D9AA 4X4VA 2V4QA 2WVFA 1N32F 4O4RA 4ZVGA 1LQ9A 2FC8A 4QR1A 4OZ2A 1B99A 2C1EB 2WRMA 2M8DB 2E5IA 1Q79A 3QJLA 3BH7B 1T95A 2XSJB 3WZ0A 1CJVB 4B9TA 2QGFB 3P96A 4KO0B 5KTQA 3QSYB 2OTJS 4KHPJ 3PRBA 4ETXA 3TVKA 3JSBA 2QLBB 2IVYA 1KSPA 3R2DJ 2VB6A 3GYGA 3KUEA 3PIPQ 3CD0A 3V5RA 3BQ0A 1UEVA 4NEZA 3T5JA 1YHQS 1VOMA 4ED7A 1OYEA 1CS4A 1HHQA 1RT2A 2HIQA 4CLPA 2ASJA 3BBFA 1H72C 3M30B 2R8HA 3ILIA 2ZFHA 2J0SD 4ZJOA 1WD6A 1ZM2A 2XY6A 2MZRA 4QWCA 5LT5A 3TNVA 5JUMA 3D68A 2HQDA 1N33J 4CT9A 2W8LA 1AYEA 2E44A 1NRKA 5CYMA 3LQVA 2Z57B 4PQUA 2DB1A 2LEAA 1WTFA 2KYXA 2DNHA 3NNCA 1NK0A 2EFNA 1RI7A 2RKIB 1GTHA 1GK8A 1FEEA 1X0PA 1DTTA 3SXLA 5CXTA 4QR2A 2BOPA 4ILMA 2AQ4A 3R1HA 1EHWA 2RAQA 5U47A 2F8HA 3CD6S 4DQQA 3PACA 3OLBA 1LWCA 4ANCA 1RB0A 1UFWA 4ZP9A 2R2TA 2FUG9 1K47A 4OZ0A 1MWYA 3HSDA 4OHWA 2RHSB 5DGBA 2VDHA 3AJ1A 2HNDA 1LW2B 1HFEL 4ZCKA 2VQEF 1MWZA 3DDNA 2W9BB 3WC2A 2LLZA 2ZM6F 1S0MA 3MAHA 2FY1A 2KHDA 4WE1A 5B7WA 2CQBA 5ETRA 3C16A 5AJ3F 4LSLB 4I2QB 4EUVA 1Q8IA 1LOUA 1NUEA 1CC8A 3M2UA 3UVJB 5DDQC 5EX0A 4ZPWR 2MY8A 4DV4F 4QOTA 1N5TA 5DG8A 3BN4A 2K1RB 1U45A 4KV8A 2VA3A 2FLOA 4PG8A 5B08A 2L08A 4AD6A 5HN0A 4EO6A 3FJ2A 2B4OA 5KG0A 1WC4A 3N01A 1C1BA 1V3ZA 2IMWP 3OSNA 5D6GA 1GT8A 2UUCF 3OLAA 3ZFVA 2HHHF 2J0QD 2RRAA 3UQSA 2HS4A 5HVGA 4F4KA 5CH7B 2QG9B 2HQCA 4ECQA 1RT3B 1VQMS 3DHWC 5J2PB 5E3PA 3OJSA 1C1CA 2OPPB 3BZQA 1KC8T 3MPUB 2ZBIA 4M94A 5ETVA 5HQ8A 5GMDA 1CLFA 3MMJA 1EKSA 3S01A 4KYZA 4U9RA 1R6YA 4FYDA 2OPSA 1HQ2A 2MY7A 4I0WA 3CDAA 3KLGA 2DCLA 2GA7A 2JX2A 3CCLS 4P2FA 5E3QA 1JMTA 2Y8YA 3H5YA 3TX0A 2AGPA 3HKZD 5KT7A 4HTJA 1Q16B 2XS7A 2Y1JA 2YNFB 1JLFA 3AXKA 2OMLA 1IQTA 1VDHA 2EEYA 3KUGA 5A2QY 3TWZA 2HHPA 1S1WA 1XMQJ 3KNGA 1NDLA 2BQUA 2JZ5A 4F02A 4X65F 5CABA 1PYTA 1NHVA 2ACMA 1KS2A 2DNGA 2E1CA 4LFCJ 4P2SA 1MG7A 2JHEA 1PKUA 3U1MA 4GC6A 2OO4A 3V6KA 4OV6A 1FDAA 1HWJA 4KHMA 2KDOA 2ZH8A 2ALYB 1RT1B 2DNOA 3NMAA 3CDEA 2HNZB 1FRHA 3KUHA 8ATCB 2GJFA 4B08A 3THPA 2RDJA 4UTGA 3GFHA 3CJ5A 1JK9B 3TJ9A 4J9VA 1O51A 2FJAB 3ENWA 3I0RB 1YK9A 4CP5A 3OJUA 3VV2B 4YR0A 4AL6A 4DQPA 5KFCA 1AFIA 4J9KA 2ABYA 1RAAB 4OLOA 2X1FA 3DYAB 5KFIA 4JI5F 3J81j 4Q2MA 3IWNC 5KG3A 2XMKA 3MEEA 3X3UA 3HT0A 1H3DA 1RAJA 2W01A 2HGMA 3FQLA 4XIUA 1RBOB 2A1BA 2R42A 1VK8A 2J6UA 3MMAB 1VBXA 3DMJB 2FQQB 4DV6F 1TVRA 2ZE2A 5IC4B 2ZUGA 4DG1A 2B8QA 4ZLNA 4BC7A 1Z4UA 4Y2CA 5I42B 3WIUA 3BBBA 1RZMA 3MR7A 1I1GA 3DXSX 3LOUA 2DO0A 2MZ1A 2R7RA 4G1PA 3KK3B 4R0EA 4F67A 3GV8B 4G1QB 1G6BA 2CJ9A 3ONQA 4A8OA 1H38A 3GYNA 1RHMB 1FKOB 2MB0B 4B3OA 2MLXA 2EG1A 5LL6d 4N56A 2FJDB 2V8VA 2HMIB 1BC6A 1EP4B 5EDWA 4B9MA 2C28A 3IS9A 2DXDA 2YKMA 1BE4A 1KQFB 4F7VA 3LGMA 4MKBA 2ZBRA 2W4DA 4L72B 1WF1A 3PW4A 2E7XA 4KH1B 2CWKA 2XBPA 4ZVHA 1VQ8S 5KFJA 4ILRA 3OHAA 1HBOA 1VQYA 5HJYA 2I0XA 1C0UB 3GJQB 2WSFC 5BXIA 3OSPA 2VFUA 1RTZA 4J5OA 3CC2S 4LIRA 3NP5A 4ID5A 4OL8A 2GGPA 1Y00A 2VQFF 2UXBJ 1NSQA 1UP1A 1PJ6A 2F8EX 2XM3A 4JYAJ 7AT1B 3BGFA 1J5OA 4YQWA 4RW8B 4WU2A 2J0XA 2V4JA 2DGWA 3NAHA 4QWAA 3PX4A 4DV7F 7FD1A 1RSCA 4I4BA 1T7PA 3TZZA 2CIMA 2FPHX 2CJQA 2VICA 5A6WA 5CAAA 4ZCMA 3BQ2A 3D6MB 2HVHA 2ACYA 4IQXA 1U1KA 1TKZA 3IR6B 1TL7B 5IFMA 3G8SA 4Y00A 4C2MA 1FFWB 1RHQB 2W2NP 4KKOB 1PCAA 1HR0F 2NYHA 5B0FA 5CCMA 3MGJA 3HVWA 5KFRA 4X4QA 1SIZA 1W2BR 4MIWA 3NGDA 2KM8B 2X1AA 4B9VA 4K4ZA 2UXCJ 1AB8A 2VPWB 2MKJA 3KLHA 4M5MA 3IC1A 1N34F 2NZ4A 4QW9A 2Z30B 1RWXB 3K2YA 1HPZB 1SQEA 1KTQA 2G0CA 2P6SA 5GAEI 2R7WA 2BW2A 2V2QA 2BR0A 3DN9A 1ZM4A 3H2LA 3EZ5A 2P8IA 2AP6A 4JP8A 3PX0A 3K8WA 3QZ8A 1Q81T 5L9XA 2GVZB 4LUBA 4O4GB 4ZP7A 1YQHA 3ZZPA 3O5TB 4F3OA 1DFDA 1QSSA 3RZAA 2KB2A 3Q89A 4DUZJ 3RB6A 4WK1A 1GEHA 2H9ZA 2VC1A 3KHGA 1Y5NB 3CCTA 1YWXA 4KTQA 2MZTA 2NZCA 3BGRA 1E6VA 4DV5F 2CPFA 3RGIA 2Y1IA 5EWGA 1MW7A 2KFYA 4UOCA 4NLWA 4CO1A 1N36J 3BDEA 1CVJA 4DOZA 2RILA 1UA1A 2KJVA 4PXDA 1WG4A 3MMBA 3B8HA 3NCQA 1GXUA 3HHLD 1KOHA 1HW9A 3N6MA 3T1HJ 3T1AA 2FVQA 3MFHA 2QJ3A 1M5PC 2ZH9A 4WZQA 1WJ9A 1T3NA 1Q1KA 3P5TL 2NSCA 2B5JA 4G1IA 3TA1A 1RAFB 3MDFA 4DPTA 1RTHB 2VOPA 2YBVA 4JV5J 4USUA 4KE5A 3M05A 4OJHA 4I7FA 1YIJS 4IYQA 3HHLB 2B4VA 1P27B 2GO8A 3OTCA 2MDAA 1IWGA 1MN7A 3LW5C 4PAAA 3I4PA 1S77D 1U0HB 4BWMA 3QSIA 2B9WA 2FJWA 2MSTA 3EGNA 3SSSA 5D0GA 2C2ZB 2GMHA 3TOQA 3BSNA 1FO1A 4AXIA 2B3TB 2MJNA 1MMNA 3W8GA 4W90B 3ZZOA 2MKKA 4EBDA 3C14B 2IYIA 5BR8J 3W3SA 1RABB 1VBZA 4MFBB 4ZLLA 4F8RA 2ZJRQ 1IBKJ 2COLA 1RU1A 1ZBTA 4ECVA 2WBMA 1YJRA 2OUGA 1JWWA 4DR2J 4JI7F 3LALA 2IYGA 2N3OA 4YMEA 1CQMA 1QVFR 1IKYB 2OPRB 3OL9A 2DEIA 1S57A 3HJFA 2V8HA 1QAIA 3OW2R 3M7VA 2G13A 2QN6B 1U8WA 4DR4F 2HQGA 1CPZA 1CJUB 3EDQB 4FF3A 3DGPB 5C42A 3LO3A 3P3DA 1O0PA 2AJ1A 3ILJA 2B6AB 1YBAA 4K8RA 2ATCB 4DPXA 2XB2D 4LFBF 3UDEA 1LK7A 2LQ5A 1JLEA 3ICLA 4PXBA 4CLLA 1PSDA 3QGGA 3M9OB 5HO4A 3R5JB 4O0IA 2KH9A 1CULA 2CXEA 3W9HA 4CLZA 5J2QB 5EUHA 2FVRA 4QIWD 2PMWA 1UEKA 3W9JA 4K4WA 2AJFE 3PRDA 5F41A 2U1AA 2HZVA 4TY9A 2GO9A 2DD8S 1FKPB 5F8LA 3L3CA 4BCAA 2POKA 1BUXA 1SXLA 3O8WA 2F65A 1Z2LA 3ZZYA 2HBYB 3BSAA 4O3OA 4A47A 2EFPA 2YWHA 1VRTA 1DURA 5C24A 3MCOA 2BANA 1H73A 3EUNA 3GR0A 3J81Y 1NMEB 4RW9B 2WVEA 2JEIA 2PFDA 5KFYA 4DN9A 3MTKA 1N4LA 2L9DA 1IBCB 2CAJA 1YRXA 5HSPA 4JV0A 3M32A 1DHMA 3DLHA 4NXNJ 4Z7CA 3POTA 3NBPA 4OI2A 2NUHA 1HBNB 1LEOA 3T5KA 1RHJB 4WCEQ 4YS2A 2XZTB 2IC3A 5HBMA 1A6LA 3GB0A 1REGX 4Q0BB 1SKUB 4M5LA 1S79A 2U2FA 4CLYA 4FF2A 2FIUA 3RRHA 1RKJA 2BJ3A 1SKSA 3CDWA 1JQGA 2RE1A 1VLYA 3TQ1A 3H40A 2IFXA 1G2EA 2G9OA 3VHQA 3PNIA 1NH7A 1RACB 4HKQA 2A2DA 3IG1B 1JLBB 1RLCL 4TU7A 3A3OB 2MLYA 2DY9A 1W2IA 3G9CA 4YB6A 2DNNA 4LMZA 4DV3F 1D8ZA 2EKYA 1RGVA 4U96A 2HRYA 3ETOA 2DNPA 5FDLB 1UEUA 2EFOA 2H54B 2XCAA 2CQPA 1RT7B 3A4TA 2AV5A 2AYGA 2Q1LA 3D1QA 4I56A 1VJWA 2UU9J 4OIXA 5HROB 2D3UA 1URNA 2RQKA 5GAHU 1EAYC 3FK4A 3QNWB 4OZ1A 5C7PA 4Z2XA 1S9GA 2BMBA 2WK4A 4B9SA 2HWIA 4P10A 4B3TJ 3JAMY 2XWYA 5DQGA 1X9SA 4QCLA 5HMWA 4Y2MA 3VZHA 5KFPA 1X60A 4GKJJ 4ECSA 2M3DA 2IBKA 2ZH6A 1IBMF 1YRUA 4LRBA 4NLDA 2X51A 3M6WA 2FHMA 2UV8A 2CYYA 2AJQA 1HWLA 1GTEA 2E5GA 3UR0A 1HNVA 3DRPB 3PEJA 4LR9A 5BYRA 3G6ES 1I51B 3KHHA 4N8OA 2CDRB 1FJCA 4LF6F 2G2YA 1S6OA 2CNOB 3D6TB 5HQLA 2OSRA 2I8EA 2CPJA 2DGUA 3KXDA 4ZKAA 4TXSA 2NPIA 2IVFB 1C2PA 2DHSA 3US5A 4AT1B 3EXCX 5IQ6A 1SJFA 1NXIA 1TQLA 1WKLA 2DRAA 1X4BA 1QJHA 4ZPBA 3M2RB 3CCRS 1T9WA 4ZIVA 1ZTTA 3PFEA 3CJ8A 3WIVA 2WTFA 3ZZ0A 2RQMA 4Q8EA 1UPPA 1APSA 5K8NA 4Q8FA 3NOGA 2Y1RI 4KPCA 2L48A 1ZA2B 2BYCA 4ES1A 3Q8PB 1SKRA 4RWXA 3W5ZA 2JLGA 1B7YB 4MK7A 1B0TA 4JI6F 1VFJA 3LGNA 4Y0FA 2NXUA 4USJC 3U02A 3EPGA 2JC0A 4B9LA 2PEBA 2EFVA 2C3MA 1R8CA 3JSRA 1U24A 1GXTA 1XNQJ 1S0NA 1OY6A 5J1EB 4A8XA 2MGZA 2CFXA 4ED6A 2KRBA 4DR1J 3GG1A 1S72S 2ZD1A 1DLOA 4OHYA 3H59A 3R5AA 3MM7A 3HVTA 1X5PA 1EIYB 4PR6A 4R8UB 2GVDA 2CQIA 3CCJS 3MOZA 3AFGA 2XNQA 1NHUA 3MAAA 1Q86T 9ATCB 2N4DA 5E2QA 2HNYA 2EK6A 3K5PA 3TYTA 1FESA 3GV5B 2K2PA 3QLHB 3QRPA 2CPIA 1YJNS 3IAM9 1VBKA 3G6YA 4QQBA 3KLFB 2GJ2A 1WF0A 3T6BA 4IFVA 4K5RA 3ZTOA 1RTIA 2W24A 1SC1B 3M9MB 3AXMA 2VQEJ 1S6PA 3BV8A 2MHEA 2LXUA 4CLWA 3DLGA 2L9WA 3I0SB 1RQ0A 1RWPB 1Y4ZB 3HT3A 3ELHA 3CMAS 4GMKA 1H2TZ 2CKWA 3LP0B 3DFEA 1X4CA 5KFAA 3PHTA 3CCZA 4QU7A 2FJBB 2WONB 2DR7A 2NSBA 2JL9A 4RO0A 2VZ9A 3C15B 2R2SA 2VG6B 4CWBA 2B9XA 2BE2A 3Q86A 1OJ4A 4URQU 4UY8T 2GQ2A 1OS5A 3MM9A 4TY8A 2XC9A 3PR5B 3NMRA 3G4SS 1JLGB 1TFWA 2R7SA 2ZZNA 4X4PA 4UOGA 3EMTA 4TQRA 1WOPA 3H20A 4QYZK 1RISA 1TP7A 1VQ4S 5K8OA 3GMGA 5I4MA 5KFBA 1N33F 3NGUA 4OHZA 3OXGA 4R5PB 2E29A 4BDPA 1UWBB 3PW0A 5CCLA 1BWVA 2XSJA 1VC5A 4WP9A 1NK6A 1CJVA 2KG0A 2P9EA 2YQ0A 4KO0A 4LF4J 4DLGA 2XY7A 3Q2SC 2F3JA 2BJDA 5HP1B 2YWKA 3DC2A 4A8YA 2M0GB 3HHEA 1ZPWX 4RW4B 1PC4A 2FTRA 1RADB 1IR0A 4O44B 2NLWA 4H4OB 1LNQA 4DV2J 2H5IB 2LEBA 4LF8J 4LFAJ 1Z1ZA 3MUTP 3KYLA 1YJTA 1Y3KA 5GAHI 1JJ2R 1JB0C 3UN2A 3IA0A 2HFNA 1FK9B 2C2NA 3M30A 3NCPA 2PMZD 1S1VB 4DR5J 3QJPA 9RUBA 2HKEA 1QVGR 2CNKB 1ZH5A 1U2RA 3GCWP 4P74A 3TUZC 3J7YU 3TUPA 1JLCB 1YJWS 4IRKA 3M6UA 2DHXA 3FC9A 3RU0A 4YN3B 1SCJB 3N6LA 2QC3A 2RF2B 3JXOA 2OPQB 3UI3A 4LBIA 3HSJA 3PJXA 1WSRA 1SV5B 2ZJPQ 5C25B 4NA3A 2RKIA 4FZVA 4OZJA 1ZA1B 4OYIA 4DL2A 3JTOA 1RA6A 3P5BP 3ENQA 2ROGA 3B4DA 3N6NA 2VDIA 2CQCA 3ITHB 2ZC4A 1MMLA 1IKWB 2D41A 1NLKL 1QSYA 1Q0NA 1JLQB 3EJMA 1X7VA 1NB2A 4E8UA 2LKZA 1ITPA 2BJ9A 5D4OA 2M70A 4IUFA 2IM1A 2Z2YB 2BRKA 4U7UK 2LVWA 4ED4A 2CQHA 2SXLA 3G82B 4OYAA 3CJ4A 1LW2A 2CADA 2F4VF 3MURP 2I9SA 1OMSA 2CJBA 4M8LA 2W9BA 3GSDA 4JI2J 3HHNB 5F8JA 5KFSA 2HZAA 3RBXA 3I5BA 4DCPB 3NGSA 3AQOA 1TR0A 4PPZA 4OLPA 4FF1A 4EK2A 1LV5A 2GCFA 1NJZA 3E2EA 2ZVSA 3FBCA 3ZTSA 4LSLA 4I2QA 1NJYA 3LAKA 3UVJA 2CA9A 5IXUA 1OQ6A 2HVDA 3H8YA 3SCIE 2CWXA 1MNEA 1FE4A 4OHXA 1R8HA 4CYUB 2C3PA 2O5DA 2K1RA 4NA2A 4EYIB 1LWFB 2ZNYA 1KRPA 1HMVB 4USIA 1X4GA 4U7CA 2ZVIA 2N7CA 2ZWPA 4K50A 1BWEA 1T8EA 4DUYF 1WOOA 4OI3A 3SSRA 3TRGA 1XMQF 3HX9A 3NL0A 3N5FA 5KFVA 5H1SV 2P2CB 2W2QP 5HMYA 3VGTA 1TKXB 1FJ7A 3BREA 2HWHA 2XMVA 4LFCF 2CVIA 2MZJA 1H7XA 2C2DA 5J1NA 2W4PA 3BYPA 2J76E 3H90A 1HBMB 1RT3A 1IKXB 1TUVA 1SKWA 5J2PA 4ECXA 1UZDA 3ET6B 2OPPA 2V6AA 2YH0A 4WU3A 4DU7A 2JEGA 1B0PA 1Y5LB 4USVA 3BKTA 2LA6A 2F63A 4GO7X 4WIIA 1FXDA 5L39A 4IR9A 1XR6A 1RT5B 1T9XA 2C3OA 3RBEA 2VL1A 2XLKA 3GIKA 2Z2LA 4PKDB 3P49B 4NLRA 5HL7Q 4DV7J 5D8HB 3FFIB 5BJRA 2YNFA 3KLIB 5ETKA 5D4LA 2DKOB 4ZOSA 4DSKA 1C0TB 5KG5A 4DI6A 2YNHB 4KGZB 4O3PA 5KFOA 1U09A 4IH7A 3UD4P 1NDKA 2FJVA 2O66A 3W9IA 2CG4A 4CDIA 4J90A 4C11B 1NJWA 1HR0J 2VFSA 3QAEA 3OD2A 3J80U 3D7SB 5E3CA 4YHHJ 1QTMA 3Q8RB 2DHHA 3M8ZA 4XPEA 3FNNA 4CNYA 1N34J 1RT1A 3N28A 1RWKB 2HNZA 2MQLA 3D3CJ 2KXNB 1D8YA 2W2MP 2CQDA 3I0RA 2FVSA 3EGVA 4CRJA 4H54A 4F4AA 3H0PA 2H3EB 3K5MA 3ZZUA 3PXGa 5KFZA 3DYAA 3PYDA 1F9FA 4C97A 3Q0AA 3O1LA 1VCTA 1RP5A 2KRRA 1AROP 1H2UX 3L95X 1P9YA 3C19A 1YBUA 2GX8A 3G6XA 2RHQB 1UVJA 3IBCB 1NK7A 1PBUA 3C6UB 2A6MA 3I5CA 4DL4A 1FFSB 2IM2A 2V2VA 4DPUA 2XI2A 4F0KA 4I68A 3MMAA 3DMJA 3KDNA 4UOHA 1N5QA 3TVZA 3D6HB 4OHVA 2XMWA 3TJ8A 5DLGA 3EDRB 5EWFA 4UZBA 5KT4A 3DM2B 3I55S 2MKCA 2NXCA 4JYAF 4N5SA 5I42A 1HI8A 4ETZA 3M1VB 3KK3A 1U1MA 3D67A 5MLCV 4G1QA 1MLAA 2DXEA 3J7YI 4DR7J 4W92B 1FF2A 1X9WA 1FKOA 4LR7A 3R5GA 4UUWA 1IJEB 3TANA 3U7JA 2N7YA 4NOHA 1DQAA 3K89A 2HMIA 3O44A 1EP4A 2R7TA 5A8WB 3CVKA 4UW2A 1Q8KA 1KVJA 3Q83A 3RW7A 4O0NA 2Z2MA 4D3GA 4X4TA 3MEGB 4QJVA 4W4MA 3L09A 4NLSA 3J7ZT 3PVXA 4L6V3 3QT7A 1TTHB 2XI3A 1YDLA 4UQTA 4ZHRB 3IBWA 5KFGA 1KOOA 1Q53A 1C0UA 2UXCF 1W26A 3J81U 4CCHA 4HACB 3S7RA 2YTCA 3PW7A 2QTWA 5IT9Y 3AOBA 3TUJC 4FXDA 3OVAA 1OSCA 3HHDA 5B0BA 1X9MA 1H0HB 4NLQA 5E7OB 1SJRA 2KZMA 3LP2B 2YKAA 4JB8B 5IWAJ 3CJ2A 3GFZA 1TK8A 3FCHA 4RW8A 2HLTA 1N5VA 1RBLA 5IQQA 3OR1B 2OEMA 3HPOA 2IRYA 2YKPA 3AODA 2JEFA 4QWBA 3CDBA 4F50A 4V19J 2ZKUA 4U8YA 3V4MA 1MSWD 4WJBA 3I9ZA 2O01C 4KQZA 3MTJA 3KWMA 4TU9A 2V34A 2AEJA 5CZVA 1Q82T 2DBBA 2PDAA 3ISNC 4MAKA 3CJKB 4JI1J 1UVIA 1UFKA 4E2FB 1SJ3P 2HRUA 1RCOB 3RTVA 4M5NA 1TL7A 1T02A 4DR4J 2MQMA 4N8NA 1WDDA 2W25A 4JUZA 4KKOA 4ZCLA 7FDRA 4WKYA 2XO6A 3R8YA 1IXKA 2DNRA 1TL1B 1IUJA 3AQPA 4Z7YA 1N36F 2CUYA 3V4IB 3R1LA 1N88A 1WEYA 3CSKA 3UR3C 4DHVA 3PIOQ 4OX6A 1HHSA 4DZ6A 2W2PP 3GIIA 4NI2B 1HPZA 3KJFB 5KFKA 4P72A 2PA3A 1QE1B 2YXLA 4WTOB 3K5OA 4PWUA 4DSJA 2ILZA 2KT5A 4M63A 3R97A 2XLIA 2WOMB 3R9LA 2BJEA 4IR1A 3RYLA 2UZAA 3RW6A 4G65A 4RNHA 1S9EB 1HIYA 3FEXB 4KGXB 4USMA 3IR7B 4JV5F 1IKVB 2B0GA 5E0OA 2GVZA 4O4GA 1D0EA 3CO9A 1PGZA 2MKIA 4AYBD 1K0TA 3EZOA 4MT1A 1RT6B 2LCWA 4ES3A 3F0NA 1D09B 5T14A 3SEOA 5HANA 2IDLA 3MMCB 5A76A 1S1TB 4HT7A 5B0EA 5I3QA 3HKWA 1U1NA 5LMUF 1DJ0A 4QIFA 4Y34A 1VMBA 3LWMA 1H7WA 5DG7A 1Q5VA 2ERRA 3G6VA 2PA8D 3HULA 3QWPA 5BR8F 5FLXU 5LSLA 2ALZA 3DOLB 2BBEA 2V50A 4Q2LA 1KNZA 4V19X 3B4MA 3MCNA 3E8OA 4CI0B 4ALZA 4OJGA 2OEJA 3VR1A 2IVMA 3R7NB 1YGYA 1IBKF 1G7CB 1WKKA 2P6TA 3AOCA 3CCES 3D4JA 1SH0A 4DR2F 1WELA 3W61A 2ZHOA 4NLTA 4WKRA 1SH2A 4I2PB 1TFYA 3QGPA 1RTHA 4AUKA 2FC9A 4P71A 3VCDA 3BJYA 2QE5A 1WWHA 5T7LB 1HYSB 3PYEA 3HHLA 2RSQA 4DX8H 2B51A 1WF2A 1YBTA 2DNMA 4ZIWA 3HO1A 2Q6CA 2R3VA 1SIWB 1U0HA 3BN7A 1EX8A 1NDCA 4Y28C 2OH2A 3CCSS 3G8QA 1G3OA 2DT9A 2IA6A 4ZPTR 2ADCA 2LXFA 4ICLB 4RW6B 3FEYB 2E9ZA 1NKEA 3SSQA 4X66J 4DCJB 1TV6B 2H65B 5E41A 2VHGA 3C14A 1LK5A 1VQ5S 2BOAA 4ECUA 3MR6A 2G0JA 3LA0A 1RWVB 2HAFA 2FB0A 1UAWA 1U6FA 4NLYA 4MFBA 1IBMJ 5LXRA 1HQUB 2XCPA 2QYCA 4OYZA 2RUGA 3RB3A 2HG4A 1KFSA 1SB6A 5DETA 3DOKB 4OI0A 4FBTA 4OYXA 3LH2S 3D1HA 5F8GA 1IKYA 2OPRA 1T94A 4AL5A 1XC9A 3M8WA 2AX1A 4EZ6A 4FKXA 1XR5A 1AUDA 3T5HA 1CJUA 2VUGA 4ELVA 3ILOA 1XK8A 4ED2A 5LOQA 1KVIA 1MMDA 5I3UB 3Q2TC 3DGPA 2PE8A 4LF6J 3AB4B 3RBDA 2IAJB 4EBCA 2B6AA 8RUCA 5GADU 1N0VC 2RMLA 4USHA 3PYGA 3AB2B 1LWEB 3UD5A 3DLEB 1B0VA 4WYWA 1CBKA 1GFWB 5F8IA 2WHOA 4F3MA 4ZK7M 1QTNB 2PD1A 3JTNA 1YVFA 2LDIA 4LF2A 5H9FK 5J2QA 5H9EK 1REVB 2E9TA 2HK2A 4BHQA 1FKPA 3UCUP 2O67A 2BX6A 3KK2B 3H98A 3IO1A 2R2UA 3HVRA 3BB5A 3O2IA 2OMOA 4ZVPB 4L76A 4U95A 4JI8F 3HFVA 1TELA 4RW9A 4XDDA 1M5HA 4ED3A 4KY3A 1RAIB 2ZWOA 4ED5A 2VF3A 3IAS9 1R7IA 2KVIA 4NZ7A 3JB9k 2RQ4A 1HBNA 3QO9B 3ZTRA 3M4XA 2GFFA 3QYYA 2WAQD 2XMUA 4QYRA 2XY5A 1XEZA 2DIUA 4URSA 4Q0BA 3NNAA 3CB4A 2UU9F 3T41A 1HNXF 1TL3B 1GNKA 2YWWA 4WPAA 4IFYB 4RUBA 5J2MB 4B3TF 2VOOA 1U7LA 2VKRA 3ETMA 3MR5A 4WZMA 1N8RT 2HS3A 4KSEB 4YY3J 2A3JA 3JQMA 1K8AT 5F8MA 3ENAA 4J9RA 3FMBA 3IG1A 1JLBA 4A8WA 2LA4A 5ETMA 4NL5A 5ITHA 2J7UA 1KBRA 3LUYA 2HBZB 2JOQA 3MF5A 1HNWJ 1F5AA 3KDOA 2HBQB 4EWTA 4LF9J 4FXWA 3OPKA 2R9LA 5FDLA 4DFJA 1M5SA 5IV3A 4NCAA 3GWCA 4ZVRB 4CO5A 3RR8A 4CLTA 4FVMA 3T6JA 2UUWA 4A8MP 1RT7A 3EE3A 4KFBB 4LRAA 5E3RA 1F2HA 1HARA 2N4CA 4ZLJA 5AXKA 5D3GB 2MXYA 4B02A 3D1OA 4QWEA 5D4PA 1FDBA 5L1KA 1U2CA 5HROA 2BV3A 5LMNJ 4R0JA 4JI3F 1JNRB 2BVZA 3BR8A 4DR6J 2F9JA 3VQTA 1FCAA 4DQSA 1I3OB 2DGVA 2GMLA 4NYPA 1E6YB 3FSYA 1FRIA 3AAWB 3QRRA 4RKUC 4F0MA 3F73A 2C42A 2D9PA 4ITSA 3DRPA 1U48A 2DH8A 1WEZA 4Y2AA 2W8KA 1HD0A 3TAMB 4U6PA 3ZZZA 1R0AB 4QIVA 2CJAA 5KOWA 1XNQF 2GIRA 3GSIA 3I6PA 2PGCA 1XN9A 3SFUA 2DR5A 5EHHA 4NCGB 5GMKa 2E9RX 5GAGU 4DR1F 2K3IA 1OPZA 4V1Ak 4ANDA 2IJFA 1S9FA 1CJKB 2CPZA 1TZ0A 2M2BA 2PIIA 2A0FB 3H2VE 3M2RA 1P9QC 2B43A 2K8GA 1KLNA 3MD3A 1PYOB 2MMYA 3TX8A
chains in the Genus database with same CATH topology
4HI1A 3OR2B 2K3KA 3KHHA 4N8OA 3SZ2A 1U1PA 4NLOA 1FJCA 3BO4A 2F8MA 4HHJA 4LF7F 5K14A 3SQGA 2ZH4A 4EZ9A 4LF6F 1X4HA 5KFHA 2MYFA 4EYHB 1OSDA 1TL4A 3S6EA 3C46A 3M2VB 1S6OA 2V8DA 1FRJA 2E1MC 2OSRA 1NK8A 2FLPA 2I8EA 3BEGB 2VBWA 3FRYA 3MAQA 4FXVA 3DLLQ 4WFZA 1S9GB 2CPJA 1N5YB 2YNGB 3OQ2A 3QGHA 2UXDF 1VQNS 2DGUA 4TU8A 4ZKAA 4TXSA 3DRYA 4J9SA 3E01A 1VIOA 2XMTA 1SL1A 3MHYA 2NPIA 6FDRA 2WSCC 4WXWA 2IVFB 1C2PA 1T03A 4AE5A 2DHSA 1BQNA 4J9OA 3CPWR 2Z8QA 3DDKA 3DCAA 2AWZA 3US5A 3ZZTA 3EXCX 4K59A 3W2VA 2V94A 4FBUA 4TQSA 5IQ6A 1SJFA 4ZA1A 3NRBA 4PG7A 3DRSB 3NWGA 1TQLA 2DRAA 1X4BA 2DGSA 1QJHA 4F4YA 2ZH2A 4I67A 3NG8A 4ZPBA 4Y6IA 2J7WA 6FD1A 3CC7S 3MUMP 1ZPVA 3M2RB 3CCRS 4MIAA 5J1EA 4A8KA 4OZ5A 2F1FA 2C2EA 4U67Q 1VIXA 1ZTTA 3KHLA 1YJUA 1HNVB 1ZZFA 2JVRA 3PFEA 5DDRC 3AA9A 1XTZA 2VBYA 3B82A 2KXFA 3PHEA 4XAKA 4HDHA 4M1KA 1F5CA 2KJWA 2WTFA 4DL5A 3ZZ0A 3FSIA 3CD5A 4C3MA 2RQMA 5K14B 3SQGB 4Q8EA 4CO4A 4YR2A 4YR3A 4QIGA 4Q45A 1UJ6A 2R4FA 2VC0A 3OTOF 2ASLA 1DQ8A 5BYSA 3HM9A 4C8MA 2IM3A 1QUPA 1L3SA 1NJXA 2ZBCA 1WTBA 1APSA 5K8NA 4R8UA 4Q8FA 5AXMA 1DTQA 2Y1RI 4IDKA 2L48A 4UUXA 4QBUA 2R8JA 4I6WA 4YFUA 1RTDA 2XGQA 2BYCA 1UL3A 4CH7A 5GADI 4ES1A 3Q8PB 3E01B 4ES2A 1SKRA 4RWXA 4LVNP 2JLGA 3TI0A 5L1JA 1KONA 2GNKA 4PCQA 5CYQA 4I1TA 4MK7A 1B0TA 5E33A 4LT6A 1S6QA 4NRTA 2G1DA 1T03B 2ZDOA 3BGUA 4JI6F 1BQNB 2XZWA 1S48A 3D0GE 3TA2A 1VFJA 3LGNA 4Y0FA 3CD7A 2NXUA 4USJC 2J7KA 1XWLA 1KQGB 3QLHA 3U02A 1OQ3A 3W2VB 2AW0A 2JC0A 3O3LA 5LSRA 3EPGA 4B9LA 2HGLA 2DHGA 4IKAA 2EFVA 2C3MA 2VD3A 5DRKA 3TP2A 3TVYA 1R8CA 3PKMA 3JSRA 2M88A 2O1PA 3KLFA 1VS3A 1X0FA 2QO3A 1U24A 1NU4A 3QMQA 4RNMA 1GXTA 3Q23A 1XR7A 1NNDA 3CE8A 5KFQA 3J80Y 1S4FA 1S0NA 1SJQA 3KG0A 5KT5A 1KQSR 5GAEU 5J1EB 2EVZA 2DPJA 3RRKA 5B0CA 4A8XA 4BC9A 4C3KA 2MGZA 1FHTA 2CFXA 1N0UA 2YNIA 4ED6A 2EWHA 2RJZA 2RVJA 1UMJA 1U2FA 2FGCA 2KRBA 2MSSA 1B64A 3GG1A 2OAUA 4RWWA 2HFOA 1JX4A 4E98A 4FVCA 1S72S 1JNZB 2ZD1A 3PKYA 3UDLA 3T1YF 2C3YA 2DGQA 3D0IE 2PO4A 1DLOA 3D54A 3Q22A 3H59A 3R5AA 3MM7A 4K2XA 1J5EF 4OHYA 3DOMA 3I0SA 1ULRA 3HVTA 4FNHA 1X5PA 4PR6A 3SYZA 4G6VB 4R8UB 4RU9A 1FNMA 1IBLF 4UY85 1DTQB 2CQIA 4IDKB 3CCJS 2IMOA 4KIAA 1KLMA 1R8PA 5KT6A 2W9CA 4TLQA 1RTDB 4LF4F 3K57A 3S8SA 3LP1A 3MOZA 3LP0A 4EEYA 4TYAA 3OL6A 2XNQA 1NHUA 5JVGQ 4NXNF 3HHKA 2ZOMA 4QU6A 3JSMA 3TW0A 1Q86T 1LKZA 5D77A 1R43A 2N4DA 5E2QA 5CYQB 3KNAA 2HNYA 3RB0A 2EK6A 3HK2A 1S6QB 1N5SA 2M7SA 2FHOB 2MPUA 3K5PA 3MEKA 3OFHA 4HDGA 3IRXA 3TYTA 2DGXA 3KHRA 1FESA 2WONA 3GV5B 2K2PA 2RB7A 2Z4PA 2CVEA 3QLHB 2CPIA 3G86A 1YJNS 3IAM9 2HHTA 1FEHA 3G6YA 1L3UA 2RNEA 4DV2F 1NAQA 4QQBA 2VG6A 3KLFB 3W7BA 5F3ZA 2GJ2A 4C8LA 1WF0A 3PY8A 1A9NB 4DL0C 4LF8F 3T6BA 1S6UA 4IFVA 4LFAF 4K5RA 5IS2A 4GO5X 2YKOA 1LXNA 1RTIA 4C0HA 4D3HA 2W24A 3N79A 4YEAA 3M9MB 2VG7A 3I56S 2MGZB 3CCUS 1UFLA 2UUAF 1S6PA 2YNIB 1U6ZA 3DRXA 4NLGA 3RAXA 2MHEA 4Y65A 1RWUA 2V4RA 2DR8A 2LXUA 5KOXA 1RT4A 1JLGA 4MH8A 2R7UA 3M8QA 1P8GA 2ZD1B 3GQCA 1BD6A 3JSYA 3DLGA 4Y2KA 1DARA 1N56A 1N6QA 3J7A1 4DMZA 1DLOB 2L9WA 3MM7B 3I0SB 3Q8QB 3HVTB 4DR5F 4J9NA 1RQ0A 4X4RA 1FD2A 1Y4ZB 3HT3A 5KG2A 3VAJA 2W9CB 1KLMB 3SDEA 3CMAS 1UVMA 4GMKA 2A18A 3LP1B 3HVAA 3VF0B 4C9DA 3PDNA 1H2TZ 2CKWA 2WW8A 3LP0B 2JEJA 3DFEA 4A4JA 5B09A 3JSMB 3J7Z5 4IRCA 2X3GA 2VFRA 4C8YA 2WB4A 3UW1A 1X4CA 4ECYA 1FE0A 2XO7A 2E7WA 1WACA 5F8HA 5KFAA 2HNYB 2W7OA 4KR0B 1VQ7S 4R5PA 2QSFA 4I69A 5CZXA 2RS8A 4LQ3A 3IRXB 2FDNA 3D28A 1WHWA 3CCZA 4QU7A 2FJBB 3DNCA 2WONB 4DSEA 1FRMA 2DR7A 3CJ0A 2NSBA 3DLBA 2UV8G 1UWBA 2DH7A 2JLEA 3KMSA 1BQMA 3I82A 1VBYA 3MI7X 4ZS6A 2JL9A 1JIHA 2BXJA 2VZ9A 4HLBA 2R2SA 3D5MA 2VG6B 2B9XA 2BE2A 3N0VA 3H25A 2HQ3A 4HTIA 4IFVB 4URQU 4NA1A 4UY8T 1S97A 2GQ2A 1P6TA 1OS5A 1RTIB 3MM9A 2Q43A 1T3OA 3MXHP 2P9CA 2VG7B 4TY8A 2XC9A 4DBQA 5HP1A 3PR5B 4PRFA 1S6PB 3CF5Q 2QLWA 3U27A 2NR0A 1YTYA 2CZVC 3OHBA 4O3QA 3NMRA 2XEXA 2D3OR 3M6VA 1RT4B 1JLGB 3G4SS 4PXEA 1XERA 1ZYQA 4QPTA 1TFWA 2R7SA 2HHQA 2ZZNA 4RW4A 4XDCA 3M8QB 4X4PA 3MPWA 4PG4A 3KJVA 4TQRA 3DLGB 4O44A 5F8NA 1M0SA 3H20A 1N6QB 3G8TA 2YVSA 3GFYA 2GV1A 4CQ1A 1RISA 1TP7A 3OFGA 2WB1D 3OXLA 3T19A 1VQ4S 4H4OA 3I9V9 5K8OA 2LXIA 3GMGA 4WFXA 4X4SA 5I4MA 4OZNA 2MQNA 3DU5A 1C4CA 1N52B 3CDUA 5DJBA 2YKNA 3SDEB 4LVOP 4PQAA 2R7OA 2EW9A 3SV3A 5KFBA 2CQ1A 2OTLS 3UCZP 4DQRA 1Q7YT 2P9GA 2N82B 2EI5A 1FVQA 4RX6A 4RUHA 4K4VA 2DGTA 1N33F 4LQ9A 4FF4A 4NX9A 1B7FA 2EBEA 2XS2A 2B7CB 4OHZA 3OXGA 5L8RC 5L9NA 4G3IA 4R5PB 4DSLA 1TKTA 1FT8A 2AYBA 2XSFA 4DV1F 2CPXA 2E29A 2E1AA 4K4YA 4BDPA 4JI2F 2OIHA 1R8AA 4GKJF 3F41A 1UWBB 2PI4A 2L9NA 5CCLA 3PW0A 1BQMB 2E5LF 4EFAC 1S1VA 1XBWA 3C8YA 4B9UA 2XSJA 2L41A 1VC5A 4TNOA 4NYOA 1NK6A 4ZPDA 1L3VA 2J9DA 2KG0A 2YH1A 2BE2B 2P9EA 1FA0A 4KO0A 1JLCA 1M5KC 2RS2A 2ZH1A 4DLGA 2D1CA 3MM9B 3E3XA 5F9NA 4AQYF 3Q2SC 2XY7A 4RUAA 1IM4A 2F3JA 3GFXA 1FRXA 2YWGA 4TY8B 2BJDA 5HP1B 2RH3A 2YWKA 4LJMA 4K4SA 3DC2A 2C22A 5C5JA 2PT0A 4DJBA 4CH0S 4A8YA 2M0GB 3FSXA 3MCSA 2DK2A 4LIWA 4RNNA 3HHEA 1ZPWX 1CEZA 4OI1A 4RW4B 4NMLA 1PC4A 2RF2A 1C4AA 2FTRA 1FDNA 2OPQA 4KBIA 3KJVB 1IR0A 4O44B 4CO0A 4A48A 1J2VA 2KFNA 2NLWA 4FS2A 5J2NA 2A10A 1T05A 1W25A 4H4OB 1SV5A 1U49A 2FJXA 5C25A 2HHWA 3GILA 5DM7Q 4PWDA 2E1RA 4ECZA 1ZZNA 1NZAA 1D9AA 2GJIA 2LQ9A 2QA4S 1YI2S 1V6HA 2YKNB 2LEBA 4X4VA 2V4QA 2E5HA 4MYUA 1Z1ZA 1KD1T 1HI0P 1N32F 4O4RA 4Q43A 4ZVGA 4ECTA 2XGPA 4PUOA 3MUTP 3KYLA 1YJTA 1LQ9A 1Y3KA 5GAHI 1QSLA 2VA2A 1JJ2R 3CWJA 1JB0C 2FC8A 2GHVC 2DJWA 4QR1A 2J9EA 1X8DA 2XLJA 2YX4A 2IA0A 1TKTB 3IA0A 2WRMA 3NS6A 2HFNA 3ITHA 2M8DB 1FK9B 2I2YA 2E5IA 3M30A 1LW0A 3NCPA 3M9NB 1Q79A 2J0WA 4DFPA 3FQKA 1IKWA 2PMZD 1S1VB 3QJLA 3QAUA 5GAGI 1RK8A 5KAKA 1ZAXA 3QJPA 2W7AA 1QVGR 1JLQA 2YX7A 1ZH5A 3SCKE 1T95A 1O5JA 1U2RA 2XSJB 3WZ0A 3TUZC 4B9TA 2EG2A 3WDOA 3J7YU 4JOUA 3P96A 4KO0B 5KTQA 1JLCB 2X1GA 5H9EJ 4DR3F 1YJWS 1D1UA 5LXYA 1IQZA 2OTJS 1U1OA 4IRKA 2YWEA 3M6UA 1PILA 2DHXA 3PRBA 3RU0A 4ETXA 1GQEA 3TVKA 3JSBA 4IH6A 2IVYA 3MECA 3OL7A 3N6LA 1FJGF 1KSPA 2RF2B 2VB6A 1Q7LB 4C0BA 3WBZA 4HL9A 3UI3A 2OPQB 2E66A 4ZLPA 4I64A 3CCVS 4O3RA 1D3WA 3PIPQ 5J2NB 1T05B 1U8SA 3PJXA 1SV5B 2ZJPQ 5C25B 4NA3A 3MD1A 3PW2A 2RKIA 1HNZF 2IJNA 3CD0A 4FZVA 4OZJA 4PWDB 3V5RA 2XULA 4J9MA 3BQ0A 2VPXB 1UEVA 3HLUA 1MROA 4PG6A 4DL2A 4FN5A 2VPYB 3T5JA 1YHQS 1URRA 1VQPS 1VOMA 3JTOA 1SBRA 1RA6A 3BSOA 4PUOB 4ED7A 3ENQA 2ROGA 3KTQA 3MPYA 3B4DA 1BGXT 3N6NA 4C8OA 1RT2A 2DR9A 2HIQA 3NS5A 2CQCA 1UVLA 2DVIA 3R5CA 3ITHB 2ASJA 2DRBA 2CRLA 3M30B 1LW0B 2ZC4A 5HMZA 2R8HA 4RZRA 1MMLA 2KO1A 2W4CA 2HAIA 4C4WA 1IKWB 2ZFHA 2D41A 4X64F 2J0SD 1WD6A 1QSYA 1QLNA 1JLQB 5E5NA 1ZM2A 1X7VA 2XY6A 2KU7A 4E8UA 4QYZJ 2LKZA 2MZRA 2FHJD 2PSZA 5D4OA 4QWCA 1LWFA 2F9DA 2M70A 4IUFA 2IM1A 5LT5A 3TNVA 3CC4S 1VQKS 1HMVA 5JUMA 2BRKA 4U7UK 1R27B 2LVWA 2CQHA 2SXLA 4CT9A 2W8LA 3CJ4A 1JJ4A 1LW2A 2E44A 2PFFB 1NRKA 2QMWA 5CYMA 5G4DA 2QEXS 3MECB 4CNZA 3LQVA 4PQUA 2F4VF 3MURP 2RT3A 2DB1A 2I9SA 2LEAA 3V6JA 2CJBA 4M8LA 3UD3P 2W9BA 3GSDA 2J8AA 1VI7A 2ZKTA 3HHNB 5F8JA 5KFSA 1WTFA 2KYXA 2DNHA 4HH1A 3NNCA 1LFWA 1NK0A 3K8VA 2EFNA 3I5BA 1RI7A 5D78A 2RKIB 2CJKA 1GTHA 2DPIA 1L3KA 3AQOA 4RBTA 1TR0A 4PPZA 3EX7B 5LJ5Y</