1WE8A

Solution structure of kh domain in protein bab28342
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
GSSGSSGILTENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor and KH domain containing protein
publication title Solution structure of KH domain in protein BAB28342
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1we8A01
1ZTGA 5K36G 1X4MA 1KHMA 1ZZIA 2JA9A 2CTLA 2QNDA 5JEAG 4BA2I 2OPVA 2PY9A 4OO1G 4LIJA 2DGRA 1WE8A 2CTJA 2JVZA 4NBQA 1DTJA 1ZZKA 4B8TA 3VKEA 4WANA 4AIMA 1EC6A 2JE6I 4AM3A 1TUAA 2P2RA 1DT4A 1X4NA 3L7ZC 2BL5A 1WVNA 2HH2A 2OPUA 1K1GA 1VIHA 2CTFA 2HH3A 2YQRA 2CTEA 2ANRA 5C0XG 2ANNA 2JEAI 1ZZJA 2NN6G 4QMFB 2AXYA 3AEVB 2JZXA 2PQUA 3V69A 1J4WA 2CPQA 4JVYA 4JVHA 2MJHA 2Z0SA 4BA1I 2FMRA 1VIGA 3U1KA 4IFDG 2E3UA 2JEBI 4WALA 1J5KA 2CTMA 2BA0A 2CTKA
chains in the Genus database with same CATH superfamily
2UXBH 1X4MA 4DR3H 1IBKH 2X06A 3I0PA 2CTLA 4LFCH 3EZJA 2LF0A 1F0XA 4FJUA 4LIJA 2PY9A 5IT9W 3OSSD 1HNWH 1VBIA 4WANA 1I94H 1J5EH 4AIMA 4B3TH 1EC6A 4LF8H 3KDKA 1X4NA 3L7ZC 2UUAH 1K1GA 4JI2H 4JV5H 2ANNA 4YY3H 5C0XG 4GKKH 1ZZJA 2AXYA 3T1HH 3AEVB 2JZXA 1X0AA 2Y3MA 4K0KH 3GABA 4JI7H 2CPMA 3GKUA 1HR0H 2A1SA 3GR5A 3UOEA 1XNRH 2CTKA 2K1HA 1ZTGA 3OETA 1XMOH 4LF9H 1ZZIA 2JA9A 4NZRM 4OCHA 2FFMA 4OD6A 1WE8A 1N36H 4NXMH 2JVZA 4DV6H 1DTJA 2G8YA 2VQFH 4DV4H 4KHPH 3VKEA 3KDGA 1XMQH 1WHRA 1TUAA 1HNXH 2OPUA 3SB1A 4EC5A 1IBLH 1VIHA 2HH3A 2LTMA 2CTEA 2ANRA 1FKAH 4DR7H 4B8CD 2PQUA 4DR6H 3V69A 4LF6H 4LFAH 5FLXW 1N32H 4BA1I 1NXUA 4LF7H 1VIGA 5A2QW 2VKCA 4B3SH 1AN7A 3FAUA 2M8WA 2LTLA 3U1KA 2E3UA 4DV0H 2JEBI 2CWHA 1S03G 4WALA 4B3MH 4JI5H 4DV5H 5K36G 4DV7H 2F4VH 1I6UA 3NCVA 4DUZH 4FJSA 2QNDA 2PT7G 4GKJH 4JI3H 4OO1G 4X65H 2FPHX 2CTJA 4X62H 2M6QA 4NBQA 3J7AK 1SEIA 4DV2H 1V8CA 2HHHH 2UU9H 5IWAH 2P2RA 1DT4A 4JYAH 1WVNA 2BL5A 4G08A 1FJGH 1XNQH 2D9IA 2CTFA 2ZM6H 2UUCH 1Z2IA 2JEAI 4DR5H 4QMFB 1ODHA 1N33H 3T1YH 1WTJA 2E5LH 4JI0H 1HNZH 1PQXA 4B3RH 3J80W 4LFBH 1IBMH 4IFDG 4DUYH 4LF4H 3JAMW 2LRRA 1X9ZA 1J5KA 4AM3A 3RF2A 4E9JA 1KHMA 4JI1H 5LMUH 4DV3H 5DT9A 1V9NA 5JEAG 2UXCH 4BA2I 2OPVA 1N34H 1S20A 2DGRA 4X64H 4DR1H 4DV1H 4AQYH 3QD7X 4X66H 1ZZKA 2O4CA 4B8TA 4NZTM 4YHHH 4JI4H 4DR4H 2JE6I 1XRHA 1MSZA 1UG8A 5BR8H 2HH2A 4LF5H 5LL6b 4NXNH 2YQRA 2VQEH 3OTOH 2NN6G 2UXDH 4JI6H 4JI8H 4H8AA 2ZQEA 2CWFA 2CPQA 1J4WA 4JVYA 4JVHA 2MJHA 2UUBH 2Z0SA 4PDBA 2FMRA 5LMNH 4DR2H 3J81W 4OX9H 2CTMA 2BA0A
chains in the Genus database with same CATH topology
1ZTGA 5K36G 1X4MA 1KHMA 1ZZIA 2JA9A 2CTLA 2QNDA 5JEAG 4BA2I 2OPVA 2PY9A 4OO1G 4LIJA 2DGRA 1WE8A 2CTJA 2JVZA 4NBQA 1DTJA 1ZZKA 4B8TA 3VKEA 4WANA 4AIMA 1EC6A 2JE6I 4AM3A 1TUAA 2P2RA 1DT4A 1X4NA 3L7ZC 2BL5A 1WVNA 2HH2A 2OPUA 1K1GA 1VIHA 2CTFA 2HH3A 2YQRA 2CTEA 2ANRA 5C0XG 2ANNA 2JEAI 1ZZJA 2NN6G 4QMFB 2AXYA 3AEVB 2JZXA 2PQUA 3V69A 1J4WA 2CPQA 4JVYA 4JVHA 2MJHA 2Z0SA 4BA1I 2FMRA 1VIGA 3U1KA 4IFDG 2E3UA 2JEBI 4WALA 1J5KA 2CTMA 2BA0A 2CTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTG A;  5K36 G;  1X4M A;  1KHM A;  1ZZI A;  2JA9 A;  2CTL A;  2QND A;  5JEA G;  4BA2 I;  2OPV A;  2PY9 A;  4OO1 G;  4LIJ A;  2DGR A;  1WE8 A;  2CTJ A;  2JVZ A;  4NBQ A;  1DTJ A;  1ZZK A;  4B8T A;  3VKE A;  4WAN A;  4AIM A;  1EC6 A;  2JE6 I;  4AM3 A;  1TUA A;  2P2R A;  1DT4 A;  1X4N A;  3L7Z C;  2BL5 A;  1WVN A;  2HH2 A;  2OPU A;  1K1G A;  1VIH A;  2CTF A;  2HH3 A;  2YQR A;  2CTE A;  2ANR A;  5C0X G;  2ANN A;  2JEA I;  1ZZJ A;  2NN6 G;  4QMF B;  2AXY A;  3AEV B;  2JZX A;  2PQU A;  3V69 A;  1J4W A;  2CPQ A;  4JVY A;  4JVH A;  2MJH A;  2Z0S A;  4BA1 I;  2FMR A;  1VIG A;  3U1K A;  4IFD G;  2E3U A;  2JEB I;  4WAL A;  1J5K A;  2CTM A;  2BA0 A;  2CTK A; 
#chains in the Genus database with same CATH topology
 2UXB H;  1X4M A;  4DR3 H;  1IBK H;  2X06 A;  3I0P A;  2CTL A;  4LFC H;  3EZJ A;  2LF0 A;  1F0X A;  4FJU A;  4LIJ A;  2PY9 A;  5IT9 W;  3OSS D;  1HNW H;  1VBI A;  4WAN A;  1I94 H;  1J5E H;  4AIM A;  4B3T H;  1EC6 A;  4LF8 H;  3KDK A;  1X4N A;  3L7Z C;  2UUA H;  1K1G A;  4JI2 H;  4JV5 H;  2ANN A;  4YY3 H;  5C0X G;  4GKK H;  1ZZJ A;  2AXY A;  3T1H H;  3AEV B;  2JZX A;  1X0A A;  2Y3M A;  4K0K H;  3GAB A;  4JI7 H;  2CPM A;  3GKU A;  1HR0 H;  2A1S A;  3GR5 A;  3UOE A;  1XNR H;  2CTK A;  2K1H A;  1ZTG A;  3OET A;  1XMO H;  4LF9 H;  1ZZI A;  2JA9 A;  4NZR M;  4OCH A;  2FFM A;  4OD6 A;  1WE8 A;  1N36 H;  4NXM H;  2JVZ A;  4DV6 H;  1DTJ A;  2G8Y A;  2VQF H;  4DV4 H;  4KHP H;  3VKE A;  3KDG A;  1XMQ H;  1WHR A;  1TUA A;  1HNX H;  2OPU A;  3SB1 A;  4EC5 A;  1IBL H;  1VIH A;  2HH3 A;  2LTM A;  2CTE A;  2ANR A;  1FKA H;  4DR7 H;  4B8C D;  2PQU A;  4DR6 H;  3V69 A;  4LF6 H;  4LFA H;  5FLX W;  1N32 H;  4BA1 I;  1NXU A;  4LF7 H;  1VIG A;  5A2Q W;  2VKC A;  4B3S H;  1AN7 A;  3FAU A;  2M8W A;  2LTL A;  3U1K A;  2E3U A;  4DV0 H;  2JEB I;  2CWH A;  1S03 G;  4WAL A;  4B3M H;  4JI5 H;  4DV5 H;  5K36 G;  4DV7 H;  2F4V H;  1I6U A;  3NCV A;  4DUZ H;  4FJS A;  2QND A;  2PT7 G;  4GKJ H;  4JI3 H;  4OO1 G;  4X65 H;  2FPH X;  2CTJ A;  4X62 H;  2M6Q A;  4NBQ A;  3J7A K;  1SEI A;  4DV2 H;  1V8C A;  2HHH H;  2UU9 H;  5IWA H;  2P2R A;  1DT4 A;  4JYA H;  1WVN A;  2BL5 A;  4G08 A;  1FJG H;  1XNQ H;  2D9I A;  2CTF A;  2ZM6 H;  2UUC H;  1Z2I A;  2JEA I;  4DR5 H;  4QMF B;  1ODH A;  1N33 H;  3T1Y H;  1WTJ A;  2E5L H;  4JI0 H;  1HNZ H;  1PQX A;  4B3R H;  3J80 W;  4LFB H;  1IBM H;  4IFD G;  4DUY H;  4LF4 H;  3JAM W;  2LRR A;  1X9Z A;  1J5K A;  4AM3 A;  3RF2 A;  4E9J A;  1KHM A;  4JI1 H;  5LMU H;  4DV3 H;  5DT9 A;  1V9N A;  5JEA G;  2UXC H;  4BA2 I;  2OPV A;  1N34 H;  1S20 A;  2DGR A;  4X64 H;  4DR1 H;  4DV1 H;  4AQY H;  3QD7 X;  4X66 H;  1ZZK A;  2O4C A;  4B8T A;  4NZT M;  4YHH H;  4JI4 H;  4DR4 H;  2JE6 I;  1XRH A;  1MSZ A;  1UG8 A;  5BR8 H;  2HH2 A;  4LF5 H;  5LL6 b;  4NXN H;  2YQR A;  2VQE H;  3OTO H;  2NN6 G;  2UXD H;  4JI6 H;  4JI8 H;  4H8A A;  2ZQE A;  2CWF A;  2CPQ A;  1J4W A;  4JVY A;  4JVH A;  2MJH A;  2UUB H;  2Z0S A;  4PDB A;  2FMR A;  5LMN H;  4DR2 H;  3J81 W;  4OX9 H;  2CTM A;  2BA0 A; 
#chains in the Genus database with same CATH homology
 1ZTG A;  5K36 G;  1X4M A;  1KHM A;  1ZZI A;  2JA9 A;  2CTL A;  2QND A;  5JEA G;  4BA2 I;  2OPV A;  2PY9 A;  4OO1 G;  4LIJ A;  2DGR A;  1WE8 A;  2CTJ A;  2JVZ A;  4NBQ A;  1DTJ A;  1ZZK A;  4B8T A;  3VKE A;  4WAN A;  4AIM A;  1EC6 A;  2JE6 I;  4AM3 A;  1TUA A;  2P2R A;  1DT4 A;  1X4N A;  3L7Z C;  2BL5 A;  1WVN A;  2HH2 A;  2OPU A;  1K1G A;  1VIH A;  2CTF A;  2HH3 A;  2YQR A;  2CTE A;  2ANR A;  5C0X G;  2ANN A;  2JEA I;  1ZZJ A;  2NN6 G;  4QMF B;  2AXY A;  3AEV B;  2JZX A;  2PQU A;  3V69 A;  1J4W A;  2CPQ A;  4JVY A;  4JVH A;  2MJH A;  2Z0S A;  4BA1 I;  2FMR A;  1VIG A;  3U1K A;  4IFD G;  2E3U A;  2JEB I;  4WAL A;  1J5K A;  2CTM A;  2BA0 A;  2CTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...