1WE7A

Solution structure of ubiquitin-like domain in sf3a120
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
115
Chain Sequence
b'GSSGSSGTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQGLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMASGAVIHLALKERSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sf3a1 protein
publication title Solution structure of Ubiquitin-like domain in SF3a120
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 14
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1we7A00
2BYFA 1WY8A 3TMPB 2FIDA 1WE7A 3BINA 4MJSA 2B3AA 2NBWB 2LUEA 4FJZA 5TR5A 2ASQA 2R2OA 3ECIA 4DHJB 5L83A 4HDQA 4W9FA 4ZRJA 2FCNA 2KK8A 1PQSA 2QHOA 2BWES 2IZVB 2JY6A 3OLMD 5D6JB 3TCAA 2MBOA 2GBMA 2LXAA 2BWFA 3RT3B 2EMSA 2IO3B 3SU8X 3ML8A 4W9EA 1C1YB 2MSED 4CO7A 1WX8A 5EDSA 1RAXA 1R4MI 3W1YA 1LFDA 3VH3B 1GC7A 3ZKJC 1J8CA 3L16A 4AJWA 3PRMB 3ZNGC 1WJNA 1WZ3A 3QARA 1FXTB 2JRHA 5CHFA 1OQYA 1V5OA 3P2BA 3RUIB 4BKSD 4W9IA 2K8CA 1C3TA 2LI5A 1LM8B 1V80A 3DVNV 4PS8A 3A9KA 4NNJB 4FADA 3HK0A 3QX1A 5CHWA 1Z2MA 3PREA 5C1ZA 3WAPA 4FJVB 2LGYA 3JSVA 2LVOA 1U4AA 3PSEB 4AOFA 1LQBA 3CF6E 2HE7A 3WAMA 2L0FA 2PE6B 2CKHB 2BGFA 4W9HA 3ENEA 4PYZA 2KZRA 3ZUNA 4M8NA 4RM9A 5AZGA 3CSTA 3ZTCA 3UIPB 4KDIC 3ZTDA 1WX7A 1JRUA 2I1KA 3PHXB 1ZGUB 1F9JA 2BPSA 1UBIA 2MBEA 1GNUA 2AL6A 2I1JA 3EHVA 3JYUA 4LCDE 2REXA 5AEKB 3IBEA 4PS3A 2N1VA 1V6EA 2AL3A 2KKCA 3S2AA 4MELA 1V49A 2N4FA 4JL9A 2NPTA 1WJUA 3X0WA 1XD3B 3ZW3A 1EF5A 3ONSA 4II3B 4IW0A 4HPMB 4KZCA 4WWNA 3KUCB 5AZFA 2A4ZA 2C7NB 4MGKE 1QZEA 3RZFA 3DPDA 3UF8A 3WANA 2MBHA 1GG3A 2HD5B 2D10A 1P1AA 3WA0A 2M0XA 3H9DA 2JXXA 4JGHB 1RFAA 3MHSD 3NZUA 2O6VD 4IC7B 3OJ4B 3PVLA 1P98A 3A33B 2N7EA 4TV3A 2G4DB 2CR5A 2FNJB 3DBRI 3ZIMA 1E5WA 2JUOA 3QAQA 4DXAB 1NDDA 2MA9B 1D3ZA 3RCZA 3KUZA 3W1SC 2JWZA 2Z59B 3C0RB 2ZPYA 4AJYB 4FN2A 2LRUA 4GN1A 3H6NA 4NQKE 2MQJA 2GMIC 1V81A 3DCGA 1ZKHA 4ANUA 2K8BA 4WAAA 1S3SG 2MRPA 2Y5BB 2FAZA 4GDKB 2NS5A 4HDOA 2DAFA 1Y8RC 1WF9A 2KFJA 4WJQA 1YX6B 3OAWA 4K1RB 1IP9A 1WYWB 3K9OB 2EMTA 2WYQA 3EECA 3HIZA 4HVBA 3VUXA 2KLCA 3ZDTA 4PS7A 3RZWC 2AEHA 4GDLA 3IG3A 3A1QB 3VVWB 2JVCA 1T0YA 1LXDA 2KWCA 3V62A 2JT4B 3PZDA 4BOZB 5JZEB 5BO4B 4GMVA 3NOBA 1YIWA 3L0WB 3U7DA 1IYFA 1WFYA 2GBRA 3HM3A 2CHZA 4W9KA 5DPTA 2KN5A 2KO3A 4MEMA 3CSFA 2UWQA 3APCA 1WXAA 4WQOB 1Z5SB 4NAWA 2ZJDA 2KMCA 1UZXB 2R2QA 4IM0A 1L2NA 2PPHA 2KX0A 4HJKA 2DZKA 1VCBA 2D2QA 4HPLB 4W9LA 2KX3A 4NY0A 5DPRA 2WX0A 4IM2A 1WM3A 5J17A 3K9PB 2DYMA 2GBKA 3A9JA 4HWIB 4G11A 3DVNU 3R3MA 4E71A 3AULA 3UQAA 1WR1A 3IVFA 2KDFB 4FHKA 4K7UA 4KIKB 1I42A 1J0GA 3H7PA 3PRZA 5CX3A 2KD0A 1V86A 3DVGX 2BKFA 2CHWA 3R7QA 4W9JA 2LXCA 2OOBB 3SHQA 2K6QA 2NR2A 2PJHA 1RRBA 3DQVA 3KVFB 4NJ7A 4TKNA 3VHTC 2XEWA 2O2VB 1E8ZA 1WJ4A 2XBBC 4JLCA 1EUVB 4M0WB 1UBQA 1UH6A 4N9F4 3VFKA 1EF1A 1WGYA 3VDZA 4OVVA 1WH3A 2M8SA 3PS6A 3R7RA 1KJTA 2PE9A 3SD5A 3GZNI 4I6NB 1GJZA 2J7QB 2XK5A 1J19A 3VH4B 2MP2A 3L10B 3V60A 3QWZB 4EOYA 4MSMB 1WMHA 2KFKA 1E8XA 3DVGY 4MDKE 1EO6A 2BYVE 2MBQA 3KW5B 3ZNID 4GXBA 3ML9A 4ANWA 4TUUA 1WR6E 4GB9A 2KTRB 4DWFA 2LJ5A 5E6NA 3NZSA 3UINB 2V3SA 2MLBA 4HXDA 4II2B 1WXVA 3WAOA 4A3PA 1YD8U 1H8CA 4XC2A 4TQ0A 1NBFC 4W9DA 3RULA 2DX5B 2DZJA 4FULA 4FBJB 2L05A 4W9GA 2RD0A 3ZRFA 4F7ZA 2FIFA 4MH0E 1P3QU 3M95A 3PT2B 3ZDMC 4IWOA 1GUAB 3H7SA 3PPAA 4GU2A 4G0NB 4B9KA 1MG8A 5CTRC 4GGQA 3VTWA 2UYZB 2FCSA 1WZ0A 1SIFA 2V4LA 5LLIA 2RGFA 1OEYJ 2VRRB 4RMAA 1A5RA 4DK5A 3NY5A 4DDID 3A4RA 1YQBA 4ZDVA 4I6PA 3L08A 2IY1B 4HK2A 4A3OA 3QA8A 3TL5A 3PLVA 1Q5WB 2KC2A 4E3CA 2K1FA 4ZYNA 3KH0A 4DHZE 4E74A 4B95A 2FCQA 3JW0X 4MJSB 1X1MA 2V1YA 2ZPNA 2WWZA 2MWSB 1V5TA 3MTNB 4J6IA 3QIJA 4LJOB 1NI2A 4AUQC 2DYOA 4WJNA 4EUTA 4ICVA 1WE6A 1XT9B 3VXWA 3TIXA 3T8MA 2AYOB 4GIVA 2PEAA 2C7MB 2JF5A 1K8RB 4K7SA 3DOWA 2J0KA 3NHEB 1UGMA 2JRIB 2RPQA 4WWPA 2ZVOA 3N30A 4HCNB 4EEWA 2JZZA 2L8JA 1WIAA 2NBUA 4BVUC 5LXHA 2M17A 3KYDD 2DHZA 4WWOA 2KXJA 1P0RA 5IAAC 3B0AA 4KV2A 3B1LX 5KHOA 3A9KB 3W1SA 1OGWA 1WXMA 4BKGA 4EZLA 3EFUA 1TTNA 3SDLC 3V61A 2MX2A 4AP4C 3PRPB 3JSVB 4MGZE 2GBJA 1E8WA 1E8YA 2LWPA 4JQWC 2W9NA 2L76A 5FR6A 3VTVA 4F8CB 4IG7B 1WGGA 3D32A 4ZRKA 1WGHA 2KNBA 3V6EB 1WXSA 2HJ8A 3WALA 3ALBA 3L17A 4KDLB 3LDZE 2LZ6A 3X23A 1WGDA 1V9JA 2O6VB 3IHPC 3M3JA 2C7HA 1UD7A 4MGIE 2IO0B 4EKUA 1Q0WB 4BBNC 1VD2A 2M1MA 5L95C 1M94A 2DZIA 2N9XA 2KLGA 4X57B 2N1WA 5D94A 5J2RA 2BF8B 4MGYE 3PHWB 2J0JA 3AI5A 4XZ4A 2KDEB 2KVRA 2D11A 4BKTA 1E7VA 2RR9A 2ZCBA 3VUWA 1WI0A 2DAJA 5AZHA 2NPTB 5HKHA 4GOCA 2IBIB 3UIOB 1V2YA 3PV1A 1AARA 4WJPA 2C5LC 4M8MA 4EFOA 2KHWB 3NS8A 2ZVNA 1RLFA 2JZ3B 3OJ3A 2MCNB 3DBLI 3PTFC 1WX9A 4CYEA 5G2NA 4EZJA 2NBVB 4MSQB 3GOEA 2G3QB 2J0MA 5D7GA 1IPGA 3LJ3A 4BFRA 3DBSA 3M62B 3VUYA 4B6WA 3JVZX 3I3TB 2KOXA 5GMVA 2KWVB 2CS4A 2M4NA 2KC1A 5E6OA 2C9WB 3ZNZB 3TJPA 2KJ6A 2D07B 3UQBA 3B08A 4GDKA 2NVUI 4HCPB 3AXCA 3HM6X 3U8ZA 2MBBB 1YJ1A 2A5UA 2WDTB 5JH5C 3AU5A 2KQ7A 3QC8B 2FUHB 4URKA 3DDCB 4K81A 2MW5A 2KJHB 3A1QA 3H1UA 3ZRCA 4DDGD 2KQSA 3APFA 2WX1A 2LASA 3ZNHB 4FA6A 4HLEA 1UELA 3QCAA 2KDIA 3MJWA 3UGBB 1E7UA 2N9EB 1R4NI 2LGDA 2K25A 1ISNA 2L7RA 2Z0EB 4IM3A 3Q3JA 3QK0A 4A20A 4YL8A 2LVPA 4P7IA 2N9PC 2EKEC 4GDLB 3A4SC 3RD2A 3O65B 2DYBA 2ZEQA 4XX5A 1I35A 2IO1B 3APDA 1H4RA 2HTHA 2O6VA 3Q3FA 4BOSC 4FLHA 2KMAA 5LXIB 1WJ6A 4OVUA 5KHQA 3L13A 2IYDB 4BBNF 1BT0A 3QHTA 3T9LA 4RM8A 1WGRA 3U30A 3L54A 4LDTD 2YVCA 2ZNVB 3M63B 3AU4A 1KLVA 3PLUA 4LJPB 2DENB 1L7YA 4K7WA 3VQIA 4KIKA 3IFWB 4NAWB 1G6JA 2NCNA 3EC8A 1GC6A 4MM3A 2DZMA 2KDBA 2LGXA 4F1SA 2GOWA 1E90A 1TBEA 1CMXB 2KWUB 4KZ0A 4W9CA 2IO2B 3RYTA 4ICUA 4I6LB 2LRWA 3N32A 2K8HA 5C23A 5D2MB 5DCNA 2O2VA 3A9JB 2IY0B 3BY4B 4FJYA 2CHXA 1XQQA 1YX5B 5DPSA 4AWJA 3R66C 3H7PB 4CHKA 2BKRB 1Q1OA 4ANVA 4DHJD 2ZCCA 5J18A 2C60A 4PYUA 2LVQA 3ZLZA 1OTRB 3KYCD 3TBLD 3V6CB 3VTUA 4ZRIA 3VAWA 4NPNA 4DHZB 2L0TA 4WJOA 1SGHA 4ANXA 3N3KB 4G3XB 4GSWA 4KVGB 2Z0DB 2G45B 2YLMA 5JHBA 2CU1A 4NQLB 4KSKC 2KTRA 2GBNA 4IUMB 2XK5B 4G50A 1WM2A 2MP2B 4ASWC 5CHVC 2RSUA 2ZNVC 3CMMB 2ZZPB 2KANA 5DPWA 1P9DU 4FHJA 3QJZA 1TZ1A 2N7DA 4TQ1A 4DBGA 4JIOU 2D3GA 1WMHB 2K39A 1TGZB 2KFKB 4IWPA 1OEYA 2FCMA 4LDTB 1KM7A 3HHMA 4EZKA 2JPHA 1WRDB 2L3ZA 3PGEA 2KTFA 3WIMA 4NJ6A 5IA7A 2KJRA 2LD9A 2AWTA 3QQ8B 5E6PA 2BYEA 3KUDB 3ZO5B 5G55A 1SE9A 1HE8A 5JHAA 4KSLC 4BKSA 2K6DB 1ZW7A 3DBHI 2G4SA 2OJRA 1KOTA 4IWQA 1S1QB 2L00B 3ZVVA
chains in the Genus database with same CATH superfamily
4JX1C 2W82A 3IAM1 3TMPB 4M02A 3J9CA 1PFDA 3KQ4A 3ZJVA 5TR5A 2ASQA 5L83A 4DHJB 1FFVA 3TEZA 2QHOA 2KK8A 1PQSA 2JY6A 3B2GA 3T3OA 3SU8X 1K50A 2MSED 1WX8A 4TMAB 4Q2JA 3ZKJC 3L16A 4AJWA 3PRMB 1EWCA 1I4GA 3NRZA 1MHHE 3Q14C 1R4MB 1FXTB 4BKSD 4PS8A 3DVNV 4HROA 3HK0A 4A90A 3WAPA 3JSVA 1U4AA 3PSEB 2Q5WD 3WAMA 2PE6B 4ZYSA 1PDXA 4PYZA 1D5XC 4H2AA 5GXGB 5AZGA 3UIPB 2EKIA 3PHXB 2BPSA 2ON8A 3BIID 2MBEA 1P7FA 3EHVA 4LCDE 5AEKB 4AS1A 3E56A 4KGSA 4C56C 1NVID 4HPPA 4WWNA 3ZGZA 2A4ZA 2AX5A 1QZEA 3AE6B 3DPDA 3RZFA 1RFKA 2MBHA 3UF8A 3N1YC 1OQQA 1FNWA 2LGIA 1P1AA 2JXXA 4JGHB 2WHIA 3PVLA 2PIAA 2FNJB 4ZRQA 1C9FA 4YXDB 4P1CC 1NDDA 1D3ZA 2KDMA 1TS4A 2Z59B 3C0RB 2RPVA 2LRUA 4GN1A 3ETRA 5H92C 1ZKHA 1D5MC 2MRPA 2Y5BB 4GDKB 2DAFA 2KFJA 3FAHA 1YX6B 3OAWA 2WYQA 1P7EA 1SSNA 4GDLA 3Q8EA 3IG3A 3VVWB 2JVCA 1T0YA 3Q8FA 3T3NA 5D3IB 3HM3A 5DPTA 4MEMA 3OG5A 3CSFA 4WQOB 3NVWA 4IM0A 3RFZB 4W9LA 1RWSA 5DPRA 2V3PA 2JYEA 2DYMA 3A9JA 3SEBA 2L32A 1WR1A 1GB4A 1HZ6A 3DVGX 2JWUA 3SHQA 4RGNA 1ROEA 3ZJTA 2PJHA 1RRBA 3DQVA 3VHTC 4NJ7A 1V1PA 2IGDA 2WDVB 1SJHD 3VFKA 1E0ZA 3AEAB 1WGYA 3SD5A 1KJTA 3GZNI 3RNBC 1J19A 3L10B 3V60A 4MSMB 1N5XA 4YTMB 1I4QA 2KFKA 3ZNID 4M00A 4DWFA 3P1MA 3NZSA 2V3SA 2MLBA 5T8IA 1VRAB 4A3PA 4XC2A 4XGAB 3HVZA 2IPKD 3H8HA 1YN5A 2Y5CA 2RD0A 3ZRFA 1MJDA 1GUAB 4B9KA 1MG8A 2UYZB 1NYRA 4P16A 1WXQA 2V4LA 3TUOA 3GS2A 1OEYJ 2VRRB 3A4RA 2VZKB 2FBWB 2TSSA 3L08A 4I6PA 3RNFC 3AE1B 3NS1A 3PLVA 2K1FA 4ZYNA 4E74A 5I4DA 2FCQA 1FMAD 1V97A 4LTUA 3RPFC 1A70A 3AE2B 1FNUA 3T8MA 4XYCA 2KYWA 2PEAA 2D5GA 2E6XA 4WWPA 3AEDB 5LXHA 2NBUA 1WIAA 2LMCA 2M17A 2RDBC 3B0AA 4KV2A 2BVCA 5KHOA 1OGWA 1KLGD 1L5PA 4EZLA 2AQ1B 3EFUA 2NTTA 1KRHA 2GBJA 1E8WA 2LWPA 4JQWC 2KAJA 2W9NA 2L76A 2WLBA 3Q69A 5FR6A 4F8CB 1JWMD 3D32A 2PVGC 2KNBA 3V6EB 4YTPB 2WQYB 3L17A 3LDZE 2LZ6A 3X23A 1T6BX 1V9JA 3M3JA 4RFBA 1UD7A 1M94A 4X57B 5D94A 4MGYE 3PHWB 2PLPA 4XZ4A 5BYRA 2ZCBA 4JWUC 1V2YA 2Z8LA 3N1ZC 3PV1A 1AARA 2WP9B 1C77A 2NBVB 4MSQB 2G3QB 3Q8AA 3DBSA 3FKYA 3RMKC 2KWVB 2M4NA 2KC1A 5E6OA 3ZNZB 3BVMA 2FE8A 2NVUI 1F52A 2D3BA 3U8ZA 2A5UA 4NAMA 3RNCC 3AH7A 3ABVB 3FC4A 2KQ7A 3QC8B 4URKA 1T3QA 1N63A 4K81A 2MW5A 3A1QA 2INCC 3AE7B 3H1UA 3AEBB 4L23A 4DDGD 3APFA 2WX1A 3ZNHB 3QCAA 1FEHA 1C79A 1IBXB 2N9EB 5AUKA 2L7RA 3QK0A 4P7IA 5HFYA 4XX5A 3B2FA 2IO1B 1H4RA 3Q3FA 4BOSC 1WJ6A 4BBNF 2BYTA 1BT0A 2K9XA 4RM8A 2J4XA 1FRDA 3M63B 3PLUA 1DGJA 4LJPB 2DENB 1Y56A 1F1HA 2NCNA 4ZHOA 1GC6A 4MM3A 2LGXA 1PGBA 2KWUB 1CMXB 3GP7A 2IY0B 2J53A 3FILA 4M0WA 1QOGA 1JROA 2BKRB 4ANVA 2MJEA 5J18A 4PYUA 2WXFA 1OTRB 3VTUA 4ZRIA 3VAWA 4WJOA 4G3XB 1FXIA 2CU1A 2KTRA 2LFIA 2WXHA 2MP2B 4DXFA 2ZNVC 3CMMB 3U2SC 1TZ1A 2N7DA 1FIQA 4IWPA 4BAXA 3P42A 4LDTB 1KM7A 2JPHA 2L3ZA 3PGEA 5BYQA 3WIMA 4NJ6A 2KJRA 2NMQA 3KUDB 5EE9A 1ZPSA 5IP4D 5JHAA 4KSLC 4BKSA 2K6DB 1ZW7A 2M19A 3ZVVA 2BYFA 3P63A 3W5VB 1BMLC 4WQMA 2FIDA 1WE7A 3R8BA 3NG0A 2B3AA 1HQRD 3Q3OC 4FJZA 1FNVA 4W9FA 2K5PA 4RCOA 2FCNA 2GBMA 2LXAA 3RT3B 4BZAA 2IO3B 3ML8A 5BYSA 3I9V1 1RAXA 3IT6B 1R4MI 1LFDA 1GC7A 2RDHA 1N60A 3ZNGC 1JWAD 1WJNA 3OWEB 2WXNA 3W5UB 3RUIB 2VZKD 4FADA 3A9KA 4NNJB 1JWBD 3AEFB 1MG4A 1D5ZC 3PREA 2PTLA 1I4XA 3EA6A 2LGYA 4AOFA 1LQBA 2HE7A 2L0FA 2CKHB 3ZXVA 3ENEA 2KZRA 4RM9A 4ZHPA 3CSTA 3ZTCA 2SEBD 1DYQA 1Q10A 1UGJA 1F9JA 2I1JA 2REXA 3IBEA 4PS3A 2N1VA 3S2AA 2AL3A 4REZA 2N4FA 2NPTA 2ICIA 3X0WA 3ZW3A 4IW0A 2HJ1A 4MGKE 4YSZB 1E7PB 1ZP0B 1I4PA 2HD5B 2D10A 2WXOA 3NZUA 3UI3A 1MHXA 4IC7B 3OJ4B 4P1BC 3A33B 2N7EA 2G4DB 3RI7C 3ZIMA 2KN4A 1L0YB 3MC9A 2WGSA 2MA9B 3RCZA 3W1SC 2Y5PA 4FN2A 5FR3A 3H6NA 3DCGA 2K8BA 1S3SG 1K52A 2MJDA 1Y8RC 1WF9A 2KVZA 4K1RB 1IP9A 2EMTA 4JPSA 1JCKB 4EE2A 4HVBA 3PZ8A 2AEHA 2W55A 5JZEB 2KWCA 2JT4B 4BOZB 2QDFA 5BO4B 3NOBA 2KT7A 1YIWA 3L0WB 1WYGA 5HHDG 2CHZA 2KN5A 2UWQA 1AN8A 4KKIA 2BS2B 1Z5SB 4NAWA 2KMCA 2PPHA 2DZKA 1V1OA 1QQRA 1YJJA 1VDVA 4IM2A 1VZ7A 2ACZB 3AN1A 5IN7A 1JW9D 4FHKA 4K7UA 3H7PA 2OHFA 3PRZA 2KD0A 2LXCA 1IGCA 1QLBB 2V0GA 1C4AA 2O2VB 2XBBC 4JLCA 2M56B 4US9A 1UH6A 4N9F4 3GE8C 1EF1A 4OVVA 3PS6A 1GJZA 1NYQA 2J7QB 2WS3B 3BZDB 2SAKA 3P4QB 4EOYA 1TIFA 2RDGA 1WMHA 3DVGY 1C76A 3AEGB 4ANWA 4TUUA 1WR6E 2LJ5A 2M0AA 3UINB 2WXPA 1YD8U 1QKZA 4B0MA 1NBFC 3RULA 1UNSA 5HG2A 3RNEC 2RMMA 1YMHE 1SE3A 3PT2B 4IWOA 3H7SA 3IAS1 5AUIA 4G0NB 4D2KA 1WZ0A 2RGFA 2JX5A 4ZDVA 4HK2A 4A3OA 3QA8A 4OW0A 3TL5A 3EGRA 3KH0A 4DHZE 4MJSB 2IGHA 1X1MA 5EE3A 4J6IA 4AUQC 2DYOA 4WJNA 4ICVA 2LJIA 3IT4B 1NI3A 1T0RC 3VRAB 2JRIB 1XXGA 2ZVOA 4HCNB 2L8JA 4YWGG 1VR9A 2KXJA 1P0RA 3AV8A 5IAAC 4UDUC 3B1LX 1XEEA 3W1SA 3HRDD 4BKGA 4RF1A 1N61A 4MGZE 1QOAA 4LNNA 1WGGA 2WXKA 2N0SB 2LHDA 2HJ8A 5G5GA 1V8CA 4M01A 3VR8B 2O6VB 3IHPC 1Q0WB 2N9XA 1K53A 1EWYC 3NVVA 2DAJA 5HKHA 3UIOB 2KACA 1RLFA 3BK2A 1MI0A 4CYEA 2L1AA 3GOEA 2J0MA 3DBLB 1IPGA 3VUYA 1FD6A 2KOXA 2DBYA 3UQBA 3NUHB 4GDKA 1XLNA 3HM6X 1TS2A 2MBBB 3BWUD 3KWVA 3DDCB 1BUIC 4C80A 3MC8A 2KQSA 2LASA 2W54A 1LO5D 1UELA 1XCQL 3AEEB 3UGBB 1E7UA 2Z0EB 1YNTE 4A20A 3Q3JA 4ITKA 2N9PC 2EKEC 3RD2A 3RNAC 3O65B 1R4NB 2O6VA 1J7CA 1WWTA 3ZJUA 5HI1A 1VJKA 5LNK1 2IYDB 2JYTA 2LGSA 3T9LA 3U30A 3HVDA 4LNOA 3L54A 3AU4A 2JZPA 3IFWB 1L0VB 2INDC 4A55A 1VZ6A 1EU3A 2KDBA 4JE3B 2GOWA 1E90A 3EUB2 1MPEA 3RYTA 1HZ5A 4I6LB 2LRWA 3N32A 2K8HA 3BY4B 4FJYA 1TZOA 4OZCA 3VR9B 1XQQA 4DHJD 3ZLZA 1D4BA 3V6CB 1SBBB 2JSVX 2L0TA 1T0QC 3CIRB 1SGHA 4USAA 2Z0DB 2YLMA 1KFYB 1TS5A 4NQLB 2GBNA 2XK5B 1WM2A 4LNKA 2WXGA 2QMTA 2RSUA 3GE3C 2R61A 2ZZPB 2KANA 1P9DU 2GLSA 2ONQA 1YJIA 3N1XC 2K39A 2KTFA 1J7AA 1PGXA 3QQ8B 4MACA 4FXCA 1HE8A 4C00A 3AECB 2OJRA 4KKJA 4IWQA 4EUTA 1WY8A 3BINA 3BVZA 3U7ZA 2NBWB 1GB1A 2R2OA 1GAQB 3DHGC 4ZRJA 2IZVB 3ZXRA 1TJEA 2BWFA 1UF0A 2BBCA 2BW2A 4W9EA 5EDSA 3VH3B 1J8CA 2BB5A 3P4SB 1ZE3D 5CHFA 1OQYA 1V5OA 3P2BA 1IUEA 3NZ3A 2BB6A 1V80A 1FXAA 2LEKA 1Z2MA 4TSSA 1XO3A 2B76B 3LYYA 1SXTA 3ZUNA 4M8NA 1E6EB 3ZTDA 1L0XB 1JRUA 4NJCA 1ZGUB 3WCQA 3JYUA 3PZ7A 4LLGM 1JMLA 4MELA 1V49A 4JL9A 1WJUA 5EE0A 2V4IB 1EF5A 4AQ7A 3ONSA 4II3B 4HPMB 3Q6BA 4KZCA 3KUCB 3TSSA 2W3SA 1C78A 2QJLA 2V3NA 5MPOA 2M0XA 3TEWA 1N62A 2WXQA 4RH6A 2O6VD 2WU5B 4P6VF 1E5WA 2JUOA 1DOXA 4DXAB 3DBRB 2JWZA 2ZPYA 1SF0A 4AJYB 2PKOA 1DOYA 2MQJA 2QILA 1L4DB 4ANUA 4WAAA 4XDCA 2FAZA 2KQ4X 4HDOA 4JWSC 3K9OB 1IBXA 3HIZA 2XN9C 4PS7A 2GB1A 3V62A 4C4VB 4GMVA 3U7DA 2MEKA 1OFFA 2KO3A 5TSSA 3APCA 1WXAA 3AE4B 3I63C 2ZJDA 5FKAC 1B9RA 2R2QA 2KX0A 4A9AA 3W9CB 2ZW0A 4HPLB 2KX3A 4NY0A 3NVYA 2WX0A 1WM3A 3K9PB 2GBKA 4HWIB 3DVNU 3R3MA 3AULA 3IVFA 2KDFB 4KIKB 2INPE 2BKFA 2CHWA 3R7QA 2OOBB 5D3DA 4US8A 2XEWA 1E8ZA 1WGKA 2VH1A 1UBQA 4XWWA 1AYFA 1M4VA 3VDZA 4XDDA 3R7RA 1ET9A 1YQ4B 4I6NB 3VH4B 2MP2A 3BYYB 1E8XA 1UWMA 3KW5B 4PT5A 5BMHA 5E6NA 1SEBD 2H88B 1FCCC 4HXDA 4II2B 3CWIA 4HRSA 2JQRB 4W9DA 1TY2A 2OJWA 4FULA 4FBJB 2L05A 4W9GA 2DLBA 2E3TA 3W2DA 4MT5A 1P3QU 3M95A 1KH0A 3PPAA 5IKCM 3SFDB 4GGQA 5G5HA 4B0EA 4YSYB 5LLIA 1A5RA 1QOBA 4DDID 2IY1B 4MH8A 4LK0M 1CJEA 1Q5WB 2KC2A 2IJ0A 4B95A 2ZPNA 2MWSB 1V5TA 3MTNB 1XLOA 3DHHC 4LJOB 2X8XX 1WSPA 3AE5B 1WE6A 1XT9B 3VXWA 3DWMA 5BMGA 3LXFA 3KLSX 2JF5A 1K8RB 4K7SA 4YT0B 3Q3NC 5H8YE 4IOIE 3N30A 2V9HA 4EEWA 2JZZA 4OHJA 1FM0D 3KYDD 4RGMA 3EFCA 4RGOS 1WXMA 2Y3AA 3AM9A 3V61A 2MX2A 3ZYYX 3PRPB 3JSVB 1I35A 1E8YA 3VTVA 4S0RA 1FFUA 4ACFA 4KGTA 2GI9A 4ZRKA 2CJOA 3WALA 3ALBA 3TEXA 1I7HA 2BQQA 5L95C 2FUG1 2N9KA 1YN4A 2DZIA 3N20C 1SJED 2BF8B 2J0JA 3AI5A 4BKTA 1ESFA 2RR9A 2I2YA 1VZ8A 1WI0A 5AZHA 2IBIB 1ZDXA 2C5LC 4EFOA 2JZ3B 3OJ3A 2MCNB 2N7JA 3DBLI 5G2NA 4EZJA 2CU3A 5D7GA 4BFRA 2WDRB 4B6WA 1SIJA 3I3TB 2CS4A 2C9WB 4GLSC 3O13A 4A6QA 2KWDA 3AXCA 1YJ1A 2D3CA 3URYA 4K3BA 1ENFA 1PYWD 2N9LA 3ZRCA 4XWTA 2JU6X 4FA6A 4HLEA 4WURA 2KMMA 4LNFA 2J52A 1R4NI 1UUPA 1XF5L 1ISNA 1NENB 2D3AA 2LGDA 2LVPA 4GDLB 3A4SC 2DYBA 2ZEQA 1JRPA 3APDA 1FRRA 1BXTA 4NZLB 1C4PA 1TYGB 4FLHA 5LXIB 1GOZA 4OVUA 5KHQA 3L13A 1JQ4A 1VLBA 3QHTA 1WGRA 4KX6B 4LDTD 4RF0A 4ARCA 1L7YA 5C2TB 1G6JA 3EC8A 4F1SA 1TBEA 4KZ0A 4W9CA 4J3OD 2UU7A 2O2VA 3A9JB 5BMIA 2X38A 1YX5B 2PMVA 3MFGA 3R66C 5DPSA 4CHKA 1Q1OA 2ZCCA 2LVQA 3TBLD 3L4PA 4DHZB 1STEA 3RN9C 2I38A 3MC0B 1V1PB 4ANXA 1FCLA 3BVGA 1KLUD 4GSWA 1ACCA 2G45B 5JHBA 3Q8BA 4KSKC 2LHEA 4G50A 5CHVC 5DPWA 4DBGA 3QJZA 4TQ1A 4HEA1 2KFKB 1TGZB 2WU2B 2FCMA 1I4RA 3HHMA 3P4PB 4EZKA 1WRDB 1E10A 5IA7A 5E6PA 3ZO5B 1SE9A 1QF6A 3MHZA 1S1QB 2L00B 1TKGA 3DBHB 4MJSA 1YN3A 2HDEA 2LUEA 3ECIA 4HDQA 5D6JB 2BWES 3OLMD 3TCAA 2MBOA 1PUTA 3KWLA 2EMSA 1T5XD 1C1YB 4OZAA 2YEPF 4CO7A 3W1YA 2WXMA 1WZ3A 2K3UA 3QARA 5JXVA 2JRHA 3MP9A 4W9IA 2K8CA 1C3TA 2LI5A 1LM8B 2G9HD 1AWDA 4C7YA 3QX1A 1N5WA 5CHWA 2WXIA 1KF6B 5C1ZA 4HKQA 4FJVB 2LVOA 1FPYA 3Q8CA 3CF6E 1C4CA 2WXLA 2CJNA 2BGFA 4W9HA 2JXTA 4KDIC 1WX7A 1FO4A 2I1KA 1UBIA 1GNUA 1JWUD 2AL6A 1QT9A 1V6EA 2KKCA 4S17A 3NVZA 1XD3B 2INNE 5AZFA 2C7NB 1T0SC 3WANA 1GG3A 2QIEB 3WA0A 3H9DA 1PGAA 1RFAA 3MHSD 1P98A 4TV3A 2CR5A 1ZUD2 3DBRI 4YSXB 4CQNA 3QAQA 4K3CA 3KUZA 2HTME 4NQKE 2GMIC 2K22A 2J42A 1V81A 3R2IA 3E9SA 2NS5A 2ZW1A 4WJQA 3HUIA 2GRIA 1WYWB 3TEYA 3EECA 3VUXA 2KLCA 3ZDTA 3RZWC 1EM7A 1HTQA 2WXRA 3P4RB 3A1QB 1LXDA 3PZDA 1IYFA 1WFYA 4RNAA 2GBRA 4W9KA 5IOIA 1F2RI 4O1NA 1UZXB 1DOIA 1L2NA 4HJKA 1VCBA 2D2QA 2LUMA 5J17A 3GB1A 1TT5B 4G11A 1GPXA 2EELA 4ZOHC 4E71A 3UQAA 5FK9C 1I42A 2BS3B 1J0GA 5CX3A 4MM3B 1V86A 4W9JA 3I57A 4QAYA 2K6QA 2NR2A 3KVFB 4TKNA 3DWGC 1YQ3B 3NJTA 1WJ4A 3FILB 1EUVB 4M0WB 1ZOYB 1OQRA 1WH3A 2M8SA 3AMZA 2PE9A 1QOFA 2H89B 3ZQ4A 2XK5A 3QWZB 3GZNB 2BTEA 1XLPA 4R3DA 4HKZE 4MDKE 2QEJC 2WDQB 1EO6A 2BYVE 4L2YA 2MBQA 4GXBA 2AQ3B 3ML9A 2YEPB 2MHJA 1F2RC 1F0ZA 4GB9A 4DQOC 2KTRB 4WIPA 1TY0A 3WAOA 1WXVA 1H8CA 4TQ0A 2DX5B 2DZJA 2IDYA 4OZBA 4F7ZA 2FIFA 4MH0E 4YTNB 3ZDMC 2WNMA 4GU2A 2WXJA 4OVZA 4WH4A 5CTRC 3VTWA 1L6UA 2FCSA 1SIFA 4N6EB 1R7SA 1RYJA 4RMAA 4DK5A 3NY5A 1YQBA 1TKEA 3AB5A 3V05A 1SE2A 4IDIA 4E3CA 3PO0A 3JW0X 2V1YA 2WWZA 1TKYA 3QIJA 2XNAC 3IXSA 1NI2A 4A8XC 3SFEB 2K0PA 3TIXA 2AYOB 4GIVA 2QC8A 2C7MB 3MJ5A 3DOWA 2J0KA 3NHEB 1UGMA 2RPQA 3B9JA 4IKGA 1L6VA 4BVUC 1YOVB 1HEZE 3Q3MC 2DHZA 4WWOA 3A9KB 1TTNA 4WWMA 3SDLC 4AP4C 2L52A 1MVKA 3N9YC 3U52E 4IG7B 1ZXHA 1WGHA 3BYTB 3Q2AC 4RGTA 1WXSA 4N59A 2W3RA 3I5JC 4KDLB 2QCZA 1WGDA 5EE1A 4DXGA 1L4ZB 2C7HA 4MGIE 2IO0B 4EKUA 4BBNC 1VD2A 2M1MA 2KLGA 1AW7A 2N1WA 2VH2A 5J2RA 1JWSD 2KDEB 2KVRA 2D11A 1E7VA 3VUWA 4ZRPA 2MJ3A 2NPTB 2PW9A 4GOCA 4PK1A 1XCTL 1EU4A 4WJPA 4M8MA 2AQ2B 1MFWA 1F77A 2KHWB 3NS8A 2ZVNA 1XLQA 3PTFC 1WX9A 2BT6A 5C3JB 4KGRA 2MH7A 3LB8C 3LJ3A 3M62B 3C19A 3JVZX 4WAFA 5GMVA 3TJPA 2KJ6A 2D07B 3B08A 1E9MA 1B1ZA 4HCPB 4L1BA 1RM6C 1D6EC 3AE9B 1CZPA 3V3XA 2WDTB 2G1EA 5E6JA 5JH5C 3AU5A 1ZXIA 1TS3A 2FUHB 2KJHB 1CK1A 4C4VA 1QILA 2KDIA 4N58A 2QSDA 1ET6A 3MJWA 2BS4B 2K25A 4IM3A 3DHIC 4YL8A 1SE4A 1I4HA 4HJGE 2HTHA 2KMAA 2DNFA 3U4EG 4LNIA 1NEKB 1J7BA 2YVCA 2ZNVB 1KLVA 4K7WA 3AE3B 3VQIA 4KIKA 4NAWB 2DZMA 1ZDVA 1WRIA 2IO2B 4ICUA 1CQVA 5C23A 5D2MB 5DCNA 1UWXA 3R2TA 5IO9A 2DWQA 2CHXA 4AWJA 3H7PB 2C60A 3KYCD 4NPNA 3N3KB 4KVGB 1K51A 3AE8B 4XE0A 1HA5A 4IUMB 2NTSA 3BK1A 4ASWC 3SR6A 4FHJA 4JIOU 2D3GA 1SB3C 1KTKA 1WMHB 3VRBB 1OEYA 2IGGA 1IGDA 1JALA 2LD9A 2AWTA 1HTOA 3RNGC 1HXYD 2BYEA 3C8YA 5G55A 4C7ZA 4ARIA 1N6ZA 1LGRA 2G4SA 2L83A 2OEDA 3DBHI 1KOTA 2PVOD
chains in the Genus database with same CATH topology
2BYFA 1WY8A 3TMPB 2FIDA 1WE7A 3BINA 4MJSA 2B3AA 2NBWB 2LUEA 4FJZA 5TR5A 2ASQA 2R2OA 3ECIA 4DHJB 5L83A 4HDQA 4W9FA 4ZRJA 2FCNA 2KK8A 1PQSA 2QHOA 2BWES 2IZVB 2JY6A 3OLMD 5D6JB 3TCAA 2MBOA 2GBMA 2LXAA 2BWFA 3RT3B 2EMSA 2IO3B 3SU8X 3ML8A 4W9EA 1C1YB 2MSED 4CO7A 1WX8A 5EDSA 1RAXA 1R4MI 3W1YA 1LFDA 3VH3B 1GC7A 3ZKJC 1J8CA 3L16A 4AJWA 3PRMB 3ZNGC 1WJNA 1WZ3A 3QARA 1FXTB 2JRHA 5CHFA 1OQYA 1V5OA 3P2BA 3RUIB 4BKSD 4W9IA 2K8CA 1C3TA 2LI5A 1LM8B 1V80A 3DVNV 4PS8A 3A9KA 4NNJB 4FADA 3HK0A 3QX1A 5CHWA 1Z2MA 3PREA 5C1ZA 3WAPA 4FJVB 2LGYA 3JSVA 2LVOA 1U4AA 3PSEB 4AOFA 1LQBA 3CF6E 2HE7A 3WAMA 2L0FA 2PE6B 2CKHB 2BGFA 4W9HA 3ENEA 4PYZA 2KZRA 3ZUNA 4M8NA 4RM9A 5AZGA 3CSTA 3ZTCA 3UIPB 4KDIC 3ZTDA 1WX7A 1JRUA 2I1KA 3PHXB 1ZGUB 1F9JA 2BPSA 1UBIA 2MBEA 1GNUA 2AL6A 2I1JA 3EHVA 3JYUA 4LCDE 2REXA 5AEKB 3IBEA 4PS3A 2N1VA 1V6EA 2AL3A 2KKCA 3S2AA 4MELA 1V49A 2N4FA 4JL9A 2NPTA 1WJUA 3X0WA 1XD3B 3ZW3A 1EF5A 3ONSA 4II3B 4IW0A 4HPMB 4KZCA 4WWNA 3KUCB 5AZFA 2A4ZA 2C7NB 4MGKE 1QZEA 3RZFA 3DPDA 3UF8A 3WANA 2MBHA 1GG3A 2HD5B 2D10A 1P1AA 3WA0A 2M0XA 3H9DA 2JXXA 4JGHB 1RFAA 3MHSD 3NZUA 2O6VD 4IC7B 3OJ4B 3PVLA 1P98A 3A33B 2N7EA 4TV3A 2G4DB 2CR5A 2FNJB 3DBRI 3ZIMA 1E5WA 2JUOA 3QAQA 4DXAB 1NDDA 2MA9B 1D3ZA 3RCZA 3KUZA 3W1SC 2JWZA 2Z59B 3C0RB 2ZPYA 4AJYB 4FN2A 2LRUA 4GN1A 3H6NA 4NQKE 2MQJA 2GMIC 1V81A 3DCGA 1ZKHA 4ANUA 2K8BA 4WAAA 1S3SG 2MRPA 2Y5BB 2FAZA 4GDKB 2NS5A 4HDOA 2DAFA 1Y8RC 1WF9A 2KFJA 4WJQA 1YX6B 3OAWA 4K1RB 1IP9A 1WYWB 3K9OB 2EMTA 2WYQA 3EECA 3HIZA 4HVBA 3VUXA 2KLCA 3ZDTA 4PS7A 3RZWC 2AEHA 4GDLA 3IG3A 3A1QB 3VVWB 2JVCA 1T0YA 1LXDA 2KWCA 3V62A 2JT4B 3PZDA 4BOZB 5JZEB 5BO4B 4GMVA 3NOBA 1YIWA 3L0WB 3U7DA 1IYFA 1WFYA 2GBRA 3HM3A 2CHZA 4W9KA 5DPTA 2KN5A 2KO3A 4MEMA 3CSFA 2UWQA 3APCA 1WXAA 4WQOB 1Z5SB 4NAWA 2ZJDA 2KMCA 1UZXB 2R2QA 4IM0A 1L2NA 2PPHA 2KX0A 4HJKA 2DZKA 1VCBA 2D2QA 4HPLB 4W9LA 2KX3A 4NY0A 5DPRA 2WX0A 4IM2A 1WM3A 5J17A 3K9PB 2DYMA 2GBKA 3A9JA 4HWIB 4G11A 3DVNU 3R3MA 4E71A 3AULA 3UQAA 1WR1A 3IVFA 2KDFB 4FHKA 4K7UA 4KIKB 1I42A 1J0GA 3H7PA 3PRZA 5CX3A 2KD0A 1V86A 3DVGX 2BKFA 2CHWA 3R7QA 4W9JA 2LXCA 2OOBB 3SHQA 2K6QA 2NR2A 2PJHA 1RRBA 3DQVA 3KVFB 4NJ7A 4TKNA 3VHTC 2XEWA 2O2VB 1E8ZA 1WJ4A 2XBBC 4JLCA 1EUVB 4M0WB 1UBQA 1UH6A 4N9F4 3VFKA 1EF1A 1WGYA 3VDZA 4OVVA 1WH3A 2M8SA 3PS6A 3R7RA 1KJTA 2PE9A 3SD5A 3GZNI 4I6NB 1GJZA 2J7QB 2XK5A 1J19A 3VH4B 2MP2A 3L10B 3V60A 3QWZB 4EOYA 4MSMB 1WMHA 2KFKA 1E8XA 3DVGY 4MDKE 1EO6A 2BYVE 2MBQA 3KW5B 3ZNID 4GXBA 3ML9A 4ANWA 4TUUA 1WR6E 4GB9A 2KTRB 4DWFA 2LJ5A 5E6NA 3NZSA 3UINB 2V3SA 2MLBA 4HXDA 4II2B 1WXVA 3WAOA 4A3PA 1YD8U 1H8CA 4XC2A 4TQ0A 1NBFC 4W9DA 3RULA 2DX5B 2DZJA 4FULA 4FBJB 2L05A 4W9GA 2RD0A 3ZRFA 4F7ZA 2FIFA 4MH0E 1P3QU 3M95A 3PT2B 3ZDMC 4IWOA 1GUAB 3H7SA 3PPAA 4GU2A 4G0NB 4B9KA 1MG8A 5CTRC 4GGQA 3VTWA 2UYZB 2FCSA 1WZ0A 1SIFA 2V4LA 5LLIA 2RGFA 1OEYJ 2VRRB 4RMAA 1A5RA 4DK5A 3NY5A 4DDID 3A4RA 1YQBA 4ZDVA 4I6PA 3L08A 2IY1B 4HK2A 4A3OA 3QA8A 3TL5A 3PLVA 1Q5WB 2KC2A 4E3CA 2K1FA 4ZYNA 3KH0A 4DHZE 4E74A 4B95A 2FCQA 3JW0X 4MJSB 1X1MA 2V1YA 2ZPNA 2WWZA 2MWSB 1V5TA 3MTNB 4J6IA 3QIJA 4LJOB 1NI2A 4AUQC 2DYOA 4WJNA 4EUTA 4ICVA 1WE6A 1XT9B 3VXWA 3TIXA 3T8MA 2AYOB 4GIVA 2PEAA 2C7MB 2JF5A 1K8RB 4K7SA 3DOWA 2J0KA 3NHEB 1UGMA 2JRIB 2RPQA 4WWPA 2ZVOA 3N30A 4HCNB 4EEWA 2JZZA 2L8JA 1WIAA 2NBUA 4BVUC 5LXHA 2M17A 3KYDD 2DHZA 4WWOA 2KXJA 1P0RA 5IAAC 3B0AA 4KV2A 3B1LX 5KHOA 3A9KB 3W1SA 1OGWA 1WXMA 4BKGA 4EZLA 3EFUA 1TTNA 3SDLC 3V61A 2MX2A 4AP4C 3PRPB 3JSVB 4MGZE 2GBJA 1E8WA 1E8YA 2LWPA 4JQWC 2W9NA 2L76A 5FR6A 3VTVA 4F8CB 4IG7B 1WGGA 3D32A 4ZRKA 1WGHA 2KNBA 3V6EB 1WXSA 2HJ8A 3WALA 3ALBA 3L17A 4KDLB 3LDZE 2LZ6A 3X23A 1WGDA 1V9JA 2O6VB 3IHPC 3M3JA 2C7HA 1UD7A 4MGIE 2IO0B 4EKUA 1Q0WB 4BBNC 1VD2A 2M1MA 5L95C 1M94A 2DZIA 2N9XA 2KLGA 4X57B 2N1WA 5D94A 5J2RA 2BF8B 4MGYE 3PHWB 2J0JA 3AI5A 4XZ4A 2KDEB 2KVRA 2D11A 4BKTA 1E7VA 2RR9A 2ZCBA 3VUWA 1WI0A 2DAJA 5AZHA 2NPTB 5HKHA 4GOCA 2IBIB 3UIOB 1V2YA 3PV1A 1AARA 4WJPA 2C5LC 4M8MA 4EFOA 2KHWB 3NS8A 2ZVNA 1RLFA 2JZ3B 3OJ3A 2MCNB 3DBLI 3PTFC 1WX9A 4CYEA 5G2NA 4EZJA 2NBVB 4MSQB 3GOEA 2G3QB 2J0MA 5D7GA 1IPGA 3LJ3A 4BFRA 3DBSA 3M62B 3VUYA 4B6WA 3JVZX 3I3TB 2KOXA 5GMVA 2KWVB 2CS4A 2M4NA 2KC1A 5E6OA 2C9WB 3ZNZB 3TJPA 2KJ6A 2D07B 3UQBA 3B08A 4GDKA 2NVUI 4HCPB 3AXCA 3HM6X 3U8ZA 2MBBB 1YJ1A 2A5UA 2WDTB 5JH5C 3AU5A 2KQ7A 3QC8B 2FUHB 4URKA 3DDCB 4K81A 2MW5A 2KJHB 3A1QA 3H1UA 3ZRCA 4DDGD 2KQSA 3APFA 2WX1A 2LASA 3ZNHB 4FA6A 4HLEA 1UELA 3QCAA 2KDIA 3MJWA 3UGBB 1E7UA 2N9EB 1R4NI 2LGDA 2K25A 1ISNA 2L7RA 2Z0EB 4IM3A 3Q3JA 3QK0A 4A20A 4YL8A 2LVPA 4P7IA 2N9PC 2EKEC 4GDLB 3A4SC 3RD2A 3O65B 2DYBA 2ZEQA 4XX5A 1I35A 2IO1B 3APDA 1H4RA 2HTHA 2O6VA 3Q3FA 4BOSC 4FLHA 2KMAA 5LXIB 1WJ6A 4OVUA 5KHQA 3L13A 2IYDB 4BBNF 1BT0A 3QHTA 3T9LA 4RM8A 1WGRA 3U30A 3L54A 4LDTD 2YVCA 2ZNVB 3M63B 3AU4A 1KLVA 3PLUA 4LJPB 2DENB 1L7YA 4K7WA 3VQIA 4KIKA 3IFWB 4NAWB 1G6JA 2NCNA 3EC8A 1GC6A 4MM3A 2DZMA 2KDBA 2LGXA 4F1SA 2GOWA 1E90A 1TBEA 1CMXB 2KWUB 4KZ0A 4W9CA 2IO2B 3RYTA 4ICUA 4I6LB 2LRWA 3N32A 2K8HA 5C23A 5D2MB 5DCNA 2O2VA 3A9JB 2IY0B 3BY4B 4FJYA 2CHXA 1XQQA 1YX5B 5DPSA 4AWJA 3R66C 3H7PB 4CHKA 2BKRB 1Q1OA 4ANVA 4DHJD 2ZCCA 5J18A 2C60A 4PYUA 2LVQA 3ZLZA 1OTRB 3KYCD 3TBLD 3V6CB 3VTUA 4ZRIA 3VAWA 4NPNA 4DHZB 2L0TA 4WJOA 1SGHA 4ANXA 3N3KB 4G3XB 4GSWA 4KVGB 2Z0DB 2G45B 2YLMA 5JHBA 2CU1A 4NQLB 4KSKC 2KTRA 2GBNA 4IUMB 2XK5B 4G50A 1WM2A 2MP2B 4ASWC 5CHVC 2RSUA 2ZNVC 3CMMB 2ZZPB 2KANA 5DPWA 1P9DU 4FHJA 3QJZA 1TZ1A 2N7DA 4TQ1A 4DBGA 4JIOU 2D3GA 1WMHB 2K39A 1TGZB 2KFKB 4IWPA 1OEYA 2FCMA 4LDTB 1KM7A 3HHMA 4EZKA 2JPHA 1WRDB 2L3ZA 3PGEA 2KTFA 3WIMA 4NJ6A 5IA7A 2KJRA 2LD9A 2AWTA 3QQ8B 5E6PA 2BYEA 3KUDB 3ZO5B 5G55A 1SE9A 1HE8A 5JHAA 4KSLC 4BKSA 2K6DB 1ZW7A 3DBHI 2G4SA 2OJRA 1KOTA 4IWQA 1S1QB 2L00B 3ZVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYF A;  1WY8 A;  3TMP B;  2FID A;  1WE7 A;  3BIN A;  4MJS A;  2B3A A;  2NBW B;  2LUE A;  4FJZ A;  5TR5 A;  2ASQ A;  2R2O A;  3ECI A;  4DHJ B;  5L83 A;  4HDQ A;  4W9F A;  4ZRJ A;  2FCN A;  2KK8 A;  1PQS A;  2QHO A;  2BWE S;  2IZV B;  2JY6 A;  3OLM D;  5D6J B;  3TCA A;  2MBO A;  2GBM A;  2LXA A;  2BWF A;  3RT3 B;  2EMS A;  2IO3 B;  3SU8 X;  3ML8 A;  4W9E A;  1C1Y B;  2MSE D;  4CO7 A;  1WX8 A;  5EDS A;  1RAX A;  1R4M I;  3W1Y A;  1LFD A;  3VH3 B;  1GC7 A;  3ZKJ C;  1J8C A;  3L16 A;  4AJW A;  3PRM B;  3ZNG C;  1WJN A;  1WZ3 A;  3QAR A;  1FXT B;  2JRH A;  5CHF A;  1OQY A;  1V5O A;  3P2B A;  3RUI B;  4BKS D;  4W9I A;  2K8C A;  1C3T A;  2LI5 A;  1LM8 B;  1V80 A;  3DVN V;  4PS8 A;  3A9K A;  4NNJ B;  4FAD A;  3HK0 A;  3QX1 A;  5CHW A;  1Z2M A;  3PRE A;  5C1Z A;  3WAP A;  4FJV B;  2LGY A;  3JSV A;  2LVO A;  1U4A A;  3PSE B;  4AOF A;  1LQB A;  3CF6 E;  2HE7 A;  3WAM A;  2L0F A;  2PE6 B;  2CKH B;  2BGF A;  4W9H A;  3ENE A;  4PYZ A;  2KZR A;  3ZUN A;  4M8N A;  4RM9 A;  5AZG A;  3CST A;  3ZTC A;  3UIP B;  4KDI C;  3ZTD A;  1WX7 A;  1JRU A;  2I1K A;  3PHX B;  1ZGU B;  1F9J A;  2BPS A;  1UBI A;  2MBE A;  1GNU A;  2AL6 A;  2I1J A;  3EHV A;  3JYU A;  4LCD E;  2REX A;  5AEK B;  3IBE A;  4PS3 A;  2N1V A;  1V6E A;  2AL3 A;  2KKC A;  3S2A A;  4MEL A;  1V49 A;  2N4F A;  4JL9 A;  2NPT A;  1WJU A;  3X0W A;  1XD3 B;  3ZW3 A;  1EF5 A;  3ONS A;  4II3 B;  4IW0 A;  4HPM B;  4KZC A;  4WWN A;  3KUC B;  5AZF A;  2A4Z A;  2C7N B;  4MGK E;  1QZE A;  3RZF A;  3DPD A;  3UF8 A;  3WAN A;  2MBH A;  1GG3 A;  2HD5 B;  2D10 A;  1P1A A;  3WA0 A;  2M0X A;  3H9D A;  2JXX A;  4JGH B;  1RFA A;  3MHS D;  3NZU A;  2O6V D;  4IC7 B;  3OJ4 B;  3PVL A;  1P98 A;  3A33 B;  2N7E A;  4TV3 A;  2G4D B;  2CR5 A;  2FNJ B;  3DBR I;  3ZIM A;  1E5W A;  2JUO A;  3QAQ A;  4DXA B;  1NDD A;  2MA9 B;  1D3Z A;  3RCZ A;  3KUZ A;  3W1S C;  2JWZ A;  2Z59 B;  3C0R B;  2ZPY A;  4AJY B;  4FN2 A;  2LRU A;  4GN1 A;  3H6N A;  4NQK E;  2MQJ A;  2GMI C;  1V81 A;  3DCG A;  1ZKH A;  4ANU A;  2K8B A;  4WAA A;  1S3S G;  2MRP A;  2Y5B B;  2FAZ A;  4GDK B;  2NS5 A;  4HDO A;  2DAF A;  1Y8R C;  1WF9 A;  2KFJ A;  4WJQ A;  1YX6 B;  3OAW A;  4K1R B;  1IP9 A;  1WYW B;  3K9O B;  2EMT A;  2WYQ A;  3EEC A;  3HIZ A;  4HVB A;  3VUX A;  2KLC A;  3ZDT A;  4PS7 A;  3RZW C;  2AEH A;  4GDL A;  3IG3 A;  3A1Q B;  3VVW B;  2JVC A;  1T0Y A;  1LXD A;  2KWC A;  3V62 A;  2JT4 B;  3PZD A;  4BOZ B;  5JZE B;  5BO4 B;  4GMV A;  3NOB A;  1YIW A;  3L0W B;  3U7D A;  1IYF A;  1WFY A;  2GBR A;  3HM3 A;  2CHZ A;  4W9K A;  5DPT A;  2KN5 A;  2KO3 A;  4MEM A;  3CSF A;  2UWQ A;  3APC A;  1WXA A;  4WQO B;  1Z5S B;  4NAW A;  2ZJD A;  2KMC A;  1UZX B;  2R2Q A;  4IM0 A;  1L2N A;  2PPH A;  2KX0 A;  4HJK A;  2DZK A;  1VCB A;  2D2Q A;  4HPL B;  4W9L A;  2KX3 A;  4NY0 A;  5DPR A;  2WX0 A;  4IM2 A;  1WM3 A;  5J17 A;  3K9P B;  2DYM A;  2GBK A;  3A9J A;  4HWI B;  4G11 A;  3DVN U;  3R3M A;  4E71 A;  3AUL A;  3UQA A;  1WR1 A;  3IVF A;  2KDF B;  4FHK A;  4K7U A;  4KIK B;  1I42 A;  1J0G A;  3H7P A;  3PRZ A;  5CX3 A;  2KD0 A;  1V86 A;  3DVG X;  2BKF A;  2CHW A;  3R7Q A;  4W9J A;  2LXC A;  2OOB B;  3SHQ A;  2K6Q A;  2NR2 A;  2PJH A;  1RRB A;  3DQV A;  3KVF B;  4NJ7 A;  4TKN A;  3VHT C;  2XEW A;  2O2V B;  1E8Z A;  1WJ4 A;  2XBB C;  4JLC A;  1EUV B;  4M0W B;  1UBQ A;  1UH6 A;  4N9F 4;  3VFK A;  1EF1 A;  1WGY A;  3VDZ A;  4OVV A;  1WH3 A;  2M8S A;  3PS6 A;  3R7R A;  1KJT A;  2PE9 A;  3SD5 A;  3GZN I;  4I6N B;  1GJZ A;  2J7Q B;  2XK5 A;  1J19 A;  3VH4 B;  2MP2 A;  3L10 B;  3V60 A;  3QWZ B;  4EOY A;  4MSM B;  1WMH A;  2KFK A;  1E8X A;  3DVG Y;  4MDK E;  1EO6 A;  2BYV E;  2MBQ A;  3KW5 B;  3ZNI D;  4GXB A;  3ML9 A;  4ANW A;  4TUU A;  1WR6 E;  4GB9 A;  2KTR B;  4DWF A;  2LJ5 A;  5E6N A;  3NZS A;  3UIN B;  2V3S A;  2MLB A;  4HXD A;  4II2 B;  1WXV A;  3WAO A;  4A3P A;  1YD8 U;  1H8C A;  4XC2 A;  4TQ0 A;  1NBF C;  4W9D A;  3RUL A;  2DX5 B;  2DZJ A;  4FUL A;  4FBJ B;  2L05 A;  4W9G A;  2RD0 A;  3ZRF A;  4F7Z A;  2FIF A;  4MH0 E;  1P3Q U;  3M95 A;  3PT2 B;  3ZDM C;  4IWO A;  1GUA B;  3H7S A;  3PPA A;  4GU2 A;  4G0N B;  4B9K A;  1MG8 A;  5CTR C;  4GGQ A;  3VTW A;  2UYZ B;  2FCS A;  1WZ0 A;  1SIF A;  2V4L A;  5LLI A;  2RGF A;  1OEY J;  2VRR B;  4RMA A;  1A5R A;  4DK5 A;  3NY5 A;  4DDI D;  3A4R A;  1YQB A;  4ZDV A;  4I6P A;  3L08 A;  2IY1 B;  4HK2 A;  4A3O A;  3QA8 A;  3TL5 A;  3PLV A;  1Q5W B;  2KC2 A;  4E3C A;  2K1F A;  4ZYN A;  3KH0 A;  4DHZ E;  4E74 A;  4B95 A;  2FCQ A;  3JW0 X;  4MJS B;  1X1M A;  2V1Y A;  2ZPN A;  2WWZ A;  2MWS B;  1V5T A;  3MTN B;  4J6I A;  3QIJ A;  4LJO B;  1NI2 A;  4AUQ C;  2DYO A;  4WJN A;  4EUT A;  4ICV A;  1WE6 A;  1XT9 B;  3VXW A;  3TIX A;  3T8M A;  2AYO B;  4GIV A;  2PEA A;  2C7M B;  2JF5 A;  1K8R B;  4K7S A;  3DOW A;  2J0K A;  3NHE B;  1UGM A;  2JRI B;  2RPQ A;  4WWP A;  2ZVO A;  3N30 A;  4HCN B;  4EEW A;  2JZZ A;  2L8J A;  1WIA A;  2NBU A;  4BVU C;  5LXH A;  2M17 A;  3KYD D;  2DHZ A;  4WWO A;  2KXJ A;  1P0R A;  5IAA C;  3B0A A;  4KV2 A;  3B1L X;  5KHO A;  3A9K B;  3W1S A;  1OGW A;  1WXM A;  4BKG A;  4EZL A;  3EFU A;  1TTN A;  3SDL C;  3V61 A;  2MX2 A;  4AP4 C;  3PRP B;  3JSV B;  4MGZ E;  2GBJ A;  1E8W A;  1E8Y A;  2LWP A;  4JQW C;  2W9N A;  2L76 A;  5FR6 A;  3VTV A;  4F8C B;  4IG7 B;  1WGG A;  3D32 A;  4ZRK A;  1WGH A;  2KNB A;  3V6E B;  1WXS A;  2HJ8 A;  3WAL A;  3ALB A;  3L17 A;  4KDL B;  3LDZ E;  2LZ6 A;  3X23 A;  1WGD A;  1V9J A;  2O6V B;  3IHP C;  3M3J A;  2C7H A;  1UD7 A;  4MGI E;  2IO0 B;  4EKU A;  1Q0W B;  4BBN C;  1VD2 A;  2M1M A;  5L95 C;  1M94 A;  2DZI A;  2N9X A;  2KLG A;  4X57 B;  2N1W A;  5D94 A;  5J2R A;  2BF8 B;  4MGY E;  3PHW B;  2J0J A;  3AI5 A;  4XZ4 A;  2KDE B;  2KVR A;  2D11 A;  4BKT A;  1E7V A;  2RR9 A;  2ZCB A;  3VUW A;  1WI0 A;  2DAJ A;  5AZH A;  2NPT B;  5HKH A;  4GOC A;  2IBI B;  3UIO B;  1V2Y A;  3PV1 A;  1AAR A;  4WJP A;  2C5L C;  4M8M A;  4EFO A;  2KHW B;  3NS8 A;  2ZVN A;  1RLF A;  2JZ3 B;  3OJ3 A;  2MCN B;  3DBL I;  3PTF C;  1WX9 A;  4CYE A;  5G2N A;  4EZJ A;  2NBV B;  4MSQ B;  3GOE A;  2G3Q B;  2J0M A;  5D7G A;  1IPG A;  3LJ3 A;  4BFR A;  3DBS A;  3M62 B;  3VUY A;  4B6W A;  3JVZ X;  3I3T B;  2KOX A;  5GMV A;  2KWV B;  2CS4 A;  2M4N A;  2KC1 A;  5E6O A;  2C9W B;  3ZNZ B;  3TJP A;  2KJ6 A;  2D07 B;  3UQB A;  3B08 A;  4GDK A;  2NVU I;  4HCP B;  3AXC A;  3HM6 X;  3U8Z A;  2MBB B;  1YJ1 A;  2A5U A;  2WDT B;  5JH5 C;  3AU5 A;  2KQ7 A;  3QC8 B;  2FUH B;  4URK A;  3DDC B;  4K81 A;  2MW5 A;  2KJH B;  3A1Q A;  3H1U A;  3ZRC A;  4DDG D;  2KQS A;  3APF A;  2WX1 A;  2LAS A;  3ZNH B;  4FA6 A;  4HLE A;  1UEL A;  3QCA A;  2KDI A;  3MJW A;  3UGB B;  1E7U A;  2N9E B;  1R4N I;  2LGD A;  2K25 A;  1ISN A;  2L7R A;  2Z0E B;  4IM3 A;  3Q3J A;  3QK0 A;  4A20 A;  4YL8 A;  2LVP A;  4P7I A;  2N9P C;  2EKE C;  4GDL B;  3A4S C;  3RD2 A;  3O65 B;  2DYB A;  2ZEQ A;  4XX5 A;  1I35 A;  2IO1 B;  3APD A;  1H4R A;  2HTH A;  2O6V A;  3Q3F A;  4BOS C;  4FLH A;  2KMA A;  5LXI B;  1WJ6 A;  4OVU A;  5KHQ A;  3L13 A;  2IYD B;  4BBN F;  1BT0 A;  3QHT A;  3T9L A;  4RM8 A;  1WGR A;  3U30 A;  3L54 A;  4LDT D;  2YVC A;  2ZNV B;  3M63 B;  3AU4 A;  1KLV A;  3PLU A;  4LJP B;  2DEN B;  1L7Y A;  4K7W A;  3VQI A;  4KIK A;  3IFW B;  4NAW B;  1G6J A;  2NCN A;  3EC8 A;  1GC6 A;  4MM3 A;  2DZM A;  2KDB A;  2LGX A;  4F1S A;  2GOW A;  1E90 A;  1TBE A;  1CMX B;  2KWU B;  4KZ0 A;  4W9C A;  2IO2 B;  3RYT A;  4ICU A;  4I6L B;  2LRW A;  3N32 A;  2K8H A;  5C23 A;  5D2M B;  5DCN A;  2O2V A;  3A9J B;  2IY0 B;  3BY4 B;  4FJY A;  2CHX A;  1XQQ A;  1YX5 B;  5DPS A;  4AWJ A;  3R66 C;  3H7P B;  4CHK A;  2BKR B;  1Q1O A;  4ANV A;  4DHJ D;  2ZCC A;  5J18 A;  2C60 A;  4PYU A;  2LVQ A;  3ZLZ A;  1OTR B;  3KYC D;  3TBL D;  3V6C B;  3VTU A;  4ZRI A;  3VAW A;  4NPN A;  4DHZ B;  2L0T A;  4WJO A;  1SGH A;  4ANX A;  3N3K B;  4G3X B;  4GSW A;  4KVG B;  2Z0D B;  2G45 B;  2YLM A;  5JHB A;  2CU1 A;  4NQL B;  4KSK C;  2KTR A;  2GBN A;  4IUM B;  2XK5 B;  4G50 A;  1WM2 A;  2MP2 B;  4ASW C;  5CHV C;  2RSU A;  2ZNV C;  3CMM B;  2ZZP B;  2KAN A;  5DPW A;  1P9D U;  4FHJ A;  3QJZ A;  1TZ1 A;  2N7D A;  4TQ1 A;  4DBG A;  4JIO U;  2D3G A;  1WMH B;  2K39 A;  1TGZ B;  2KFK B;  4IWP A;  1OEY A;  2FCM A;  4LDT B;  1KM7 A;  3HHM A;  4EZK A;  2JPH A;  1WRD B;  2L3Z A;  3PGE A;  2KTF A;  3WIM A;  4NJ6 A;  5IA7 A;  2KJR A;  2LD9 A;  2AWT A;  3QQ8 B;  5E6P A;  2BYE A;  3KUD B;  3ZO5 B;  5G55 A;  1SE9 A;  1HE8 A;  5JHA A;  4KSL C;  4BKS A;  2K6D B;  1ZW7 A;  3DBH I;  2G4S A;  2OJR A;  1KOT A;  4IWQ A;  1S1Q B;  2L00 B;  3ZVV A; 
#chains in the Genus database with same CATH topology
 4JX1 C;  2W82 A;  3IAM 1;  3TMP B;  4M02 A;  3J9C A;  1PFD A;  3KQ4 A;  3ZJV A;  5TR5 A;  2ASQ A;  5L83 A;  4DHJ B;  1FFV A;  3TEZ A;  2QHO A;  2KK8 A;  1PQS A;  2JY6 A;  3B2G A;  3T3O A;  3SU8 X;  1K50 A;  2MSE D;  1WX8 A;  4TMA B;  4Q2J A;  3ZKJ C;  3L16 A;  4AJW A;  3PRM B;  1EWC A;  1I4G A;  3NRZ A;  1MHH E;  3Q14 C;  1R4M B;  1FXT B;  4BKS D;  4PS8 A;  3DVN V;  4HRO A;  3HK0 A;  4A90 A;  3WAP A;  3JSV A;  1U4A A;  3PSE B;  2Q5W D;  3WAM A;  2PE6 B;  4ZYS A;  1PDX A;  4PYZ A;  1D5X C;  4H2A A;  5GXG B;  5AZG A;  3UIP B;  2EKI A;  3PHX B;  2BPS A;  2ON8 A;  3BII D;  2MBE A;  1P7F A;  3EHV A;  4LCD E;  5AEK B;  4AS1 A;  3E56 A;  4KGS A;  4C56 C;  1NVI D;  4HPP A;  4WWN A;  3ZGZ A;  2A4Z A;  2AX5 A;  1QZE A;  3AE6 B;  3DPD A;  3RZF A;  1RFK A;  2MBH A;  3UF8 A;  3N1Y C;  1OQQ A;  1FNW A;  2LGI A;  1P1A A;  2JXX A;  4JGH B;  2WHI A;  3PVL A;  2PIA A;  2FNJ B;  4ZRQ A;  1C9F A;  4YXD B;  4P1C C;  1NDD A;  1D3Z A;  2KDM A;  1TS4 A;  2Z59 B;  3C0R B;  2RPV A;  2LRU A;  4GN1 A;  3ETR A;  5H92 C;  1ZKH A;  1D5M C;  2MRP A;  2Y5B B;  4GDK B;  2DAF A;  2KFJ A;  3FAH A;  1YX6 B;  3OAW A;  2WYQ A;  1P7E A;  1SSN A;  4GDL A;  3Q8E A;  3IG3 A;  3VVW B;  2JVC A;  1T0Y A;  3Q8F A;  3T3N A;  5D3I B;  3HM3 A;  5DPT A;  4MEM A;  3OG5 A;  3CSF A;  4WQO B;  3NVW A;  4IM0 A;  3RFZ B;  4W9L A;  1RWS A;  5DPR A;  2V3P A;  2JYE A;  2DYM A;  3A9J A;  3SEB A;  2L32 A;  1WR1 A;  1GB4 A;  1HZ6 A;  3DVG X;  2JWU A;  3SHQ A;  4RGN A;  1ROE A;  3ZJT A;  2PJH A;  1RRB A;  3DQV A;  3VHT C;  4NJ7 A;  1V1P A;  2IGD A;  2WDV B;  1SJH D;  3VFK A;  1E0Z A;  3AEA B;  1WGY A;  3SD5 A;  1KJT A;  3GZN I;  3RNB C;  1J19 A;  3L10 B;  3V60 A;  4MSM B;  1N5X A;  4YTM B;  1I4Q A;  2KFK A;  3ZNI D;  4M00 A;  4DWF A;  3P1M A;  3NZS A;  2V3S A;  2MLB A;  5T8I A;  1VRA B;  4A3P A;  4XC2 A;  4XGA B;  3HVZ A;  2IPK D;  3H8H A;  1YN5 A;  2Y5C A;  2RD0 A;  3ZRF A;  1MJD A;  1GUA B;  4B9K A;  1MG8 A;  2UYZ B;  1NYR A;  4P16 A;  1WXQ A;  2V4L A;  3TUO A;  3GS2 A;  1OEY J;  2VRR B;  3A4R A;  2VZK B;  2FBW B;  2TSS A;  3L08 A;  4I6P A;  3RNF C;  3AE1 B;  3NS1 A;  3PLV A;  2K1F A;  4ZYN A;  4E74 A;  5I4D A;  2FCQ A;  1FMA D;  1V97 A;  4LTU A;  3RPF C;  1A70 A;  3AE2 B;  1FNU A;  3T8M A;  4XYC A;  2KYW A;  2PEA A;  2D5G A;  2E6X A;  4WWP A;  3AED B;  5LXH A;  2NBU A;  1WIA A;  2LMC A;  2M17 A;  2RDB C;  3B0A A;  4KV2 A;  2BVC A;  5KHO A;  1OGW A;  1KLG D;  1L5P A;  4EZL A;  2AQ1 B;  3EFU A;  2NTT A;  1KRH A;  2GBJ A;  1E8W A;  2LWP A;  4JQW C;  2KAJ A;  2W9N A;  2L76 A;  2WLB A;  3Q69 A;  5FR6 A;  4F8C B;  1JWM D;  3D32 A;  2PVG C;  2KNB A;  3V6E B;  4YTP B;  2WQY B;  3L17 A;  3LDZ E;  2LZ6 A;  3X23 A;  1T6B X;  1V9J A;  3M3J A;  4RFB A;  1UD7 A;  1M94 A;  4X57 B;  5D94 A;  4MGY E;  3PHW B;  2PLP A;  4XZ4 A;  5BYR A;  2ZCB A;  4JWU C;  1V2Y A;  2Z8L A;  3N1Z C;  3PV1 A;  1AAR A;  2WP9 B;  1C77 A;  2NBV B;  4MSQ B;  2G3Q B;  3Q8A A;  3DBS A;  3FKY A;  3RMK C;  2KWV B;  2M4N A;  2KC1 A;  5E6O A;  3ZNZ B;  3BVM A;  2FE8 A;  2NVU I;  1F52 A;  2D3B A;  3U8Z A;  2A5U A;  4NAM A;  3RNC C;  3AH7 A;  3ABV B;  3FC4 A;  2KQ7 A;  3QC8 B;  4URK A;  1T3Q A;  1N63 A;  4K81 A;  2MW5 A;  3A1Q A;  2INC C;  3AE7 B;  3H1U A;  3AEB B;  4L23 A;  4DDG D;  3APF A;  2WX1 A;  3ZNH B;  3QCA A;  1FEH A;  1C79 A;  1IBX B;  2N9E B;  5AUK A;  2L7R A;  3QK0 A;  4P7I A;  5HFY A;  4XX5 A;  3B2F A;  2IO1 B;  1H4R A;  3Q3F A;  4BOS C;  1WJ6 A;  4BBN F;  2BYT A;  1BT0 A;  2K9X A;  4RM8 A;  2J4X A;  1FRD A;  3M63 B;  3PLU A;  1DGJ A;  4LJP B;  2DEN B;  1Y56 A;  1F1H A;  2NCN A;  4ZHO A;  1GC6 A;  4MM3 A;  2LGX A;  1PGB A;  2KWU B;  1CMX B;  3GP7 A;  2IY0 B;  2J53 A;  3FIL A;  4M0W A;  1QOG A;  1JRO A;  2BKR B;  4ANV A;  2MJE A;  5J18 A;  4PYU A;  2WXF A;  1OTR B;  3VTU A;  4ZRI A;  3VAW A;  4WJO A;  4G3X B;  1FXI A;  2CU1 A;  2KTR A;  2LFI A;  2WXH A;  2MP2 B;  4DXF A;  2ZNV C;  3CMM B;  3U2S C;  1TZ1 A;  2N7D A;  1FIQ A;  4IWP A;  4BAX A;  3P42 A;  4LDT B;  1KM7 A;  2JPH A;  2L3Z A;  3PGE A;  5BYQ A;  3WIM A;  4NJ6 A;  2KJR A;  2NMQ A;  3KUD B;  5EE9 A;  1ZPS A;  5IP4 D;  5JHA A;  4KSL C;  4BKS A;  2K6D B;  1ZW7 A;  2M19 A;  3ZVV A;  2BYF A;  3P63 A;  3W5V B;  1BML C;  4WQM A;  2FID A;  1WE7 A;  3R8B A;  3NG0 A;  2B3A A;  1HQR D;  3Q3O C;  4FJZ A;  1FNV A;  4W9F A;  2K5P A;  4RCO A;  2FCN A;  2GBM A;  2LXA A;  3RT3 B;  4BZA A;  2IO3 B;  3ML8 A;  5BYS A;  3I9V 1;  1RAX A;  3IT6 B;  1R4M I;  1LFD A;  1GC7 A;  2RDH A;  1N60 A;  3ZNG C;  1JWA D;  1WJN A;  3OWE B;  2WXN A;  3W5U B;  3RUI B;  2VZK D;  4FAD A;  3A9K A;  4NNJ B;  1JWB D;  3AEF B;  1MG4 A;  1D5Z C;  3PRE A;  2PTL A;  1I4X A;  3EA6 A;  2LGY A;  4AOF A;  1LQB A;  2HE7 A;  2L0F A;  2CKH B;  3ZXV A;  3ENE A;  2KZR A;  4RM9 A;  4ZHP A;  3CST A;  3ZTC A;  2SEB D;  1DYQ A;  1Q10 A;  1UGJ A;  1F9J A;  2I1J A;  2REX A;  3IBE A;  4PS3 A;  2N1V A;  3S2A A;  2AL3 A;  4REZ A;  2N4F A;  2NPT A;  2ICI A;  3X0W A;  3ZW3 A;  4IW0 A;  2HJ1 A;  4MGK E;  4YSZ B;  1E7P B;  1ZP0 B;  1I4P A;  2HD5 B;  2D10 A;  2WXO A;  3NZU A;  3UI3 A;  1MHX A;  4IC7 B;  3OJ4 B;  4P1B C;  3A33 B;  2N7E A;  2G4D B;  3RI7 C;  3ZIM A;  2KN4 A;  1L0Y B;  3MC9 A;  2WGS A;  2MA9 B;  3RCZ A;  3W1S C;  2Y5P A;  4FN2 A;  5FR3 A;  3H6N A;  3DCG A;  2K8B A;  1S3S G;  1K52 A;  2MJD A;  1Y8R C;  1WF9 A;  2KVZ A;  4K1R B;  1IP9 A;  2EMT A;  4JPS A;  1JCK B;  4EE2 A;  4HVB A;  3PZ8 A;  2AEH A;  2W55 A;  5JZE B;  2KWC A;  2JT4 B;  4BOZ B;  2QDF A;  5BO4 B;  3NOB A;  2KT7 A;  1YIW A;  3L0W B;  1WYG A;  5HHD G;  2CHZ A;  2KN5 A;  2UWQ A;  1AN8 A;  4KKI A;  2BS2 B;  1Z5S B;  4NAW A;  2KMC A;  2PPH A;  2DZK A;  1V1O A;  1QQR A;  1YJJ A;  1VDV A;  4IM2 A;  1VZ7 A;  2ACZ B;  3AN1 A;  5IN7 A;  1JW9 D;  4FHK A;  4K7U A;  3H7P A;  2OHF A;  3PRZ A;  2KD0 A;  2LXC A;  1IGC A;  1QLB B;  2V0G A;  1C4A A;  2O2V B;  2XBB C;  4JLC A;  2M56 B;  4US9 A;  1UH6 A;  4N9F 4;  3GE8 C;  1EF1 A;  4OVV A;  3PS6 A;  1GJZ A;  1NYQ A;  2J7Q B;  2WS3 B;  3BZD B;  2SAK A;  3P4Q B;  4EOY A;  1TIF A;  2RDG A;  1WMH A;  3DVG Y;  1C76 A;  3AEG B;  4ANW A;  4TUU A;  1WR6 E;  2LJ5 A;  2M0A A;  3UIN B;  2WXP A;  1YD8 U;  1QKZ A;  4B0M A;  1NBF C;  3RUL A;  1UNS A;  5HG2 A;  3RNE C;  2RMM A;  1YMH E;  1SE3 A;  3PT2 B;  4IWO A;  3H7S A;  3IAS 1;  5AUI A;  4G0N B;  4D2K A;  1WZ0 A;  2RGF A;  2JX5 A;  4ZDV A;  4HK2 A;  4A3O A;  3QA8 A;  4OW0 A;  3TL5 A;  3EGR A;  3KH0 A;  4DHZ E;  4MJS B;  2IGH A;  1X1M A;  5EE3 A;  4J6I A;  4AUQ C;  2DYO A;  4WJN A;  4ICV A;  2LJI A;  3IT4 B;  1NI3 A;  1T0R C;  3VRA B;  2JRI B;  1XXG A;  2ZVO A;  4HCN B;  2L8J A;  4YWG G;  1VR9 A;  2KXJ A;  1P0R A;  3AV8 A;  5IAA C;  4UDU C;  3B1L X;  1XEE A;  3W1S A;  3HRD D;  4BKG A;  4RF1 A;  1N61 A;  4MGZ E;  1QOA A;  4LNN A;  1WGG A;  2WXK A;  2N0S B;  2LHD A;  2HJ8 A;  5G5G A;  1V8C A;  4M01 A;  3VR8 B;  2O6V B;  3IHP C;  1Q0W B;  2N9X A;  1K53 A;  1EWY C;  3NVV A;  2DAJ A;  5HKH A;  3UIO B;  2KAC A;  1RLF A;  3BK2 A;  1MI0 A;  4CYE A;  2L1A A;  3GOE A;  2J0M A;  3DBL B;  1IPG A;  3VUY A;  1FD6 A;  2KOX A;  2DBY A;  3UQB A;  3NUH B;  4GDK A;  1XLN A;  3HM6 X;  1TS2 A;  2MBB B;  3BWU D;  3KWV A;  3DDC B;  1BUI C;  4C80 A;  3MC8 A;  2KQS A;  2LAS A;  2W54 A;  1LO5 D;  1UEL A;  1XCQ L;  3AEE B;  3UGB B;  1E7U A;  2Z0E B;  1YNT E;  4A20 A;  3Q3J A;  4ITK A;  2N9P C;  2EKE C;  3RD2 A;  3RNA C;  3O65 B;  1R4N B;  2O6V A;  1J7C A;  1WWT A;  3ZJU A;  5HI1 A;  1VJK A;  5LNK 1;  2IYD B;  2JYT A;  2LGS A;  3T9L A;  3U30 A;  3HVD A;  4LNO A;  3L54 A;  3AU4 A;  2JZP A;  3IFW B;  1L0V B;  2IND C;  4A55 A;  1VZ6 A;  1EU3 A;  2KDB A;  4JE3 B;  2GOW A;  1E90 A;  3EUB 2;  1MPE A;  3RYT A;  1HZ5 A;  4I6L B;  2LRW A;  3N32 A;  2K8H A;  3BY4 B;  4FJY A;  1TZO A;  4OZC A;  3VR9 B;  1XQQ A;  4DHJ D;  3ZLZ A;  1D4B A;  3V6C B;  1SBB B;  2JSV X;  2L0T A;  1T0Q C;  3CIR B;  1SGH A;  4USA A;  2Z0D B;  2YLM A;  1KFY B;  1TS5 A;  4NQL B;  2GBN A;  2XK5 B;  1WM2 A;  4LNK A;  2WXG A;  2QMT A;  2RSU A;  3GE3 C;  2R61 A;  2ZZP B;  2KAN A;  1P9D U;  2GLS A;  2ONQ A;  1YJI A;  3N1X C;  2K39 A;  2KTF A;  1J7A A;  1PGX A;  3QQ8 B;  4MAC A;  4FXC A;  1HE8 A;  4C00 A;  3AEC B;  2OJR A;  4KKJ A;  4IWQ A;  4EUT A;  1WY8 A;  3BIN A;  3BVZ A;  3U7Z A;  2NBW B;  1GB1 A;  2R2O A;  1GAQ B;  3DHG C;  4ZRJ A;  2IZV B;  3ZXR A;  1TJE A;  2BWF A;  1UF0 A;  2BBC A;  2BW2 A;  4W9E A;  5EDS A;  3VH3 B;  1J8C A;  2BB5 A;  3P4S B;  1ZE3 D;  5CHF A;  1OQY A;  1V5O A;  3P2B A;  1IUE A;  3NZ3 A;  2BB6 A;  1V80 A;  1FXA A;  2LEK A;  1Z2M A;  4TSS A;  1XO3 A;  2B76 B;  3LYY A;  1SXT A;  3ZUN A;  4M8N A;  1E6E B;  3ZTD A;  1L0X B;  1JRU A;  4NJC A;  1ZGU B;  3WCQ A;  3JYU A;  3PZ7 A;  4LLG M;  1JML A;  4MEL A;  1V49 A;  4JL9 A;  1WJU A;  5EE0 A;  2V4I B;  1EF5 A;  4AQ7 A;  3ONS A;  4II3 B;  4HPM B;  3Q6B A;  4KZC A;  3KUC B;  3TSS A;  2W3S A;  1C78 A;  2QJL A;  2V3N A;  5MPO A;  2M0X A;  3TEW A;  1N62 A;  2WXQ A;  4RH6 A;  2O6V D;  2WU5 B;  4P6V F;  1E5W A;  2JUO A;  1DOX A;  4DXA B;  3DBR B;  2JWZ A;  2ZPY A;  1SF0 A;  4AJY B;  2PKO A;  1DOY A;  2MQJ A;  2QIL A;  1L4D B;  4ANU A;  4WAA A;  4XDC A;  2FAZ A;  2KQ4 X;  4HDO A;  4JWS C;  3K9O B;  1IBX A;  3HIZ A;  2XN9 C;  4PS7 A;  2GB1 A;  3V62 A;  4C4V B;  4GMV A;  3U7D A;  2MEK A;  1OFF A;  2KO3 A;  5TSS A;  3APC A;  1WXA A;  3AE4 B;  3I63 C;  2ZJD A;  5FKA C;  1B9R A;  2R2Q A;  2KX0 A;  4A9A A;  3W9C B;  2ZW0 A;  4HPL B;  2KX3 A;  4NY0 A;  3NVY A;  2WX0 A;  1WM3 A;  3K9P B;  2GBK A;  4HWI B;  3DVN U;  3R3M A;  3AUL A;  3IVF A;  2KDF B;  4KIK B;  2INP E;  2BKF A;  2CHW A;  3R7Q A;  2OOB B;  5D3D A;  4US8 A;  2XEW A;  1E8Z A;  1WGK A;  2VH1 A;  1UBQ A;  4XWW A;  1AYF A;  1M4V A;  3VDZ A;  4XDD A;  3R7R A;  1ET9 A;  1YQ4 B;  4I6N B;  3VH4 B;  2MP2 A;  3BYY B;  1E8X A;  1UWM A;  3KW5 B;  4PT5 A;  5BMH A;  5E6N A;  1SEB D;  2H88 B;  1FCC C;  4HXD A;  4II2 B;  3CWI A;  4HRS A;  2JQR B;  4W9D A;  1TY2 A;  2OJW A;  4FUL A;  4FBJ B;  2L05 A;  4W9G A;  2DLB A;  2E3T A;  3W2D A;  4MT5 A;  1P3Q U;  3M95 A;  1KH0 A;  3PPA A;  5IKC M;  3SFD B;  4GGQ A;  5G5H A;  4B0E A;  4YSY B;  5LLI A;  1A5R A;  1QOB A;  4DDI D;  2IY1 B;  4MH8 A;  4LK0 M;  1CJE A;  1Q5W B;  2KC2 A;  2IJ0 A;  4B95 A;  2ZPN A;  2MWS B;  1V5T A;  3MTN B;  1XLO A;  3DHH C;  4LJO B;  2X8X X;  1WSP A;  3AE5 B;  1WE6 A;  1XT9 B;  3VXW A;  3DWM A;  5BMG A;  3LXF A;  3KLS X;  2JF5 A;  1K8R B;  4K7S A;  4YT0 B;  3Q3N C;  5H8Y E;  4IOI E;  3N30 A;  2V9H A;  4EEW A;  2JZZ A;  4OHJ A;  1FM0 D;  3KYD D;  4RGM A;  3EFC A;  4RGO S;  1WXM A;  2Y3A A;  3AM9 A;  3V61 A;  2MX2 A;  3ZYY X;  3PRP B;  3JSV B;  1I35 A;  1E8Y A;  3VTV A;  4S0R A;  1FFU A;  4ACF A;  4KGT A;  2GI9 A;  4ZRK A;  2CJO A;  3WAL A;  3ALB A;  3TEX A;  1I7H A;  2BQQ A;  5L95 C;  2FUG 1;  2N9K A;  1YN4 A;  2DZI A;  3N20 C;  1SJE D;  2BF8 B;  2J0J A;  3AI5 A;  4BKT A;  1ESF A;  2RR9 A;  2I2Y A;  1VZ8 A;  1WI0 A;  5AZH A;  2IBI B;  1ZDX A;  2C5L C;  4EFO A;  2JZ3 B;  3OJ3 A;  2MCN B;  2N7J A;  3DBL I;  5G2N A;  4EZJ A;  2CU3 A;  5D7G A;  4BFR A;  2WDR B;  4B6W A;  1SIJ A;  3I3T B;  2CS4 A;  2C9W B;  4GLS C;  3O13 A;  4A6Q A;  2KWD A;  3AXC A;  1YJ1 A;  2D3C A;  3URY A;  4K3B A;  1ENF A;  1PYW D;  2N9L A;  3ZRC A;  4XWT A;  2JU6 X;  4FA6 A;  4HLE A;  4WUR A;  2KMM A;  4LNF A;  2J52 A;  1R4N I;  1UUP A;  1XF5 L;  1ISN A;  1NEN B;  2D3A A;  2LGD A;  2LVP A;  4GDL B;  3A4S C;  2DYB A;  2ZEQ A;  1JRP A;  3APD A;  1FRR A;  1BXT A;  4NZL B;  1C4P A;  1TYG B;  4FLH A;  5LXI B;  1GOZ A;  4OVU A;  5KHQ A;  3L13 A;  1JQ4 A;  1VLB A;  3QHT A;  1WGR A;  4KX6 B;  4LDT D;  4RF0 A;  4ARC A;  1L7Y A;  5C2T B;  1G6J A;  3EC8 A;  4F1S A;  1TBE A;  4KZ0 A;  4W9C A;  4J3O D;  2UU7 A;  2O2V A;  3A9J B;  5BMI A;  2X38 A;  1YX5 B;  2PMV A;  3MFG A;  3R66 C;  5DPS A;  4CHK A;  1Q1O A;  2ZCC A;  2LVQ A;  3TBL D;  3L4P A;  4DHZ B;  1STE A;  3RN9 C;  2I38 A;  3MC0 B;  1V1P B;  4ANX A;  1FCL A;  3BVG A;  1KLU D;  4GSW A;  1ACC A;  2G45 B;  5JHB A;  3Q8B A;  4KSK C;  2LHE A;  4G50 A;  5CHV C;  5DPW A;  4DBG A;  3QJZ A;  4TQ1 A;  4HEA 1;  2KFK B;  1TGZ B;  2WU2 B;  2FCM A;  1I4R A;  3HHM A;  3P4P B;  4EZK A;  1WRD B;  1E10 A;  5IA7 A;  5E6P A;  3ZO5 B;  1SE9 A;  1QF6 A;  3MHZ A;  1S1Q B;  2L00 B;  1TKG A;  3DBH B;  4MJS A;  1YN3 A;  2HDE A;  2LUE A;  3ECI A;  4HDQ A;  5D6J B;  2BWE S;  3OLM D;  3TCA A;  2MBO A;  1PUT A;  3KWL A;  2EMS A;  1T5X D;  1C1Y B;  4OZA A;  2YEP F;  4CO7 A;  3W1Y A;  2WXM A;  1WZ3 A;  2K3U A;  3QAR A;  5JXV A;  2JRH A;  3MP9 A;  4W9I A;  2K8C A;  1C3T A;  2LI5 A;  1LM8 B;  2G9H D;  1AWD A;  4C7Y A;  3QX1 A;  1N5W A;  5CHW A;  2WXI A;  1KF6 B;  5C1Z A;  4HKQ A;  4FJV B;  2LVO A;  1FPY A;  3Q8C A;  3CF6 E;  1C4C A;  2WXL A;  2CJN A;  2BGF A;  4W9H A;  2JXT A;  4KDI C;  1WX7 A;  1FO4 A;  2I1K A;  1UBI A;  1GNU A;  1JWU D;  2AL6 A;  1QT9 A;  1V6E A;  2KKC A;  4S17 A;  3NVZ A;  1XD3 B;  2INN E;  5AZF A;  2C7N B;  1T0S C;  3WAN A;  1GG3 A;  2QIE B;  3WA0 A;  3H9D A;  1PGA A;  1RFA A;  3MHS D;  1P98 A;  4TV3 A;  2CR5 A;  1ZUD 2;  3DBR I;  4YSX B;  4CQN A;  3QAQ A;  4K3C A;  3KUZ A;  2HTM E;  4NQK E;  2GMI C;  2K22 A;  2J42 A;  1V81 A;  3R2I A;  3E9S A;  2NS5 A;  2ZW1 A;  4WJQ A;  3HUI A;  2GRI A;  1WYW B;  3TEY A;  3EEC A;  3VUX A;  2KLC A;  3ZDT A;  3RZW C;  1EM7 A;  1HTQ A;  2WXR A;  3P4R B;  3A1Q B;  1LXD A;  3PZD A;  1IYF A;  1WFY A;  4RNA A;  2GBR A;  4W9K A;  5IOI A;  1F2R I;  4O1N A;  1UZX B;  1DOI A;  1L2N A;  4HJK A;  1VCB A;  2D2Q A;  2LUM A;  5J17 A;  3GB1 A;  1TT5 B;  4G11 A;  1GPX A;  2EEL A;  4ZOH C;  4E71 A;  3UQA A;  5FK9 C;  1I42 A;  2BS3 B;  1J0G A;  5CX3 A;  4MM3 B;  1V86 A;  4W9J A;  3I57 A;  4QAY A;  2K6Q A;  2NR2 A;  3KVF B;  4TKN A;  3DWG C;  1YQ3 B;  3NJT A;  1WJ4 A;  3FIL B;  1EUV B;  4M0W B;  1ZOY B;  1OQR A;  1WH3 A;  2M8S A;  3AMZ A;  2PE9 A;  1QOF A;  2H89 B;  3ZQ4 A;  2XK5 A;  3QWZ B;  3GZN B;  2BTE A;  1XLP A;  4R3D A;  4HKZ E;  4MDK E;  2QEJ C;  2WDQ B;  1EO6 A;  2BYV E;  4L2Y A;  2MBQ A;  4GXB A;  2AQ3 B;  3ML9 A;  2YEP B;  2MHJ A;  1F2R C;  1F0Z A;  4GB9 A;  4DQO C;  2KTR B;  4WIP A;  1TY0 A;  3WAO A;  1WXV A;  1H8C A;  4TQ0 A;  2DX5 B;  2DZJ A;  2IDY A;  4OZB A;  4F7Z A;  2FIF A;  4MH0 E;  4YTN B;  3ZDM C;  2WNM A;  4GU2 A;  2WXJ A;  4OVZ A;  4WH4 A;  5CTR C;  3VTW A;  1L6U A;  2FCS A;  1SIF A;  4N6E B;  1R7S A;  1RYJ A;  4RMA A;  4DK5 A;  3NY5 A;  1YQB A;  1TKE A;  3AB5 A;  3V05 A;  1SE2 A;  4IDI A;  4E3C A;  3PO0 A;  3JW0 X;  2V1Y A;  2WWZ A;  1TKY A;  3QIJ A;  2XNA C;  3IXS A;  1NI2 A;  4A8X C;  3SFE B;  2K0P A;  3TIX A;  2AYO B;  4GIV A;  2QC8 A;  2C7M B;  3MJ5 A;  3DOW A;  2J0K A;  3NHE B;  1UGM A;  2RPQ A;  3B9J A;  4IKG A;  1L6V A;  4BVU C;  1YOV B;  1HEZ E;  3Q3M C;  2DHZ A;  4WWO A;  3A9K B;  1TTN A;  4WWM A;  3SDL C;  4AP4 C;  2L52 A;  1MVK A;  3N9Y C;  3U52 E;  4IG7 B;  1ZXH A;  1WGH A;  3BYT B;  3Q2A C;  4RGT A;  1WXS A;  4N59 A;  2W3R A;  3I5J C;  4KDL B;  2QCZ A;  1WGD A;  5EE1 A;  4DXG A;  1L4Z B;  2C7H A;  4MGI E;  2IO0 B;  4EKU A;  4BBN C;  1VD2 A;  2M1M A;  2KLG A;  1AW7 A;  2N1W A;  2VH2 A;  5J2R A;  1JWS D;  2KDE B;  2KVR A;  2D11 A;  1E7V A;  3VUW A;  4ZRP A;  2MJ3 A;  2NPT B;  2PW9 A;  4GOC A;  4PK1 A;  1XCT L;  1EU4 A;  4WJP A;  4M8M A;  2AQ2 B;  1MFW A;  1F77 A;  2KHW B;  3NS8 A;  2ZVN A;  1XLQ A;  3PTF C;  1WX9 A;  2BT6 A;  5C3J B;  4KGR A;  2MH7 A;  3LB8 C;  3LJ3 A;  3M62 B;  3C19 A;  3JVZ X;  4WAF A;  5GMV A;  3TJP A;  2KJ6 A;  2D07 B;  3B08 A;  1E9M A;  1B1Z A;  4HCP B;  4L1B A;  1RM6 C;  1D6E C;  3AE9 B;  1CZP A;  3V3X A;  2WDT B;  2G1E A;  5E6J A;  5JH5 C;  3AU5 A;  1ZXI A;  1TS3 A;  2FUH B;  2KJH B;  1CK1 A;  4C4V A;  1QIL A;  2KDI A;  4N58 A;  2QSD A;  1ET6 A;  3MJW A;  2BS4 B;  2K25 A;  4IM3 A;  3DHI C;  4YL8 A;  1SE4 A;  1I4H A;  4HJG E;  2HTH A;  2KMA A;  2DNF A;  3U4E G;  4LNI A;  1NEK B;  1J7B A;  2YVC A;  2ZNV B;  1KLV A;  4K7W A;  3AE3 B;  3VQI A;  4KIK A;  4NAW B;  2DZM A;  1ZDV A;  1WRI A;  2IO2 B;  4ICU A;  1CQV A;  5C23 A;  5D2M B;  5DCN A;  1UWX A;  3R2T A;  5IO9 A;  2DWQ A;  2CHX A;  4AWJ A;  3H7P B;  2C60 A;  3KYC D;  4NPN A;  3N3K B;  4KVG B;  1K51 A;  3AE8 B;  4XE0 A;  1HA5 A;  4IUM B;  2NTS A;  3BK1 A;  4ASW C;  3SR6 A;  4FHJ A;  4JIO U;  2D3G A;  1SB3 C;  1KTK A;  1WMH B;  3VRB B;  1OEY A;  2IGG A;  1IGD A;  1JAL A;  2LD9 A;  2AWT A;  1HTO A;  3RNG C;  1HXY D;  2BYE A;  3C8Y A;  5G55 A;  4C7Z A;  4ARI A;  1N6Z A;  1LGR A;  2G4S A;  2L83 A;  2OED A;  3DBH I;  1KOT A;  2PVO D; 
#chains in the Genus database with same CATH homology
 2BYF A;  1WY8 A;  3TMP B;  2FID A;  1WE7 A;  3BIN A;  4MJS A;  2B3A A;  2NBW B;  2LUE A;  4FJZ A;  5TR5 A;  2ASQ A;  2R2O A;  3ECI A;  4DHJ B;  5L83 A;  4HDQ A;  4W9F A;  4ZRJ A;  2FCN A;  2KK8 A;  1PQS A;  2QHO A;  2BWE S;  2IZV B;  2JY6 A;  3OLM D;  5D6J B;  3TCA A;  2MBO A;  2GBM A;  2LXA A;  2BWF A;  3RT3 B;  2EMS A;  2IO3 B;  3SU8 X;  3ML8 A;  4W9E A;  1C1Y B;  2MSE D;  4CO7 A;  1WX8 A;  5EDS A;  1RAX A;  1R4M I;  3W1Y A;  1LFD A;  3VH3 B;  1GC7 A;  3ZKJ C;  1J8C A;  3L16 A;  4AJW A;  3PRM B;  3ZNG C;  1WJN A;  1WZ3 A;  3QAR A;  1FXT B;  2JRH A;  5CHF A;  1OQY A;  1V5O A;  3P2B A;  3RUI B;  4BKS D;  4W9I A;  2K8C A;  1C3T A;  2LI5 A;  1LM8 B;  1V80 A;  3DVN V;  4PS8 A;  3A9K A;  4NNJ B;  4FAD A;  3HK0 A;  3QX1 A;  5CHW A;  1Z2M A;  3PRE A;  5C1Z A;  3WAP A;  4FJV B;  2LGY A;  3JSV A;  2LVO A;  1U4A A;  3PSE B;  4AOF A;  1LQB A;  3CF6 E;  2HE7 A;  3WAM A;  2L0F A;  2PE6 B;  2CKH B;  2BGF A;  4W9H A;  3ENE A;  4PYZ A;  2KZR A;  3ZUN A;  4M8N A;  4RM9 A;  5AZG A;  3CST A;  3ZTC A;  3UIP B;  4KDI C;  3ZTD A;  1WX7 A;  1JRU A;  2I1K A;  3PHX B;  1ZGU B;  1F9J A;  2BPS A;  1UBI A;  2MBE A;  1GNU A;  2AL6 A;  2I1J A;  3EHV A;  3JYU A;  4LCD E;  2REX A;  5AEK B;  3IBE A;  4PS3 A;  2N1V A;  1V6E A;  2AL3 A;  2KKC A;  3S2A A;  4MEL A;  1V49 A;  2N4F A;  4JL9 A;  2NPT A;  1WJU A;  3X0W A;  1XD3 B;  3ZW3 A;  1EF5 A;  3ONS A;  4II3 B;  4IW0 A;  4HPM B;  4KZC A;  4WWN A;  3KUC B;  5AZF A;  2A4Z A;  2C7N B;  4MGK E;  1QZE A;  3RZF A;  3DPD A;  3UF8 A;  3WAN A;  2MBH A;  1GG3 A;  2HD5 B;  2D10 A;  1P1A A;  3WA0 A;  2M0X A;  3H9D A;  2JXX A;  4JGH B;  1RFA A;  3MHS D;  3NZU A;  2O6V D;  4IC7 B;  3OJ4 B;  3PVL A;  1P98 A;  3A33 B;  2N7E A;  4TV3 A;  2G4D B;  2CR5 A;  2FNJ B;  3DBR I;  3ZIM A;  1E5W A;  2JUO A;  3QAQ A;  4DXA B;  1NDD A;  2MA9 B;  1D3Z A;  3RCZ A;  3KUZ A;  3W1S C;  2JWZ A;  2Z59 B;  3C0R B;  2ZPY A;  4AJY B;  4FN2 A;  2LRU A;  4GN1 A;  3H6N A;  4NQK E;  2MQJ A;  2GMI C;  1V81 A;  3DCG A;  1ZKH A;  4ANU A;  2K8B A;  4WAA A;  1S3S G;  2MRP A;  2Y5B B;  2FAZ A;  4GDK B;  2NS5 A;  4HDO A;  2DAF A;  1Y8R C;  1WF9 A;  2KFJ A;  4WJQ A;  1YX6 B;  3OAW A;  4K1R B;  1IP9 A;  1WYW B;  3K9O B;  2EMT A;  2WYQ A;  3EEC A;  3HIZ A;  4HVB A;  3VUX A;  2KLC A;  3ZDT A;  4PS7 A;  3RZW C;  2AEH A;  4GDL A;  3IG3 A;  3A1Q B;  3VVW B;  2JVC A;  1T0Y A;  1LXD A;  2KWC A;  3V62 A;  2JT4 B;  3PZD A;  4BOZ B;  5JZE B;  5BO4 B;  4GMV A;  3NOB A;  1YIW A;  3L0W B;  3U7D A;  1IYF A;  1WFY A;  2GBR A;  3HM3 A;  2CHZ A;  4W9K A;  5DPT A;  2KN5 A;  2KO3 A;  4MEM A;  3CSF A;  2UWQ A;  3APC A;  1WXA A;  4WQO B;  1Z5S B;  4NAW A;  2ZJD A;  2KMC A;  1UZX B;  2R2Q A;  4IM0 A;  1L2N A;  2PPH A;  2KX0 A;  4HJK A;  2DZK A;  1VCB A;  2D2Q A;  4HPL B;  4W9L A;  2KX3 A;  4NY0 A;  5DPR A;  2WX0 A;  4IM2 A;  1WM3 A;  5J17 A;  3K9P B;  2DYM A;  2GBK A;  3A9J A;  4HWI B;  4G11 A;  3DVN U;  3R3M A;  4E71 A;  3AUL A;  3UQA A;  1WR1 A;  3IVF A;  2KDF B;  4FHK A;  4K7U A;  4KIK B;  1I42 A;  1J0G A;  3H7P A;  3PRZ A;  5CX3 A;  2KD0 A;  1V86 A;  3DVG X;  2BKF A;  2CHW A;  3R7Q A;  4W9J A;  2LXC A;  2OOB B;  3SHQ A;  2K6Q A;  2NR2 A;  2PJH A;  1RRB A;  3DQV A;  3KVF B;  4NJ7 A;  4TKN A;  3VHT C;  2XEW A;  2O2V B;  1E8Z A;  1WJ4 A;  2XBB C;  4JLC A;  1EUV B;  4M0W B;  1UBQ A;  1UH6 A;  4N9F 4;  3VFK A;  1EF1 A;  1WGY A;  3VDZ A;  4OVV A;  1WH3 A;  2M8S A;  3PS6 A;  3R7R A;  1KJT A;  2PE9 A;  3SD5 A;  3GZN I;  4I6N B;  1GJZ A;  2J7Q B;  2XK5 A;  1J19 A;  3VH4 B;  2MP2 A;  3L10 B;  3V60 A;  3QWZ B;  4EOY A;  4MSM B;  1WMH A;  2KFK A;  1E8X A;  3DVG Y;  4MDK E;  1EO6 A;  2BYV E;  2MBQ A;  3KW5 B;  3ZNI D;  4GXB A;  3ML9 A;  4ANW A;  4TUU A;  1WR6 E;  4GB9 A;  2KTR B;  4DWF A;  2LJ5 A;  5E6N A;  3NZS A;  3UIN B;  2V3S A;  2MLB A;  4HXD A;  4II2 B;  1WXV A;  3WAO A;  4A3P A;  1YD8 U;  1H8C A;  4XC2 A;  4TQ0 A;  1NBF C;  4W9D A;  3RUL A;  2DX5 B;  2DZJ A;  4FUL A;  4FBJ B;  2L05 A;  4W9G A;  2RD0 A;  3ZRF A;  4F7Z A;  2FIF A;  4MH0 E;  1P3Q U;  3M95 A;  3PT2 B;  3ZDM C;  4IWO A;  1GUA B;  3H7S A;  3PPA A;  4GU2 A;  4G0N B;  4B9K A;  1MG8 A;  5CTR C;  4GGQ A;  3VTW A;  2UYZ B;  2FCS A;  1WZ0 A;  1SIF A;  2V4L A;  5LLI A;  2RGF A;  1OEY J;  2VRR B;  4RMA A;  1A5R A;  4DK5 A;  3NY5 A;  4DDI D;  3A4R A;  1YQB A;  4ZDV A;  4I6P A;  3L08 A;  2IY1 B;  4HK2 A;  4A3O A;  3QA8 A;  3TL5 A;  3PLV A;  1Q5W B;  2KC2 A;  4E3C A;  2K1F A;  4ZYN A;  3KH0 A;  4DHZ E;  4E74 A;  4B95 A;  2FCQ A;  3JW0 X;  4MJS B;  1X1M A;  2V1Y A;  2ZPN A;  2WWZ A;  2MWS B;  1V5T A;  3MTN B;  4J6I A;  3QIJ A;  4LJO B;  1NI2 A;  4AUQ C;  2DYO A;  4WJN A;  4EUT A;  4ICV A;  1WE6 A;  1XT9 B;  3VXW A;  3TIX A;  3T8M A;  2AYO B;  4GIV A;  2PEA A;  2C7M B;  2JF5 A;  1K8R B;  4K7S A;  3DOW A;  2J0K A;  3NHE B;  1UGM A;  2JRI B;  2RPQ A;  4WWP A;  2ZVO A;  3N30 A;  4HCN B;  4EEW A;  2JZZ A;  2L8J A;  1WIA A;  2NBU A;  4BVU C;  5LXH A;  2M17 A;  3KYD D;  2DHZ A;  4WWO A;  2KXJ A;  1P0R A;  5IAA C;  3B0A A;  4KV2 A;  3B1L X;  5KHO A;  3A9K B;  3W1S A;  1OGW A;  1WXM A;  4BKG A;  4EZL A;  3EFU A;  1TTN A;  3SDL C;  3V61 A;  2MX2 A;  4AP4 C;  3PRP B;  3JSV B;  4MGZ E;  2GBJ A;  1E8W A;  1E8Y A;  2LWP A;  4JQW C;  2W9N A;  2L76 A;  5FR6 A;  3VTV A;  4F8C B;  4IG7 B;  1WGG A;  3D32 A;  4ZRK A;  1WGH A;  2KNB A;  3V6E B;  1WXS A;  2HJ8 A;  3WAL A;  3ALB A;  3L17 A;  4KDL B;  3LDZ E;  2LZ6 A;  3X23 A;  1WGD A;  1V9J A;  2O6V B;  3IHP C;  3M3J A;  2C7H A;  1UD7 A;  4MGI E;  2IO0 B;  4EKU A;  1Q0W B;  4BBN C;  1VD2 A;  2M1M A;  5L95 C;  1M94 A;  2DZI A;  2N9X A;  2KLG A;  4X57 B;  2N1W A;  5D94 A;  5J2R A;  2BF8 B;  4MGY E;  3PHW B;  2J0J A;  3AI5 A;  4XZ4 A;  2KDE B;  2KVR A;  2D11 A;  4BKT A;  1E7V A;  2RR9 A;  2ZCB A;  3VUW A;  1WI0 A;  2DAJ A;  5AZH A;  2NPT B;  5HKH A;  4GOC A;  2IBI B;  3UIO B;  1V2Y A;  3PV1 A;  1AAR A;  4WJP A;  2C5L C;  4M8M A;  4EFO A;  2KHW B;  3NS8 A;  2ZVN A;  1RLF A;  2JZ3 B;  3OJ3 A;  2MCN B;  3DBL I;  3PTF C;  1WX9 A;  4CYE A;  5G2N A;  4EZJ A;  2NBV B;  4MSQ B;  3GOE A;  2G3Q B;  2J0M A;  5D7G A;  1IPG A;  3LJ3 A;  4BFR A;  3DBS A;  3M62 B;  3VUY A;  4B6W A;  3JVZ X;  3I3T B;  2KOX A;  5GMV A;  2KWV B;  2CS4 A;  2M4N A;  2KC1 A;  5E6O A;  2C9W B;  3ZNZ B;  3TJP A;  2KJ6 A;  2D07 B;  3UQB A;  3B08 A;  4GDK A;  2NVU I;  4HCP B;  3AXC A;  3HM6 X;  3U8Z A;  2MBB B;  1YJ1 A;  2A5U A;  2WDT B;  5JH5 C;  3AU5 A;  2KQ7 A;  3QC8 B;  2FUH B;  4URK A;  3DDC B;  4K81 A;  2MW5 A;  2KJH B;  3A1Q A;  3H1U A;  3ZRC A;  4DDG D;  2KQS A;  3APF A;  2WX1 A;  2LAS A;  3ZNH B;  4FA6 A;  4HLE A;  1UEL A;  3QCA A;  2KDI A;  3MJW A;  3UGB B;  1E7U A;  2N9E B;  1R4N I;  2LGD A;  2K25 A;  1ISN A;  2L7R A;  2Z0E B;  4IM3 A;  3Q3J A;  3QK0 A;  4A20 A;  4YL8 A;  2LVP A;  4P7I A;  2N9P C;  2EKE C;  4GDL B;  3A4S C;  3RD2 A;  3O65 B;  2DYB A;  2ZEQ A;  4XX5 A;  1I35 A;  2IO1 B;  3APD A;  1H4R A;  2HTH A;  2O6V A;  3Q3F A;  4BOS C;  4FLH A;  2KMA A;  5LXI B;  1WJ6 A;  4OVU A;  5KHQ A;  3L13 A;  2IYD B;  4BBN F;  1BT0 A;  3QHT A;  3T9L A;  4RM8 A;  1WGR A;  3U30 A;  3L54 A;  4LDT D;  2YVC A;  2ZNV B;  3M63 B;  3AU4 A;  1KLV A;  3PLU A;  4LJP B;  2DEN B;  1L7Y A;  4K7W A;  3VQI A;  4KIK A;  3IFW B;  4NAW B;  1G6J A;  2NCN A;  3EC8 A;  1GC6 A;  4MM3 A;  2DZM A;  2KDB A;  2LGX A;  4F1S A;  2GOW A;  1E90 A;  1TBE A;  1CMX B;  2KWU B;  4KZ0 A;  4W9C A;  2IO2 B;  3RYT A;  4ICU A;  4I6L B;  2LRW A;  3N32 A;  2K8H A;  5C23 A;  5D2M B;  5DCN A;  2O2V A;  3A9J B;  2IY0 B;  3BY4 B;  4FJY A;  2CHX A;  1XQQ A;  1YX5 B;  5DPS A;  4AWJ A;  3R66 C;  3H7P B;  4CHK A;  2BKR B;  1Q1O A;  4ANV A;  4DHJ D;  2ZCC A;  5J18 A;  2C60 A;  4PYU A;  2LVQ A;  3ZLZ A;  1OTR B;  3KYC D;  3TBL D;  3V6C B;  3VTU A;  4ZRI A;  3VAW A;  4NPN A;  4DHZ B;  2L0T A;  4WJO A;  1SGH A;  4ANX A;  3N3K B;  4G3X B;  4GSW A;  4KVG B;  2Z0D B;  2G45 B;  2YLM A;  5JHB A;  2CU1 A;  4NQL B;  4KSK C;  2KTR A;  2GBN A;  4IUM B;  2XK5 B;  4G50 A;  1WM2 A;  2MP2 B;  4ASW C;  5CHV C;  2RSU A;  2ZNV C;  3CMM B;  2ZZP B;  2KAN A;  5DPW A;  1P9D U;  4FHJ A;  3QJZ A;  1TZ1 A;  2N7D A;  4TQ1 A;  4DBG A;  4JIO U;  2D3G A;  1WMH B;  2K39 A;  1TGZ B;  2KFK B;  4IWP A;  1OEY A;  2FCM A;  4LDT B;  1KM7 A;  3HHM A;  4EZK A;  2JPH A;  1WRD B;  2L3Z A;  3PGE A;  2KTF A;  3WIM A;  4NJ6 A;  5IA7 A;  2KJR A;  2LD9 A;  2AWT A;  3QQ8 B;  5E6P A;  2BYE A;  3KUD B;  3ZO5 B;  5G55 A;  1SE9 A;  1HE8 A;  5JHA A;  4KSL C;  4BKS A;  2K6D B;  1ZW7 A;  3DBH I;  2G4S A;  2OJR A;  1KOT A;  4IWQ A;  1S1Q B;  2L00 B;  3ZVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...