1WE7A

Solution structure of ubiquitin-like domain in sf3a120
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
115
Chain Sequence
GSSGSSGTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQGLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMASGAVIHLALKERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Ubiquitin-like domain in SF3a120
rcsb
source organism Mus musculus
molecule tags Gene regulation
molecule keywords Sf3a1 protein
total genus 14
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1we7A00
1WGYA 1P98A 2CU1A 2D2QA 4JL9A 3VH4B 2JT4B 1EO6A 2R2QA 4IG7B 2WDTB 3M95A 2V1YA 3A9KB 3L10B 2LI5A 5J2RA 1E90A 3QARA 4II3B 4TQ1A 5L83A 4MJSA 3PRZA 3QCAA 4ANUA 4RMAA 4G11A 3UIOB 4IM0A 3OJ4B 4LDTB 1UD7A 4WJPA 4W9KA 2M17A 1WM2A 2KWCA 5E6NA 3TL5A 1EUVB 2XK5B 3ZDMC 3DBSA 3VVWB 1WR6E 4ASWC 2NCNA 1WGDA 4BVUC 2LVOA 2ASQA 4FJYA 4W9GA 2IZVB 4PS8A 1WZ0A 2YVCA 3TBLD 1TTNA 1WMHB 4KSKC 3VXWA 2KO3A 3RULA 4BKTA 3N32A 2CHWA 2KOXA 3A9KA 1WGGA 3VFKA 5GMVA 2C7HA 2M0XA 2UWQA 3V61A 4BFRA 1J19A 3HM6X 4DHZB 4IW0A 2K25A 4DK5A 4GDKB 4GXBA 5J18A 1YIWA 4EFOA 2N9XA 2ZPYA 2JWZA 1OGWA 1WY8A 4W9FA 4A20A 2GBKA 3WA0A 1XT9B 2KDEB 3W1SC 1WX9A 4II2B 5AZFA 2LD9A 3PV1A 4GDKA 5D94A 1UGMA 3PZDA 3L17A 3L54A 1IYFA 1GNUA 5LXIB 4JIOU 3A9JB 1V80A 3WANA 2KKCA 1WMHA 2VRRB 3DVGX 2RPQA 4MGIE 4NNJB 4WWPA 1C3TA 3A1QA 3NS8A 4GMVA 2JUOA 1K8RB 1YD8U 2MBEA 4ANVA 3RD2A 3UINB 3WALA 4HVBA 1WIAA 3PGEA 4XC2A 2K6DB 5BO4B 4JLCA 2JRHA 2O2VB 3KYDD 4W9LA 4LJOB 5DPWA 2O6VB 2LZ6A 3VUXA 2D3GA 1RFAA 3B08A 2C9WB 3JYUA 4EZJA 2OJRA 1WM3A 4CHKA 4F1SA 4RM8A 1TGZB 2KX0A 4GDLA 4W9DA 1J0GA 2DYOA 4FLHA 4I6NB 2JF5A 4IWPA 4K81A 4ZRJA 5AZGA 4FA6A 4URKA 2KMCA 4CYEA 4BBNC 1CMXB 2HTHA 1V81A 3VDZA 1LFDA 2K8HA 1JRUA 2J0JA 1EF1A 2KC2A 1H4RA 1WJ4A 4EKUA 5EDSA 3RCZA 2B3AA 3VHTC 1E7VA 2KFKB 2DZJA 4HPMB 2GMIC 1WGRA 3KVFB 4PS3A 2J7QB 4AJWA 4F7ZA 1WJ6A 4OVUA 4JGHB 3VAWA 2KFJA 1AARA 4GDLB 4K7UA 3HK0A 3UIPB 2NVUI 2QHOA 3SD5A 4BOSC 3S2AA 2NPTA 2KJRA 2FAZA 2XBBC 4IM3A 5D2MB 4MGZE 5IA7A 4DBGA 3DCGA 3H9DA 4KVGB 2ZCCA 3WAPA 2KJHB 2LXAA 1E8XA 1Q1OA 4KDIC 2ZZPB 3ZIMA 3KYCD 3APCA 3DVGY 2KK8A 4GOCA 2BWES 3Q3JA 2C7MB 3QK0A 2EKEC 3TIXA 3ZNID 1G6JA 2J0MA 3QIJA 2V3SA 2LGYA 3CSFA 3U30A 3V6EB 2KJ6A 4E74A 2N7DA 2PJHA 2LJ5A 4HLEA 3IHPC 2GBJA 2WWZA 3DOWA 4KSLC 4B9KA 2JXXA 4MSQB 5JH5C 2WYQA 1LXDA 4EUTA 1KOTA 1ZW7A 3OJ3A 5TR5A 3ZTDA 3V62A 3A9JA 2LVPA 2D10A 4MGYE 3ZUNA 5DCNA 2N7EA 3L08A 4JQWC 1QZEA 3M3JA 5DPSA 3W1YA 3PHXB 3QHTA 3RYTA 4GIVA 2KC1A 1XD3B 2MW5A 2L76A 1BT0A 5C23A 4A3PA 1Q5WB 3JW0X 2Z0EB 1SE9A 4WJQA 3X23A 4BOZB 1U4AA 3QWZB 3VQIA 1C1YB 3B1LX 3PT2B 2C5LC 2LVQA 2EMSA 3DBLI 3Q3FA 2DYBA 2CR5A 3KW5B 3QQ8B 1OTRB 3CMMB 4AUQC 2KLGA 3EFUA 3DPDA 4GU2A 5L95C 3R7QA 3DVNV 4NQKE 2LGXA 4FHKA 3U7DA 3JVZX 2G4DB 4MH0E 3DVNU 3UQAA 4GN1A 1NDDA 3H7PB 1UBIA 1YJ1A 3MTNB 3W1SA 2MP2B 2XK5A 5DPRA 5HKHA 4IUMB 1YX6B 3AU4A 4W9IA 3M63B 1S1QB 1UBQA 3R66C 2MQJA 5CHVC 1J8CA 4KZCA 4W9HA 3DBRI 4IM2A 3NOBA 1LM8B 2FNJB 4WWNA 3NY5A 3H7PA 4NPNA 3HHMA 4MJSB 1Q0WB 2KXJA 3WAOA 3U8ZA 4A3OA 3UQBA 2CHZA 3VTUA 4BKSA 2I1KA 2KMAA 4ICVA 4WQOB 2DHZA 3LDZE 3OLMD 2G45B 3VH3B 1LQBA 4GSWA 1R4NI 1E7UA 1A5RA 4KZ0A 2KTRA 4PYZA 3R7RA 1R4MI 4G50A 4LJPB 3KUZA 3L0WB 3KH0A 4TV3A 5E6PA 2MSED 3JSVB 4G3XB 3B0AA 3DQVA 1OEYA 3PHWB 5AEKB 4NAWB 1UZXB 2D07B 2MCNB 2ZEQA 1RRBA 3EECA 5JHAA 2IO3B 3MHSD 4B6WA 3HIZA 4KIKB 3QAQA 2KANA 2JVCA 4W9JA 1MG8A 2MA9B 4NJ7A 1RLFA 1WJNA 3PTFC 4M8NA 4E3CA 3ZW3A 2DZMA 4ZRKA 5JZEB 2PE6B 2G3QB 2DX5B 2FCQA 2J0KA 4WWOA 3RT3B 3ZNGC 3O65B 4HDOA 2KDIA 3PRPB 4TKNA 2FCNA 2BPSA 1RAXA 2KNBA 2WX1A 2MBOA 2MWSB 4FJVB 1KM7A 4GB9A 3H7SA 3ML9A 4FBJB 4EEWA 1WYWB 4W9CA 4WJOA 2LUEA 1V2YA 2K39A 1WX7A 4ICUA 4MEMA 3KUDB 1WRDB 3AU5A 2CKHB 2L0FA 3IVFA 2UYZB 2HE7A 5D6JB 4MM3A 2IY0B 4IC7B 5D7GA 3SU8X 1IPGA 3QA8A 2KDFB 2AYOB 3RZFA 3WAMA 1IP9A 5LXHA 3I3TB 3V60A 2K6QA 2M1MA 1GC7A 2L05A 2DZKA 2G4SA 1P0RA 2KTFA 2IO1B 2MX2A 3A33B 5DPTA 3T9LA 3ZNZB 2C60A 2CS4A 2IBIB 1OQYA 1P1AA 4MELA 2N4FA 5JHBA 4K1RB 1V5OA 3NHEB 4DWFA 3BY4B 2DYMA 3HM3A 3CSTA 2BYFA 2KTRB 3N30A 3T8MA 2LRUA 1ZGUB 4BKGA 4ANXA 5IAAC 2WX0A 2M4NA 1F9JA 4EZKA 4FADA 2GBMA 3ENEA 3KUCB 3ZDTA 4XX5A 3APFA 3ZKJC 3APDA 2KLCA 2C7NB 2W9NA 1V5TA 2KWUB 2Y5BB 2R2OA 3K9OB 3V6CB 2IY1B 4NQLB 4HCNB 2O6VA 2ZJDA 4WJNA 3CF6E 4ZRIA 4J6IA 5E6OA 2O2VA 5KHOA 2ZCBA 3A4SC 2KDBA 2DZIA 2NBUA 1I42A 3PSEB 3IFWB 3UF8A 1WE7A 4EOYA 3ML8A 2MP2A 2BKRB 2GOWA 3C0RB 2N9EB 3ALBA 2BWFA 2D11A 2FCMA 2AWTA 2N1VA 2XEWA 3ZVVA 1WXAA 4M0WB 3AULA 1E8WA 4NJ6A 4AP4C 1WF9A 1WXVA 2L8JA 2REXA 4BBNF 1WR1A 2KHWB 3AXCA 4KIKA 4PYUA 4XZ4A 5KHQA 1TBEA 3DDCB 3PVLA 1VCBA 3VTWA 4DDGD 1EF5A 3A4RA 4HXDA 3PS6A 3QJZA 3SHQA 4FN2A 2KQSA 4CO7A 3ZRCA 1UH6A 4OVVA 4BKSD 3L16A 1WX8A 4NAWA 2I1JA 2OOBB 3EHVA 2A4ZA 3JSVA 3PPAA 2M8SA 1FXTB 1Z5SB 4ZYNA 4N9F4 4X57B 2GBNA 1H8CA 2BYEA 2ZNVB 3QC8B 4KV2A 4I6LB 2MLBA 1WZ3A 2FIFA 3OAWA 2L00B 4RM9A 1GJZA 2MRPA 1NBFC 2HJ8A 1GC6A 1SIFA 2DAFA 2JPHA 2GBRA 4WAAA 4AJYB 1T0YA 1KLVA 3IBEA 5CHFA 2KX3A 2L3ZA 2JRIB 3D32A 2EMTA 1P3QU 4HCPB 4MSMB 2ZVNA 4GGQA 3EC8A 4B95A 2JZ3B 1SGHA 3AI5A 3N3KB 4HWIB 3NZUA 1KJTA 5CTRC 3IG3A 5G2NA 2LASA 3PLVA 2NBWB 1L2NA 4AOFA 1WE6A 3RZWC 2DENB 3VUYA 5CHWA 1HE8A 3ECIA 4LDTD 3K9PB 3TCAA 2AL6A 3MJWA 1WH3A 2L0TA 3R3MA 2L7RA 1PQSA 2CHXA 2KD0A 1NI2A 3TMPB 3VTVA 4NY0A 2AEHA 2NS5A 4DHJD 1D3ZA 3TJPA 1GG3A 5CX3A 3BINA 1P9DU 2FUHB 5G55A 1ISNA 1L7YA 2YLMA 4LCDE 3WIMA 2V4LA 3ZNHB 1Y8RC 2PE9A 2IYDB 5LLIA 4I6PA 1WGHA 1GUAB 2PPHA 2NR2A 3ONSA 2ZVOA 1V9JA 2K8BA 2Z59B 3LJ3A 4HDQA 2K8CA 2NBVB 1E5WA 5AZHA 2ZNVC 4HJKA 4K7WA 3ZRFA 4DHZE 3GOEA 3H1UA 2PEAA 2BKFA 1OEYJ 2KVRA 2MBQA 2BGFA 3SDLC 2LRWA 2Z0DB 1XQQA 4M8MA 1WXMA 3PLUA 4HK2A 1I35A 4DXAB 5FR6A 2N1WA 1V49A 1YX5B 4DDID 3X0WA 3DBHI 2N9PC 1E8ZA 2DAJA 4IWOA 4E71A 4DHJB 2LGDA 2AL3A 4G0NB 3ZLZA 4MDKE 1WJUA 1X1MA 2LXCA 4TQ0A 3P2BA 5C1ZA 3L13A 3ZO5B 4ZDVA 4IWQA 4K7SA 4PS7A 1WXSA 4HPLB 2BF8B 3PRMB 2FCSA 2FIDA 1E8YA 1WFYA 2MBBB 2KWVB 1TZ1A 3A1QB 4AWJA 3M62B 2HD5B 1M94A 3ZTCA 5J17A 1V6EA 4FHJA 2RD0A 2KQ7A 2LWPA 2A5UA 2NPTB 2O6VD 1YQBA 2RR9A 2K1FA 1V86A 3GZNI 1UELA 3PREA 2RGFA 4YL8A 3QX1A 4TUUA 4P7IA 2IO0B 2KN5A 2MBHA 3UGBB 1ZKHA 2ZPNA 4MGKE 4ANWA 4FULA 2JY6A 1WI0A 2KFKA 3NZSA 4FJZA 3H6NA 4KDLB 2BYVE 1Z2MA 2IO2B 2RSUA 3VUWA 2KZRA 3RUIB 4EZLA 4F8CB 4W9EA 2JZZA 1VD2A 1S3SG
chains in the Genus database with same CATH superfamily
4JL9A 3RFZB 3DWMA 2WDTB 3A9KB 5IOIA 3TEZA 1ZXIA 1VDVA 3FILA 4ANUA 2KACA 4IM0A 2NTSA 4M00A 4LDTB 5IN7A 1XLPA 2WP9B 2WU5B 2DNFA 2WXMA 1HA5A 1QOFA 3ZDMC 1VLBA 1WR6E 2NCNA 4BVUC 3FILB 4FJYA 4W9GA 2IZVB 3TBLD 4BKTA 3N32A 2CHWA 2KOXA 3A9KA 5GMVA 2M0XA 3HM6X 2K25A 1J7CA 4GXBA 5D3IB 3NVYA 4RF0A 3PO0A 2JWZA 4W9FA 2GBKA 3WA0A 2KDEB 4II2B 5AZFA 1JMLA 4GDKA 2H88B 1WYGA 1UGMA 3L17A 3R2TA 4HPPA 4JIOU 4OZCA 5G5HA 3WANA 2VRRB 2RPQA 2OJWA 1BMLC 1EWCA 1SE2A 3NS8A 5IO9A 2LGSA 1YD8U 4A8XC 4HVBA 1WIAA 4JLCA 1JWAD 4W9LA 1TS2A 3W5VB 5BYQA 1FXAA 1TT5B 1ZXHA 2LZ6A 3MC8A 2N0SB 1WGKA 2I38A 4CHKA 4F1SA 4W9DA 1I4GA 1D6EC 4ZRJA 4RNAA 4RGTA 4URKA 4BBNC 1UUPA 1L4DB 3VDZA 3TEXA 2KC2A 2EKIA 1STEA 5EE0A 3I5JC 2L83A 2WS3B 3NVWA 1JW9D 1HQRD 2LEKA 3HK0A 4BOSC 1RM6C 2WDQB 4IM3A 5EE1A 3WAPA 4KVGB 2ZCCA 2BW2A 2LXAA 1RFKA 3NVVA 1Q1OA 1HEZE 2C7MB 3Q3OC 1C9FA 1V97A 1FEHA 1FM0D 2INPE 1YJIA 1L0YB 5JH5C 3BZDB 1LXDA 2M56B 1ZW7A 3W2DA 2WLBA 2FUG1 3L08A 4EE2A 1XD3B 2L76A 4R3DA 1N5WA 1Q5WB 5AUIA 3JW0X 1SE9A 1ZUD2 3QWZB 2VH2A 3E56A 2LVQA 3O13A 3FAHA 4GU2A 1EM7A 3DVNV 1LO5D 1NYQA 4MH0E 1YJ1A 5HKHA 2MP2B 3IXSA 2WXPA 3AU4A 1KF6B 1S1QB 1UBQA 3NRZA 1MFWA 1RWSA 3DBRI 1ZOYB 4IM2A 1LM8B 2FNJB 4FXCA 4TMAB 2KXJA 3WAOA 4BKSA 2QILA 4HKQA 2G45B 3VH3B 1LQBA 3AM9A 1A5RA 4PYZA 2KTRA 4LJPB 3L0WB 2OHFA 3KH0A 3AEDB 3P4SB 5E6PA 1YJJA 1RRBA 1A70A 1SE4A 4B6WA 3HIZA 3DWGC 1DOIA 2KANA 2MA9B 3ABVB 2KN4A 4M8NA 2DZMA 5JZEB 4O1NA 2DX5B 2FCQA 1AN8A 2WXNA 3AE2B 3RT3B 3ZNGC 4TKNA 2MWSB 3FKYA 1V2YA 4M01A 1MVKA 4ICUA 3MC0B 2CKHB 2L0FA 2RMMA 3AEFB 1FD6A 2J42A 2BS4B 4IC7B 1F2RC 1QOBA 5D7GA 3RZFA 1E7PB 1B9RA 1GC7A 2DZKA 2MX2A 5DPTA 2C60A 2CS4A 4MELA 4J3OD 1V5OA 3IT4B 3HM3A 2PVOD 2SEBD 2LUMA 1R7SA 4EZKA 2M4NA 1F9JA 4FADA 3ZDTA 1QLBB 2Y5BB 2R2OA 3V6CB 2IY1B 4K3CA 4HCNB 5E6OA 4WQMA 1FNVA 2DZIA 3UF8A 4P16A 1ENFA 2BKRB 2GOWA 1J7AA 4A9AA 4LNNA 2BWFA 2D11A 2FCMA 3ZVVA 3EUB2 4M0WB 3AULA 4ZHPA 2KHWB 4XZ4A 5KHQA 3BK2A 2QDFA 1TBEA 3DDCB 3A4RA 3SHQA 1N62A 1UH6A 3RNBC 3OWEB 1HTQA 1Z5SB 2BBCA 4ZYNA 2BYEA 3QC8B 2FIFA 1E6EB 2N9LA 1GJZA 1KLUD 2MRPA 1L0VB 4HEA1 2WQYB 2IJ0A 1EU3A 2KYWA 1KLVA 1WWTA 2L3ZA 2ZVNA 2PTLA 3N3KB 5CTRC 2OEDA 2LASA 2JX5A 1L2NA 3ZJTA 1ZE3D 2INCC 4RGOS 1HE8A 3KWLA 3K9PB 3TCAA 1WH3A 1FFUA 3TMPB 3VTVA 1EU4A 4DHJD 1F52A 1GG3A 1BUIC 3BINA 1WXQA 4LCDE 1WGHA 4HJKA 3DHHC 4DHZE 1XEEA 2PEAA 1OEYJ 2MBQA 4JE3B 2LRWA 3B2GA 3BYYB 4M8MA 4MM3B 1UWXA 3NUHB 5C2TB 4HK2A 1VRAB 5FR6A 1YX5B 4IKGA 2DAJA 4DHJB 2LGDA 1WJUA 4TQ0A 1QF6A 4CQNA 4ZDVA 1JWMD 4PS7A 1J7BA 1WXSA 2BQQA 2MBBB 4A6QA 1CJEA 3ZYYX 1TZ1A 3A1QB 2CJNA 2V4IB 4FHJA 3GP7A 2KQ7A 2WGSA 2O6VD 4US8A 2K1FA 5H8YE 2RGFA 4MGKE 4ANWA 4FULA 4ZRQA 2JY6A 3AMZA 3NZSA 4UDUC 4TSSA 4KDLB 2BYVE 1Z2MA 2IO2B 3VUWA 1OQQA 4F8CB 2ICIA 4FHKA 1S3SG 2D2QA 4KKIA 1L4ZB 2JT4B 2JXTA 2R2QA 3M95A 4YSYB 2FE8A 3L10B 3DHIC 1E90A 3QARA 2G9HD 4KKJA 1FCCC 4MJSA 3QCAA 3UIOB 3OJ4B 1FRDA 4IOIE 4W9KA 4A55A 2M17A 2WXHA 3VR9B 1GB1A 1HZ5A 1SEBD 2XK5B 3DBSA 4ASWC 1WGDA 2ASQA 3GZNB 2YVCA 1TTNA 4KSKC 3VXWA 2IGGA 1WGGA 3BIID 5LNK1 1TJEA 4GDKB 1T0QC 1JWBD 2N9XA 2VZKB 1PYWD 1WY8A 4A20A 3W1SC 1WX9A 2Q5WD 2DBYA 1FPYA 1V80A 3DVGX 4YXDB 3AE6B 2PMVA 2RDBC 1FFVA 2MBEA 3RD2A 4XC2A 2QCZA 3HVDA 4L2YA 4XWTA 3AE5B 2C9WB 2TSSA 4LNOA 4EZJA 1XXGA 2WHIA 2N9KA 1J0GA 2WXFA 4I6NB 2JF5A 4K81A 1FMAD 1WSPA 4CYEA 1CMXB 2JYTA 1V81A 1LFDA 2K9XA 1JRUA 2J0JA 1EF1A 1TS4A 4WAFA 2WXIA 1H4RA 3OG5A 2QC8A 3U7ZA 1PUTA 4PS3A 2J7QB 4F7ZA 1YQ4B 3AE3B 3I9V1 5FK9C 2XNAC 2IDYA 4GDLB 3UIPB 3SD5A 2NPTA 2KJRA 2FAZA 5D2MB 5IA7A 3DCGA 3H9DA 3ZIMA 2ZZPB 3KYCD 3DVGY 4KGTA 2BWES 3ZNID 1G6JA 2J0MA 3U30A 4C56C 2LGYA 4OW0A 3V6EB 3ZGZA 4JPSA 1ZPSA 4OHJA 1F0ZA 2GBJA 2M19A 2JXXA 5T8IA 2WYQA 1KOTA 3OJ3A 3N1ZC 3A9JA 2D10A 3W9CB 4MGYE 2KT7A 2N7EA 4JQWC 2RDHA 3M3JA 3W1YA 3BYTB 1SE3A 2K5PA 5C23A 3X23A 4BOZB 1U4AA 3VQIA 1C1YB 2C5LC 1GPXA 3B9JA 3ZJVA 4LNFA 2ZW1A 2CR5A 3KW5B 2KLGA 3DPDA 4NQKE 3U7DA 3JVZX 3TUOA 2N7JA 3DVNU 3Q69A 3R66C 2MQJA 2L32A 1HTOA 1J8CA 3VRBB 3H7PA 4NPNA 1YMHE 3OLMD 3SFDB 4GSWA 3Q3NC 4KZ0A 4G50A 4YSXB 3DQVA 1OEYA 3PHWB 4NAWB 2MCNB 2ZEQA 2WXLA 1VZ7A 3EECA 2HJ1A 5FR3A 5JHAA 4HRSA 1OFFA 4KIKB 1IGDA 1V1PB 3QAQA 2Y5PA 1AW7A 4W9JA 3EGRA 4NJ7A 2DWQA 3ZXRA 2Y3AA 3GE8C 4ZRKA 2PE6B 3I63C 2IGDA 4WWOA 2W82A 2KDIA 2K0PA 1L6VA 1C4PA 1RAXA 2MBOA 1KM7A 3RI7C 3TEWA 2KAJA 3ML9A 4FBJB 2J52A 1WYWB 4WJOA 2LUEA 5BYSA 1D5MC 4MEMA 1WRDB 2D3BA 3AU5A 3CWIA 3IVFA 4C7YA 1ZP0B 1C4AA 2IY0B 4KX6B 3V05A 1SIJA 2KDFB 4C4VB 2BB5A 3WAMA 5LXHA 3I3TB 3MFGA 2MHJA 2G4SA 2KTFA 1K50A 3T9LA 3ZNZB 2I2YA 2JWUA 1P1AA 1NENB 2N4FA 5JHBA 4DWFA 1TS3A 3T8MA 2LRUA 2L52A 4HROA 4BKGA 1SJHD 2Z8LA 2WX0A 4YTNB 5IAAC 1L6UA 4XX5A 3ZKJC 2C7NB 1IBXB 1ET6A 5HG2A 2KWUB 3K9OB 4H2AA 4NQLB 4WJNA 4ZRIA 4RCOA 2ONQA 2NBUA 3PSEB 4OZAA 1SB3C 4MACA 1CZPA 1DOYA 1WRIA 3ALBA 3T3OA 2AWTA 3TEYA 4AP4C 1QKZA 1WF9A 2L8JA 1HXYD 1WR1A 1TS5A 4HXDA 1V1OA 3ZRCA 3AE8B 4OVVA 4BKSD 3L16A 2I1JA 2OOBB 1MPEA 3JSVA 4N59A 1FXTB 4X57B 4S17A 4RM9A 1FXIA 1YN3A 3RNCC 2DAFA 1NVID 2JPHA 1NI3A 4WAAA 4AJYB 4HCPB 3D32A 1P3QU 3EC8A 1SGHA 1KRHA 3IG3A 2W55A 5G2NA 4LNIA 2NBWB 3KLSX 2INDC 3ECIA 3ETRA 2AQ2B 2QSDA 5IKCM 1Q10A 2KD0A 4NY0A 3SFEB 3TJPA 2K3UA 2GB1A 1P9DU 5HHDG 3WIMA 2PE9A 2IYDB 2JYEA 2MJEA 4I6PA 1GUAB 2PPHA 4LLGM 2ZVOA 2AQ1B 2K8BA 2Z59B 4C00A 1CQVA 2K8CA 2NBVB 4K7WA 4RGMA 2D5GA 3GOEA 3UI3A 2KVRA 4XGAB 2Z0DB 1NYRA 1XQQA 1I35A 4DXAB 2N1WA 1V49A 2JQRB 4KGSA 3DBHI 3VR8B 4E71A 2AL3A 1R4NB 1VJKA 3ZLZA 3P2BA 5C1ZA 4IWQA 4K7SA 4NZLB 4HPLB 2FCSA 3N1XC 1WFYA 1K52A 2KWVB 4AWJA 1KH0A 3HUIA 1M94A 3AE1B 2H89B 2A5UA 1YQBA 3TSSA 1V86A 4XE0A 3QX1A 5IP4D 1JQ4A 4P7IA 3UGBB 1ZKHA 4DQOC 1PGXA 3P4PB 2RSUA 1VD2A 1WGYA 1P98A 2CU1A 1E10A 2NTTA 3VH4B 3MC9A 3N20C 1EO6A 2LFIA 4IG7B 2MH7A 2LI5A 4TQ1A 3PRZA 4RMAA 4G11A 1UD7A 4WJPA 2YEPF 3MHZA 3C19A 1EUVB 3VVWB 2XN9C 4WH4A 3HVZA 2JZPA 1WZ0A 1WMHB 2SAKA 5BYRA 2KO3A 1JALA 2UWQA 3V61A 4BFRA 1J19A 2HDEA 4DHZB 4IW0A 3B2FA 1YIWA 1I4QA 2ZPYA 1OGWA 3RNEC 1XT9B 1PDXA 1YN4A 2LD9A 3PV1A 1I4PA 3PZDA 1IYFA 1GNUA 5LXIB 1K53A 4NNJB 1HZ6A 3BVGA 1N63A 1AYFA 3WALA 2L1AA 5BO4B 2K6DB 2O2VB 3KYDD 5DPWA 2O6VB 2PLPA 2FBWB 2E6XA 2D3GA 1RFAA 3DBLB 1WM3A 1TY0A 2WXGA 4RM8A 2KX0A 4USAA 3AE9B 4IWPA 5AZGA 4FA6A 1JWSD 5D3DA 4WIPA 2BYTA 1TKEA 2WXOA 4DXGA 2K8HA 4YTPB 4P1CC 1WJ4A 5EDSA 3VHTC 1TYGB 2MEKA 2KFKB 2V3PA 1WGRA 3KVFB 1WJ6A 1C77A 5E6JA 3VAWA 2KFJA 1AARA 2NVUI 3S2AA 4ZRPA 2XBBC 1R4MB 4DBGA 1LGRA 2KJHB 4KDIC 3APCA 4GOCA 1D5ZC 3QK0A 3QIJA 4RF1A 2GRIA 2V3SA 3CSFA 4E74A 2PJHA 3IHPC 3DOWA 4B9KA 1F1HA 4EUTA 3Q8EA 3ZTDA 1TIFA 1XCQL 2LVPA 3NJTA 2LJIA 3ZUNA 5DPSA 1QZEA 1MG4A 1T3QA 3PHXB 4GIVA 2MW5A 2Z0EB 2M0AA 5TSSA 2KMMA 2WDVB 2WXQA 2EMSA 4AUQC 2DYBA 3AEGB 3NZ3A 3EFUA 5L95C 2QIEB 3R7QA 2KQ4X 2G4DB 4S0RA 3UQAA 1NDDA 1IUEA 3W1SA 3MTNB 5DPRA 4IUMB 4W9IA 3R8BA 5I4DA 3M63B 4KGRA 1C4CA 5CHVC 4W9HA 1UNSA 4WWNA 3NY5A 4L23A 3UQBA 2CHZA 3VTUA 2KMAA 4ICVA 2DHZA 3LDZE 1R4NI 1E7UA 2Y5CA 3R7RA 5GXGB 1R4MI 1FCLA 1XF5L 4G3XB 3B0AA 4N58A 5AEKB 1UZXB 2D07B 3RPFC 1QT9A 4ACFA 3Q8FA 3MHSD 1RLFA 1WJNA 3ZW3A 1DOXA 2J0KA 2WXJA 1V8CA 3AEEB 3PRPB 2BPSA 1Y56A 4LNKA 2KNBA 1E9MA 3H7SA 4EEWA 4W9CA 2K39A 2BTEA 1KLGD 2UYZB 3EFCA 5D6JB 1IPGA 3QA8A 2AYOB 3EA6A 4ITKA 3V60A 3B1LX 2L05A 2IO1B 4MH8A 3FC4A 1GOZA 4ZHOA 4K1RB 2BYFA 3U4EG 2PVGC 1XLOA 1ZGUB 1AWDA 4ANXA 3KUCB 3T3NA 3BVMA 3APDA 2KLCA 4HKZE 2W9NA 3ZJUA 1V5TA 3P42A 3LYYA 2O6VA 2ZJDA 1JCKB 3CF6E 4J6IA 2O2VA 2ZCBA 3A4SC 1I42A 3IFWB 3W5UB 2N9EB 2N1VA 2XEWA 4NJ6A 4BBNF 3GE3C 1N60A 1L0XB 4OZBA 3PVLA 2KVZA 3QJZA 4FN2A 2PW9A 1WX8A 2MJDA 2IGHA 3EHVA 2UU7A 2M8SA 2CJOA 3L4PA 3Q2AC 4N9F4 2GBNA 4RH6A 1H8CA 2ZNVB 3BVZA 4KV2A 4LK0M 2K22A 2MLBA 1UF0A 1WZ3A 3OAWA 1YOVB 5C3JB 4XDCA 1I4RA 2HJ8A 2RPVA 2E3TA 3URYA 4MSMB 4GGQA 1SJED 2BS3B 2JZ3B 3AI5A 1KJTA 2G1EA 3PLVA 5JXVA 1WE6A 3RZWC 2DENB 3VUYA 3AV8A 5CHWA 4BZAA 4D2KA 2WXRA 4LDTD 2AL6A 3MJWA 1IBXA 2L0TA 3WCQA 3R3MA 2L7RA 2HTME 1PQSA 2X38A 2AEHA 1IGCA 3Q8CA 1I4HA 3AN1A 5CX3A 2FUHB 5G55A 1QOAA 3ZNHB 2PIAA 3VRAB 5BMIA 2NR2A 3DHGC 2MJ3A 1V9JA 1E5WA 3J9CA 3ZRFA 1GB4A 2BKFA 3SDLC 4XDDA 1WXMA 3DBHB 1D5XC 4DDID 4LTUA 1E8ZA 2W54A 1FRRA 4IWOA 2LGIA 1C78A 4G0NB 3LB8C 2LXCA 3P1MA 1E0ZA 4ARIA 1JWUD 3ZXVA 3ZO5B 2BF8B 3PRMB 4M02A 2FIDA 3Q6BA 1YNTE 1MHHE 3M62B 2HD5B 1YN5A 5J17A 2LWPA 4JWSC 3GZNI 2JU6X 4QAYA 4YL8A 4TUUA 2IO0B 2KN5A 2MBHA 1WI0A 2KFKA 5BMGA 1KFYB 3H6NA 2NMQA 2WXKA 3DBRB 1C76A 1FO4A 1SSNA 2RDGA 4AS1A 2V1YA 2JSVX 3RMKC 5J2RA 4II3B 5L83A 3NG0A 4ARCA 4PT5A 1TKGA 3PZ8A 2YEPB 2ZW0A 4P6VF 1WM2A 2KWCA 1T6BX 5E6NA 3TL5A 3CIRB 2EELA 2LVOA 4NJCA 3MJ5A 4PS8A 3RULA 3VFKA 2C7HA 4WWMA 4DK5A 2AQ3B 5J18A 4EFOA 2B76B 4ZOHC 3AEBB 3N1YC 2J53A 1XLQA 1ESFA 5FKAC 2D3AA 5D94A 3L54A 3N9YC 5G5GA 3A9JB 3AH7A 3GB1A 4YWGG 2W3SA 2KKCA 1WMHA 4MGIE 4WWPA 1C3TA 3A1QA 4GMVA 2JUOA 1K8RB 4ANVA 3UINB 1MJDA 3PGEA 4C80A 2JRHA 2ON8A 4LJOB 3VUXA 3B08A 3JYUA 2OJRA 1MHXA 3NS1A 2GI9A 1TGZB 4GDLA 1ZDVA 2DYOA 4FLHA 2KMCA 2LHDA 2HTHA 2V9HA 3Q3MC 3C8YA 1TY2A 3IAS1 4EKUA 2WDRB 1PGAA 3RCZA 2B3AA 4YTMB 1E7VA 2DZJA 3P63A 4HPMB 2CU3A 2GMIC 4L1BA 1T0RC 4AJWA 4RGNA 4OVUA 3ZQ4A 4JGHB 4K7UA 2QHOA 4MT5A 2GLSA 1N5XA 1KTKA 4MGZE 2D3CA 1TKYA 1D4BA 1E8XA 1NEKB 2KK8A 2WNMA 5BMHA 3R2IA 4B0MA 3AEAB 3Q3JA 3TIXA 2EKEC 4US9A 1BXTA 1VR9A 1RYJA 2KJ6A 2N7DA 4C7ZA 1ACCA 2LJ5A 4N6EB 4HLEA 2WWZA 4KSLC 4MSQB 3KQ4A 5TR5A 3SEBA 1PGBA 3V62A 3BWUD 1V1PA 1MI0A 5DCNA 2V3NA 1XO3A 3QHTA 3RYTA 3PZ7A 2KC1A 1BT0A 1T0SC 4A3PA 4WJQA 2VH1A 1GAQB 3HRDD 3PT2B 2AX5A 3DBLI 3Q3FA 3QQ8B 1OTRB 3CMMB 5EE3A 2DLBA 4M0WA 2LGXA 4HJGE 3RN9C 2KWDA 4GN1A 3H7PB 1UBIA 3NVZA 2XK5A 1YX6B 4KZCA 3NOBA 3AB5A 3HHMA 1ZDXA 1Q0WB 4MJSB 3U8ZA 4A3OA 2I1KA 4WQOB 2V0GA 1M4VA 3RNFC 1SXTA 3H8HA 2KDMA 3KUZA 1N6ZA 4TV3A 4ZYSA 2MSED 3JSVB 5HFYA 1C79A 2ACZB 4IDIA 2QJLA 2PKOA 2IO3B 5EE9A 4REZA 2JVCA 1MG8A 2BB6A 3AECB 3Q14C 3PTFC 4E3CA 4GLSC 2G3QB 1ROEA 3O65B 3RNAC 4HDOA 2QEJC 2FCNA 4BAXA 2WX1A 1VZ6A 4FJVB 4GB9A 3U2SC 1UWMA 4YT0B 3BK1A 1WX7A 1QILA 3KUDB 3U52E 2HE7A 4MM3A 3SU8X 4PK1A 1IP9A 3Q8AA 2K6QA 3AE7B 2M1MA 4B0EA 3A33B 1P0RA 5H92C 2IBIB 1OQYA 3NHEB 3E9SA 3BY4B 2DYMA 3V3XA 3CSTA 3KWVA 4C4VA 2KTRB 3N30A 1VZ8A 4A90A 3MP9A 2GBMA 3ENEA 5HI1A 3APFA 1QQRA 4WURA 1XLNA 5KHOA 1CK1A 2KDBA 1FNWA 1I7HA 1WE7A 4EOYA 3ML8A 4JWUC 2MP2A 3RNGC 3C0RB 4NAMA 2INNE 4OVZA 1WXAA 2X8XX 3IAM1 1E8WA 1WXVA 2REXA 4P1BC 4KIKA 4PYUA 1QOGA 3AXCA 4AQ7A 1VCBA 3VTWA 4DDGD 1EF5A 3PS6A 2KQSA 3Q8BA 4CO7A 1N61A 4NAWA 2LMCA 2R61A 2A4ZA 3PPAA 4XYCA 1FIQA 1FNUA 4I6LB 3I57A 3AE4B 2L00B 1NBFC 4RFBA 1GC6A 1SIFA 1XCTL 2GBRA 1T0YA 3GS2A 1F77A 3IBEA 5CHFA 1JROA 2KX3A 2JRIB 2EMTA 2LHEA 4B95A 4HWIB 3NZUA 1B1ZA 3IT6B 5AUKA 1OQRA 4AOFA 1T5XD 1PFDA 1I4XA 2CHXA 2WU2B 1NI2A 2NS5A 4YSZB 1D3ZA 5MPOA 2VZKD 1F2RI 1ISNA 1L7YA 2YLMA 2V4LA 4XWWA 1Y8RC 5LLIA 4JX1C 3ONSA 2BVCA 3LJ3A 4HDQA 1P7FA 5AZHA 2ZNVC 1SF0A 4DXFA 3H1UA 3P4RB 3LXFA 2BGFA 3P4QB 3PLUA 2BT6A 1DGJA 3X0WA 4Q2JA 2BS2B 2N9PC 4MDKE 1X1MA 1EWYC 3L13A 1E8YA 2W3RA 1L5PA 3SR6A 3ZTCA 1JRPA 1V6EA 2IPKD 2RD0A 1YQ3B 2NPTB 2RR9A 1UELA 3PREA 1K51A 4K3BA 2ZPNA 1SBBB 1UGJA 4FJZA 2J4XA 1DYQA 1TZOA 2QMTA 1P7EA 2KZRA 3RUIB 4EZLA 1ET9A 4W9EA 2JZZA
chains in the Genus database with same CATH topology
1WGYA 1P98A 2CU1A 2D2QA 4JL9A 3VH4B 2JT4B 1EO6A 2R2QA 4IG7B 2WDTB 3M95A 2V1YA 3A9KB 3L10B 2LI5A 5J2RA 1E90A 3QARA 4II3B 4TQ1A 5L83A 4MJSA 3PRZA 3QCAA 4ANUA 4RMAA 4G11A 3UIOB 4IM0A 3OJ4B 4LDTB 1UD7A 4WJPA 4W9KA 2M17A 1WM2A 2KWCA 5E6NA 3TL5A 1EUVB 2XK5B 3ZDMC 3DBSA 3VVWB 1WR6E 4ASWC 2NCNA 1WGDA 4BVUC 2LVOA 2ASQA 4FJYA 4W9GA 2IZVB 4PS8A 1WZ0A 2YVCA 3TBLD 1TTNA 1WMHB 4KSKC 3VXWA 2KO3A 3RULA 4BKTA 3N32A 2CHWA 2KOXA 3A9KA 1WGGA 3VFKA 5GMVA 2C7HA 2M0XA 2UWQA 3V61A 4BFRA 1J19A 3HM6X 4DHZB 4IW0A 2K25A 4DK5A 4GDKB 4GXBA 5J18A 1YIWA 4EFOA 2N9XA 2ZPYA 2JWZA 1OGWA 1WY8A 4W9FA 4A20A 2GBKA 3WA0A 1XT9B 2KDEB 3W1SC 1WX9A 4II2B 5AZFA 2LD9A 3PV1A 4GDKA 5D94A 1UGMA 3PZDA 3L17A 3L54A 1IYFA 1GNUA 5LXIB 4JIOU 3A9JB 1V80A 3WANA 2KKCA 1WMHA 2VRRB 3DVGX 2RPQA 4MGIE 4NNJB 4WWPA 1C3TA 3A1QA 3NS8A 4GMVA 2JUOA 1K8RB 1YD8U 2MBEA 4ANVA 3RD2A 3UINB 3WALA 4HVBA 1WIAA 3PGEA 4XC2A 2K6DB 5BO4B 4JLCA 2JRHA 2O2VB 3KYDD 4W9LA 4LJOB 5DPWA 2O6VB 2LZ6A 3VUXA 2D3GA 1RFAA 3B08A 2C9WB 3JYUA 4EZJA 2OJRA 1WM3A 4CHKA 4F1SA 4RM8A 1TGZB 2KX0A 4GDLA 4W9DA 1J0GA 2DYOA 4FLHA 4I6NB 2JF5A 4IWPA 4K81A 4ZRJA 5AZGA 4FA6A 4URKA 2KMCA 4CYEA 4BBNC 1CMXB 2HTHA 1V81A 3VDZA 1LFDA 2K8HA 1JRUA 2J0JA 1EF1A 2KC2A 1H4RA 1WJ4A 4EKUA 5EDSA 3RCZA 2B3AA 3VHTC 1E7VA 2KFKB 2DZJA 4HPMB 2GMIC 1WGRA 3KVFB 4PS3A 2J7QB 4AJWA 4F7ZA 1WJ6A 4OVUA 4JGHB 3VAWA 2KFJA 1AARA 4GDLB 4K7UA 3HK0A 3UIPB 2NVUI 2QHOA 3SD5A 4BOSC 3S2AA 2NPTA 2KJRA 2FAZA 2XBBC 4IM3A 5D2MB 4MGZE 5IA7A 4DBGA 3DCGA 3H9DA 4KVGB 2ZCCA 3WAPA 2KJHB 2LXAA 1E8XA 1Q1OA 4KDIC 2ZZPB 3ZIMA 3KYCD 3APCA 3DVGY 2KK8A 4GOCA 2BWES 3Q3JA 2C7MB 3QK0A 2EKEC 3TIXA 3ZNID 1G6JA 2J0MA 3QIJA 2V3SA 2LGYA 3CSFA 3U30A 3V6EB 2KJ6A 4E74A 2N7DA 2PJHA 2LJ5A 4HLEA 3IHPC 2GBJA 2WWZA 3DOWA 4KSLC 4B9KA 2JXXA 4MSQB 5JH5C 2WYQA 1LXDA 4EUTA 1KOTA 1ZW7A 3OJ3A 5TR5A 3ZTDA 3V62A 3A9JA 2LVPA 2D10A 4MGYE 3ZUNA 5DCNA 2N7EA 3L08A 4JQWC 1QZEA 3M3JA 5DPSA 3W1YA 3PHXB 3QHTA 3RYTA 4GIVA 2KC1A 1XD3B 2MW5A 2L76A 1BT0A 5C23A 4A3PA 1Q5WB 3JW0X 2Z0EB 1SE9A 4WJQA 3X23A 4BOZB 1U4AA 3QWZB 3VQIA 1C1YB 3B1LX 3PT2B 2C5LC 2LVQA 2EMSA 3DBLI 3Q3FA 2DYBA 2CR5A 3KW5B 3QQ8B 1OTRB 3CMMB 4AUQC 2KLGA 3EFUA 3DPDA 4GU2A 5L95C 3R7QA 3DVNV 4NQKE 2LGXA 4FHKA 3U7DA 3JVZX 2G4DB 4MH0E 3DVNU 3UQAA 4GN1A 1NDDA 3H7PB 1UBIA 1YJ1A 3MTNB 3W1SA 2MP2B 2XK5A 5DPRA 5HKHA 4IUMB 1YX6B 3AU4A 4W9IA 3M63B 1S1QB 1UBQA 3R66C 2MQJA 5CHVC 1J8CA 4KZCA 4W9HA 3DBRI 4IM2A 3NOBA 1LM8B 2FNJB 4WWNA 3NY5A 3H7PA 4NPNA 3HHMA 4MJSB 1Q0WB 2KXJA 3WAOA 3U8ZA 4A3OA 3UQBA 2CHZA 3VTUA 4BKSA 2I1KA 2KMAA 4ICVA 4WQOB 2DHZA 3LDZE 3OLMD 2G45B 3VH3B 1LQBA 4GSWA 1R4NI 1E7UA 1A5RA 4KZ0A 2KTRA 4PYZA 3R7RA 1R4MI 4G50A 4LJPB 3KUZA 3L0WB 3KH0A 4TV3A 5E6PA 2MSED 3JSVB 4G3XB 3B0AA 3DQVA 1OEYA 3PHWB 5AEKB 4NAWB 1UZXB 2D07B 2MCNB 2ZEQA 1RRBA 3EECA 5JHAA 2IO3B 3MHSD 4B6WA 3HIZA 4KIKB 3QAQA 2KANA 2JVCA 4W9JA 1MG8A 2MA9B 4NJ7A 1RLFA 1WJNA 3PTFC 4M8NA 4E3CA 3ZW3A 2DZMA 4ZRKA 5JZEB 2PE6B 2G3QB 2DX5B 2FCQA 2J0KA 4WWOA 3RT3B 3ZNGC 3O65B 4HDOA 2KDIA 3PRPB 4TKNA 2FCNA 2BPSA 1RAXA 2KNBA 2WX1A 2MBOA 2MWSB 4FJVB 1KM7A 4GB9A 3H7SA 3ML9A 4FBJB 4EEWA 1WYWB 4W9CA 4WJOA 2LUEA 1V2YA 2K39A 1WX7A 4ICUA 4MEMA 3KUDB 1WRDB 3AU5A 2CKHB 2L0FA 3IVFA 2UYZB 2HE7A 5D6JB 4MM3A 2IY0B 4IC7B 5D7GA 3SU8X 1IPGA 3QA8A 2KDFB 2AYOB 3RZFA 3WAMA 1IP9A 5LXHA 3I3TB 3V60A 2K6QA 2M1MA 1GC7A 2L05A 2DZKA 2G4SA 1P0RA 2KTFA 2IO1B 2MX2A 3A33B 5DPTA 3T9LA 3ZNZB 2C60A 2CS4A 2IBIB 1OQYA 1P1AA 4MELA 2N4FA 5JHBA 4K1RB 1V5OA 3NHEB 4DWFA 3BY4B 2DYMA 3HM3A 3CSTA 2BYFA 2KTRB 3N30A 3T8MA 2LRUA 1ZGUB 4BKGA 4ANXA 5IAAC 2WX0A 2M4NA 1F9JA 4EZKA 4FADA 2GBMA 3ENEA 3KUCB 3ZDTA 4XX5A 3APFA 3ZKJC 3APDA 2KLCA 2C7NB 2W9NA 1V5TA 2KWUB 2Y5BB 2R2OA 3K9OB 3V6CB 2IY1B 4NQLB 4HCNB 2O6VA 2ZJDA 4WJNA 3CF6E 4ZRIA 4J6IA 5E6OA 2O2VA 5KHOA 2ZCBA 3A4SC 2KDBA 2DZIA 2NBUA 1I42A 3PSEB 3IFWB 3UF8A 1WE7A 4EOYA 3ML8A 2MP2A 2BKRB 2GOWA 3C0RB 2N9EB 3ALBA 2BWFA 2D11A 2FCMA 2AWTA 2N1VA 2XEWA 3ZVVA 1WXAA 4M0WB 3AULA 1E8WA 4NJ6A 4AP4C 1WF9A 1WXVA 2L8JA 2REXA 4BBNF 1WR1A 2KHWB 3AXCA 4KIKA 4PYUA 4XZ4A 5KHQA 1TBEA 3DDCB 3PVLA 1VCBA 3VTWA 4DDGD 1EF5A 3A4RA 4HXDA 3PS6A 3QJZA 3SHQA 4FN2A 2KQSA 4CO7A 3ZRCA 1UH6A 4OVVA 4BKSD 3L16A 1WX8A 4NAWA 2I1JA 2OOBB 3EHVA 2A4ZA 3JSVA 3PPAA 2M8SA 1FXTB 1Z5SB 4ZYNA 4N9F4 4X57B 2GBNA 1H8CA 2BYEA 2ZNVB 3QC8B 4KV2A 4I6LB 2MLBA 1WZ3A 2FIFA 3OAWA 2L00B 4RM9A 1GJZA 2MRPA 1NBFC 2HJ8A 1GC6A 1SIFA 2DAFA 2JPHA 2GBRA 4WAAA 4AJYB 1T0YA 1KLVA 3IBEA 5CHFA 2KX3A 2L3ZA 2JRIB 3D32A 2EMTA 1P3QU 4HCPB 4MSMB 2ZVNA 4GGQA 3EC8A 4B95A 2JZ3B 1SGHA 3AI5A 3N3KB 4HWIB 3NZUA 1KJTA 5CTRC 3IG3A 5G2NA 2LASA 3PLVA 2NBWB 1L2NA 4AOFA 1WE6A 3RZWC 2DENB 3VUYA 5CHWA 1HE8A 3ECIA 4LDTD 3K9PB 3TCAA 2AL6A 3MJWA 1WH3A 2L0TA 3R3MA 2L7RA 1PQSA 2CHXA 2KD0A 1NI2A 3TMPB 3VTVA 4NY0A 2AEHA 2NS5A 4DHJD 1D3ZA 3TJPA 1GG3A 5CX3A 3BINA 1P9DU 2FUHB 5G55A 1ISNA 1L7YA 2YLMA 4LCDE 3WIMA 2V4LA 3ZNHB 1Y8RC 2PE9A 2IYDB 5LLIA 4I6PA 1WGHA 1GUAB 2PPHA 2NR2A 3ONSA 2ZVOA 1V9JA 2K8BA 2Z59B 3LJ3A 4HDQA 2K8CA 2NBVB 1E5WA 5AZHA 2ZNVC 4HJKA 4K7WA 3ZRFA 4DHZE 3GOEA 3H1UA 2PEAA 2BKFA 1OEYJ 2KVRA 2MBQA 2BGFA 3SDLC 2LRWA 2Z0DB 1XQQA 4M8MA 1WXMA 3PLUA 4HK2A 1I35A 4DXAB 5FR6A 2N1WA 1V49A 1YX5B 4DDID 3X0WA 3DBHI 2N9PC 1E8ZA 2DAJA 4IWOA 4E71A 4DHJB 2LGDA 2AL3A 4G0NB 3ZLZA 4MDKE 1WJUA 1X1MA 2LXCA 4TQ0A 3P2BA 5C1ZA 3L13A 3ZO5B 4ZDVA 4IWQA 4K7SA 4PS7A 1WXSA 4HPLB 2BF8B 3PRMB 2FCSA 2FIDA 1E8YA 1WFYA 2MBBB 2KWVB 1TZ1A 3A1QB 4AWJA 3M62B 2HD5B 1M94A 3ZTCA 5J17A 1V6EA 4FHJA 2RD0A 2KQ7A 2LWPA 2A5UA 2NPTB 2O6VD 1YQBA 2RR9A 2K1FA 1V86A 3GZNI 1UELA 3PREA 2RGFA 4YL8A 3QX1A 4TUUA 4P7IA 2IO0B 2KN5A 2MBHA 3UGBB 1ZKHA 2ZPNA 4MGKE 4ANWA 4FULA 2JY6A 1WI0A 2KFKA 3NZSA 4FJZA 3H6NA 4KDLB 2BYVE 1Z2MA 2IO2B 2RSUA 3VUWA 2KZRA 3RUIB 4EZLA 4F8CB 4W9EA 2JZZA 1VD2A 1S3SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGY A;  1P98 A;  2CU1 A;  2D2Q A;  4JL9 A;  3VH4 B;  2JT4 B;  1EO6 A;  2R2Q A;  4IG7 B;  2WDT B;  3M95 A;  2V1Y A;  3A9K B;  3L10 B;  2LI5 A;  5J2R A;  1E90 A;  3QAR A;  4II3 B;  4TQ1 A;  5L83 A;  4MJS A;  3PRZ A;  3QCA A;  4ANU A;  4RMA A;  4G11 A;  3UIO B;  4IM0 A;  3OJ4 B;  4LDT B;  1UD7 A;  4WJP A;  4W9K A;  2M17 A;  1WM2 A;  2KWC A;  5E6N A;  3TL5 A;  1EUV B;  2XK5 B;  3ZDM C;  3DBS A;  3VVW B;  1WR6 E;  4ASW C;  2NCN A;  1WGD A;  4BVU C;  2LVO A;  2ASQ A;  4FJY A;  4W9G A;  2IZV B;  4PS8 A;  1WZ0 A;  2YVC A;  3TBL D;  1TTN A;  1WMH B;  4KSK C;  3VXW A;  2KO3 A;  3RUL A;  4BKT A;  3N32 A;  2CHW A;  2KOX A;  3A9K A;  1WGG A;  3VFK A;  5GMV A;  2C7H A;  2M0X A;  2UWQ A;  3V61 A;  4BFR A;  1J19 A;  3HM6 X;  4DHZ B;  4IW0 A;  2K25 A;  4DK5 A;  4GDK B;  4GXB A;  5J18 A;  1YIW A;  4EFO A;  2N9X A;  2ZPY A;  2JWZ A;  1OGW A;  1WY8 A;  4W9F A;  4A20 A;  2GBK A;  3WA0 A;  1XT9 B;  2KDE B;  3W1S C;  1WX9 A;  4II2 B;  5AZF A;  2LD9 A;  3PV1 A;  4GDK A;  5D94 A;  1UGM A;  3PZD A;  3L17 A;  3L54 A;  1IYF A;  1GNU A;  5LXI B;  4JIO U;  3A9J B;  1V80 A;  3WAN A;  2KKC A;  1WMH A;  2VRR B;  3DVG X;  2RPQ A;  4MGI E;  4NNJ B;  4WWP A;  1C3T A;  3A1Q A;  3NS8 A;  4GMV A;  2JUO A;  1K8R B;  1YD8 U;  2MBE A;  4ANV A;  3RD2 A;  3UIN B;  3WAL A;  4HVB A;  1WIA A;  3PGE A;  4XC2 A;  2K6D B;  5BO4 B;  4JLC A;  2JRH A;  2O2V B;  3KYD D;  4W9L A;  4LJO B;  5DPW A;  2O6V B;  2LZ6 A;  3VUX A;  2D3G A;  1RFA A;  3B08 A;  2C9W B;  3JYU A;  4EZJ A;  2OJR A;  1WM3 A;  4CHK A;  4F1S A;  4RM8 A;  1TGZ B;  2KX0 A;  4GDL A;  4W9D A;  1J0G A;  2DYO A;  4FLH A;  4I6N B;  2JF5 A;  4IWP A;  4K81 A;  4ZRJ A;  5AZG A;  4FA6 A;  4URK A;  2KMC A;  4CYE A;  4BBN C;  1CMX B;  2HTH A;  1V81 A;  3VDZ A;  1LFD A;  2K8H A;  1JRU A;  2J0J A;  1EF1 A;  2KC2 A;  1H4R A;  1WJ4 A;  4EKU A;  5EDS A;  3RCZ A;  2B3A A;  3VHT C;  1E7V A;  2KFK B;  2DZJ A;  4HPM B;  2GMI C;  1WGR A;  3KVF B;  4PS3 A;  2J7Q B;  4AJW A;  4F7Z A;  1WJ6 A;  4OVU A;  4JGH B;  3VAW A;  2KFJ A;  1AAR A;  4GDL B;  4K7U A;  3HK0 A;  3UIP B;  2NVU I;  2QHO A;  3SD5 A;  4BOS C;  3S2A A;  2NPT A;  2KJR A;  2FAZ A;  2XBB C;  4IM3 A;  5D2M B;  4MGZ E;  5IA7 A;  4DBG A;  3DCG A;  3H9D A;  4KVG B;  2ZCC A;  3WAP A;  2KJH B;  2LXA A;  1E8X A;  1Q1O A;  4KDI C;  2ZZP B;  3ZIM A;  3KYC D;  3APC A;  3DVG Y;  2KK8 A;  4GOC A;  2BWE S;  3Q3J A;  2C7M B;  3QK0 A;  2EKE C;  3TIX A;  3ZNI D;  1G6J A;  2J0M A;  3QIJ A;  2V3S A;  2LGY A;  3CSF A;  3U30 A;  3V6E B;  2KJ6 A;  4E74 A;  2N7D A;  2PJH A;  2LJ5 A;  4HLE A;  3IHP C;  2GBJ A;  2WWZ A;  3DOW A;  4KSL C;  4B9K A;  2JXX A;  4MSQ B;  5JH5 C;  2WYQ A;  1LXD A;  4EUT A;  1KOT A;  1ZW7 A;  3OJ3 A;  5TR5 A;  3ZTD A;  3V62 A;  3A9J A;  2LVP A;  2D10 A;  4MGY E;  3ZUN A;  5DCN A;  2N7E A;  3L08 A;  4JQW C;  1QZE A;  3M3J A;  5DPS A;  3W1Y A;  3PHX B;  3QHT A;  3RYT A;  4GIV A;  2KC1 A;  1XD3 B;  2MW5 A;  2L76 A;  1BT0 A;  5C23 A;  4A3P A;  1Q5W B;  3JW0 X;  2Z0E B;  1SE9 A;  4WJQ A;  3X23 A;  4BOZ B;  1U4A A;  3QWZ B;  3VQI A;  1C1Y B;  3B1L X;  3PT2 B;  2C5L C;  2LVQ A;  2EMS A;  3DBL I;  3Q3F A;  2DYB A;  2CR5 A;  3KW5 B;  3QQ8 B;  1OTR B;  3CMM B;  4AUQ C;  2KLG A;  3EFU A;  3DPD A;  4GU2 A;  5L95 C;  3R7Q A;  3DVN V;  4NQK E;  2LGX A;  4FHK A;  3U7D A;  3JVZ X;  2G4D B;  4MH0 E;  3DVN U;  3UQA A;  4GN1 A;  1NDD A;  3H7P B;  1UBI A;  1YJ1 A;  3MTN B;  3W1S A;  2MP2 B;  2XK5 A;  5DPR A;  5HKH A;  4IUM B;  1YX6 B;  3AU4 A;  4W9I A;  3M63 B;  1S1Q B;  1UBQ A;  3R66 C;  2MQJ A;  5CHV C;  1J8C A;  4KZC A;  4W9H A;  3DBR I;  4IM2 A;  3NOB A;  1LM8 B;  2FNJ B;  4WWN A;  3NY5 A;  3H7P A;  4NPN A;  3HHM A;  4MJS B;  1Q0W B;  2KXJ A;  3WAO A;  3U8Z A;  4A3O A;  3UQB A;  2CHZ A;  3VTU A;  4BKS A;  2I1K A;  2KMA A;  4ICV A;  4WQO B;  2DHZ A;  3LDZ E;  3OLM D;  2G45 B;  3VH3 B;  1LQB A;  4GSW A;  1R4N I;  1E7U A;  1A5R A;  4KZ0 A;  2KTR A;  4PYZ A;  3R7R A;  1R4M I;  4G50 A;  4LJP B;  3KUZ A;  3L0W B;  3KH0 A;  4TV3 A;  5E6P A;  2MSE D;  3JSV B;  4G3X B;  3B0A A;  3DQV A;  1OEY A;  3PHW B;  5AEK B;  4NAW B;  1UZX B;  2D07 B;  2MCN B;  2ZEQ A;  1RRB A;  3EEC A;  5JHA A;  2IO3 B;  3MHS D;  4B6W A;  3HIZ A;  4KIK B;  3QAQ A;  2KAN A;  2JVC A;  4W9J A;  1MG8 A;  2MA9 B;  4NJ7 A;  1RLF A;  1WJN A;  3PTF C;  4M8N A;  4E3C A;  3ZW3 A;  2DZM A;  4ZRK A;  5JZE B;  2PE6 B;  2G3Q B;  2DX5 B;  2FCQ A;  2J0K A;  4WWO A;  3RT3 B;  3ZNG C;  3O65 B;  4HDO A;  2KDI A;  3PRP B;  4TKN A;  2FCN A;  2BPS A;  1RAX A;  2KNB A;  2WX1 A;  2MBO A;  2MWS B;  4FJV B;  1KM7 A;  4GB9 A;  3H7S A;  3ML9 A;  4FBJ B;  4EEW A;  1WYW B;  4W9C A;  4WJO A;  2LUE A;  1V2Y A;  2K39 A;  1WX7 A;  4ICU A;  4MEM A;  3KUD B;  1WRD B;  3AU5 A;  2CKH B;  2L0F A;  3IVF A;  2UYZ B;  2HE7 A;  5D6J B;  4MM3 A;  2IY0 B;  4IC7 B;  5D7G A;  3SU8 X;  1IPG A;  3QA8 A;  2KDF B;  2AYO B;  3RZF A;  3WAM A;  1IP9 A;  5LXH A;  3I3T B;  3V60 A;  2K6Q A;  2M1M A;  1GC7 A;  2L05 A;  2DZK A;  2G4S A;  1P0R A;  2KTF A;  2IO1 B;  2MX2 A;  3A33 B;  5DPT A;  3T9L A;  3ZNZ B;  2C60 A;  2CS4 A;  2IBI B;  1OQY A;  1P1A A;  4MEL A;  2N4F A;  5JHB A;  4K1R B;  1V5O A;  3NHE B;  4DWF A;  3BY4 B;  2DYM A;  3HM3 A;  3CST A;  2BYF A;  2KTR B;  3N30 A;  3T8M A;  2LRU A;  1ZGU B;  4BKG A;  4ANX A;  5IAA C;  2WX0 A;  2M4N A;  1F9J A;  4EZK A;  4FAD A;  2GBM A;  3ENE A;  3KUC B;  3ZDT A;  4XX5 A;  3APF A;  3ZKJ C;  3APD A;  2KLC A;  2C7N B;  2W9N A;  1V5T A;  2KWU B;  2Y5B B;  2R2O A;  3K9O B;  3V6C B;  2IY1 B;  4NQL B;  4HCN B;  2O6V A;  2ZJD A;  4WJN A;  3CF6 E;  4ZRI A;  4J6I A;  5E6O A;  2O2V A;  5KHO A;  2ZCB A;  3A4S C;  2KDB A;  2DZI A;  2NBU A;  1I42 A;  3PSE B;  3IFW B;  3UF8 A;  1WE7 A;  4EOY A;  3ML8 A;  2MP2 A;  2BKR B;  2GOW A;  3C0R B;  2N9E B;  3ALB A;  2BWF A;  2D11 A;  2FCM A;  2AWT A;  2N1V A;  2XEW A;  3ZVV A;  1WXA A;  4M0W B;  3AUL A;  1E8W A;  4NJ6 A;  4AP4 C;  1WF9 A;  1WXV A;  2L8J A;  2REX A;  4BBN F;  1WR1 A;  2KHW B;  3AXC A;  4KIK A;  4PYU A;  4XZ4 A;  5KHQ A;  1TBE A;  3DDC B;  3PVL A;  1VCB A;  3VTW A;  4DDG D;  1EF5 A;  3A4R A;  4HXD A;  3PS6 A;  3QJZ A;  3SHQ A;  4FN2 A;  2KQS A;  4CO7 A;  3ZRC A;  1UH6 A;  4OVV A;  4BKS D;  3L16 A;  1WX8 A;  4NAW A;  2I1J A;  2OOB B;  3EHV A;  2A4Z A;  3JSV A;  3PPA A;  2M8S A;  1FXT B;  1Z5S B;  4ZYN A;  4N9F 4;  4X57 B;  2GBN A;  1H8C A;  2BYE A;  2ZNV B;  3QC8 B;  4KV2 A;  4I6L B;  2MLB A;  1WZ3 A;  2FIF A;  3OAW A;  2L00 B;  4RM9 A;  1GJZ A;  2MRP A;  1NBF C;  2HJ8 A;  1GC6 A;  1SIF A;  2DAF A;  2JPH A;  2GBR A;  4WAA A;  4AJY B;  1T0Y A;  1KLV A;  3IBE A;  5CHF A;  2KX3 A;  2L3Z A;  2JRI B;  3D32 A;  2EMT A;  1P3Q U;  4HCP B;  4MSM B;  2ZVN A;  4GGQ A;  3EC8 A;  4B95 A;  2JZ3 B;  1SGH A;  3AI5 A;  3N3K B;  4HWI B;  3NZU A;  1KJT A;  5CTR C;  3IG3 A;  5G2N A;  2LAS A;  3PLV A;  2NBW B;  1L2N A;  4AOF A;  1WE6 A;  3RZW C;  2DEN B;  3VUY A;  5CHW A;  1HE8 A;  3ECI A;  4LDT D;  3K9P B;  3TCA A;  2AL6 A;  3MJW A;  1WH3 A;  2L0T A;  3R3M A;  2L7R A;  1PQS A;  2CHX A;  2KD0 A;  1NI2 A;  3TMP B;  3VTV A;  4NY0 A;  2AEH A;  2NS5 A;  4DHJ D;  1D3Z A;  3TJP A;  1GG3 A;  5CX3 A;  3BIN A;  1P9D U;  2FUH B;  5G55 A;  1ISN A;  1L7Y A;  2YLM A;  4LCD E;  3WIM A;  2V4L A;  3ZNH B;  1Y8R C;  2PE9 A;  2IYD B;  5LLI A;  4I6P A;  1WGH A;  1GUA B;  2PPH A;  2NR2 A;  3ONS A;  2ZVO A;  1V9J A;  2K8B A;  2Z59 B;  3LJ3 A;  4HDQ A;  2K8C A;  2NBV B;  1E5W A;  5AZH A;  2ZNV C;  4HJK A;  4K7W A;  3ZRF A;  4DHZ E;  3GOE A;  3H1U A;  2PEA A;  2BKF A;  1OEY J;  2KVR A;  2MBQ A;  2BGF A;  3SDL C;  2LRW A;  2Z0D B;  1XQQ A;  4M8M A;  1WXM A;  3PLU A;  4HK2 A;  1I35 A;  4DXA B;  5FR6 A;  2N1W A;  1V49 A;  1YX5 B;  4DDI D;  3X0W A;  3DBH I;  2N9P C;  1E8Z A;  2DAJ A;  4IWO A;  4E71 A;  4DHJ B;  2LGD A;  2AL3 A;  4G0N B;  3ZLZ A;  4MDK E;  1WJU A;  1X1M A;  2LXC A;  4TQ0 A;  3P2B A;  5C1Z A;  3L13 A;  3ZO5 B;  4ZDV A;  4IWQ A;  4K7S A;  4PS7 A;  1WXS A;  4HPL B;  2BF8 B;  3PRM B;  2FCS A;  2FID A;  1E8Y A;  1WFY A;  2MBB B;  2KWV B;  1TZ1 A;  3A1Q B;  4AWJ A;  3M62 B;  2HD5 B;  1M94 A;  3ZTC A;  5J17 A;  1V6E A;  4FHJ A;  2RD0 A;  2KQ7 A;  2LWP A;  2A5U A;  2NPT B;  2O6V D;  1YQB A;  2RR9 A;  2K1F A;  1V86 A;  3GZN I;  1UEL A;  3PRE A;  2RGF A;  4YL8 A;  3QX1 A;  4TUU A;  4P7I A;  2IO0 B;  2KN5 A;  2MBH A;  3UGB B;  1ZKH A;  2ZPN A;  4MGK E;  4ANW A;  4FUL A;  2JY6 A;  1WI0 A;  2KFK A;  3NZS A;  4FJZ A;  3H6N A;  4KDL B;  2BYV E;  1Z2M A;  2IO2 B;  2RSU A;  3VUW A;  2KZR A;  3RUI B;  4EZL A;  4F8C B;  4W9E A;  2JZZ A;  1VD2 A;  1S3S G; 
#chains in the Genus database with same CATH topology
 4JL9 A;  3RFZ B;  3DWM A;  2WDT B;  3A9K B;  5IOI A;  3TEZ A;  1ZXI A;  1VDV A;  3FIL A;  4ANU A;  2KAC A;  4IM0 A;  2NTS A;  4M00 A;  4LDT B;  5IN7 A;  1XLP A;  2WP9 B;  2WU5 B;  2DNF A;  2WXM A;  1HA5 A;  1QOF A;  3ZDM C;  1VLB A;  1WR6 E;  2NCN A;  4BVU C;  3FIL B;  4FJY A;  4W9G A;  2IZV B;  3TBL D;  4BKT A;  3N32 A;  2CHW A;  2KOX A;  3A9K A;  5GMV A;  2M0X A;  3HM6 X;  2K25 A;  1J7C A;  4GXB A;  5D3I B;  3NVY A;  4RF0 A;  3PO0 A;  2JWZ A;  4W9F A;  2GBK A;  3WA0 A;  2KDE B;  4II2 B;  5AZF A;  1JML A;  4GDK A;  2H88 B;  1WYG A;  1UGM A;  3L17 A;  3R2T A;  4HPP A;  4JIO U;  4OZC A;  5G5H A;  3WAN A;  2VRR B;  2RPQ A;  2OJW A;  1BML C;  1EWC A;  1SE2 A;  3NS8 A;  5IO9 A;  2LGS A;  1YD8 U;  4A8X C;  4HVB A;  1WIA A;  4JLC A;  1JWA D;  4W9L A;  1TS2 A;  3W5V B;  5BYQ A;  1FXA A;  1TT5 B;  1ZXH A;  2LZ6 A;  3MC8 A;  2N0S B;  1WGK A;  2I38 A;  4CHK A;  4F1S A;  4W9D A;  1I4G A;  1D6E C;  4ZRJ A;  4RNA A;  4RGT A;  4URK A;  4BBN C;  1UUP A;  1L4D B;  3VDZ A;  3TEX A;  2KC2 A;  2EKI A;  1STE A;  5EE0 A;  3I5J C;  2L83 A;  2WS3 B;  3NVW A;  1JW9 D;  1HQR D;  2LEK A;  3HK0 A;  4BOS C;  1RM6 C;  2WDQ B;  4IM3 A;  5EE1 A;  3WAP A;  4KVG B;  2ZCC A;  2BW2 A;  2LXA A;  1RFK A;  3NVV A;  1Q1O A;  1HEZ E;  2C7M B;  3Q3O C;  1C9F A;  1V97 A;  1FEH A;  1FM0 D;  2INP E;  1YJI A;  1L0Y B;  5JH5 C;  3BZD B;  1LXD A;  2M56 B;  1ZW7 A;  3W2D A;  2WLB A;  2FUG 1;  3L08 A;  4EE2 A;  1XD3 B;  2L76 A;  4R3D A;  1N5W A;  1Q5W B;  5AUI A;  3JW0 X;  1SE9 A;  1ZUD 2;  3QWZ B;  2VH2 A;  3E56 A;  2LVQ A;  3O13 A;  3FAH A;  4GU2 A;  1EM7 A;  3DVN V;  1LO5 D;  1NYQ A;  4MH0 E;  1YJ1 A;  5HKH A;  2MP2 B;  3IXS A;  2WXP A;  3AU4 A;  1KF6 B;  1S1Q B;  1UBQ A;  3NRZ A;  1MFW A;  1RWS A;  3DBR I;  1ZOY B;  4IM2 A;  1LM8 B;  2FNJ B;  4FXC A;  4TMA B;  2KXJ A;  3WAO A;  4BKS A;  2QIL A;  4HKQ A;  2G45 B;  3VH3 B;  1LQB A;  3AM9 A;  1A5R A;  4PYZ A;  2KTR A;  4LJP B;  3L0W B;  2OHF A;  3KH0 A;  3AED B;  3P4S B;  5E6P A;  1YJJ A;  1RRB A;  1A70 A;  1SE4 A;  4B6W A;  3HIZ A;  3DWG C;  1DOI A;  2KAN A;  2MA9 B;  3ABV B;  2KN4 A;  4M8N A;  2DZM A;  5JZE B;  4O1N A;  2DX5 B;  2FCQ A;  1AN8 A;  2WXN A;  3AE2 B;  3RT3 B;  3ZNG C;  4TKN A;  2MWS B;  3FKY A;  1V2Y A;  4M01 A;  1MVK A;  4ICU A;  3MC0 B;  2CKH B;  2L0F A;  2RMM A;  3AEF B;  1FD6 A;  2J42 A;  2BS4 B;  4IC7 B;  1F2R C;  1QOB A;  5D7G A;  3RZF A;  1E7P B;  1B9R A;  1GC7 A;  2DZK A;  2MX2 A;  5DPT A;  2C60 A;  2CS4 A;  4MEL A;  4J3O D;  1V5O A;  3IT4 B;  3HM3 A;  2PVO D;  2SEB D;  2LUM A;  1R7S A;  4EZK A;  2M4N A;  1F9J A;  4FAD A;  3ZDT A;  1QLB B;  2Y5B B;  2R2O A;  3V6C B;  2IY1 B;  4K3C A;  4HCN B;  5E6O A;  4WQM A;  1FNV A;  2DZI A;  3UF8 A;  4P16 A;  1ENF A;  2BKR B;  2GOW A;  1J7A A;  4A9A A;  4LNN A;  2BWF A;  2D11 A;  2FCM A;  3ZVV A;  3EUB 2;  4M0W B;  3AUL A;  4ZHP A;  2KHW B;  4XZ4 A;  5KHQ A;  3BK2 A;  2QDF A;  1TBE A;  3DDC B;  3A4R A;  3SHQ A;  1N62 A;  1UH6 A;  3RNB C;  3OWE B;  1HTQ A;  1Z5S B;  2BBC A;  4ZYN A;  2BYE A;  3QC8 B;  2FIF A;  1E6E B;  2N9L A;  1GJZ A;  1KLU D;  2MRP A;  1L0V B;  4HEA 1;  2WQY B;  2IJ0 A;  1EU3 A;  2KYW A;  1KLV A;  1WWT A;  2L3Z A;  2ZVN A;  2PTL A;  3N3K B;  5CTR C;  2OED A;  2LAS A;  2JX5 A;  1L2N A;  3ZJT A;  1ZE3 D;  2INC C;  4RGO S;  1HE8 A;  3KWL A;  3K9P B;  3TCA A;  1WH3 A;  1FFU A;  3TMP B;  3VTV A;  1EU4 A;  4DHJ D;  1F52 A;  1GG3 A;  1BUI C;  3BIN A;  1WXQ A;  4LCD E;  1WGH A;  4HJK A;  3DHH C;  4DHZ E;  1XEE A;  2PEA A;  1OEY J;  2MBQ A;  4JE3 B;  2LRW A;  3B2G A;  3BYY B;  4M8M A;  4MM3 B;  1UWX A;  3NUH B;  5C2T B;  4HK2 A;  1VRA B;  5FR6 A;  1YX5 B;  4IKG A;  2DAJ A;  4DHJ B;  2LGD A;  1WJU A;  4TQ0 A;  1QF6 A;  4CQN A;  4ZDV A;  1JWM D;  4PS7 A;  1J7B A;  1WXS A;  2BQQ A;  2MBB B;  4A6Q A;  1CJE A;  3ZYY X;  1TZ1 A;  3A1Q B;  2CJN A;  2V4I B;  4FHJ A;  3GP7 A;  2KQ7 A;  2WGS A;  2O6V D;  4US8 A;  2K1F A;  5H8Y E;  2RGF A;  4MGK E;  4ANW A;  4FUL A;  4ZRQ A;  2JY6 A;  3AMZ A;  3NZS A;  4UDU C;  4TSS A;  4KDL B;  2BYV E;  1Z2M A;  2IO2 B;  3VUW A;  1OQQ A;  4F8C B;  2ICI A;  4FHK A;  1S3S G;  2D2Q A;  4KKI A;  1L4Z B;  2JT4 B;  2JXT A;  2R2Q A;  3M95 A;  4YSY B;  2FE8 A;  3L10 B;  3DHI C;  1E90 A;  3QAR A;  2G9H D;  4KKJ A;  1FCC C;  4MJS A;  3QCA A;  3UIO B;  3OJ4 B;  1FRD A;  4IOI E;  4W9K A;  4A55 A;  2M17 A;  2WXH A;  3VR9 B;  1GB1 A;  1HZ5 A;  1SEB D;  2XK5 B;  3DBS A;  4ASW C;  1WGD A;  2ASQ A;  3GZN B;  2YVC A;  1TTN A;  4KSK C;  3VXW A;  2IGG A;  1WGG A;  3BII D;  5LNK 1;  1TJE A;  4GDK B;  1T0Q C;  1JWB D;  2N9X A;  2VZK B;  1PYW D;  1WY8 A;  4A20 A;  3W1S C;  1WX9 A;  2Q5W D;  2DBY A;  1FPY A;  1V80 A;  3DVG X;  4YXD B;  3AE6 B;  2PMV A;  2RDB C;  1FFV A;  2MBE A;  3RD2 A;  4XC2 A;  2QCZ A;  3HVD A;  4L2Y A;  4XWT A;  3AE5 B;  2C9W B;  2TSS A;  4LNO A;  4EZJ A;  1XXG A;  2WHI A;  2N9K A;  1J0G A;  2WXF A;  4I6N B;  2JF5 A;  4K81 A;  1FMA D;  1WSP A;  4CYE A;  1CMX B;  2JYT A;  1V81 A;  1LFD A;  2K9X A;  1JRU A;  2J0J A;  1EF1 A;  1TS4 A;  4WAF A;  2WXI A;  1H4R A;  3OG5 A;  2QC8 A;  3U7Z A;  1PUT A;  4PS3 A;  2J7Q B;  4F7Z A;  1YQ4 B;  3AE3 B;  3I9V 1;  5FK9 C;  2XNA C;  2IDY A;  4GDL B;  3UIP B;  3SD5 A;  2NPT A;  2KJR A;  2FAZ A;  5D2M B;  5IA7 A;  3DCG A;  3H9D A;  3ZIM A;  2ZZP B;  3KYC D;  3DVG Y;  4KGT A;  2BWE S;  3ZNI D;  1G6J A;  2J0M A;  3U30 A;  4C56 C;  2LGY A;  4OW0 A;  3V6E B;  3ZGZ A;  4JPS A;  1ZPS A;  4OHJ A;  1F0Z A;  2GBJ A;  2M19 A;  2JXX A;  5T8I A;  2WYQ A;  1KOT A;  3OJ3 A;  3N1Z C;  3A9J A;  2D10 A;  3W9C B;  4MGY E;  2KT7 A;  2N7E A;  4JQW C;  2RDH A;  3M3J A;  3W1Y A;  3BYT B;  1SE3 A;  2K5P A;  5C23 A;  3X23 A;  4BOZ B;  1U4A A;  3VQI A;  1C1Y B;  2C5L C;  1GPX A;  3B9J A;  3ZJV A;  4LNF A;  2ZW1 A;  2CR5 A;  3KW5 B;  2KLG A;  3DPD A;  4NQK E;  3U7D A;  3JVZ X;  3TUO A;  2N7J A;  3DVN U;  3Q69 A;  3R66 C;  2MQJ A;  2L32 A;  1HTO A;  1J8C A;  3VRB B;  3H7P A;  4NPN A;  1YMH E;  3OLM D;  3SFD B;  4GSW A;  3Q3N C;  4KZ0 A;  4G50 A;  4YSX B;  3DQV A;  1OEY A;  3PHW B;  4NAW B;  2MCN B;  2ZEQ A;  2WXL A;  1VZ7 A;  3EEC A;  2HJ1 A;  5FR3 A;  5JHA A;  4HRS A;  1OFF A;  4KIK B;  1IGD A;  1V1P B;  3QAQ A;  2Y5P A;  1AW7 A;  4W9J A;  3EGR A;  4NJ7 A;  2DWQ A;  3ZXR A;  2Y3A A;  3GE8 C;  4ZRK A;  2PE6 B;  3I63 C;  2IGD A;  4WWO A;  2W82 A;  2KDI A;  2K0P A;  1L6V A;  1C4P A;  1RAX A;  2MBO A;  1KM7 A;  3RI7 C;  3TEW A;  2KAJ A;  3ML9 A;  4FBJ B;  2J52 A;  1WYW B;  4WJO A;  2LUE A;  5BYS A;  1D5M C;  4MEM A;  1WRD B;  2D3B A;  3AU5 A;  3CWI A;  3IVF A;  4C7Y A;  1ZP0 B;  1C4A A;  2IY0 B;  4KX6 B;  3V05 A;  1SIJ A;  2KDF B;  4C4V B;  2BB5 A;  3WAM A;  5LXH A;  3I3T B;  3MFG A;  2MHJ A;  2G4S A;  2KTF A;  1K50 A;  3T9L A;  3ZNZ B;  2I2Y A;  2JWU A;  1P1A A;  1NEN B;  2N4F A;  5JHB A;  4DWF A;  1TS3 A;  3T8M A;  2LRU A;  2L52 A;  4HRO A;  4BKG A;  1SJH D;  2Z8L A;  2WX0 A;  4YTN B;  5IAA C;  1L6U A;  4XX5 A;  3ZKJ C;  2C7N B;  1IBX B;  1ET6 A;  5HG2 A;  2KWU B;  3K9O B;  4H2A A;  4NQL B;  4WJN A;  4ZRI A;  4RCO A;  2ONQ A;  2NBU A;  3PSE B;  4OZA A;  1SB3 C;  4MAC A;  1CZP A;  1DOY A;  1WRI A;  3ALB A;  3T3O A;  2AWT A;  3TEY A;  4AP4 C;  1QKZ A;  1WF9 A;  2L8J A;  1HXY D;  1WR1 A;  1TS5 A;  4HXD A;  1V1O A;  3ZRC A;  3AE8 B;  4OVV A;  4BKS D;  3L16 A;  2I1J A;  2OOB B;  1MPE A;  3JSV A;  4N59 A;  1FXT B;  4X57 B;  4S17 A;  4RM9 A;  1FXI A;  1YN3 A;  3RNC C;  2DAF A;  1NVI D;  2JPH A;  1NI3 A;  4WAA A;  4AJY B;  4HCP B;  3D32 A;  1P3Q U;  3EC8 A;  1SGH A;  1KRH A;  3IG3 A;  2W55 A;  5G2N A;  4LNI A;  2NBW B;  3KLS X;  2IND C;  3ECI A;  3ETR A;  2AQ2 B;  2QSD A;  5IKC M;  1Q10 A;  2KD0 A;  4NY0 A;  3SFE B;  3TJP A;  2K3U A;  2GB1 A;  1P9D U;  5HHD G;  3WIM A;  2PE9 A;  2IYD B;  2JYE A;  2MJE A;  4I6P A;  1GUA B;  2PPH A;  4LLG M;  2ZVO A;  2AQ1 B;  2K8B A;  2Z59 B;  4C00 A;  1CQV A;  2K8C A;  2NBV B;  4K7W A;  4RGM A;  2D5G A;  3GOE A;  3UI3 A;  2KVR A;  4XGA B;  2Z0D B;  1NYR A;  1XQQ A;  1I35 A;  4DXA B;  2N1W A;  1V49 A;  2JQR B;  4KGS A;  3DBH I;  3VR8 B;  4E71 A;  2AL3 A;  1R4N B;  1VJK A;  3ZLZ A;  3P2B A;  5C1Z A;  4IWQ A;  4K7S A;  4NZL B;  4HPL B;  2FCS A;  3N1X C;  1WFY A;  1K52 A;  2KWV B;  4AWJ A;  1KH0 A;  3HUI A;  1M94 A;  3AE1 B;  2H89 B;  2A5U A;  1YQB A;  3TSS A;  1V86 A;  4XE0 A;  3QX1 A;  5IP4 D;  1JQ4 A;  4P7I A;  3UGB B;  1ZKH A;  4DQO C;  1PGX A;  3P4P B;  2RSU A;  1VD2 A;  1WGY A;  1P98 A;  2CU1 A;  1E10 A;  2NTT A;  3VH4 B;  3MC9 A;  3N20 C;  1EO6 A;  2LFI A;  4IG7 B;  2MH7 A;  2LI5 A;  4TQ1 A;  3PRZ A;  4RMA A;  4G11 A;  1UD7 A;  4WJP A;  2YEP F;  3MHZ A;  3C19 A;  1EUV B;  3VVW B;  2XN9 C;  4WH4 A;  3HVZ A;  2JZP A;  1WZ0 A;  1WMH B;  2SAK A;  5BYR A;  2KO3 A;  1JAL A;  2UWQ A;  3V61 A;  4BFR A;  1J19 A;  2HDE A;  4DHZ B;  4IW0 A;  3B2F A;  1YIW A;  1I4Q A;  2ZPY A;  1OGW A;  3RNE C;  1XT9 B;  1PDX A;  1YN4 A;  2LD9 A;  3PV1 A;  1I4P A;  3PZD A;  1IYF A;  1GNU A;  5LXI B;  1K53 A;  4NNJ B;  1HZ6 A;  3BVG A;  1N63 A;  1AYF A;  3WAL A;  2L1A A;  5BO4 B;  2K6D B;  2O2V B;  3KYD D;  5DPW A;  2O6V B;  2PLP A;  2FBW B;  2E6X A;  2D3G A;  1RFA A;  3DBL B;  1WM3 A;  1TY0 A;  2WXG A;  4RM8 A;  2KX0 A;  4USA A;  3AE9 B;  4IWP A;  5AZG A;  4FA6 A;  1JWS D;  5D3D A;  4WIP A;  2BYT A;  1TKE A;  2WXO A;  4DXG A;  2K8H A;  4YTP B;  4P1C C;  1WJ4 A;  5EDS A;  3VHT C;  1TYG B;  2MEK A;  2KFK B;  2V3P A;  1WGR A;  3KVF B;  1WJ6 A;  1C77 A;  5E6J A;  3VAW A;  2KFJ A;  1AAR A;  2NVU I;  3S2A A;  4ZRP A;  2XBB C;  1R4M B;  4DBG A;  1LGR A;  2KJH B;  4KDI C;  3APC A;  4GOC A;  1D5Z C;  3QK0 A;  3QIJ A;  4RF1 A;  2GRI A;  2V3S A;  3CSF A;  4E74 A;  2PJH A;  3IHP C;  3DOW A;  4B9K A;  1F1H A;  4EUT A;  3Q8E A;  3ZTD A;  1TIF A;  1XCQ L;  2LVP A;  3NJT A;  2LJI A;  3ZUN A;  5DPS A;  1QZE A;  1MG4 A;  1T3Q A;  3PHX B;  4GIV A;  2MW5 A;  2Z0E B;  2M0A A;  5TSS A;  2KMM A;  2WDV B;  2WXQ A;  2EMS A;  4AUQ C;  2DYB A;  3AEG B;  3NZ3 A;  3EFU A;  5L95 C;  2QIE B;  3R7Q A;  2KQ4 X;  2G4D B;  4S0R A;  3UQA A;  1NDD A;  1IUE A;  3W1S A;  3MTN B;  5DPR A;  4IUM B;  4W9I A;  3R8B A;  5I4D A;  3M63 B;  4KGR A;  1C4C A;  5CHV C;  4W9H A;  1UNS A;  4WWN A;  3NY5 A;  4L23 A;  3UQB A;  2CHZ A;  3VTU A;  2KMA A;  4ICV A;  2DHZ A;  3LDZ E;  1R4N I;  1E7U A;  2Y5C A;  3R7R A;  5GXG B;  1R4M I;  1FCL A;  1XF5 L;  4G3X B;  3B0A A;  4N58 A;  5AEK B;  1UZX B;  2D07 B;  3RPF C;  1QT9 A;  4ACF A;  3Q8F A;  3MHS D;  1RLF A;  1WJN A;  3ZW3 A;  1DOX A;  2J0K A;  2WXJ A;  1V8C A;  3AEE B;  3PRP B;  2BPS A;  1Y56 A;  4LNK A;  2KNB A;  1E9M A;  3H7S A;  4EEW A;  4W9C A;  2K39 A;  2BTE A;  1KLG D;  2UYZ B;  3EFC A;  5D6J B;  1IPG A;  3QA8 A;  2AYO B;  3EA6 A;  4ITK A;  3V60 A;  3B1L X;  2L05 A;  2IO1 B;  4MH8 A;  3FC4 A;  1GOZ A;  4ZHO A;  4K1R B;  2BYF A;  3U4E G;  2PVG C;  1XLO A;  1ZGU B;  1AWD A;  4ANX A;  3KUC B;  3T3N A;  3BVM A;  3APD A;  2KLC A;  4HKZ E;  2W9N A;  3ZJU A;  1V5T A;  3P42 A;  3LYY A;  2O6V A;  2ZJD A;  1JCK B;  3CF6 E;  4J6I A;  2O2V A;  2ZCB A;  3A4S C;  1I42 A;  3IFW B;  3W5U B;  2N9E B;  2N1V A;  2XEW A;  4NJ6 A;  4BBN F;  3GE3 C;  1N60 A;  1L0X B;  4OZB A;  3PVL A;  2KVZ A;  3QJZ A;  4FN2 A;  2PW9 A;  1WX8 A;  2MJD A;  2IGH A;  3EHV A;  2UU7 A;  2M8S A;  2CJO A;  3L4P A;  3Q2A C;  4N9F 4;  2GBN A;  4RH6 A;  1H8C A;  2ZNV B;  3BVZ A;  4KV2 A;  4LK0 M;  2K22 A;  2MLB A;  1UF0 A;  1WZ3 A;  3OAW A;  1YOV B;  5C3J B;  4XDC A;  1I4R A;  2HJ8 A;  2RPV A;  2E3T A;  3URY A;  4MSM B;  4GGQ A;  1SJE D;  2BS3 B;  2JZ3 B;  3AI5 A;  1KJT A;  2G1E A;  3PLV A;  5JXV A;  1WE6 A;  3RZW C;  2DEN B;  3VUY A;  3AV8 A;  5CHW A;  4BZA A;  4D2K A;  2WXR A;  4LDT D;  2AL6 A;  3MJW A;  1IBX A;  2L0T A;  3WCQ A;  3R3M A;  2L7R A;  2HTM E;  1PQS A;  2X38 A;  2AEH A;  1IGC A;  3Q8C A;  1I4H A;  3AN1 A;  5CX3 A;  2FUH B;  5G55 A;  1QOA A;  3ZNH B;  2PIA A;  3VRA B;  5BMI A;  2NR2 A;  3DHG C;  2MJ3 A;  1V9J A;  1E5W A;  3J9C A;  3ZRF A;  1GB4 A;  2BKF A;  3SDL C;  4XDD A;  1WXM A;  3DBH B;  1D5X C;  4DDI D;  4LTU A;  1E8Z A;  2W54 A;  1FRR A;  4IWO A;  2LGI A;  1C78 A;  4G0N B;  3LB8 C;  2LXC A;  3P1M A;  1E0Z A;  4ARI A;  1JWU D;  3ZXV A;  3ZO5 B;  2BF8 B;  3PRM B;  4M02 A;  2FID A;  3Q6B A;  1YNT E;  1MHH E;  3M62 B;  2HD5 B;  1YN5 A;  5J17 A;  2LWP A;  4JWS C;  3GZN I;  2JU6 X;  4QAY A;  4YL8 A;  4TUU A;  2IO0 B;  2KN5 A;  2MBH A;  1WI0 A;  2KFK A;  5BMG A;  1KFY B;  3H6N A;  2NMQ A;  2WXK A;  3DBR B;  1C76 A;  1FO4 A;  1SSN A;  2RDG A;  4AS1 A;  2V1Y A;  2JSV X;  3RMK C;  5J2R A;  4II3 B;  5L83 A;  3NG0 A;  4ARC A;  4PT5 A;  1TKG A;  3PZ8 A;  2YEP B;  2ZW0 A;  4P6V F;  1WM2 A;  2KWC A;  1T6B X;  5E6N A;  3TL5 A;  3CIR B;  2EEL A;  2LVO A;  4NJC A;  3MJ5 A;  4PS8 A;  3RUL A;  3VFK A;  2C7H A;  4WWM A;  4DK5 A;  2AQ3 B;  5J18 A;  4EFO A;  2B76 B;  4ZOH C;  3AEB B;  3N1Y C;  2J53 A;  1XLQ A;  1ESF A;  5FKA C;  2D3A A;  5D94 A;  3L54 A;  3N9Y C;  5G5G A;  3A9J B;  3AH7 A;  3GB1 A;  4YWG G;  2W3S A;  2KKC A;  1WMH A;  4MGI E;  4WWP A;  1C3T A;  3A1Q A;  4GMV A;  2JUO A;  1K8R B;  4ANV A;  3UIN B;  1MJD A;  3PGE A;  4C80 A;  2JRH A;  2ON8 A;  4LJO B;  3VUX A;  3B08 A;  3JYU A;  2OJR A;  1MHX A;  3NS1 A;  2GI9 A;  1TGZ B;  4GDL A;  1ZDV A;  2DYO A;  4FLH A;  2KMC A;  2LHD A;  2HTH A;  2V9H A;  3Q3M C;  3C8Y A;  1TY2 A;  3IAS 1;  4EKU A;  2WDR B;  1PGA A;  3RCZ A;  2B3A A;  4YTM B;  1E7V A;  2DZJ A;  3P63 A;  4HPM B;  2CU3 A;  2GMI C;  4L1B A;  1T0R C;  4AJW A;  4RGN A;  4OVU A;  3ZQ4 A;  4JGH B;  4K7U A;  2QHO A;  4MT5 A;  2GLS A;  1N5X A;  1KTK A;  4MGZ E;  2D3C A;  1TKY A;  1D4B A;  1E8X A;  1NEK B;  2KK8 A;  2WNM A;  5BMH A;  3R2I A;  4B0M A;  3AEA B;  3Q3J A;  3TIX A;  2EKE C;  4US9 A;  1BXT A;  1VR9 A;  1RYJ A;  2KJ6 A;  2N7D A;  4C7Z A;  1ACC A;  2LJ5 A;  4N6E B;  4HLE A;  2WWZ A;  4KSL C;  4MSQ B;  3KQ4 A;  5TR5 A;  3SEB A;  1PGB A;  3V62 A;  3BWU D;  1V1P A;  1MI0 A;  5DCN A;  2V3N A;  1XO3 A;  3QHT A;  3RYT A;  3PZ7 A;  2KC1 A;  1BT0 A;  1T0S C;  4A3P A;  4WJQ A;  2VH1 A;  1GAQ B;  3HRD D;  3PT2 B;  2AX5 A;  3DBL I;  3Q3F A;  3QQ8 B;  1OTR B;  3CMM B;  5EE3 A;  2DLB A;  4M0W A;  2LGX A;  4HJG E;  3RN9 C;  2KWD A;  4GN1 A;  3H7P B;  1UBI A;  3NVZ A;  2XK5 A;  1YX6 B;  4KZC A;  3NOB A;  3AB5 A;  3HHM A;  1ZDX A;  1Q0W B;  4MJS B;  3U8Z A;  4A3O A;  2I1K A;  4WQO B;  2V0G A;  1M4V A;  3RNF C;  1SXT A;  3H8H A;  2KDM A;  3KUZ A;  1N6Z A;  4TV3 A;  4ZYS A;  2MSE D;  3JSV B;  5HFY A;  1C79 A;  2ACZ B;  4IDI A;  2QJL A;  2PKO A;  2IO3 B;  5EE9 A;  4REZ A;  2JVC A;  1MG8 A;  2BB6 A;  3AEC B;  3Q14 C;  3PTF C;  4E3C A;  4GLS C;  2G3Q B;  1ROE A;  3O65 B;  3RNA C;  4HDO A;  2QEJ C;  2FCN A;  4BAX A;  2WX1 A;  1VZ6 A;  4FJV B;  4GB9 A;  3U2S C;  1UWM A;  4YT0 B;  3BK1 A;  1WX7 A;  1QIL A;  3KUD B;  3U52 E;  2HE7 A;  4MM3 A;  3SU8 X;  4PK1 A;  1IP9 A;  3Q8A A;  2K6Q A;  3AE7 B;  2M1M A;  4B0E A;  3A33 B;  1P0R A;  5H92 C;  2IBI B;  1OQY A;  3NHE B;  3E9S A;  3BY4 B;  2DYM A;  3V3X A;  3CST A;  3KWV A;  4C4V A;  2KTR B;  3N30 A;  1VZ8 A;  4A90 A;  3MP9 A;  2GBM A;  3ENE A;  5HI1 A;  3APF A;  1QQR A;  4WUR A;  1XLN A;  5KHO A;  1CK1 A;  2KDB A;  1FNW A;  1I7H A;  1WE7 A;  4EOY A;  3ML8 A;  4JWU C;  2MP2 A;  3RNG C;  3C0R B;  4NAM A;  2INN E;  4OVZ A;  1WXA A;  2X8X X;  3IAM 1;  1E8W A;  1WXV A;  2REX A;  4P1B C;  4KIK A;  4PYU A;  1QOG A;  3AXC A;  4AQ7 A;  1VCB A;  3VTW A;  4DDG D;  1EF5 A;  3PS6 A;  2KQS A;  3Q8B A;  4CO7 A;  1N61 A;  4NAW A;  2LMC A;  2R61 A;  2A4Z A;  3PPA A;  4XYC A;  1FIQ A;  1FNU A;  4I6L B;  3I57 A;  3AE4 B;  2L00 B;  1NBF C;  4RFB A;  1GC6 A;  1SIF A;  1XCT L;  2GBR A;  1T0Y A;  3GS2 A;  1F77 A;  3IBE A;  5CHF A;  1JRO A;  2KX3 A;  2JRI B;  2EMT A;  2LHE A;  4B95 A;  4HWI B;  3NZU A;  1B1Z A;  3IT6 B;  5AUK A;  1OQR A;  4AOF A;  1T5X D;  1PFD A;  1I4X A;  2CHX A;  2WU2 B;  1NI2 A;  2NS5 A;  4YSZ B;  1D3Z A;  5MPO A;  2VZK D;  1F2R I;  1ISN A;  1L7Y A;  2YLM A;  2V4L A;  4XWW A;  1Y8R C;  5LLI A;  4JX1 C;  3ONS A;  2BVC A;  3LJ3 A;  4HDQ A;  1P7F A;  5AZH A;  2ZNV C;  1SF0 A;  4DXF A;  3H1U A;  3P4R B;  3LXF A;  2BGF A;  3P4Q B;  3PLU A;  2BT6 A;  1DGJ A;  3X0W A;  4Q2J A;  2BS2 B;  2N9P C;  4MDK E;  1X1M A;  1EWY C;  3L13 A;  1E8Y A;  2W3R A;  1L5P A;  3SR6 A;  3ZTC A;  1JRP A;  1V6E A;  2IPK D;  2RD0 A;  1YQ3 B;  2NPT B;  2RR9 A;  1UEL A;  3PRE A;  1K51 A;  4K3B A;  2ZPN A;  1SBB B;  1UGJ A;  4FJZ A;  2J4X A;  1DYQ A;  1TZO A;  2QMT A;  1P7E A;  2KZR A;  3RUI B;  4EZL A;  1ET9 A;  4W9E A;  2JZZ A; 
#chains in the Genus database with same CATH homology
 1WGY A;  1P98 A;  2CU1 A;  2D2Q A;  4JL9 A;  3VH4 B;  2JT4 B;  1EO6 A;  2R2Q A;  4IG7 B;  2WDT B;  3M95 A;  2V1Y A;  3A9K B;  3L10 B;  2LI5 A;  5J2R A;  1E90 A;  3QAR A;  4II3 B;  4TQ1 A;  5L83 A;  4MJS A;  3PRZ A;  3QCA A;  4ANU A;  4RMA A;  4G11 A;  3UIO B;  4IM0 A;  3OJ4 B;  4LDT B;  1UD7 A;  4WJP A;  4W9K A;  2M17 A;  1WM2 A;  2KWC A;  5E6N A;  3TL5 A;  1EUV B;  2XK5 B;  3ZDM C;  3DBS A;  3VVW B;  1WR6 E;  4ASW C;  2NCN A;  1WGD A;  4BVU C;  2LVO A;  2ASQ A;  4FJY A;  4W9G A;  2IZV B;  4PS8 A;  1WZ0 A;  2YVC A;  3TBL D;  1TTN A;  1WMH B;  4KSK C;  3VXW A;  2KO3 A;  3RUL A;  4BKT A;  3N32 A;  2CHW A;  2KOX A;  3A9K A;  1WGG A;  3VFK A;  5GMV A;  2C7H A;  2M0X A;  2UWQ A;  3V61 A;  4BFR A;  1J19 A;  3HM6 X;  4DHZ B;  4IW0 A;  2K25 A;  4DK5 A;  4GDK B;  4GXB A;  5J18 A;  1YIW A;  4EFO A;  2N9X A;  2ZPY A;  2JWZ A;  1OGW A;  1WY8 A;  4W9F A;  4A20 A;  2GBK A;  3WA0 A;  1XT9 B;  2KDE B;  3W1S C;  1WX9 A;  4II2 B;  5AZF A;  2LD9 A;  3PV1 A;  4GDK A;  5D94 A;  1UGM A;  3PZD A;  3L17 A;  3L54 A;  1IYF A;  1GNU A;  5LXI B;  4JIO U;  3A9J B;  1V80 A;  3WAN A;  2KKC A;  1WMH A;  2VRR B;  3DVG X;  2RPQ A;  4MGI E;  4NNJ B;  4WWP A;  1C3T A;  3A1Q A;  3NS8 A;  4GMV A;  2JUO A;  1K8R B;  1YD8 U;  2MBE A;  4ANV A;  3RD2 A;  3UIN B;  3WAL A;  4HVB A;  1WIA A;  3PGE A;  4XC2 A;  2K6D B;  5BO4 B;  4JLC A;  2JRH A;  2O2V B;  3KYD D;  4W9L A;  4LJO B;  5DPW A;  2O6V B;  2LZ6 A;  3VUX A;  2D3G A;  1RFA A;  3B08 A;  2C9W B;  3JYU A;  4EZJ A;  2OJR A;  1WM3 A;  4CHK A;  4F1S A;  4RM8 A;  1TGZ B;  2KX0 A;  4GDL A;  4W9D A;  1J0G A;  2DYO A;  4FLH A;  4I6N B;  2JF5 A;  4IWP A;  4K81 A;  4ZRJ A;  5AZG A;  4FA6 A;  4URK A;  2KMC A;  4CYE A;  4BBN C;  1CMX B;  2HTH A;  1V81 A;  3VDZ A;  1LFD A;  2K8H A;  1JRU A;  2J0J A;  1EF1 A;  2KC2 A;  1H4R A;  1WJ4 A;  4EKU A;  5EDS A;  3RCZ A;  2B3A A;  3VHT C;  1E7V A;  2KFK B;  2DZJ A;  4HPM B;  2GMI C;  1WGR A;  3KVF B;  4PS3 A;  2J7Q B;  4AJW A;  4F7Z A;  1WJ6 A;  4OVU A;  4JGH B;  3VAW A;  2KFJ A;  1AAR A;  4GDL B;  4K7U A;  3HK0 A;  3UIP B;  2NVU I;  2QHO A;  3SD5 A;  4BOS C;  3S2A A;  2NPT A;  2KJR A;  2FAZ A;  2XBB C;  4IM3 A;  5D2M B;  4MGZ E;  5IA7 A;  4DBG A;  3DCG A;  3H9D A;  4KVG B;  2ZCC A;  3WAP A;  2KJH B;  2LXA A;  1E8X A;  1Q1O A;  4KDI C;  2ZZP B;  3ZIM A;  3KYC D;  3APC A;  3DVG Y;  2KK8 A;  4GOC A;  2BWE S;  3Q3J A;  2C7M B;  3QK0 A;  2EKE C;  3TIX A;  3ZNI D;  1G6J A;  2J0M A;  3QIJ A;  2V3S A;  2LGY A;  3CSF A;  3U30 A;  3V6E B;  2KJ6 A;  4E74 A;  2N7D A;  2PJH A;  2LJ5 A;  4HLE A;  3IHP C;  2GBJ A;  2WWZ A;  3DOW A;  4KSL C;  4B9K A;  2JXX A;  4MSQ B;  5JH5 C;  2WYQ A;  1LXD A;  4EUT A;  1KOT A;  1ZW7 A;  3OJ3 A;  5TR5 A;  3ZTD A;  3V62 A;  3A9J A;  2LVP A;  2D10 A;  4MGY E;  3ZUN A;  5DCN A;  2N7E A;  3L08 A;  4JQW C;  1QZE A;  3M3J A;  5DPS A;  3W1Y A;  3PHX B;  3QHT A;  3RYT A;  4GIV A;  2KC1 A;  1XD3 B;  2MW5 A;  2L76 A;  1BT0 A;  5C23 A;  4A3P A;  1Q5W B;  3JW0 X;  2Z0E B;  1SE9 A;  4WJQ A;  3X23 A;  4BOZ B;  1U4A A;  3QWZ B;  3VQI A;  1C1Y B;  3B1L X;  3PT2 B;  2C5L C;  2LVQ A;  2EMS A;  3DBL I;  3Q3F A;  2DYB A;  2CR5 A;  3KW5 B;  3QQ8 B;  1OTR B;  3CMM B;  4AUQ C;  2KLG A;  3EFU A;  3DPD A;  4GU2 A;  5L95 C;  3R7Q A;  3DVN V;  4NQK E;  2LGX A;  4FHK A;  3U7D A;  3JVZ X;  2G4D B;  4MH0 E;  3DVN U;  3UQA A;  4GN1 A;  1NDD A;  3H7P B;  1UBI A;  1YJ1 A;  3MTN B;  3W1S A;  2MP2 B;  2XK5 A;  5DPR A;  5HKH A;  4IUM B;  1YX6 B;  3AU4 A;  4W9I A;  3M63 B;  1S1Q B;  1UBQ A;  3R66 C;  2MQJ A;  5CHV C;  1J8C A;  4KZC A;  4W9H A;  3DBR I;  4IM2 A;  3NOB A;  1LM8 B;  2FNJ B;  4WWN A;  3NY5 A;  3H7P A;  4NPN A;  3HHM A;  4MJS B;  1Q0W B;  2KXJ A;  3WAO A;  3U8Z A;  4A3O A;  3UQB A;  2CHZ A;  3VTU A;  4BKS A;  2I1K A;  2KMA A;  4ICV A;  4WQO B;  2DHZ A;  3LDZ E;  3OLM D;  2G45 B;  3VH3 B;  1LQB A;  4GSW A;  1R4N I;  1E7U A;  1A5R A;  4KZ0 A;  2KTR A;  4PYZ A;  3R7R A;  1R4M I;  4G50 A;  4LJP B;  3KUZ A;  3L0W B;  3KH0 A;  4TV3 A;  5E6P A;  2MSE D;  3JSV B;  4G3X B;  3B0A A;  3DQV A;  1OEY A;  3PHW B;  5AEK B;  4NAW B;  1UZX B;  2D07 B;  2MCN B;  2ZEQ A;  1RRB A;  3EEC A;  5JHA A;  2IO3 B;  3MHS D;  4B6W A;  3HIZ A;  4KIK B;  3QAQ A;  2KAN A;  2JVC A;  4W9J A;  1MG8 A;  2MA9 B;  4NJ7 A;  1RLF A;  1WJN A;  3PTF C;  4M8N A;  4E3C A;  3ZW3 A;  2DZM A;  4ZRK A;  5JZE B;  2PE6 B;  2G3Q B;  2DX5 B;  2FCQ A;  2J0K A;  4WWO A;  3RT3 B;  3ZNG C;  3O65 B;  4HDO A;  2KDI A;  3PRP B;  4TKN A;  2FCN A;  2BPS A;  1RAX A;  2KNB A;  2WX1 A;  2MBO A;  2MWS B;  4FJV B;  1KM7 A;  4GB9 A;  3H7S A;  3ML9 A;  4FBJ B;  4EEW A;  1WYW B;  4W9C A;  4WJO A;  2LUE A;  1V2Y A;  2K39 A;  1WX7 A;  4ICU A;  4MEM A;  3KUD B;  1WRD B;  3AU5 A;  2CKH B;  2L0F A;  3IVF A;  2UYZ B;  2HE7 A;  5D6J B;  4MM3 A;  2IY0 B;  4IC7 B;  5D7G A;  3SU8 X;  1IPG A;  3QA8 A;  2KDF B;  2AYO B;  3RZF A;  3WAM A;  1IP9 A;  5LXH A;  3I3T B;  3V60 A;  2K6Q A;  2M1M A;  1GC7 A;  2L05 A;  2DZK A;  2G4S A;  1P0R A;  2KTF A;  2IO1 B;  2MX2 A;  3A33 B;  5DPT A;  3T9L A;  3ZNZ B;  2C60 A;  2CS4 A;  2IBI B;  1OQY A;  1P1A A;  4MEL A;  2N4F A;  5JHB A;  4K1R B;  1V5O A;  3NHE B;  4DWF A;  3BY4 B;  2DYM A;  3HM3 A;  3CST A;  2BYF A;  2KTR B;  3N30 A;  3T8M A;  2LRU A;  1ZGU B;  4BKG A;  4ANX A;  5IAA C;  2WX0 A;  2M4N A;  1F9J A;  4EZK A;  4FAD A;  2GBM A;  3ENE A;  3KUC B;  3ZDT A;  4XX5 A;  3APF A;  3ZKJ C;  3APD A;  2KLC A;  2C7N B;  2W9N A;  1V5T A;  2KWU B;  2Y5B B;  2R2O A;  3K9O B;  3V6C B;  2IY1 B;  4NQL B;  4HCN B;  2O6V A;  2ZJD A;  4WJN A;  3CF6 E;  4ZRI A;  4J6I A;  5E6O A;  2O2V A;  5KHO A;  2ZCB A;  3A4S C;  2KDB A;  2DZI A;  2NBU A;  1I42 A;  3PSE B;  3IFW B;  3UF8 A;  1WE7 A;  4EOY A;  3ML8 A;  2MP2 A;  2BKR B;  2GOW A;  3C0R B;  2N9E B;  3ALB A;  2BWF A;  2D11 A;  2FCM A;  2AWT A;  2N1V A;  2XEW A;  3ZVV A;  1WXA A;  4M0W B;  3AUL A;  1E8W A;  4NJ6 A;  4AP4 C;  1WF9 A;  1WXV A;  2L8J A;  2REX A;  4BBN F;  1WR1 A;  2KHW B;  3AXC A;  4KIK A;  4PYU A;  4XZ4 A;  5KHQ A;  1TBE A;  3DDC B;  3PVL A;  1VCB A;  3VTW A;  4DDG D;  1EF5 A;  3A4R A;  4HXD A;  3PS6 A;  3QJZ A;  3SHQ A;  4FN2 A;  2KQS A;  4CO7 A;  3ZRC A;  1UH6 A;  4OVV A;  4BKS D;  3L16 A;  1WX8 A;  4NAW A;  2I1J A;  2OOB B;  3EHV A;  2A4Z A;  3JSV A;  3PPA A;  2M8S A;  1FXT B;  1Z5S B;  4ZYN A;  4N9F 4;  4X57 B;  2GBN A;  1H8C A;  2BYE A;  2ZNV B;  3QC8 B;  4KV2 A;  4I6L B;  2MLB A;  1WZ3 A;  2FIF A;  3OAW A;  2L00 B;  4RM9 A;  1GJZ A;  2MRP A;  1NBF C;  2HJ8 A;  1GC6 A;  1SIF A;  2DAF A;  2JPH A;  2GBR A;  4WAA A;  4AJY B;  1T0Y A;  1KLV A;  3IBE A;  5CHF A;  2KX3 A;  2L3Z A;  2JRI B;  3D32 A;  2EMT A;  1P3Q U;  4HCP B;  4MSM B;  2ZVN A;  4GGQ A;  3EC8 A;  4B95 A;  2JZ3 B;  1SGH A;  3AI5 A;  3N3K B;  4HWI B;  3NZU A;  1KJT A;  5CTR C;  3IG3 A;  5G2N A;  2LAS A;  3PLV A;  2NBW B;  1L2N A;  4AOF A;  1WE6 A;  3RZW C;  2DEN B;  3VUY A;  5CHW A;  1HE8 A;  3ECI A;  4LDT D;  3K9P B;  3TCA A;  2AL6 A;  3MJW A;  1WH3 A;  2L0T A;  3R3M A;  2L7R A;  1PQS A;  2CHX A;  2KD0 A;  1NI2 A;  3TMP B;  3VTV A;  4NY0 A;  2AEH A;  2NS5 A;  4DHJ D;  1D3Z A;  3TJP A;  1GG3 A;  5CX3 A;  3BIN A;  1P9D U;  2FUH B;  5G55 A;  1ISN A;  1L7Y A;  2YLM A;  4LCD E;  3WIM A;  2V4L A;  3ZNH B;  1Y8R C;  2PE9 A;  2IYD B;  5LLI A;  4I6P A;  1WGH A;  1GUA B;  2PPH A;  2NR2 A;  3ONS A;  2ZVO A;  1V9J A;  2K8B A;  2Z59 B;  3LJ3 A;  4HDQ A;  2K8C A;  2NBV B;  1E5W A;  5AZH A;  2ZNV C;  4HJK A;  4K7W A;  3ZRF A;  4DHZ E;  3GOE A;  3H1U A;  2PEA A;  2BKF A;  1OEY J;  2KVR A;  2MBQ A;  2BGF A;  3SDL C;  2LRW A;  2Z0D B;  1XQQ A;  4M8M A;  1WXM A;  3PLU A;  4HK2 A;  1I35 A;  4DXA B;  5FR6 A;  2N1W A;  1V49 A;  1YX5 B;  4DDI D;  3X0W A;  3DBH I;  2N9P C;  1E8Z A;  2DAJ A;  4IWO A;  4E71 A;  4DHJ B;  2LGD A;  2AL3 A;  4G0N B;  3ZLZ A;  4MDK E;  1WJU A;  1X1M A;  2LXC A;  4TQ0 A;  3P2B A;  5C1Z A;  3L13 A;  3ZO5 B;  4ZDV A;  4IWQ A;  4K7S A;  4PS7 A;  1WXS A;  4HPL B;  2BF8 B;  3PRM B;  2FCS A;  2FID A;  1E8Y A;  1WFY A;  2MBB B;  2KWV B;  1TZ1 A;  3A1Q B;  4AWJ A;  3M62 B;  2HD5 B;  1M94 A;  3ZTC A;  5J17 A;  1V6E A;  4FHJ A;  2RD0 A;  2KQ7 A;  2LWP A;  2A5U A;  2NPT B;  2O6V D;  1YQB A;  2RR9 A;  2K1F A;  1V86 A;  3GZN I;  1UEL A;  3PRE A;  2RGF A;  4YL8 A;  3QX1 A;  4TUU A;  4P7I A;  2IO0 B;  2KN5 A;  2MBH A;  3UGB B;  1ZKH A;  2ZPN A;  4MGK E;  4ANW A;  4FUL A;  2JY6 A;  1WI0 A;  2KFK A;  3NZS A;  4FJZ A;  3H6N A;  4KDL B;  2BYV E;  1Z2M A;  2IO2 B;  2RSU A;  3VUW A;  2KZR A;  3RUI B;  4EZL A;  4F8C B;  4W9E A;  2JZZ A;  1VD2 A;  1S3S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...