1WEJH

Igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEKGLEWIGRIDPASGNTKYDPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCAGYDYGNFDYWGQGTTLTVSSAETTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/electron transport)
molecule keywords E8 ANTIBODY
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 1998-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wejH02
1AY1H 3MUGA 4L1HA 2B39A 1OY3B 5IHZB 1U3YA 3MRPA 4KTYA 4GKZB 1AXSA 2EYRA 5GZOC 2NW3B 4KXZH 4U0QB 2D31A 3VH8G 4X6CE 3NPSB 4PG2A 4Z7WF 4XZUA 4MXVF 4H20H 4UAOC 1OM3H 4HF5L 5A3IC 4MA1C 4PJ8C 1ZHLB 2BY0A 2EDLA 4JRXD 5FYJE 5HY9B 1MCPH 4F37K 3TPUB 5FAAA 3X12A 3T3PF 4E42B 3KPMA 3PABB 4MDJA 4IRSB 4GW1B 4M9OA 1NFDA 4XNXH 1N6VA 5DHYB 4ZNEE 3Q2CA 1HILA 4OCWH 3O45B 3QUKB 4MLSA 3QWOB 2PCPB 4R4FL 4MJ6B 3NFPB 4WV1B 5T5NG 5HHQA 5EIIB 2B5IC 2Y9RT 5JXEA 4HIJB 1J8HD 1WT5C 3DVGA 4GFTB 1QRNB 2NXYD 1P4BH 4FFVC 5H37G 3ZHDA 1DVFB 3PF2A 5JUEH 1ONQB 3IXTA 1RZIB 2X2YA 5IJKC 1RJYA 5T33L 4I0PD 3QFJE 4XWOD 1L0QA 3MLVH 4AMKL 3MV9B 4XP1L 3IVKA 4LEOB 5E6IA 2NLJB 3S37H 3I50H 3S36X 1MFEL 4WW2F 4HUUA 4ZOAA 3PP3K 4PGZA 5ESQB 5D7KD 5F9AC 1FG9C 3VH8A 3S9DB 4D3CH 2BVYA 3HCVB 3UPCA 3MV8B 4DOHB 2VL4A 3RWDB 3BW9A 4O51B 1C12A 3OWEA 4FTVB 5IIEA 4NNXB 3DUUB 1K4CA 1MVUB 4Q0XL 2FBJH 3V4VH 4IEFB 1QEWA 4OF7A 4W6YB 1NJ9B 3MYJA 4HPOL 1BD2D 3UC0H 2EKSB 1ZEAH 2BC4A 3RIAF 1YYMH 4AENB 5LQBH 3B4NA 2OJZH 4S2SB 2BJMH 4Z7VB 5D1ZD 4GUPB 2AQ2A 4PB0L 5GPRA 5AD0B 4OCSL 3ARYA 1HH9A 4LIQL 1VFAA 4OBRA 1EHAA 3HRPA 2EDKA 4HZLA 2D03L 2W65A 4LARL 1G1CA 2GUOB 1NFDF 1X7QA 1OSPL 3S3SA 3MJ7B 4CMHB 5DS8B 4GAYB 3AB0C 3E8UL 1AR1C 3IDIB 1IKNA 2QQLH 3K3QA 4QF1A 3L3DA 4GG6E 4YHYB 3HMWL 4CVZA 4FNLH 2VH5L 2BVEA 4Z5RA 5E2VL 3BKJH 5JHDB 5I1GL 5IWLC 2KUTA 4GBXA 2BDNL 3R4DA 4IDJH 3IU4H 2Z92A 3BIBX 2Q6WA 3QI9A 1KPVB 5DFTA 4APQB 1BP3B 1Q38A 4Y8DC 5EZIH 4EVNA 3VFSB 4MNQE 4JZNB 4HLZG 2GJ6B 3TVMD 1UT9A 3TO4A 1QP1A 1KLUB 3LKSA 1F8TL 2VC2L 5I1AA 1FORH 3VXUA 4IOIB 1QSZA 1JGUH 5E24E 1WCBB 3QG7L 5BVPH 1DQJA 3GMLB 4MXQC 2BSTA 1OGTA 1SYVA 1FO0H 5D2LB 4H88L 3C6SB 4ZO6A 3WNPA 5IHBA 3K1DA 1LE9A 3FCTB 4R4BB 5B4MD 4I18B 2MPAH 1DANU 3K1KC 3VFUA 2ICEB 3V6ZA 4MA3A 3U82B 1I3GH 3QUZD 4XPAH 3ZL4L 3I3BA 43C9B 4UQ2A 4RZCB 4PJDB 1J7VR 2XZAH 3WE6B 3G5VA 1EGJA 3OJVC 4JRYD 3RGHA 2WBJA 3KR3L 5JW5A 3STZB 2FHBA 4M5ZL 4U1GB 1SVZA 4QOKD 3PWNB 1TITA 3EDJA 4OUOA 5KVEL 1CDIA 5C2UB 1B2WH 4PLJC 2HT3C 2PW1A 1HH6A 2VR4A 2A77L 1IAKA 3U4EB 1A7QH 2DLIA 4PRPB 4XNZC 4G7VH 1MJUL 4Y4HB 2Q8BL 2HJLA 3R06A 4XX1E 1VCAA 3VWKD 3K4ZA 4R8WH 2CDEB 1FZJB 2R1YB 5E8OB 1RZJH 2IAMB 1RZ8B 2E5EA 3O4LB 5CD3B 1MHCB 2CIKB 3DV4A 3GIVA 2MHAB 1U8JB 2NY0B 2P43B 1OT2A 2EZ0C 2FL5A 2QSTA 3M8OL 4KU1A 4UILH 1SJEA 4BZ1H 4LMQI 4GMTH 5CP3H 3ILPA 5CJBA 3ULSB 1E4XL 1J8KA 2X4TB 3BE1L 4OLYL 3OL2A 2G75B 1GIGL 4R26H 4UV4L 4KVCL 4P2CG 1DLHA 3L3KB 4YHLH 1C08A 3JWNC 4DZ8A 4NNPH 5T1LB 4EUPH 4HD9A 2NQCA 5IEKA 5GRUH 4OZGA 5KS9A 3BN3B 3PHSA 2Q7NA 3MGTB 1MCWW 3FRPG 3S97C 1PY9A 1I85A 1DCLA 2NY4D 3IAPA 2ATKB 2APTA 1QOKA 4NOFA 4PBVC 4EI6B 1CICD 1A1NA 1DBMH 5D7JB 3TYFA 3UTSE 2EXYC 4HSQA 5EC1A 2OTUB 4HF5H 1TVBB 3UXFA 5DJ6A 4PY8I 4NO2A 5F7KC 3D3VA 3GHBL 1I1AD 3LH2L 2N7AA 1TQBB 2ZCHL 2D7OA 3LDBB 1A9BB 2GY7B 2IJ0C 3ILQD 1LD9A 4R4FH 2FEDC 4O2FB 2FB4L 3FONA 2LV4A 1T0MB 2ARJA 1V7ML 4P46B 5LGHL 5BXFA 1NCNA 1A4KB 4ODXB 1UWXH 3JTSA 2C4FU 3U48A 4X7FC 3O41B 1IAIL 1D9KC 4OZIA 5E8NA 2BOBA 4HCRA 2VXSL 3Q3GB 1AC6A 3CIQA 3G08B 2CRIA 3BRDA 2FR4B 4PTTB 3B9DA 5T33H 4KKLC 4LSSL 3GFUA 4MZ2A 1NAMB 4D0DA 4AMKH 3MRMA 1QFHA 4XP1H 2V2XB 5JOPD 4GRLA 4U0RC 3ZTNL 4N0UA 3LPGA 2MCG1 1MFEH 4XCCL 5E8PB 2P8LA 2OMNA 2JCCF 3ALXA 1XH3B 4KJWD 2W59A 5KTEL 5MENB 1AH1A 3DSFL 4CU6A 1QSVA 1EGJL 1WQVT 1YNLL 5E03A 3WJLC 4F15B 5KS9F 2GK0B 4BH7B 4WI2A 5ERWA 2BERA 3BPLB 3KJ4B 4HPOH 3FOMA 4NBXB 4LSTH 4H0HB 4S10A 5EOCL 1OF2A 5DJYB 3ARBC 3NIDF 5BRZD 1OTTC 4ZFGL 5HGAB 5JMRA 3R0NA 4OCSH 2UVFA 4ELME 3SGKC 3SDAC 1F3JB 5A1AA 2UUDH 2X9YA 4LARH 2D03H 2WM0A 4LRNL 5HPMB 4FOMA 1KC5L 4TVPL 5DRNB 1OSPH 1B88A 1BJ1J 4OZ4A 4XBGB 5HGDA 5A40E 1YYLL 3E8UH 3CZJA 4PREB 4WI6A 4Y4KB 3U7AA 1C5DA 4KV5E 1JNLL 2QV2A 3HMWH 4JFED 1MCKA 2VH5H 2E6JA 3GEWB 4ODWA 5IF0B 3A6CL 4I2XE 5E2VH 3AMKA 3RVXC 5I1GH 4U1KA 2OJEB 2BDNH 4YX2L 1K8IB 1JHKL 4HAFA 3T65A 4YDKL 1HSBA 8FABA 4ZAKD 4PJBA 4S1DC 4WHYH 1F8TH 2VC2H 1N8ZA 4X6EB 3EHBC 3QG7H 3VE0B 1J12A 4N1EA 4LNVA 4H88H 3DMMB 3TNMB 3QCUL 4MWFA 4Y16C 3MGOB 4DJMA 3MRNA 1IM9A 4WFHD 2X6MA 1CFBA 4MNGB 1A6AA 1B6DA 5DJZB 4Q6IB 4M61A 4N90E 1CLYL 4XVUC 3ZL4H 1FGVL 4PJHE 3U6RB 1JYNA 3VGGA 3L7EA 3VXPA 1UVQB 3AC0A 1T20B 2ZUQB 3BZDA 4NQCE 2EDWA 3EW3B 2CDGB 5IMMB 5KVEH 3O9WC 3VFMA 1DQML 2Z31B 3RVWD 1A22B 3KLSA 4MB4A 1T6WA 2A77H 3NN8A 4KKCC 1MJUH 2Q8BH 1BBJA 5JO5A 2DWEB 1TXKA 1K4DA 4RSVA 2MMXA 4OI7A 4NHCL 4IMKC 3QIBC 4IMLB 4WFFD 4HCRL 3TBSA 4PJ9D 2HFFB 5CHNA 3TYGL 3O6FB 3S36L 3W9DA 3QNXA 2YA1A 3PV6B 1ZT7A 3VCLB 2VIRB 5D2NA 4RGMB 5EFIA 3M8OH 4IHOA 4P2RB 1P7KA 2GSIA 2DWDA 2AXFB 4HZAA 5IM7A 3SDCA 2XY2A 2NY1D 3T0EE 3FJTA 2EECA 1E4XH 3VD3A 1PW3A 1JZ6A 2WZPD 3BE1H 1FE8L 3HZMB 4OLYH 1HYSC 1GIGH 4DCQA 4UV4H 1I8KA 4KVCH 4MX7A 2BNQA 3QEQE 1F58L 3BEWA 1OARL 5DJDA 3ARWA 4TTDD 1S78D 1JNHA 4C57C 2F54D 2AK4D 4PJCB 1IEBB 5MHSE 3BP7B 2J5LB 2A73B 3NAAL 5IHZA 1KCSL 3JZ7A 3ECBB 5IHLB 3TCLB 4GKZA 3LZFL 5HD8D 2NW3A 3RWCB 3V7AG 4HBQA 4M7JL 3VI4E 2C1PB 4Z7OE 1T4KB 2Z35B 3AS0A 1VFOA 3GGWB 3GHBH 4DN4H 3LH2H 1ZHLA 5F44A 5HY9A 4ELKB 5TDNB 5H37H 2ZCHH 4LLAA 1JJUA 3TPUA 2EXWD 4NGHL 3FQNB 3PABA 2EDJA 5DMKB 1IGCL 1TZHB 3K4DA 4IRSA 4GW1A 2PYEB 2BRRL 2EIDA 3O45A 3QUKA 4K71B 3QWOA 1ZLWH 2PCPA 1V7MH 5LGHH 1NBZB 1CWVA 4O5LL 4CDHA 4MJ6A 3NFPA 4WV1A 5J9PB 5EIIA 4HPYL 1IAIH 1MCEA 3OXRB 4XB7A 2CSPA 4J3XA 1UJ3B 2APFA 2VXSH 4HIJA 1QRNA 4HMDA 5HVHB 4JHWL 2A83B 1YNKL 4JDZA 5TF1L 1LEIB 1IC5H 5D4QA 3HNTL 2R0KL 5ISZE 4LSSH 1DVFA 1ONQA 3BN9C 5BZWB 2RB8A 3CFEB 1RZIA 2CJUL 5EG6C 4NQVB 5ITFB 2MKWA 3ZTNH 4XCCH 1T7XA 1A8JH 3RGVC 3MV9A 1G9NC 4LEOA 2NLJA 4HKBB 1PEWA 5T1KB 3H9HB 5KTEH 1Q94B 2XV6B 1BAFL 3DSFH 4XT1C 1VEPA 5E9DE 1EGJH 3QIWC 1CFSB 1CXKA 1YNLH 3HCVA 3VFVA 3MV8A 3RWDA 1T5WB 2XTJB 4HXAL 4O51A 1MCBA 3DURB 1IQDA 4FTVA 3WFDL 1CXLA 3GNML 4NNXA 3DUUA 4NM4H 4ENEC 5EOCH 1CF8L 4KXZI 1NJ9A 1TIUA 1L9MA 1ZMYA 2EKSA 4L3ED 2X4QB 1ZK9A 4Q2ZA 4AENA 3O4OC 4ZFGH 1U95B 1FCCA 1H8SA 4Z7VA 5M7QA 2ORBL 4EQ2A 4LRNH 1MPAL 4KUZL 5AD0A 3SBWC 4TVPH 3ROLB 3RJQB 3EOAB 1KGCD 1IBGH 1KUMA 5J11B 4HLZH 2GUOA 5KSBB 5B39G 5IP4A 1YYLH 2X4UB 1I9RL 2DQJL 2APWA 5L0QC 1JNLH 3MJ7A 5I1IL 1GGBL 5DS8A 4GAYA 3A6CH 3IDIA 1WBZB 2XA8L 3U7YL 5FB8B 4ORZC 1MAJA 1NCTA 4YX2H 4GW5B 4G9FB 4K7FB 5JHDA 1JHKH 2XNAA 5D6DA 4YDKH 5DT1L 2NMSA 2CQVA 3BGFB 5DJ0B 3PP4L 1KPVA 5C3TA 4APQA 2P5EE 4YEEA 2O5YH 4JO4L 1CGWA 3VFSA 5ADOL 1CE1L 1EV2E 4OB5L 5EIQA 4JZNA 3SJVB 4GBXC 2L7JA 2VN4A 4NN5C 1KLUA 2EDRA 4K55A 1ERNA 2VL5B 4IOIA 1V8HA 3PIQB 1WCBA 1EFXB 4M4PA 4P9HL 5ESAB 4FZEL 1EHLL 1LO3L 1QO3B 4RGOL 5D2LA 5SWZB 3C6SA 2DF3A 2R1WB 4OJFL 2WINB 3FCTA 1JHTB 2NY2B 4J3OC 4R4BA 4I18A 1CLYH 4K07A 1FGVH 5C7XL 5E7FA 3U30B 3WSQL 5JOEA 43C9A 4RZCA 4PJDA 5D9SA 1BREA 3WE6A 5T3XL 2VDNH 3OJ2C 2HLAA 2MSPA 1S7QB 3OR7B 1DQMH 3PWPD 3STZA 4KK6C 3ULVD 5I1DB 4P2QB 2DQFB 4ZSOB 3TF7C 1JZ7A 3G6DL 2VSDA 3PWNA 3VXNB 1DEDA 4RX4D 3VD5A 1RURL 5MEOB 1YC8A 4NHCH 3SO3C 2WBJC 4RRPG 1HWGB 4X5LA 3U4EA 4HCRH 4PRPA 4ELMF 4P48A 4Z7VF 4NKDB 4Y4HA 1KJVB 1WAAA 3TYGH 2VLMD 4NNYB 2CDEA 1FZJA 5E8OA 2IAMA 3ZE0F 1RZ8A 3E3QC 4K8RL 3O4LA 5FFLA 5CD3A 1INQB 1MHCA 2CIKA 3EDEA 1A7NL 2MHAA 2ZCLL 1U8JA 5J56B 1AQKL 1PKOA 2YUZA 4XNMB 2FO1A 2LAGB 5GZOD 4LQFL 1PBYA 4OUUB 4OCRL 1FE8H 1J1XL 4QRSB 3VGBA 1A6WL 2Y36L 3G6AB 3ULSA 4DUXA 2X4TA 3WNNA 4POZC 2DQHL 1F58H 2EC9T 2G75A 4AY0A 1OARH 5A3ID 1QSEB 4PJ8D 3OTTA 4Y4FB 5IB5B 3L3KA 2CRYA 1U36A 3KGRA 3C09B 3I2CL 5CCKL 3IS1X 2A6IB 1JYXA 3LS5L 3NAAH 2AQ3A 5SX4H 1KCSH 1FC1A 3MGTA 4PB9L 4E9LA 5E56A 2ID5A 2FX8L 1QFOA 2ATKA 3GSNB 4HGWA 4JKPL 4EI6A 3HZKB 4NM8L 1X5XA 5DURD 4YGAB 4JCLA 5D7JA 5D2LF 4QRTB 4HFWA 1YY9C 2XIDA 3NA4A 1I85C 2OTUA 3N1QC 4NCC1 1DQQB 1TVBA 3K81A 2EDHA 4RRPA 4XNQB 3QXAB 4JG1L 4NGHH 4FFVD 1IGCH 3C5JB 1S5HB 3OX8B 4U6XB 4PJDF 1G0XA 1GGUA 1BZ9A 1Z9MA 4X9HA 2BRRH 1DANT 1BVLB 4RGNB 1OP5K 1A9BA 2RFXA 4QLRA 2F8XC 1TZGL 3MLRL 4O5LH 3SHSA 4OD3L 3OAUL 4O2FA 1S7TB 1T7WA 4HPYH 1T0MA 2DLGA 2IADB 4P46A 3NIGE 2JJVA 1A4KA 4ODXA 3DGGB 2VDKL 1ZVSB 1WAAF 3O41A 4LCCC 5ICYB 1FFQA 1YNKH 5TF1H 3WFHB 1G7IB 1R3LB 4KDWA 3HNTH 4QRPD 5D1XD 2R0KH 1OP5H 3Q3GA 4HMCA 4WI5A 3G08A 4JRXB 2HFGL 5DLML 2FR4A 2CJUH 4PTTA 4GW4B 4ZUTA 2W07A 4O2EA 3AREC 2ZUTA 4PV8B 2IALB 3BH9B 2YK1L 2K7QA 2V2XA 3BD4A 1UEMA 4YPGB 3MFFB 3FFCD 4NQED 5E8PA 1BAFH 5HGHB 4GMSL 2YXMA 4E5XB 5FYLD 1XH3A 2DN7A 1EH9A 4N0RA 4GRLC 5MENA 1ZE3C 1NC4D 4HXAH 2OR7A 1J8HB 1JGEB 2NXYB 3ABZA 4NFDA 2BCKB 4LHUD 2O26U 4OCYH 3WFDH 3GNMH 2PW2B 2UZYB 2GK0A 4ZFOB 1IILE 1CF8H 3P4LA 1AR1D 4IJ3C 5F21B 4D9RE 1UWEL 1JMXA 4I0PB 1FAIL 5DJYA 4JANB 1Z2KA 2ORBH 1LO4L 3TO2B 1MPAH 5GS3A 4KUZH 5HGAA 3DI2B 3DUHA 1X5KA 1F3JA 1GHFL 1LQSR 5HPMA 4X7EC 1YEHL 5FO8B 3VXMA 1I9RH 2DQJH 5DRNA 5CEYB 1MFNA 5I1IH 1GGBH 4XBGA 4PREA 4Y4KA 3VGAB 3R8BB 2XA8H 2NY6C 5D7IB 2QQKL 4MXQD 3U7YH 2DL2A 1AO7A 5IF0A 2ZUVA 1BD2B 1OGAD 5DT1H 2OJEA 2EE2A 4XNYL 3AS2A 1UM5L 3SDXB 3PP4H 5D1ZB 1KIPB 4ONOA 1K8IA 4JO4H 4F9LA 5I1LB 5ADOH 4OB5H 4JFXB 5C70A 5J1SC 3W5NA 1G6RB 2DQIL 3DYPA 4X6EA 2BY1A 3VE0A 1EHLH 4HWZB 1LO3H 4RGOH 1OQOA 2JF1A 3DMMA 3TNMA 4OJFH 4PLJD 5B38B 2HT3D 3MGOA 2D0HA 3RWIB 5B22A 3FMGH 1H15B 1P2CB 4LSRL 4MNGA 4NHUB 2F8OA 2X40A 3K7UA 2J12B 1Y0LB 5DJZA 1A7OL 4Q6IA 5C0BD 3UBXB 3GSXB 3U6RA 4KWUA 5LG1A 4NN7C 3WSQH 2LABA 5TJWK 2I26N 4JPVL 5EPMB 2I24N 5B8CB 3V5HB 5T3XH 4XVSL 3LKRB 1UVQA 2BX5A 1SJVA 4C56D 1ZLVK 1EEUA 2IC2A 3VFRB 2CDGA 3G6DH 3H9SD 3TVMB 2EZ0D 3QIUC 5IMMA 4LSDA 3TH2T 1RURH 5C0AE 2Y1VA 2ERJB 4WFGD 2WIIB 1T1YB 5CMAB 5EU6A 3QDGD 2DWEA 4N5EC 3L5JA 5E94B 2HFFA 2RGSA 4K8RH 2IQ9L 1F5WA 3O6FA 2ZCLH 4XPHL 1AQKH 1CR9H 1U2HA 2W60B 3QUZB 5JW3L 1NAML 3AAZB 3VCLA 5C09D 2VIRA 2HKFL 3S88L 1ED3B 4P2RA 4LQFH 4JRYB 1MCRA 4OCRH 3GIZL 5AUMB 1J1XH 1V5JA 1A6WH 2Y36H 2YRPA 4OFIA 4I77L 2AXFA 2BVPB 4LPUA 5DHXB 3LKNB 1M05B 2EXYD 2OL3B 4FQIL 1XGYL 5GRWA 1KT2B 5KVDL 2DQHH 5CJQL 3HZMA 3OJMB 5LJYH 1MWAB 2P8MB 3K80A 1J1PL 4X7TB 3SDCC 3DECA 3VWKB 1DJSA 4ONGL 2WP3O 5FYKL 5EO1B 3V5KB 3MLTB 5FA3B 3IGAB 4PB9H 1NKRA 4PJCA 3T0WA 1IEBA 4HHAB 2FX8H 4N8CL 4X6DB 3BP7A 3HUJB 4JKPH 2A73A 4NM8H 3V4PL 1CFQB 3DGCR 3ECBA 2FEDD 4RBPK 4I3RH 3TCLA 3UJTL 4WI9A 4HJJL 3KYNB 2N7BA 3RQ3A 4G6JL 2WLZA 5JDSB 2C1PA 5FUZL 1F13A 2Z35A 4JG1H 1D9KD 2CLZB 3GGWA 1IJ9A 4ELKA 5TDNA 3FQNA 4X8JB 3CFCL 5DMKA 1JHLL 3UTQA 4M8VA 1KG0B 1TZHA 4KKLD 1OVZA 1RIUL 5IFHL 1Q9OB 3MLRH 2PYEA 4JCMA 1MJ8L 4OD3H 4TNVF 3OAUH 3NVQA 3BGMB 2NY4B 2ICCA 1NBZA 5DHVB 2JJSC 3HE7A 5E2WL 1CICB 5J9PA 2VDKH 4FA8A 3JTTA 3OXRA 4KZEL 1BQHB 1UJ3A 3NZ8B 2E27L 4XXCA 3CAFA 2A83A 2HFGH 5DLMH 5IW1B 1LEIA 1AIFB 1T7ZA 4QHMB 3MJ9A 3T0BA 1I1AB 4N9OB 2UY6A 5BZWA 4JRXE 2DS4A 3CFEA 1G7PB 1X6NA 2GAZB 2YK1H 4G6KH 4NQVA 5GS1C 3V8CA 5ITFA 3JSSA 1TCRB 1YJDC 1YMHB 1UKSA 3ARBD 4JGUA 4GMSH 1A6TB 5F88B 3UJIL 3U0WL 3KPQB 4X7CC 3IDMB 1OTTD 5DF0A 5EWIL 3RWFA 6CGTA 4HKBA 5T1KA 1RZKC 3H9HA 1Q94A 5CBAB 2Q3AA 5FO7B 3SDAD 1F4AA 4LBEB 1CFSA 4JE4B 3JV6B 3WLWC 2VN7A 4UMGA 1T5WA 4AG4L 2D9QB 2E6QA 4NSKB 4PJCF 4LP4A 3F5WB 4HC1A 1UWEH 1FAIH 3HG1E 4XAKD 4F9PA 5F3BB 1FGNL 1EUTA 3RVXD 1G7MB 1LO4H 1B9ZA 2X4QA 1U95A 2OSLA 3QXUA 4HKZB 1JNNL 1GHFH 3LQAL 2ICWI 1FJ1B 1YEHH 3DV6B 3ROLA 4WTXA 3EOAA 4M00A 4S1DD 1N26A 3EOBB 5CJOL 3VGDA 5D7LD 5KSBA 4JFDE 4NJ9L 5DVOA 1YN7B 2X4UA 4X98B 3EHBD 3OG6B 4F58L 2QQKH 3CMGA 3ULUE 1BIIB 1GZPA 1WBZA 2GY5A 1CDGA 4Y16D 3OB0K 4PRID 5FB8A 4XNYH 4RWHA 2AGJL 1UM5H 1IAII 4G9FA 4K7FA 1NCBL 1HDMA 4G6ML 4WUUE 4XVUD 2OK0H 5AAMA 1T5XB 5DJ0A 4YNYB 3RPKA 2DQIH 3BUYA 4AH2B 3X13B 4AL8H 1KTDA 4YFDB 1NMBL 3SJVA 4MS8C 4WHTB 3CMOL 1MNUL 1ZAGA 1QVOB 1QR1B 3OB0H 1DR9A 3CU7A 3P0VL 3O9WD 2VL5A 2HJFB 4XC1L 3PIQA 1G7JB 1EFXA 3MMEB 5ESAA 1QO3A 4LCUB 3D39E 3L5XL 4IS6A 4JFEB 4KKCD 5SWZA 4LSRH 1NFIB 2R1WA 2VXUL 1U9KA 3QIBD 1EMTL 2WINA 1VPOL 1JHTA 4H8WL 1JPGB 2JELL 4JPVH 3CH1B 4XC3H 4PUBL 4E0RB 1R24B 1ZGLM 1G7HB 2F8VA 2NX5E 5FM8A 4ZAKB 3E1F1 4U7SA 2JB6B 3ZYIA 4LVEA 3OR7A 1S7QA 1WUNT 4DW2L 5I1DA 4P2QA 3BKCL 2DQFA 4ZSOA 4AEIL 2LU3A 2Q3ZA 3RVTC 5F7EL 3FQTB 5MEOA 1KLFA 4WWKC 1HYSD 3VXSD 4JFQB 1MF2H 4XMKH 4NKDA 5DYOB 3I9GL 1KJVA 4MNHB 4QT5A 2IQ9H 4NNYA 3RWEB 4YEFA 3UROR 1C5CH 3MJ9L 4X4ME 3JWDC 4PRDB 3TWCL 4XPHH 4U1SA 3KPTA 5JW3H 2VO5A 1INQA 2HKFH 5TQ0L 4BELD 3K8LA 5KSBF 3S88H 2VUOA 2ARWA 1N4XL 1WGOA 3GIZH 3WN5C 4XNMA 4I77H 2IPKB 3ZZ1A 2UYLB 7FABL 1CDHA 1NL0L 1XGQB 4OUUA 4FQIH 1XGYH 2XWBB 4C58B 5CJQH 4QRSA 3G6AA 1PKQE 1JF6A 1V3KA 4QOKE 1CVSC 3VFPA 1I9JL 3UYPA 1J1PH 3OBAA 3VU2A 4NQDE 3DX8B 3OF6D 4KRPC 1OAQL 3PHOA 4ONGH 4P0DA 2CDFB 5GJSL 3BDYL 5FYKH 2EDDA 1QSEA 4PJ9B 4Y4FA 1MAML 5IB5A 5IFJB 1LILA 3TH3T 1WFOA 4HC1L 2GW5A 4N8CH 5F6IC 2A6IA 5AWNL 3V4PH 4F7CB 5BV7B 1QHOA 2EDQA 3I6LD 3OB8A 3UJTH 4HJJH 4NBZB 3VRJB 4WI8A 2FNBA 5DK2B 3GSNA 5BMFL 3TT1L 3HZKA 4U6YB 4LLWB 5FUZH 3D5OF 2NY1B 2QSQA 1A9EB 3NCFB 2EO9A 3BDBA 4PRHE 1I1YB 2A0LC 1DBJH 3Q0HA 1DQQA 4ZNEA 2ICES 5H94B 1ZHKB 3Q5YA 1TTUA 4XNQA 1X5ZA 1CLCA 3QXAA 5T1MB 2JE8A 3CFCH 1JHLH 1S5HA 3OX8A 4U6XA 1EEQA 2XN9D 1IEHA 3U7WL 5IFHH 3BN9D 1ZHBB 1MJ8H 3RI5F 2GQHA 1NUFA 1BVLA 2F54B 3IDJB 2HKHL 2AK4B 2E7CA 5E2WH 3EYVB 3W5MA 3RGVD 1S7TA 3NBNA 2IADA 3WO4C 4KZEH 4V1DD 2VLRE 3DGGA 3FQWA 1YEFL 3KXFA 5ICYA 3QIWD 1ZTXL 3WFHA 1G7IA 1R3LA 1EAJA 3LRSB 3MOAL 5FUCC 4B5EA 5BS0E 4KQ3H 2AEIT 3NGBB 1JYWA 1DQTA 4GW4A 4NZUL 5F70A 4ENED 4TNVK 4UV7L 4PV8A 5F9WB 2IALA 4HV8A 3BJLA 3BH9A 1FFPB 4OF0A 2X70B 1AI1L 3UJIH 5EO9B 3U0WH 1H3UA 5E8EA 5EWIH 4JDTL 4NOBA 1KF9B 4XI5C 4KI5F 4Z7NE 5BQ7B 2X1WL 5HGHA 4E5XA 4MJ4A 4P23C 5AAWA 3BHBB 4PG9B 4OZHE 4NFBA 2XZCL 3AMLA 4L4TE 4AG4H 1J8HA 1JGEA 3HB3C 4HH9B 1I8MB 1UGNA 2BCKA 4OIIL 4DKFL 1DUZB 3BKML 2PW2A 4HK3J 2DOCA 4ZFOA 5CJXA 4PD4K 2X1XR 5SWQB 4KTEL 3QDJE 1FGNH 4WY7L 4G8EB 1BECA 4JM4L 4I0PA 3NABL 1IFHH 4JANA 3NTCL 2YSSB 3QXVA 3LQAH 3TO2A 1JWSB 1RULL 5CFHA 4ALAL 1BVZA 5CEZE 1ZANL 3RDTA 1RUAL 3RVVC 1P84J 2W91A 5CJOH 4D94A 3BP6B 4MJ2A 4NJ9H 5FO8A 2XOTA 2GEEA 3IKCB 2R2HB 5CEYA 2ZUXA 4QYOB 3MYZA 4GBXD 4U1HB 2C3HA 3HNSL 4D0BB 4F58H 5JW4R 4D9QD 2R56L 2P49B 4ONFL 2HTLC 5D7IA 3SGEH 1A14L 3PDOB 4JFFB 3KPRE 4NCC2 1NDGB 4F2MB 3RWHB 1ZSDB 1FNSL 1BD2A 2Y5TB 4YBHA 3EJZC 1NCBH 4L3EB 5T3ZE 4G6MH 3SDXA 5D1ZA 1KB9J 1KIPA 1LNUB 3SGDI 5BRZE 5I1LA 1SEBB 3EJJX 4H1LG 2R8SL 4JFXA 1G84A 1NMBH 2MJWA 2RCSL 2J6EA 3CMOH 4OT1H 5EOQL 3CFDB 1MNUH 1G6RA 1K9TA 1CD0A 3P0VH 4YIQB 3GSNL 4XC1H 4KK6D 5KJRL 4HWZA 3HRZB 1P1ZB 3FT2B 3QQ9C 3L5XH 2EYSB 1UXSB 2E7BA 2ZG3A 4ZOCA 2ED9A 2KZ1B 1FFNB 4QEGA 1DQDL 2C3WA 2VXUH 5B21A 3KNBB 5B38A 2WBJD 1EMTH 1D5MA 3MJ8A 1VPOH 2HJKB 3RWIA 3M1BB 4H8WH 4M6OL 1QBML 1H15A 1MFBL 1P2CA 2ZZUT 4H0IA 5LXGH 4ZUSB 3C87A 4PUBH 1IKFL 1Y0LA 4FMFA 1TJGH 3UBXA 3GSXA 4HIEB 3IDYB 3ESUF 1IGFL 5FHBH 5EPMA 5AEAA 3NMEA 5B8CA 2AJ3B 3V5HA 5CJ8A 1UQSB 3LKRA 3L7FB 4DW2H 2VR5A 5CSBA 3BKCH 4AEIH 3VFRA 2XQYG 3TVMA 4E41E 1Z9SA 5F7EH 1MCDA 3WIFB 4MYWB 3FN9A 1OAXL 2WIIA 4Y19D 5HDBF 3LS4L 1T1YA 4XMLL 5CMAA 1FN4A 2YC1A 4AK1A 5K59F 1ACYL 3I9GH 3NOIA 4M1DL 4OM0L 5DRZA 4POZD 1CN4A 3MUJA 3MJ9H 3WDJA 4NIKB 1DL7L 2DMCA 5E94A 1UXWB 3TWCH 1W0YT 1X6LA 1L6XA 5GGTA 5TQ0H 2ADJB 3VJ6B 3VWJC 1N4XH 3IDNB 5FDYA 3L9RB 3QUZA 2W60A 1CDYA 4N8PA 2VDQL 1T6VN 2D7NA 7FABH 1NL0H 1ED3A 3O6FC 4JRYA 3C8KB 4QHKI 3PWPB 2NY5C 3KYKH 4GAFB 2QL1A 5AUMA 4M7ZB 2YN3A 5D7IF 1QSFD 3JVGC 2RR3A 4DGYL 4EOWL 3QEHA 3ROOB 2BVPA 2VOTA 1RI8A 3LKNA 1M05A 1I9JH 2OL3A 5F96L 1FZKA 3CGTA 1KT2A 1YY9D 1CZ8L 4RA0C 1OAQH 1BEYH 1MWAA 2P8MA 2FO4B 5GJSH 3BDYH 2JJTC 2OTWB 4LCWE 4WW2C 5K9OB 3SDXF 4KY1L 2YRZA 4X7TA 1Z6JT 2HA1A 4U4BA 4HC1H 4U6HB 2AV1B 4JVPA 5EO1A 4ZFOL 3V5KA 1DN0B 2RIKA 1YQ2A 2BVUA 3MLTA 3IGAA 4YQXL 1U3ZA 1RUKL 5DI8B 3OJDB 3D3VD 4HHAA 5FGCE 3ZT5A 4X6DA 1JTTA 3HUJA 3TT1H 2R2BA 1CFQA 3PWUB 3TBTB 1R3HB 1JZ4A 4MMXC 4P57B 3TH4T 5JDSA 3KPSE 1MQKL 3SE4C 2GFBB 3K8MA 3GK8L 1AXIB 3MLSL 3QSKB 2CLZA 2P48B 1EAPB 3NIFF 1JP5A 1EZVX 2I60L 3REVA 1T0PB 4MA1B 4PJ8B 3U7WH 3ZE1E 5JLZB 1I3RB 4X8JA 1GC1C 2HKHH 1KG0A 4QGYA 5GJTL 4NPYB 3ARED 1Q9OA 2CKNA 3U1SH 4M02A 2EDNA 2GKIA 3M07A 3BGMA 3GM8A 5DHVA 1NCAL 5KSAC 1CICA 5DURB 4NKIL 1HK6A 4JO3L 4QGTA 1YEFH 1ZTXH 1BQHA 2AI0L 4GRLD 3LD8C 1NCUA 3NZ8A 4UOW0 2B5IB 3HE7C 3ZLQC 3MOAH 2J6EL 1BFVL 1G6RL 1ZGLB 2J4WL 3PE9A 4OV6F 5L8KB 1AIFA 4L4VE 4QHMA 5TPWL 5DRWB 4NO0D 4U1JB 4NZUH 1I1AA 3RI5K 4UV7H 3G6JE 3GRWA 4G8GE 4XXCC 1G7QB 1G7PA 3NCYS 1U41A 2GAZA 3QDMD 1W0WB 3QXWA 4LOUC 4ODVL 1JGLL 1AI1H 3MV7E 4OCXL 3EOTL 3IXAB 1B4RA 3TJEL 4GRWE 1A6TA 1CE6B 4PJXB 5DUBB 5F88A 3RUGE 1XZ0B 3IDMA 2XZCH 4AQ1B 5CBAA 2VRAA 3WD5L 5FO7A 4JN1L 4WHCA 5E2JA 2VNCA 9CGTA 4LBEA 3JV6A 4OIIH 4V2CB 4DKFH 3BKMH 1IGTB 4QRPB 1JE6A 5C08E 2ITCB 4KTEH 4NWUL 1LEKA 2QSVA 5GHWL 4WY7H 4X6DF 2XPGB 1IC4L 4K94L 2X89D 3QQNA 3ALWA 2NY6D 2E9WA 4I9WD 3S4SG 3ZT7A 5F3BA 4HULB 3NTCH 3FQXB 5C2BL 1G7MA 1RULH 4ALAH 1NMAL 3FFCB 1ZANH 3DUSB 4NQEB 4HKZA 1RUAH 3BIAX 5DC4B 4CGTA 2FD6L 1FJ1A 5C9KA 4XP4L 4GJTB 3DV6A 1G6VK 4NZRL 4LKCB 5I1JL 1NC4B 4MJIE 3HNSH 3EOBA 2E8YA 3PXJA 4M6AA 5GS0C 2FH8A 4PJ5E 5CGTA 1EXUB 5GQBA 2R56H 3L5WB 1YN7A 4LHUB 1MHHB 4X98A 4ONFH 1HN1A 1A14H 2C3VB 1BIIA 3CSGA 3K2MC 2OL3L 1FNSH 3AB0B 2V5YA 1MWAL 1NGQL 2Y7QA 3RIFF 1U8PB 1A1OB 2P7TB 5DR5L 4JFHE 4L3EE 4N8VB 4EBQH 2R8SH 4YHPB 1T5XA 2RCSH 1IM9D 4YNYA 3D2UD 1UWGL 4XCFH 2CH8A 4AH2A 3GSNH 5KJRH 1JN6A 1EBAA 4WHTA 4NKOB 5JMOC 2H2SC 1QVOA 1QR1A 2FDBP 3QIUD 3P73B 5HHMD 2HJFA 1DQDH 1G7JA 2YD8A 3WHXB 2VLJE 3MMEA 4Z7NF 4LCUA 4FFWC 4JFEA 4M6OH 1QBMH 3WV0A 1MFAL 1NFIA 3S4SA 3IYLW 2AJXL 1VFMA 4OZHF 4N5ED 2IG2L 1KFAL 1OGAB 2AXGA 2AJSL 1JPGA 2C3GA 5C07E 4ZOEA 4E0RA 1R24A 3KPPB 1G7HA 1T66C 3FO1B 4ZAKA 1NAKL 1U8NB 1F4WL 2WP3T 5ANME 4NO5B 2JB6A 4PJAB 3MROB 5I66B 2WWMC 5FO9B 3RX8A 4YPJA 1OAXH 1ZKAA 5KAQG 2J8UB 4OGYL 4XMLH 1ACYH 4M1DH 4V2BA 4OM0H 3FQTA 5GIRA 4N0FB 2NNAB 5L2KD 4JFQA 5E1AB 2B8OT 4QRRE 4XNZB 4R0LC 4O02L 5DYOA 4MNHA 5I15L 3SDCD 2EEDA 3RWEA 3CSYB 4HS6B 1JTPA 1WISA 2LFGA 4PRDA 5C0BB 2GT9B 2V2TB 5C0FB 3GRWL 5BOZG 1INEL 4XVJH 3TNNB 1KCUL 1X5IA 4C56B 5L9DL 4DGYH 4EOWH 1UM4L 2IPKA 3H9SB 4G9DB 5LVEA 1XGQA 5HYQA 5F96H 3PWVB 3ZMRA 1QFWI 4XHQA 4LAJH 4QTHA 5F1IA 4MVBC 4KY1H 3QDGB 4R2GC 3DX8A 2X5PA 1R5IB 2CDFA 2IH3B 1NH6A 1PG7W 4PJ9A 4RFOL 1Z5LB 3MPCA 3F12B 4ZTOH 4G5ZL 4YQXH 5IFJA 5HHXL 1RUKH 3OKKB 4WGVB 1BIHA 1NGYA 5JPMA 3SOBL 4Z18A 4F7CA 1BBDL 5C09B 3QR2A 2J2ZA 2PTVA 3VRJA 4JQVC 2YS4A 5DK2A 1MI5D 4C55A 3ZDZE 3WUZA 4LLWA 1F4XL 3GK8H 4FABL 4UNVA 1A9EA 3MLSH 3GBML 4PY8J 1I1YA 3FN3A 2ZCKL 2I60H 1OB1B 5H94A 1ZHKA 4YHKL 4D2NA 4MQXC 5F7LB 3T1WA 5T1MA 1ZT1A 4BZYA 1CL7H 5GJTH 4FP8H 4RDQG 1ZHBA 1J87A 3T3ME 4MZ3A 3H7BB 1QRND 2F54A 5KVMC 3IDJA 3S3JA 5JW4Q 2AK4A 4JKMA 4LKXB 5DWUL 1KXTB 1NCAH 1X3DA 3OKLB 2WWKO 3EYVA 2QHLA 3HR6A 4NKIH 5C8JB 4JO3H 5DSCB 2RAMA 2AI0H 2E9BA 2A38A 1KB9K 3QXDB 2J6EH 1BFVH 1G6RH 2YA0A 3LRSA 3SGJA 1D9KB 3WLWD 4BKLB 5TGBB 4K23L 2DQEL 4UUJB 4LHJB 4YDJA 4QXWA 1MCJA 2D9CA 4OD1L 2F19L 1JGLH 1YEIL 5IESL 4OCXH 4BA8A 4NRYB 3EOTH 4KDVA 3TJEH 3MCG1 2FJGB 1FFPA 3VXRE 4ZO8A 2X70A 4M8QB 2G9HB 4U0RB 3B5GA 3T0DA 5BQ7A 5K93A 3WD5H 4JN1H 1T7VA 2R9HC 3IFNL 2QHRH 3BHBA 4DUVA 2FWOB 4PG9A 1NEZB 1QLRB 1SVCP 3HC0B 2IF7A 3JXAA 1CVRA 5DJCB 3R0MA 4M43L 1I8MA 1R3IH 1WLHA 5A16B 5GHWH 1DUZA 5CKAA 3F58L 1IC4H 3S3PA 3T08A 3U4AA 5SWQA 2MWCA 5DMIL 3D87B 1NKOA 5C2BH 3IRZA 4KGJA 4WO4C 3LIZL 5DD1L 2PO6C 3ARBB 2YSSA 5DK0B 5GGTH 4N9GA 5EBLB 2XWJB 2FD6H 1JWSA 4XP4H 4PY7B 4EUPB 3BP5B 3MO1B 4OFKA 4P49A 4NZRH 3TBYB 5I1JH 1FZMB 4U33A 1X4XA 4ZUWB 3SDAB 2AXJA 1F3DJ 3BP6A 2VTFA 5JHDD 3N1PC 3IKCA 5I8CB 2R2HA 2W9LA 3DXAD 4QYOA 4MS8D 4U1HA 3RDTC 4D0BA 2YD4A 2OL3H 1VGEL 3ELAT 4X5WB 4P3WA 3S5LB 1MWAH 2YXFA 1NGQH 3LEVL 3PDOA 1LK2B 4JFFA 4K7PX 4JHAL 1NDGA 4PBXA 3KPLB 4F2MA 4QRUB 4WJ5B 3RWHA 1ZSDA 2VXQL 4JR9L 2Y5TA 4M93C 5DR5H 3U0PB 3IAGC 3MBXL 4ZUVB 2PUQT 2VAJA 5E4IA 4PLNC 1A47A 1SEBA 1T1XB 1UWGH 3HZVB 1W8OA 2F53D 2BNRA 5KW9H 5BV7L 5MEQB 1FDLL 2VAAB 3CFDA 3T0AA 3KYOB 2FLBT 4YIQA 5D7LB 1BJMA 1E0OB 4O2CB 2LU4A 2VLKD 1G9MC 3HRZA 1P1ZA 3FT2A 4GRWF 4XBPB 4LSQL 2EYSA 4QHUB 1UXSA 5ID1B 2DM4A 4K3DL 3RVTD 1PGRB 1MFAH 5E5UB 3T77B 2AJXH 3HLAB 2IG2H 4WWKD 3BVNB 4Y16B 2HJKA 3M1BA 2E6PA 4JHZA 2AJSH 4PRIB 2DMKA 3SE9L 4ZUSA 3V6OA 4YK4C 2XG5A 3EFDL 2D0FA 2WAHA 3EO1B 3LSOB 5CWSB 4HIEA 1NAKH 1F4WH 4HX1B 2MQ0A 1S9XB 2AJ3A 1YMME 2DI8A 1UQSA 3L7FA 5DHVH 2FH6A 5DEGB 3G04B 1GGIL 1WICA 3P4NB 3EYOB 4OGYH 1BQSA 5B8CC 1F4HA 1CFNB 4I5BA 3WIFA 3O9WB 5IVXE 2IMNA 2NY0D 4LF3B 4JFPB 4K9EL 5I15H 4O02H 1VACB 2IGFL 1KSRA 4KRPD 3QIBB 1M6OB 1UXWA 4AEEA 4DVRL 1MCWM 1T89A 5HVWA 1JZ2A 3GRWH 2ADJA 3VJ6A 1KIUA 2IANA 1F4YL 1KCUH 3PGFL 5LAXB 3IDNA 3LHPL 3L9RA 4ZD3H 1GRWA 1HKLL 5L9DH 4TVSa 1UM4H 1XGPB 5L7XL 5I75B 3C8KA 5TQ2L 3PWPA 1R0AL 5KOVC 4C56E 1SJXA 3ROOA 1PDKA 3BMVA 3S96B 1NPUA 2W9DL 4RX4A 3ZKQD 4ZS7H 1IZJA 2A0LD 2FO4A 3VXSB 2OTWA 1U0QA 3WS3B 5K9OA 5ADPL 3B2VL 4RFOH 4Z8FL 1BPVA 3GSVB 4G5ZH 5HHXH 2P24B 2AV1A 5KVFL 1DN0A 3SOBH 1L0YA 4S1RL 3WJJA 3L5HA 2HTKC 5DI8A 1P9MC 1DQLL 2V5RA 5C09E 1F4XH 3PWUA 4F7PB 5C86A 3TBTA 3GBMH 4CUCA 1R3HA 5EA0L 4P57A 2ZCKH 2GFBA 4YHKH 4GLRI 4HK3N 2EYRB 4YBQC 1EAPA 4LSVL 4O4YL 3LY6A 5JLZA 3EUUA 4JG0L 4TSAL 1I3RA 1GSMA 5HGGS 2MKLC 4NPYA 5DWUH 3P11H 3TJHC 3QAZC 1WZKA 1WFTA 4RFEB 3EZJB 2BY3A 5GSVB 1FC2D 2IQAB 1KJ2B 2NY3C 3AROA 4XI5D 1XIWC 5DRXB 1WWCA 4WW1B 5EBMB 2NTFB 1CD9B 4P23D 3PJSB 3GBNL 3O3UN 4K23H 2DQEH 1WT5A 3AY4C 3HB3D 1ZGLA 4LLDB 3TFKC 5DRWA 4OD1H 1YEIH 4JKWA 4U1JA 3LQZB 2XN9B 3QDAA 2PF6A 4D8PB 1G7QA 1I1FA 1W0WA 3ULVF 3DETC 5I1CL 5J8OA 3ZE2F 3ZSSA 3S35X 3IXAA 5I71B 3VDAA 4FQQB 4GG8B 4CVWA 1HHIB 5CILL 1CE6A 4N8VG 4PJXA 5DUBA 1LO5B 4JFYB 3RGVB 3O6MH 1XZ0A 3IFNH 3O3EB 1IQWH 1R5WB 1T3FB 1B0RB 4V1DB 3RVVD 3QUXC 3CFKB 4M43H 3QIWB 1L7IL 4RIRB 2WUBL 1OAKL 1IGTA 4LPTA 4QRPA 3F58H 5HYJE 1B6UA 2ITCA 5DMIH 3C5SB 1AXTL 4NUJB 3UZEA 3ZDZF 3VH8B 1E4KC 2X10A 2GITB 2HTLD 3VXMD 35C8L 4UB0L 3B2UC 3ZDXF 5DD1H 3FQXA 3EJZD 4Y1AD 2J8HA 2KL6A 3FFCA 3O4OB 3CCHB 3DUSA 4NQEA 1U58A 3O11B 1AO7D 4KUCD 4ZO7A 4LKCA 1NC4A 1T2JA 3OR6B 1BVKB 1VGEH 4HGMA 3ULVL 1EXUA 3L5WA 4LHUA 3X14B 4FRWA 1NANI 3BPNC 2YPLE 3HHRB 4H26B 2VZVA 3QQ9D 3LEVH 4IRJC 2C3VA 5L0QB 2B1AL 4JHAH 2VXQH 4JR9H 4A2MA 1KYOK 1ZV5A 2ICWB 3QHZH 3MBXH 1TFHA 3MCKB 1U8PA 4YHZL 4O58L 1A1OA 3BZ4B 5FA4B 2DD8L 1N0LA 5IOPB 5IWLA 1QYGL 2CD0A 4N8VA 2CO6B 4YHPA 5BV7H 1FDLH 1AGDB 3MRHB 3MA7B 4LSPH 4UT9L 1G7LB 4IM8A 4MAUL 3UDWC 2YD6A 1VADB 4LSQH 4NN5B 3P73A 4K3DH 2ZSVB 2EDBA 1ZS8B 3LEYH 3WHXA 1C1EL 25C8L 3TBVB 4PJXF 3SE9H 3GMRB 4FQLL 1KULA 3LKSB 5DMGC 2ZP0T 3EFDH 1OGAA 1N59B 1B4JL 5ENWB 4DEPC 3KPPA 5EU6D 3VWJD 1X5JA 1GCFA 3FO1A 3JV5A 4B7IA 4OQTA 1U8NA 1GGIH 4NO5A 1UACL 5C0CE 4PJAA 1XF3B 3VFUB 3MROA 2V5MA 5I66A 3W0WD 3O6FD 5FO9A 3PGDB 4Z7WE 4MXVE 4Y5VC 2J8UA 2P5WE 1WTGT 2P46B 4LLYB 5EN2B 2IGFH 4Y7MA 1DN2A 5CP7B 4N0FA 3CUPB 2NNAA 3SO3B 5ALBL 2WBJB 5E1AA 3T3PE 3MJ6A 4DVRH 1JK8B 5HYSG 1UZ6E 1F4YH 2CXKA 5C0BA 2GT9A 3LHPH 2XTLA 5C0FA 2V2TA 1HKLH 3T1FA 5JR1L 5L7XH 3TNNA 4F7EA 2VMFA 3V5DB 5TQ2H 1R0AH 3H9SA 4G9DA 3T0EC 2VXTL 3RL1B 3PWVA 2ZKHL 1OPGH 2W9DH 3GIVB 4UZGA 2QKIB 2MQCA 3OAYH 4Y19B 3DRTB 3UPRB 4EDXB 1GAFL 5ADPH 3B2VH 2GI7A 4Z8FH 1QLEL 3QDGA 1A5FH 1R5IA 3LKPB 4PJGB 3V9FA 4ZTPL 2IH3A 3WO3B 4R97C 3RY4A 5KVFH 1RK1B 3ILPB 4LU5L 3F12A 4S1RH 3OKKA 4NN6C 4A2LA 4YHNB 4N68A 4PJFB 5GRZA 5J6GB 5IB1B 3S6CA 4HIXH 4L9LA 4XPTL 3GI8L 4UT6L 1BWWA 2E8ZA 4ZO9A 1P4IL 1P53A 1XF4B 5KSAD 1QSFB 1TVHB 4OZGB 1MOEA 5FYLL 4PTUB 4X0KB 1ZXQA 3ARVA 2ESVE 2EICA 2R0ZH 2YR3A 2A9NH 5SWSD 1OB1A 4LSVH 3HE7D 4JG0H 4TSAH 3BH8B 4PJAF 3H7BA 4LOUD 3JV4B 4LKXA 3D3VB 2YD9A 5B3JE 4H20L 2J8UF 3OKLA 2B2XL 5C8JA 2R2CA 1MH5B 1MCPL 5DSCA 2V17L 1U8IB 3HKFA 2R4SL 3QXDA 1RD6A 1NFDE 4LCCB 4RWYH 1IARB 5FOBB 1D9KA 1AKJD 3GMMB 4BKLA 4UUJA 5CBEB 2CGRH 1ZGLP 1I8IB 1T22A 5I1CH 4F80A 1WITA 4NRYA 3AREB 1KPUB 1QACA 1REIA 2FJGA 2UWEB 1JPFB 5CILH 5D71L 4M8QA 4EEEA 2G9HA 4WEBL 2OBGA 5F7FA 1TJIH 4D0DB 1JGDB 2FWOA 1NEZA 2ZUWA 4OQTL 1L7IH 2WUBH 1OAKH 4GRLB 5DJCA 3GM0A 1AXTH 3QJFB 5GS0D 3EIFA 3WJLA 5DJ2B 4NO0B 3IDGB 5J6HB 3TA3C 35C8H 4YZFF 3RPIB 5C6PB 15C8H 3C5ZA 1BHGA 4UB0H 3QDMB 4JDVB 3U36B 1UM6L 4UINL 4IJ3B 2QBWA 1KLGB 4NQUA 1ORSB 1GOHA 3ARBA 5DK0A 1RK0A 5EBLA 1EPFA 1KNOB 2ED8A 4BQ9A 3BFOA 4PY7A 1B3JA 2F5BL 3MLYL 3UTOA 3BP5A 3MO1A 3GSQA 3TBYA 5A2KH 1FZMA 3SGKA 3SDAA 2OZ4A 1VKXB 3ULVH 2IBZY 2COQA 1CL7I 5I8CA 2Q20A 4WEUD 3V0AC 2H2SD 1T83C 2B1AH 2BJML 4IBLT 4X5WA 1QFWM 4QCIB 5C0EB 4L3AA 1IAOB 5F1KC 2NY6B 4FFWD 4YHZH 4O58H 5HXMA 3KPLA 4QRUA 4WJ5A 2H32B 2DD8H 3DJ9A 1UCBL 2FEEI 3U0PA 1QYGH 5ALCL 2BHUA 4ZUVA 2DDQL 3U46B 1LEGB 3T0VA 5SWZD 4ZDHA 4UT9H 1T1XA 1T66D 3HZVA 1R5VB 1NLBL 4MAUH 1XEDA 5MEQA 2VAAA 2VDPL 4XBEL 3KYOA 4B50A 5D7LA 5ICZB 1U2CA 1EJOL 3BKJL 5IROC 4O2CA 1C1EH 3ES6B 1FL3B 3U83A 4XBPA 4PJBB 3PQYD 4QHUA 5ID1A 25C8H 3T77A 4FQLH 3WDIA 4KPHL 3HLAA 2IPUK 3BVNA 4Y16A 3ZKMC 2DIAA 1B4JH 4PRIA 5FGSA 3KS0H 4M1CC 4B0MM 3TV3L 1AGFB 1CCZA 3EO1A 1RJZB 3LSOA 5AZ2L 3VXUE 1OD9A 5CWSA 5EUOB 4NN7B 4HX1A 5E7BA 5HVFB 1S9XA 2HFEB 4AT6B 1UACH 3LN4B 4G8IB 4S0SD 4NYLB 1D7FA 3D2UB 4P5MB 4OI8A 3PHQB 5DEGA 3BUTA 3G04A 2GCYB 4M61B 3P4NA 3EYOA 4JO1L 1DE4B 5I30L 3QIUB 1CFNA 3O9WA 3AU1A 1I3GL 5ALBH 4DN3L 4OF6A 2HRLA 4LF3A 3RY6C 4MVBD 1VACA 4N0YL 5GRVL 4GOSA 5TDPB 3BX7C 3U2SB 4R2GD 3S35L 4IMKA 4HUNB 3QIBA 3FHQA 1M6OA 5DUML 4KQ4L 4B7LA 5C0NC 3T8XA 4JAMB 2IH1A 5JR1H 3T4YB 1BBJB 1B2WL 5LAXA 3BWAB 1N7ML 1C5BL 3QWQB 1MCSA 2K9UA 1SYSB 4G7VL 2VKWA 3HTLX 2VXTH 4JFZL 4Z77B 1TETH 2ZKHH 2X4OB 3H7LA 5I17A 3S96A 1A2YB 4PGBB 2EIZB 4DKEL 1GAFH 1D6VL 5FHAL 4ZMAT 3MGAA 1QLEH 1F2XK 5L2KB 4ZTPH 3VXSA 5FYJD 3WS3A 3GI9L 4TVPE 4MQXD 4LU5H 1JI2A 4RMUA 3RBGA 3GSVA 3VRLF 3SDCB 2CLRA 2P24A 1UKTA 4YDLC 1MRCL 4OLWL 4JM2C 5E00B 4DCQB 3MFGB 4XPTH 3JUYA 3EO9H 3GI8H 4UT6H 1A7RH 1MFDH 1OAZL 1KTKE 1P4IH 4BJLA 3C08L 1Q9KB 4PBWD 3OG4B 4F7PA 5FYLH 4OFPA 5F6HI 3VGEA 3MRIA 4YBLC 5GRUL 4HMEA 4OZGE 1A6VL 5KS9E 2OZ4L 4MAYC 3OF6A 1KEML 4GAGL 3VG9C 4MHHG 1DBML 3KXFD 5DJXB 3NIDE 3OKMB 3QFJD 4OCMC 2VZTA 4PGJA 3J8F7 4RFEA 3BIKB 5E2TL 2B2XH 5GSVA 3KYAA 2DQGL 2IQAA 2V17H 1KJ2A 4NKMB 3D3VE 1MI5B 3MSPA 5I1HL 4PS4L 4FQXA 2R4SH 5DRXA 4WW1A 1EERB 1Q1JL 2OR9H 1UZ6F 5EBMA 5CD5C 2NTFA 5EZJA 2R9HD 3PJSA 5IR1B 3EGSA 2KPNA 2W92A 4F9PC 2VJXA 4LLDA 1LE5B 5HPOA 3LQZA 4Y5YC 1HI6A 2XN9A 1I3VA 4JO2L 5HI5C 4JFOB 4D8PA 3DYMA 4G8FB 4OQ1A 5D71H 1J9CT 1RHHB 3G9VA 2C26A 4JDZB 5GS1B 3HAEG 3TEUA 4BSVB 2DM7A 4OZIE 4Q74A 4WEBH 5ACMA 4WO4D 4CVUA 4FQQA 3TGXA 4GG8A 1HHIA 2PO6D 4U2YA 3RGVA 1LO5A 4JFYA 1NLDL 3A6OA 1FH5H 3O3EA 1R5WA 1T3FA 4OQTH 1B0RA 4WUKL 4V1DA 2R15A 3MRDB 2YPKB 3P0GB 3CFKA 4LGRB 5FKPB 5L88L 3QIWA 1U8OB 4WWID 4RIRA 3C60C 1X4ZA 5DC0A 4N0UE 5D93C 1WBYB 5F8QC 3RDTD 4F33B 3C5SA 4NUJA 4ODUB 1UM6H 3MRBB 2GITA 4UINH 5KZCD 1CD8A 3G5ZB 3VFVB 3ZO0A 3CSPA 2CUIA 5FYJU 1IQDB 4I48A 3ARFC 4P5TC 3DO3A 2R69L 2F5BH 2B1HH 3CCHA 3MLYH 3O11A 5F71A 3UTTA 3FB5B 3I75A 4X9BA 3LN5B 4MNQD 4JPIB 3B9KC 3SBWA 1KN2L 4LSTL 4Q2ZB 5A2FA 2NZIA 2K7PA 3OR6A 1BVKA 3DARA 2YN5A 3UEZA 3X14A 4CMMB 5B3JF 1FNHA 2I27N 4HDIB 4H26A 3QULB 2AV7A 2Y06L 3FRUB 3N0PB 1ZT4B 5I8EB 4PP2B 2H6PB 4J12A 1UCBH 5IQ7L 1AHWC 2X1OA 2ICWA 5ALCH 3MCKA 3FAWA 1EK3A 4I9WE 2DDQH 4CBPA 3BZ4A 5FA4A 2DYPD 2EC9U 2FIRT 5IOPA 3HR5B 1QG3A 1NLBH 2VDPH 4NC2B 1AGDA 4XBEH 3MRHA 3MA7A 1ZA3B 1MCOL 4PIRF 1EJOH 1RSFA 1G7LA 2H41A 2XNAB 1ITBB 3DXAB 1VADA 3A0OA 4M7LL 2ZSVA 2PKDA 3P9LB 1ZS8A 4KPHH 2AERT 1MHEB 1RAMA 4PJBE 4KI1A 2VWEC 3TBVA 3TV3H 1LP9B 3GMRA 5J89A 4YHIB 5AZ2H 1N59A 4FQJL 5ENWA 5GRVK 4IIQC 4PGCB 4EXKA 1KJMB 4GSDL 5HHOE 2F53B 1AGBB 1H3XA 4C83B 3I85A 4WTZG 1XF3A 5EOCJ 4JO1H 5I30H 1YZZA 1KJ2L 3PGDA 1F3RB 3FB7B 4DN3H 2VLKB 4LLYA 5EN2A 5D9SB 4N0YH 5CP7A 4OF5A 4KTDL 5HHME 3CUPA 3S35H 2HLAB 4WWKB 5DUMH 4KQ4H 1RFDL 1RUPL 5B39B 1JK8A 1E4JA 3F7QA 4X4ZA 3F7PC 1DP0A 1N7MH 1C5BH 2BSRA 1UJTA 3MRLB 2HTKD 2VR9A 4P59L 5GRXG 4JFZH 3V5DA 1O7VA 1QBAA 1NBYA 5FV2A 5T5NF 3WN5B 3ZYZA 4DK6A 3U9PH 3UTSD 4DKEH 1D6VH 1G9NL 3RL1A 1IE5A 5FHAH 4G6FD 1CT8B 4XNUL 1T1WB 2QKIA 2VISA 4HS3B 1YNTB 4Y19A 3DRTA 5GGQH 3UPRA 4EDXA 3GI9H 4LCIL 4FFZL 1VESA 5D2NE 1HSAA 4KRLB 3LKPA 4PJGA 4YBQD 5EZOL 4KRPB 3AM8C 3UO1L 1S9KC 1NCCL 1MRCH 1RK1A 4OLWH 5DEFB 1X44A 5I74C 1EIBA 1N5YL 2VZOA 4YHNA 3KPSA 2VZ3A 1ULVA 4PJFA 1OAZH 5F6IB 3TJHD 4NZDA 3C08H 1U8MA 4JJ5B 5IB1A 5J6GA 2ZOKB 3DHJA 2BNQE 1FV1B 4WTZA 2NY3D 1S7WB 4AIOA 1XF4A 5CZXC 1QSFA 1TVHA 2C4XA 1A02N 1XIWD 1A6VH 1IRAY 2OZ4H 3QWRA 4PTUA 4KJQC 4X0KA 1P4LA 4L9LC 1KEMH 5D70L 4GAGH 4HGWB 1BOGB 2P1YA 3DI3B 5D8JH 4BFEA 5HSFA 5FGRA 3HA0A 3BAEL 1OAUL 3FB6B 4HFWB 1JZ8A 2EIBA 3TFKD 3BH8A 2WW8A 3L3IB 4IOFC 3CVIL 5E2TH 3QEGL 2XI9A 1QHPA 3JV4A 3DETD 5ELIA 2DQGH 1UWXK 5I1HH 4PS4H 4DN4L 5IMLB 5I2IB 2Z93B 1X5AA 1MH5A 1WZLA 4P4KC 1Q1JH 1FVEA 3WHE0 4PGEB 1BZ9B 5I6XC 4JREC 1U8IA 3WO4B 3WS6C 2RFXB 4UTAL 3QUXD 5FGBC 4LCCA 5E6ZA 5FOBA 5JPNB 1KELL 5T3XE 3GMMA 2BXYA 1AD9B 5E6YA 5CBEA 4JO2H 1HOCB 5JQ6L 1I8IA 1GZQB 5FK9B 2HLFC 3AREA 1KPUA 1KCRH 1VHPA 4DFIA 1QD0A 3B2UD 2UWEA 4YXHL 5JIIA 1JPFA 1QRNE 1NLDH 4OTXL 2C5DC 1IC5L 3NCEB 4ZUTB 4O2EB 4WUKH 1S9YB 2V7HB 3NZHL 4KGLA 4JN2B 4P3CL 1JGDA 3QB7C 4PJGF 4P23B 5EU4B 5L88H 1DBAL 3FRPA 4PRBB 5TE7L 3QJFA 3I84A 3MV9E 4Y8AA 5DJ2A 4PJFF 4NO0A 3IDGA 1GOGA 5J6HA 4QWWC 4HUXB 4IRJD 3RPIA 3CXHJ 3MC0A 1WK0A 3V7AE 1V3JA 3QDMA 4JDVA 3U36A 4PR5B 4X4YB 3PWJB 1KLGA 2R69H 1FNGB 3L6FA 4R7DB 4OZGF 1ORSA 3DX7A 3MV8E 4DOHE 4YXKH 2UUDK 3C5ZC 1KNOA 2PETA 4FTVE 2DQDL 2D3VA 1NUNB 1KN2H 4NM4L 2FATL 5M95B 3K74B 1JL8A 4UU9B 1O5DT 2XICA 3GKZA 3KHQA 3FT3B 3KYMB 3Q6FB 1TPXC 1VKXA 3GMNB 1CDBA 1SEQL 4HK0B 3ULUC 5BJTA 1MREL 5GS2D 2Y06H 4Z7VE 1PQZB 4QCIA 1JIBA 2X7LA 5C0EA 5IQ7H 1IAOA 2X89A 3VXMB 4RAVB 5A2IH 1IBGL 4YR6B 2H32A 3ZE0E 1YPZB 2VLLA 1U93B 5DMGD 4N90D 4Y1AB 3VW3L 1U8LB 1AQDB 2VUYA 3U46A 1LEGA 4KK5C 1AO7B 4MQ7B 1MCOH 4OSUL 1R3KA 2NTSP 3RIAK 1R5VA 2LU7A 4Z7UB 1TENA 1FRGL 2VQTA 4M7LH 3G5YB 4ZUUB 2DLTA 5ICZA 5ESVB 4OZIF 5JHDE 3ES6A 1FL3A 1KIQB 5C1MB 1J5OL 5JIHA 2BOCB 2UWEF 3JBG7 3C6LC 5F9OL 2DM3A 2O5YL 2QSCL 4PJIB 3FOLB 3LOWA 2QLVB 4FQJH 4C4KT 4Q9CA 2GJ6E 4C59B 1AGFA 3VDBA 1M4KA 4RQQB 3WNLA 4GSDH 1JUFB 1RJZA 1J86A 5EUOA 3KLHC 2FHFA 2HFEA 2XXCB 4RMVA 4AT6A 1I7RB 3LN4A 4G8IA 4NYLA 5D2LE 1KJ2H 3D2UA 4P5MA 1CDCA 1OWRM 3PHQA 3L3HB 2GCYA 4URTB 3QT2A 3UYRL 1DE4A 1FZOB 3QIUA 1RJLB 1U8QB 2Y72A 4KTDH 1RZGA 3EO0B 1MJ7L 1RFDH 1RUPH 1E27B 4PJDE 3QEQD 5TDPA 3U2SA 4JPWL 2VDNL 4K3JL 5IB3B 2BK8A 3QEUB 4I4WB 4JAMA 1GXEA 4UI2A 3NACL 3T4YA 5DC9B 5EU6B 4P59H 3BWAA 1S9WB 3VWJB 5MHSD 4DQOL 1NBVL 1SYSA 4PRPE 4WCYL 1Q9WB 3JV0A 1G9NH 4Z77A 1WAAE 3W0WB 4HIIB 1BZQK 1LK3L 1M7XA 4XNUH 3ZDYE 2X4OA 3U79A 1HHHA 3P2TA 1A2YA 3BEVA 4PGBA 2EIZA 4LCIH 4FFZH 5I75C 3O4LE 3FAXA 4MD5B 1QKZL 5EZOH 5L2KA 3UO1H 1NCCH 3DSNA 4UBDC 4WW2B 3U9UB 2BSSB 4X5XB 4J2XA 5BO1L 1JRHI 5CEZH 1UFUA 4HKXA 3RA7H 1N5YH 1H8OA 2HAZA 5KANG 1MY5A 5E00A 4YUEL 4XHJC 1CLOH 4TULL 1J05B 3RBSA 4KDTC 1D5XB 1FNFA 4PJBF 1Q9KA 2J3SA 3QXTA 1I7UB 3V0WL 3IDUA 2D0GA 4HG4K 3H2WA 5D70H 5MI0C 3VXOB 1JZ3A 3MNZB 1CTOA 4MJ5B 4LLMB 4P2OC 3REWB 4XCEB 5ACLA 3BAEH 1OAUH 5EUOF 3SQBA 3K2UL 5TE6L 3ARRA 3CVIH 2H3NB 2XFXB 5LCVL 3QEGH 5DJXA 1ZLWK 3ARGC 2CRMA 3OKMA 2AEPL 1CFVL 2AJYL 3BIKA 3WFZA 3V6FB 1WSST 4NKMA 1O7SA 5MEPA 5GGSY 4JQXC 1MI5A 2XXMB 1KJ3L 2JJSA 1R3JB 3UTQB 5KSAB 4UTAH 5E9DD 4U6VL 2XA3A 5IR1A 1EX0A 5JHLL 4TUOB 1KELH 4P4RB 3LD8B 5SWSB 2WQ8A 3HE7B 4FQXC 3NH7H 1KB5B 5D96C 4OLXL 5JQ6H 2AAVA 1LE5A 2PXYC 3JTTB 1E28B 4YGVB 3QPQC 3N9GL 5INDB 1MEXL 4JFOA 4G8FA 4YXHH 4RCAA 1RHHA 4U2ZA 5GS1A 2E7HA 4OTXH 4BSVA 2EEBA 4KMLB 3B9AA 3NZHH 4WI4A 1I8LA 4CU8A 4P3CH 1YA5A 4QXTB 1DBAH 1YEGL 3E6HB 4BSWB 3MRDA 2YPKA 1NBQA 5H8DA 2OCFD 5I71C 5TE7H 1HQ4B 3HPJA 5FKPA 5D5MB 1U8OA 1AKJB 5JOFA 2PTTB 4JZJA 1QNZL 1I1CA 2EKJA 3RWFB 3VFWA 5DZOA 1WBYA 4F33A 4MLIA 1WVZA 2VDLL 3IU3B 4ODUA 5A2JH 3MRBA 3EOYG 3G5ZA 1V3MA 1M71B 5MENE 3QZWG 3DVIA 3EKCA 2Q76A 4KJYB 1GGCL 4OCYL 2DQDH 1TDQA 2FATH 2X41A 3DYOA 5FYKE 4JFFD 4KROC 4PP1C 3FB5A 3LN5A 5CZKA 3GO1L 4JPIA 1SEQH 3FZUD 2OSLB 1MREH 1FVDB 4CMMA 1S9VB 4HEME 2APVA 3MCLL 4HDIA 2NPLX 4W70A 3QULA 4M03A 2BNRD 1FIEA 1IM3B 3ZKXB 1QBBA 3FRUA 1ZT4A 5I8EA 4PP2A 2H6PA 4PLKC 1BLNA 2X4PB 4LPYA 3ZKMD 3BRGC 3VW3H 3VXME 4M1CD 2IPTL 3HE6C 4L8DB 3W81A 2DIJA 2GTZA 1GZPB 2QR0B 4HEPG 3HR5A 2DQCL 4OSUH 2KDGA 1OLLA 5TE4L 4HJ0C 4LFHD 1FRGH 5IBLC 1ZA3A 2JIXD 1IGIL 4MMZC 3BQUC 2DRUA 2CRZA 3DXAA 1HDMB 4LNRB 1J5OH 4PRAB 4HWBA 4PJ7B 5F9OH 3SE8L 3P9LA 1RQ5A 2QSCH 1MHEA 3BUYB 1KTDB 1LP9A 3MREB 3OAZH 4YHIA 3WFBL 3WXWL 3QZWA 1OP3H 5F7MC 1C16B 4JHBA 1KEGH 5C0ND 4PGCA 1KJMA 3W11C 4IS6B 4PJEA 4YH6A 2F53A 1AGBA 2OLDA 1JYVA 4C83A 3O2DA 1MCFA 3FMGL 3UYRH 4ETQB 4MNGE 4ONHB 2R0LL 2IAND 1U8HB 3FB7A 1EHNA 2VLKA 1ND0B 1IGML 1MJ7H 3PQYB 4RISH 2P4AB 4JPWH 4K3JH 4WWKA 3KJ6L 1FQ9C 5B39A 4R0LB 3TIDB 3MRJB 3NACH 2AABL 3MA9L 3WDHA 1BFSA 2CK2A 2YD1A 5FDWA 5EU7E 4DQOH 1NBVH 2D7QA 4JM2D 4WCYH 3MRLA 4J1UB 2Y4SA 4QT5B 4OAWB 1LK3H 5HJ3B 1YJDL 3WN5A 5C0GB 2XY1A 4U1SB 3UP1A 1OLZA 2P47B 4M5YL 1CT8A 2OM5A 1T1WA 4HS3A 4Q9RL 1QKZH 1YNTA 1RZKL 1CR9L 3EDFA 4TRPL 4D0CB 3I6GB 5BO1H 4MAYD 4R2GB 4P2RE 4P9ML 2H26B 2C9AA 3UMTA 1QFUL 5DEFA 5E5RB 4YUEH 1X5LA 3VFPB 4TULH 2XKNA 4Q7DA 2HWZL 4XPBL 3CXHK 3PHOB 2NCMA 2W0FB 3WFCL 4JJ5A 2EE6A 1OSZB 2ZPKH 2DLEA 2ZOKA 3EJYC 3V0WH 1FV1A 1N6UA 3KHOA 1GOFA 1J1OL 1S7WA 2FSEB 2CK0L 5D1QC 1D5ZB 4X6CB 1RHFA 3QNZB 1LP9F 4IOSD 5CD5D 4RMTA 2JK5B 2Z9TA 3UAJC 1PYWB 4M62L 3FTGB 4PJCE 1BOGA 3K2UH 3LKQB 5TE6H 4I3RL 1FLTX 5LCVH 1LDPL 3FB6A 2OI9B 4TUJB 3EDDA 2AEPH 3L3IA 1CFVH 2AJYH 3O3BB 5HI5D 3GJEB 1Q0YL 2H32H 1S8DB 4KZDL 3RTQC 2FGZA 2GK2A 1KJ3H 5CINL 4NQXB 5IMLA 5I2IA 2Z93A 3CDGA 3DHMA 5HVGB 4PGEA 4U6VH 1TNNA 1Y18B 1UH2A 3O2VL 5JHLH 3D18B 2FRGP 3WKML 1BFTA 2HYMA 2PYEE 2DQTL 4OLXH 3WIHH 1IMHC 5JPNA 1OP9A 3X11B 1XCTA 1AD9A 3C60D 4X80L 5F1OB 2Z0BA 3N9GH 1MEXH 1HOCA 4HWBL 4UIMB 3FQWB 1GZQA 3R1GL 4HFUL 5FK9A 3KXFB 3ZDYF 4AYFA 4D9RD 5GGSB 3TZVB 3SGDH 3N06B 3QFJB 1ZVYA 3RZCB 3W9EB 4Y5XC 1F6LL 3WUWG 3DRQB 3ARFD 1ODAA 4P5TD 3MLPA 1S9YA 2V7HA 1YEGH 4YDIL 3D0LB 4P3DB 1PVHA 1GPOH 1ROWA 2ITDB 4HV8B 3D6GA 4JN2A 5EU4A 3QCVL 4P23A 4G6KL 4C54A 1K8DB 5DVNA 3B9KD 4PRBA 2ZNXA 5E8EB 3O2DL 1QNZH 4EI5C 3P9MB 3C9NB 3BYYA 2VDLH 4NCDA 5GRYA 5IVNA 5EU3B 2WIMA 4HUXA 2I07B 3PL6C 4KAQL 2ATPB 4NC1E 5DFVC 4Q6YA 3ARTA 3CVHB 4PR5A 4X4YA 3PWJA 1GGCH 4OLZH 3L1OL 1FNGA 4RA3A 4R7DA 2E9JA 3RZWA 1QUNA 4WO4B 2XTJE 5JW4N 5BCAA 2PO6B 4I0CC 2FLRT 1CDJA 1LO0L 2AEQL 3JWDL 3GO1H 2HG5B 2A6KB 5FOJA 4UU9A 2QTEA 3BJ91 1ADQA 2ZG2A 3KYMA 3FT3A 5F93C 3Q6FA 2NW2B 3GMNA 3MCLH 2G2RB 4HK0A 3UCRA 3RDTB 1PQZA 1S7UB 2VKXA 3ARDC 4DZBA 4GG6B 5KZCB 5I1EL 4POUB 5FEBA 4RAVA 2IPTH 4YR6A 4XP9L 1YPZA 1U93A 1W72B 4M93B 5KSBE 2DQCH 4XCNA 4Y1AA 1U8LA 1AQDA 1FG2B 2FYYB 6FABL 3P77B 5TE4H 2Q7YB 1Z9OA 3B8YA 1E6JL 4MQ7A 2VXVL 4LK4A 1IGIH 4MNQB 4Z7UA 2R23B 2YPVH 1QFWL 3EYFB 4ZUUA 3G5YA 1NGZB 1WFNA 2EDXA 5ESVA 3SE8H 4G9FE 1KIQA 2D4FA 2OK0L 2BOCA 2EE3A 1A0QL 4U1MB 3VXTA 3BPOC 4PJIA 2YD2A 2OQJB 4LLQB 3VRIB 3WFBH 3WXWH 3FOLA 3B83A 4AL8L 2DLHA 2FECI 3SJVE 4RQQA 4KFZC 2DYPB 4P99A 1JUFA 4YK4B 4TTGA 3O6LL 4U3XA 1QTYT 1FP5A 1D5MB 3MJ8B 2KQNA 1I7RA 2Q86B 5CS7A 5SWZE 1CI5A 2R0LH 4WHYG 3L3HA 3B9EA 2B7DT 5CGYC 1FZOA 1IGMH 3ARQA 4XC3L 1JF1B 1RJLA 1HHGA 1U8QA 4MCZB 4OGXH 3EO0A 4XP6L 3KJ6H 3OKEB 4QHLB 4OZFB 4W4OC 1E27A 1FYTA 4X7DC 5C9JB 5IB3A 3TESA 4PD4J 1CS6A 2AABH 2APXA 3MA9H 3QEUA 4I4WA 1OCWL 4CADB 4P2QE 4ZSOE 1ZLUH 2O5XL 3KVQA 1FN4B 2YC1B 5IBUB 4X9GA 5DRZB 1YDPB 1S9WA 3VWJA 5C3LD 1CU4H 2HT4C 3MLWH 1YJDH 3IS0X 4ZPTB 3VI3F 1MF2L 3E6FB 4MB5A 1Q9WA 2X44D 4XMKL 3TN0A 2GSGB 2A74B 4M5YH 4CJ1A 4J3TA 3W0WA 4HIIA 1C5CL 3OKOB 2J8OA 4Q9RH 1RZKH 5CZXD 3NCCB 1U91B 2DMBA 3JVGA 4IDLA 1CGVA 4TRPH 1SY6A 1YPZF 4KJQD 3FQRB 4H1LB 4MD5A 4N1CA 3ZKNC 4P9MH 2JJTA 1NQBA 4WW2A 1QFUH 3U9UA 2BSSA 4X5XA 3QEHB 2YD3A 4KUCF 5F7DA 4RFNC 1FZKB 1UA6L 3ZYJA 4F7TB 2HWZH 4XPBH 4Z7UF 4LCYB 3SE3C 1PSKL 3WFCH 4IOFD 5DMYA 5DZLA 4KI5E 3MZGB 4P5KB 1J05A 2DBLL 1D5XA 4HQQL 1J1OH 1PD6A 2CK0H 4HUWB 1CK0H 2Y23A 1QSEE 2HRPL 4P4KD 1I7UA 3UTSB 2L7UA 1I4FB 3Q48A 4PJIF 4HUKB 4G6FB 4M62H 3ARUA 3VXOA 3MNZA 3SE4A 4MJ5A 1ADQL 2R2BB 5L8JB 3O6KL 4LLMA 3REWA 4XCEA 1LDPH 1FL5B 5E5MB 2Z8WC 5I9QC 5A2LH 1KV3A 3ZSTA 2H3NA 2XFXA 1CGUA 4KMTL 5J57B 3T2PA 3V6BR 1Q0YH 2X42A 4KZDH 3O3DB 2BFVL 1DBJL 1JPTL 1U3HA 2ADIB 2EC8A 2HLFD 5CINH 3QAZB 3REVB 3V6FA 3U0TB 4OV5B 1F2QA 3TT3H 1YECH 4QXUH 4ODHL 1F11B 3O2VH 4MQTB 2NY3B 3OKYA 1R3JA 5KSAA 1A3RL 4TYUA 3WKMH 1XIWB 4WEMB 2DQTH 3CDCA 4TUOA 2JJUA 4RGNE 3NPZB 4P4RA 5SWSA 4X80H 3AFLA 4KHTL 5E4EC 5FECB 1KB5A 4HWBH 3HFML 3R1GH 5TH2B 4HFUH 4YFLI 4L9DA 3CFIC 1YN6B 1E28A 4YGVA 5INDA 1EBPA 4QWWD 3HG1D 4BFGA 4N0CC 2AW2A 2ZG1A 3SKNB 3KXFE 2X4RB 3CJJA 5DVKA 2YBRB 4LVOC 1H3WM 1Q8MA 2OP4L 1DFBL 1HYRC 5L6YL 4YDIH 4KQ3L 3C5ZD 4HBCL 3QCVH 3P30L 5ID0B 4QXTA 3HS0B 3ARZA 3E6HA 1NUGA 4BSWA 3O2DH 3WHE1 1HQ4A 3QUXB 3WL9B 4MHHI 5FXCH 4JFDD 5D5MA 1I8LC 4BQBA 1AKJA 2PTTA 5D1XC 4Z7QF 3ULUD 3WKNA 4KAQH 1RZ7L 3O8XC 3SDDC 3IU3A 4NRXB 4U05A 1KTLB 3L1OH 1M71A 4JZJC 43CAB 1GH7A 1J18A 1J8HE 3PP3H 1L7TL 1LEKB 4KJYA 3CDYA 4PFEA 4MD0B 1LO0H 4WUUD 2AEQH 3JWDH 3LQMA 3QRFM 4MSWB 4GS7C 1UKQA 4ELMB 5HHVL 1KTRL 4R9HA 1HXMB 1S7RB 3WCYA 4KK5D 3THML 2V5TA 1JBJA 3MNVB 3C2SA 5IK3B 4JY6B 3ESVF 1IFHL 5HDBE 1GYAA 1FVDA 1S9VA 5K59E 4G6AC 2NY5L 1OW0C 2GTWA 4NDMB 3RNQB 3BPNB 1U6AL 1IM3A 3D39D 4Z6AT 5I1EH 5I76B 5IB4B 4IRJB 1SY6L 3C6LD 3O2WL 4XP9H 4I2XB 1JFQL 5D7KE 2X4PA 1E6OL 2IEPA 5IV2B 6FABH 2AXHA 5KVGL 2FJHB 4L8DA 1E6JH 2QR0A 1JTOA 2B4CL 2NX5D 2VXVH 1DEEB 1J0YA 3KLHD 3GSRB 2Y7QB 1QFWH 5D7IE 1X9QA 2EH7L 4CVXA 3HZYB 5I8OL 3QUYC 1BD2E 3I3DA 3X17A 3EAKA 4LNRA 4PRAA 4EN3C 3BYTA 4PJ7A 1A0QH 1SMOA 2GIYA 2A6JB 3SDXE 1CLZL 1DUYB 4R3SB 4DKAA 1JN6B 2PR4L 4UT7L 3VA6A 4OT1L 2F5AL 3GZKA 3BI9X 4CW1B 3MREA 1Q0XL 3I02B 3O6LH 1C16A 4J4PC 2JLLA 4PJHB 3OV6A 4DEPB 1S7SB 3KLAA 5D5MF 3IAQA 1X4YA 1H8NA 1GC1L 3S4SB 5AZEL 4GT7A 3F7YB 5CZVL 4NQCB 2ENSA 2AXGB 4KH2A 4NWTL 4ETQA 5LXGL 5DD6B 4ONHA 5LWYL 1U8HA 1TJGL 2HN7A 4Y5VB 1NDMB 1ND0A 5FHBL 3NIFE 4XP6H 3PQYA 4Y0GA 4NQDD 3DX9A 4AIZB 3H0TB 1XR8B 3IF1B 3SCMC 2RHEA 1OCWH 1KB5L 5A43C 4UBDD 4ACPA 4OCLC 3MLZL 4R0LA 3TIDA 2O5XH 2XZZA 3MRJA 1PY4A 3M17B 4MGXA 1J10A 5GIRB 2R2EB 3GSUB 5IVOA 3D69B 4LPXA 4XHJD 4J1UA 2HP4A 4OAWA 1Y6NR 5HJ3A 5C0GA 2X4SB 5DDHB 5F1SA 3T0EB 1ZA6B 5K9KB 5GGUB 4PRHD 5JORA 1AFVL 1WV7T 4UIKH 4M1GL 3X3GL 2ZSWB 4D0CA 3I6GA 4P2OD 2JCCA 3QEQB 3CH8A 3CZFB 5HYQB 1SM3L 1UA6H 4JRYE 2H26A 3KYKL 4R97B 5ITBL 3RP1A 1PSKH 2I9LB 4QTHB 5F1IB 1T04B 3ARGD 3IFOB 2DBLH 4NN6B 2DI7A 4HQQH 1BEYL 2VDML 2DQUH 2W0FA 5E99L 3S34L 4PJ7F 1T03L 1OSZA 4MDIA 2HRPH 2DKMA 4JQVA 2W0LA 4OKVB 2FSEA 4UDTB 1K2DA 2VLRD 2D7PA 1NGYB 4K3HA 5JPMB 1D5ZA 4X6CA 3QNZA 4LL9A 1ADQH 3O6KH 2JK5A 1PYWA 4GXUN 3FTGA 1JNJA 3HC4L 4OFDA 3GJFB 4X6DE 3LKQA 5BS0D 3HUJE 5HDOA 4FQXD 1TLKA 5MP6L 4KMTH 5GS0L 2PXYD 4OIAA 4TUJA 4U1LB 4UNUA 3BESR 2ZUYA 2BFVH 1JPTH 3QPQD 2DIBA 3O3BA 1AJ7L 3GJEA 2WUCL 4GQ9L 1S8DA 3NCMA 4OD2A 4YLQT 4EDWL 4ODHH 4KKAC 1ZT1B 4NQXA 5IHUL 3V2AR 5CIPB 5GSRB 1A3RH 4HWUA 1RV6X 1HCFX 2QADC 3QG6A 1Y18A 3D18A 1FYHB 4L4TD 4KHTH 3U1SL 4DGIL 1I9EA 3HFMH 2Y07L 3X11A 5FKAA 3H8NA 3W82A 5ISZB 2DB8A 3QDJD 4UIMA 5E0QA 4Z0XB 1XCQB 2YHGA 1H9VA 3H3PL 3DTXB 5GGSA 2YWYA 4LQ1A 3TZVA 3DO7B 2OP4H 3QFJA 1DFBH 3RZCA 3W9EA 5L6YH 4NT6B 4HT1L 3GSOA 4YDJB 3T04D 4HBCH 5LGJB 3P30H 4JY4B 5CEZD 1XF1A 3DRQA 3GKWL 3D0LA 4P3DA 3H3KA 1RZJC 4XP5L 2ITDA 1OTUC 4KROD 1RIHL 4PP1D 5E9DB 1K8DA 5BW7A 4ZODA 5EORL 1NC2D 4HGKC 3P9MA 4RAUB 3C9NA 1RZ7H 2R0WL 3BZFB 3UTTD 2YEZA 3EBAA 2HT2C 2N1KA 2BHYA 5EU3A 5KN5B 1MRDL 3KPRD 3TA3B 2I07A 4Q0XH 3SN6N 2ATPA 3BD5A 3CVHA 1MCQA 1L7TH 4PLKD 1C7SA 4GO6B 4L8BB 5T3ZD 4F8TA 4X6CF 3LV3B 1P69B 5HHVH 4WO4A 4F7MB 3HE6D 3DROB 2PO6A 2WNGA 4PB0H 3THMH 4KK8C 2HG5A 2A6KA 1Z0MA 1KIRB 1BQUA 4HJ0D 2J7LA 5I18L 2G5RA 2I5YL 4LIQH 5IBLD 5CSGA 3TCXA 1NUDA 4QNPE 2NW2A 4N9GB 2NY5H 3BQUD 2G2RA 5JOPE 1ZHNB 1U6AH 4EJ1C 4S1QL 1SY6H 3RX7A 5J1TC 4CRPA 1S7UA 3O2WH 2CPCA 1JFQH 4OZFG 4GG6A 1E6OH 3D85D 4ZXBC 4XX1G 4XAWL 2XZQL 2XRAL 5KVGH 4HKJA 1W72A 2B4CH 1I7TA 2ADGB 2V2WA 3OKDB 1FG2A 2FYYA 5IBUG 4MXWL 3P77A 2WLYA 2Q7YA 2BSED 1X5HA 2P5EB 4OGAC 3W11D 2EH7H 4I0KA 5DJ8B 5I8OH 3F65A 4MNQA 2BRQA 3ZYOA 2R23A 4CDGC 1CG9B 5DA4A 1VFUA 3EYFA 4E41D 2D4DA 1NGZA 3IKKA 1KXQE 1CLZH 3LMJL 4ETYA 3MBEC 4LLVB 3B8SA 4LP5A 2W0PA 4U1IA 4XCYB 3MRRB 3DNKA 3OPZL 4EBQL 4K3GA 2BNRB 2VZUA 4U1MA 2PR4H 4UT7H 5HHOA 2OXHA 2F5AH 2W38A 1WC7A 3VRIA 4LLQA 2OQJA 1Q0XH