1WE8A

Solution structure of kh domain in protein bab28342
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
GSSGSSGILTENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor and KH domain containing protein
publication title Solution structure of KH domain in protein BAB28342
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1we8A01
2JZXA 2OPUA 5C0XG 1ZTGA 2JEAI 2CTEA 4JVHA 2CTLA 2ANRA 1VIGA 2BA0A 3AEVB 2JA9A 2JVZA 2PQUA 2HH3A 3VKEA 2MJHA 2P2RA 4AM3A 1EC6A 1X4NA 4NBQA 5JEAG 1WE8A 2AXYA 1KHMA 2QNDA 4WALA 2E3UA 1J5KA 1WVNA 2HH2A 4JVYA 1DT4A 2JEBI 4BA1I 1TUAA 2CTFA 4OO1G 3V69A 4AIMA 4B8TA 2DGRA 1ZZJA 2ANNA 4IFDG 4WANA 2CTJA 4QMFB 3U1KA 2JE6I 1ZZKA 2BL5A 2CTMA 2OPVA 1J4WA 5K36G 2NN6G 2CTKA 1ZZIA 1DTJA 2Z0SA 1K1GA 2CPQA 2PY9A 3L7ZC 1VIHA 2YQRA 4BA2I 2FMRA 1X4MA 4LIJA
chains in the Genus database with same CATH superfamily
2JZXA 2UXDH 4B3SH 2CTEA 4NXMH 1V9NA 4B3TH 2JEAI 2PQUA 2HH3A 2UU9H 1EC6A 1XRHA 4LF5H 5JEAG 3NCVA 1S20A 2ZQEA 2FFMA 1SEIA 4DV2H 2LTMA 2AXYA 4G08A 5BR8H 1N32H 4WALA 4YHHH 4LF9H 4H8AA 1FKAH 3SB1A 3J81W 2HH2A 4BA1I 2UUBH 1AN7A 3V69A 4AIMA 4OO1G 4IFDG 1XNRH 4JI8H 1ZZKA 2M8WA 3GABA 4LFBH 2D9IA 1HNXH 2NN6G 2CTKA 1ZZIA 1K1GA 4DR4H 5DT9A 2PY9A 5IWAH 4BA2I 1I94H 4LIJA 2OPUA 5C0XG 1IBMH 2LRRA 2ANRA 3AEVB 4JI5H 4DR7H 2JA9A 4DUYH 3RF2A 4OCHA 1ODHA 4DV3H 2UUCH 1NXUA 1IBKH 1MSZA 1X4NA 3QD7X 1N36H 4JI7H 4B3MH 4DR6H 1XNQH 1WE8A 4NZTM 4LFAH 2UXBH 4LF6H 2QNDA 2CWHA 3JAMW 1HNZH 1WVNA 1J5EH 1VBIA 4X65H 2X06A 5LMNH 2F4VH 5FLXW 1TUAA 4NZRM 2ZM6H 4WANA 4GKJH 2CTJA 3U1KA 2JE6I 4PDBA 2CTMA 2K1HA 2E5LH 1FJGH 5IT9W 4OX9H 4JYAH 4X66H 4DV4H 3UOEA 1X0AA 1F0XA 2A1SA 2LTLA 2PT7G 4JVHA 2CTLA 2BA0A 4YY3H 4OD6A 4DUZH 4DR2H 5LL6b 2MJHA 4DR1H 2P2RA 4JI6H 4B3RH 1X9ZA 4DV5H 4AM3A 4NBQA 2HHHH 4LF8H 1V8CA 2CWFA 2CPMA 5A2QW 4DR3H 2E3UA 1J5KA 1IBLH 3GKUA 3I0PA 4JVYA 1DT4A 2JEBI 2VQFH 1XMOH 2UXCH 2DGRA 3J7AK 2BL5A 3FAUA 4DR5H 1J4WA 1S03G 2LF0A 1XMQH 2Z0SA 4JI2H 4LF4H 3L7ZC 3OSSD 3EZJA 2FMRA 4K0KH 1X4MA 3KDGA 2VQEH 3OTOH 3T1YH 1ZTGA 4JI0H 1HNWH 1VIGA 2JVZA 4LFCH 1N34H 3VKEA 1WHRA 4LF7H 2O4CA 4FJSA 4X62H 3T1HH 4DV0H 1HR0H 1WTJA 5LMUH 4DV1H 2Y3MA 4DV6H 1KHMA 3J80W 3KDKA 1Z2IA 4DV7H 3OETA 2M6QA 4GKKH 2VKCA 3GR5A 2UUAH 2CTFA 4EC5A 4KHPH 2FPHX 1I6UA 4B8TA 4JI3H 1ZZJA 2ANNA 4JV5H 4QMFB 2G8YA 4AQYH 4B8CD 5K36G 2OPVA 4JI1H 1PQXA 4FJUA 1DTJA 4JI4H 2CPQA 1N33H 4X64H 1UG8A 1VIHA 2YQRA 4E9JA 4NXNH
chains in the Genus database with same CATH topology
2JZXA 2OPUA 5C0XG 1ZTGA 2JEAI 2CTEA 4JVHA 2CTLA 2ANRA 1VIGA 2BA0A 3AEVB 2JA9A 2JVZA 2PQUA 2HH3A 3VKEA 2MJHA 2P2RA 4AM3A 1EC6A 1X4NA 4NBQA 5JEAG 1WE8A 2AXYA 1KHMA 2QNDA 4WALA 2E3UA 1J5KA 1WVNA 2HH2A 4JVYA 1DT4A 2JEBI 4BA1I 1TUAA 2CTFA 4OO1G 3V69A 4AIMA 4B8TA 2DGRA 1ZZJA 2ANNA 4IFDG 4WANA 2CTJA 4QMFB 3U1KA 2JE6I 1ZZKA 2BL5A 2CTMA 2OPVA 1J4WA 5K36G 2NN6G 2CTKA 1ZZIA 1DTJA 2Z0SA 1K1GA 2CPQA 2PY9A 3L7ZC 1VIHA 2YQRA 4BA2I 2FMRA 1X4MA 4LIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZX A;  2OPU A;  5C0X G;  1ZTG A;  2JEA I;  2CTE A;  4JVH A;  2CTL A;  2ANR A;  1VIG A;  2BA0 A;  3AEV B;  2JA9 A;  2JVZ A;  2PQU A;  2HH3 A;  3VKE A;  2MJH A;  2P2R A;  4AM3 A;  1EC6 A;  1X4N A;  4NBQ A;  5JEA G;  1WE8 A;  2AXY A;  1KHM A;  2QND A;  4WAL A;  2E3U A;  1J5K A;  1WVN A;  2HH2 A;  4JVY A;  1DT4 A;  2JEB I;  4BA1 I;  1TUA A;  2CTF A;  4OO1 G;  3V69 A;  4AIM A;  4B8T A;  2DGR A;  1ZZJ A;  2ANN A;  4IFD G;  4WAN A;  2CTJ A;  4QMF B;  3U1K A;  2JE6 I;  1ZZK A;  2BL5 A;  2CTM A;  2OPV A;  1J4W A;  5K36 G;  2NN6 G;  2CTK A;  1ZZI A;  1DTJ A;  2Z0S A;  1K1G A;  2CPQ A;  2PY9 A;  3L7Z C;  1VIH A;  2YQR A;  4BA2 I;  2FMR A;  1X4M A;  4LIJ A; 
#chains in the Genus database with same CATH topology
 2JZX A;  2UXD H;  4B3S H;  2CTE A;  4NXM H;  1V9N A;  4B3T H;  2JEA I;  2PQU A;  2HH3 A;  2UU9 H;  1EC6 A;  1XRH A;  4LF5 H;  5JEA G;  3NCV A;  1S20 A;  2ZQE A;  2FFM A;  1SEI A;  4DV2 H;  2LTM A;  2AXY A;  4G08 A;  5BR8 H;  1N32 H;  4WAL A;  4YHH H;  4LF9 H;  4H8A A;  1FKA H;  3SB1 A;  3J81 W;  2HH2 A;  4BA1 I;  2UUB H;  1AN7 A;  3V69 A;  4AIM A;  4OO1 G;  4IFD G;  1XNR H;  4JI8 H;  1ZZK A;  2M8W A;  3GAB A;  4LFB H;  2D9I A;  1HNX H;  2NN6 G;  2CTK A;  1ZZI A;  1K1G A;  4DR4 H;  5DT9 A;  2PY9 A;  5IWA H;  4BA2 I;  1I94 H;  4LIJ A;  2OPU A;  5C0X G;  1IBM H;  2LRR A;  2ANR A;  3AEV B;  4JI5 H;  4DR7 H;  2JA9 A;  4DUY H;  3RF2 A;  4OCH A;  1ODH A;  4DV3 H;  2UUC H;  1NXU A;  1IBK H;  1MSZ A;  1X4N A;  3QD7 X;  1N36 H;  4JI7 H;  4B3M H;  4DR6 H;  1XNQ H;  1WE8 A;  4NZT M;  4LFA H;  2UXB H;  4LF6 H;  2QND A;  2CWH A;  3JAM W;  1HNZ H;  1WVN A;  1J5E H;  1VBI A;  4X65 H;  2X06 A;  5LMN H;  2F4V H;  5FLX W;  1TUA A;  4NZR M;  2ZM6 H;  4WAN A;  4GKJ H;  2CTJ A;  3U1K A;  2JE6 I;  4PDB A;  2CTM A;  2K1H A;  2E5L H;  1FJG H;  5IT9 W;  4OX9 H;  4JYA H;  4X66 H;  4DV4 H;  3UOE A;  1X0A A;  1F0X A;  2A1S A;  2LTL A;  2PT7 G;  4JVH A;  2CTL A;  2BA0 A;  4YY3 H;  4OD6 A;  4DUZ H;  4DR2 H;  5LL6 b;  2MJH A;  4DR1 H;  2P2R A;  4JI6 H;  4B3R H;  1X9Z A;  4DV5 H;  4AM3 A;  4NBQ A;  2HHH H;  4LF8 H;  1V8C A;  2CWF A;  2CPM A;  5A2Q W;  4DR3 H;  2E3U A;  1J5K A;  1IBL H;  3GKU A;  3I0P A;  4JVY A;  1DT4 A;  2JEB I;  2VQF H;  1XMO H;  2UXC H;  2DGR A;  3J7A K;  2BL5 A;  3FAU A;  4DR5 H;  1J4W A;  1S03 G;  2LF0 A;  1XMQ H;  2Z0S A;  4JI2 H;  4LF4 H;  3L7Z C;  3OSS D;  3EZJ A;  2FMR A;  4K0K H;  1X4M A;  3KDG A;  2VQE H;  3OTO H;  3T1Y H;  1ZTG A;  4JI0 H;  1HNW H;  1VIG A;  2JVZ A;  4LFC H;  1N34 H;  3VKE A;  1WHR A;  4LF7 H;  2O4C A;  4FJS A;  4X62 H;  3T1H H;  4DV0 H;  1HR0 H;  1WTJ A;  5LMU H;  4DV1 H;  2Y3M A;  4DV6 H;  1KHM A;  3J80 W;  3KDK A;  1Z2I A;  4DV7 H;  3OET A;  2M6Q A;  4GKK H;  2VKC A;  3GR5 A;  2UUA H;  2CTF A;  4EC5 A;  4KHP H;  2FPH X;  1I6U A;  4B8T A;  4JI3 H;  1ZZJ A;  2ANN A;  4JV5 H;  4QMF B;  2G8Y A;  4AQY H;  4B8C D;  5K36 G;  2OPV A;  4JI1 H;  1PQX A;  4FJU A;  1DTJ A;  4JI4 H;  2CPQ A;  1N33 H;  4X64 H;  1UG8 A;  1VIH A;  2YQR A;  4E9J A;  4NXN H; 
#chains in the Genus database with same CATH homology
 2JZX A;  2OPU A;  5C0X G;  1ZTG A;  2JEA I;  2CTE A;  4JVH A;  2CTL A;  2ANR A;  1VIG A;  2BA0 A;  3AEV B;  2JA9 A;  2JVZ A;  2PQU A;  2HH3 A;  3VKE A;  2MJH A;  2P2R A;  4AM3 A;  1EC6 A;  1X4N A;  4NBQ A;  5JEA G;  1WE8 A;  2AXY A;  1KHM A;  2QND A;  4WAL A;  2E3U A;  1J5K A;  1WVN A;  2HH2 A;  4JVY A;  1DT4 A;  2JEB I;  4BA1 I;  1TUA A;  2CTF A;  4OO1 G;  3V69 A;  4AIM A;  4B8T A;  2DGR A;  1ZZJ A;  2ANN A;  4IFD G;  4WAN A;  2CTJ A;  4QMF B;  3U1K A;  2JE6 I;  1ZZK A;  2BL5 A;  2CTM A;  2OPV A;  1J4W A;  5K36 G;  2NN6 G;  2CTK A;  1ZZI A;  1DTJ A;  2Z0S A;  1K1G A;  2CPQ A;  2PY9 A;  3L7Z C;  1VIH A;  2YQR A;  4BA2 I;  2FMR A;  1X4M A;  4LIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...