1WEYA

Solution structure of rrm domain in calcipressin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGLIACVANDDVFSESETRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM domain in calcipressin 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords calcipressin 1
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1weyA00
5D78A 3BO4A 4TU9A 1WELA 3THPA 3PIOQ 1VBYA 3MUTP 2YH1A 2I2YA 2MHNA 1K73T 2MKSA 1M5OC 1X4HA 2FY1A 2KXFA 3D2WA 2XNRA 1URNA 3J7ZT 2X1AA 5GAGU 2DGQA 5DDQC 1S79A 3VAFA 1U2FA 4C7QA 1FJ7A 2CQ4A 4PR6A 2KG1A 4QPTA 3IWNC 2M52A 2YTCA 4IUFA 2XS7A 1VQLS 2RUGA 5LSLA 3BS9A 1YIJS 2V94A 1VQ8S 3SDEB 1ZZNA 5DM7Q 1XN9A 1KOHA 1M5KC 1OWXA 1YJ9S 3CXCR 5CXTA 1VBZA 2BZ2A 1WG5A 4WFBQ 2CQPA 1JJ4A 1VC6A 1SJQA 2XSFA 1WHVA 4F26A 2CQCA 5BJRA 2ZJPQ 1U1LA 1K8AT 2RS8A 4M5DB 2ZJQQ 4ZKAA 2N3OA 2HGLA 2MZQA 5DM6Q 4C0OC 2OIHA 1NU4A 2KYXA 5ITHA 2M70A 2MY7A 3NNHA 2DHXA 2M4MA 1H2VZ 1SXLA 4UQTA 1VQ6S 2DNQA 2AYBA 2DNPA 2MKIA 1X4CA 3P3DA 2KVIA 2DGTA 2MZSA 3EGZA 2KN4A 1U1QA 1OIAA 1CVJA 3VAKA 2FPHX 3IRWP 1HA1A 2G4BA 2D9PA 5MLCV 4BS2A 2I38A 2KRBA 3H2UB 2LEAA 3MOJB 2RRAA 2DO0A 4TU8A 1DHMA 1M1KT 2CQGA 1Q86T 3S6EA 1VC0A 2DIUA 3CUNA 2HGNA 1YHQS 1WEZA 2CPXA 2DGSA 3NNAA 1R8HA 3NMRA 2G1DA 3U1MA 4WFNQ 4CIOA 4UY8T 3CCJS 4QU6A 1ZZFA 2PEHA 1VQKS 3TO8A 3US5A 1ZH5A 1VQ4S 1X4DA 2CJKA 1SJ4P 2M7SA 2MQQA 2FC9A 1YITS 3HI9A 5DDPC 2EK1A 3MURP 2MQNA 2CQ0A 2DGUA 3B4DA 1VQ5S 2CPZA 3UCGA 2RT3A 2AD9A 2KFYA 1R8PA 1X5SA 4P6QA 4EGLA 2KRRA 3LPYA 5GAEU 1K9MT 2CQHA 2XB2D 1YI2S 1WWHA 4V19X 5IQQA 3G4SS 1WEXA 1SJFA 2A3JA 1DRZA 3MUVP 2E5JA 3VAJA 3CC2S 2HZCA 4TU7A 2KM8C 2L08A 3CC7S 2OJ3A 2DIVA 4YB1P 5EN1A 3K0JA 4F02A 2ADBA 1DZ5A 2E5GA 2OSQA 3DLLQ 4IOAQ 1U1MA 1L3KA 2D9OA 3JB9k 5DETA 4YOEA 3Q2SC 2DGVA 1FNXH 2LXUA 3EGNA 3ULHA 4U67Q 2LEBA 3CMAS 2CPIA 3B4MA 3NS6A 3UWTA 3R1HA 1OPIA 4QQBA 4F25A 4ERDA 3S01A 1YJNS 1N54B 2DO4A 3UD4P 3H2VE 2RQ4A 1NJIT 2Q79A 1A9NB 3PIPQ 2E5HA 1H2UX 1A7GE 2U2FA 3MD3A 1D9AA 2YKAA 2DB1A 3ZZZA 2DHGA 4A8XA 2XS5A 2HVZA 1X4EA 1FHTA 2QFJA 3S7RA 2M2BA 2CPJA 2DH9A 1P27B 1SJ3P 2OTJS 3G71S 2DNNA 1WG4A 3UD3P 1H6KX 1N52B 1U1OA 3S8SA 2M9KA 1Q81T 2X1GA 4WFAQ 5IM0B 2MGZA 3UCUP 4Z2XA 3BEGB 4IOCQ 1OO0B 5GAHU 3SXLA 2HYIB 2OTLS 3CPWR 2CPFA 2MYFA 3SMZA 3P5TL 1JMTA 3CTRA 4Y00A 1JJHA 2JWNA 5GVQA 2MQLA 1HD1A 3CMES 4WIIA 1VQMS 3VAHA 2DNZA 2UP1A 1UW4A 2MKKA 3VAMA 5LXRA 2DNGA 2KHCA 1F9FA 1KC8T 2DNHA 3NNCA 2MMYA 1P1TA 4WKRA 3G9CA 2L9WA 2D3OR 1IQTA 1HL6A 2MQOA 2EK6A 4QU7A 1WHWA 3R1LA 2KM8B 3TP2A 2MKJA 2M8DB 3OW2R 3Q2TC 2ADCA 2AYEA 2LQ5A 2MZJA 3L3CA 2GO9A 2YH0A 2LCWA 3FEXB 5JVGQ 4LMZA 5HL7Q 4IO9Q 2VONA 1NO8A 1B7FA 5H1SV 3CC4S 2O3DA 2KXNB 3CCSS 3HHNB 2N3LA 1WF1A 2JRSA 2RNEA 3MXHP 1QVGR 4LJMA 2E44A 2MKCA 2DHSA 1RK8A 2LYVA 4WF9Q 2CQ1A 3G8TA 3CCLS 1O0PA 1YJWS 1UP1A 5JVHQ 1WHXA 3U1LA 3THTA 3CCUS 5CYJA 3CCMS 2F9DA 1QM9A 3ZZYA 2N7CA 2CQBA 1U6FA 1VQNS 2DNMA 1U1PA 2RQCA 1VQ9S 1YWXA 3BO3A 2KI2A 3CCES 1WI8A 4LIRA 2DH7A 2CQ2A 2DNOA 2DNYA 5LJ5Y 2KG0A 2LA4A 2QEXS 2CPYA 1X5PA 2QA4S 2J8AA 1M5VC 1FXLA 2DGXA 3I56S 2MKHA 2M8HA 2K8GA 4C4WA 2MQMA 2NLWA 2MZ1A 2DITA 2KH9A 2X1FA 2SXLA 2MXYA 5GADU 4CH1A 2LXIA 1U1NA 1RKJA 2EVZA 5LJ3Y 5LSOA 2J76E 1JJ2R 2FHOB 2N82B 1M90T 2RVJA 3G8SA 2F3JA 3TYTA 1HD0A 2DHAA 3VALA 4Y0FA 3CCRS 1UFWA 2VOPA 2BOPA 3N9UC 3RW6A 2MSTA 2B0GA 3CCVS 4W92B 3MI7X 2PE8A 3P6YC 2G0CA 2MJNA 2MJUA 2RRBA 3CF5Q 2ERRA 1M5PC 1X4BA 1WF2A 2WBRA 3V4MA 1U1RA 4YUDA 2ZJRQ 2MZRA 5HO4A 3J7YU 1PO6A 2DNKA 3NS5A 5FJ4A 1WEYA 1AUDA 1KOOA 2KT5A 1FT8A 3VAIA 1BY9A 2CPDA 3UCZP 2DNRA 1VBXA 2VOOA 2MB0B 1FJCA 2E5IA 2DH8A 1D8ZA 4TLQA 2J0SD 3G96A 2K3KA 1WG1A 1H2TZ 1VQ7S 2MPUA 2JX2A 3LQVA 1DBDA 3BO2A 2M88A 2VODA 1X4AA 5IFMA 2NZ4A 2LECA 3SDEA 3UE2A 3R27A 1FO1A 4CH0S 1S72S 2J0QD 4FXVA 2DNLA 5D77A 4PKDB 1X0FA 2OSRA 1UAWA 2CQ3A 4WCEQ 3CULA 2MQPA 3MD1A 2MY8A 1Q7YT 1X5TA 1U6BA 1X5OA 1VQOS 2LA6A 3MUMP 1WTBA 3CD6S 2FC8A 1X4FA 4PRFA 1WF0A 2DISA 2CPHA 3DXBA 2LMIA 2L41A 4J5OA 2XS2A 3VF0B 1QVFR 4FXWA 2X1BA 1VC5A 2AYMA 2YWKA 2CQIA 5LXYA 5GMKa 1WHYA 1PGZA 5DDRC 2LKZA 2CPEA 2RS2A 4OZ0A 2GHPA 3VAGA 1X4GA 5IM0A 2MGZB 1WI6A 1N8RT 1KD1T 3G6ES 1N88A 4CQ1A 5CA5A 2DGOA 2U1AA 3MDFA 2DGWA 2KXHA 5DDOC 2CQDA 2KU7A 1U1KA 2MZTA 3FEYB 1KQSR 1Q82T 2F9JA 1YTYA 4ED5A 3EX7B 3CCQS 4W90B 1G2EA 4RU2A 1SJRA 2XNQA 2AYGA 3P49B 2M0GB 1FJEB 2HGMA 2RU3A 3I55S 1VQPS 1W2BR 2MSSA 3RW7A 2JVRA 2JVOA 2DK2A 4OZ1A
chains in the Genus database with same CATH superfamily
1SH0A 4CLUA 3IO1A 3RAQA 1FD8A 3AH6A 4UOFA 3K2YA 4TU9A 4LFAF 3VVTA 2XULA 2UUBF 1IKYB 2AW0A 2BMBA 3H59A 5DZ6A 4BCAA 3CJTA 3W61A 2F8MA 3MUTP 2YH1A 1K73T 3ET6B 2IVFB 2Z57B 3N79A 1F3FA 1HBNB 3FBCA 1X4HA 1RT6A 2KXFA 2G13A 4KGZB 2V69A 4UF4A 5I3UB 4RNNA 3D2WA 4HI1A 4J9LA 1URNA 1RBLA 4PG5A 1GH8A 2X1AA 4KH0B 1FTCA 3CDEA 1CJUA 2GO8A 1S1UB 2DGQA 2DHHA 1U2CA 4GVBA 3KLEA 5M2RA 3G6VA 2UXDJ 3FGVA 1R43A 1TU0B 2J9DA 2OPSA 3ZNJ1 3NCPA 2DBBA 3MPWA 2M52A 2YTCA 3UDVA 3OPKA 3IWNC 2XS7A 1VGYA 1E6VA 2JZ5A 1LW2B 3BBFA 4MH8A 3CJ3A 3PEJA 3KLHA 1CSJA 4KE5A 1DFDA 3FFIA 1RTDB 1VK8A 4ZVQB 4AD6A 5DLGA 1KOHA 1M5KC 1YJ9S 2MEWA 3L4BC 4K5RA 2R7RA 4QCLA 4KHRA 1H7XA 1V6HA 2IJFA 2JHEA 2ROGA 1TP7A 1VBZA 5CXTA 2N4DA 1WG5A 1IJFB 2PFDA 3PDNA 3QIDA 3UO0A 1QLNA 1P8GA 4X84A 4JBCA 2CQPA 2VU5A 2Z2YB 4DV1J 3CMQA 4NLWA 4P7TA 4F3QA 2YQ3A 1NK9A 5HI7A 5BJRA 2HFUA 4ZN3A 5KFCA 3MHYA 4IR9A 1QAIA 5EWEA 5DGAA 4Z7YA 4DDFA 5B0AA 4OLOA 3KOAA 4JUZA 2HGLA 3GFHA 4MJKA 3FSYA 4C0OC 2NPFA 2JNJA 1T0TV 3DN9A 2QMXA 2RB7A 2W4CA 4MIBA 1XC9A 2DHXA 1L5UA 4NL5A 1SH3A 2NUHA 5HN0A 3IAM9 3NKYA 2Q6BA 4CDIA 4Z7CA 4UQTA 5KG7A 1LEOA 1N4LA 3R5GA 2VFTA 1Q95G 4CM0A 1T9UA 2UVRA 2DNQA 4GKKJ 4OYAA 2V8VA 1BWVA 2MKIA 2VG7B 2XMMA 1LW2A 1NB7A 4KGVB 1LNQA 2EFNA 1JNZB 5JUMA 4ECUA 2IMOA 5C7PA 2QSFA 2MZSA 3D1OA 4OX8A 2AWZA 2VHGA 3EGZA 1CVJA 3VAKA 1RHQB 2BANB 3IBCB 1SCJB 3AJDA 4PWWA 1NKBA 3W62A 3QQCD 3IRWP 4NMLA 4HDHA 4CLTA 2R2SA 1HA1A 1LXJA 3RAMA 3C14A 1S1TA 4A8QA 3HO1A 4QIWD 5KFHA 1FEHA 2I38A 1FEEA 2DY1A 2LEAA 1MROA 3FK4A 1BE4A 1ZTWA 3I5BA 1TUVA 3T5HA 4LFAJ 2O5DA 2DO0A 3DOMB 3OLBA 2ASLA 4QZVB 3NOCA 3DC2A 4OYXA 1D8YA 1XEZA 1F9HA 1F9EB 4DV2F 2HWIA 2DGSA 1R8HA 1FWPA 2GC8A 3T41A 4OYMA 5THWA 5A76A 5KFEA 1NB2A 2OEMA 3W2WB 4U7CA 3SCIE 3CCJS 4R8UA 1U2RA 3D6HB 1FWKA 1NHVA 4AL5A 2R8HA 4B9TA 2VQEJ 1FRHA 2P2CB 4KH1B 5HQMA 4XPEA 3WX8A 3TO8A 4LFCF 1U0SA 3DCAA 3VWSA 3D7SB 1S1VA 1S6UA 1X4DA 1B7YB 1ZM2A 3BR9A 1NPRA 4MFBA 3TAMA 4KR0B 2PA8D 2WVCA 1SJ4P 1NDLA 1SBRA 1DTTA 3HZEA 4ZVRB 1KQFB 2HFNA 3OQ2A 4XO0A 1O6XA 4M5MA 3M9OB 4DF4A 2UVVA 3QATA 2EK1A 2W25A 4A46A 2CQ0A 2HHTA 1HPZB 3OTBA 1L3TA 4K4SA 4LFCJ 1KKHA 2H5EA 1F0XA 2HAFA 4AQYF 3KLVA 2CPZA 2V4JB 1B0TA 4CTAB 3MM7B 4OJ1A 3NCQA 2BJEA 4ZDNA 2JLGA 3PFOA 2PEBA 3Q8RB 3RRHA 2JFKA 4DFMA 4GMKA 5HJYA 2BQUA 2AD9A 4NLTA 3V4IA 1NHUA 2YKPA 4Y28C 2BE7D 4CWBA 4NXMF 4O0NA 3PX6A 4Y2KA 3BH6B 1S49A 4LBPA 1YQHA 4FS2A 4C48A 1R0BG 3SV4A 2FD2A 2JLFA 4L6V3 4JV1A 5GAEU 4GC7A 3DI6A 1RT3A 3LGNA 4ZVSB 5EGYA 5CD4A 2XMAA 3M2VB 1FF2A 1HMVB 2XEXA 2CNKB 2GQCA 1WWHA 3D67A 2YNFB 2AJ2A 1VYAA 3AA9A 4J9NA 1SPBP 1QAJA 2VB6A 2B8QA 5CCMA 4DV0J 1DRZA 5D8HB 4L75A 5CYQB 3VAJA 3SI8A 1X9MA 1TKDA 3CC2S 2FVPA 4GC6A 1YSJA 2OLWA 1KR4A 1N34J 4B9MA 8RUCA 5A8WA 2Z30B 3JQJA 4YB1P 1E6YB 2ZC3A 4MMOA 4C8NA 3T19A 4DXLA 1PYOB 4USMA 1FKOB 3MFIA 1U09A 2OFHX 1T3NA 3WC2A 4DUYF 1EETA 1CC8A 1FJGF 1YZ6A 4PAAA 4XDCA 3CJRA 1VIXA 1S12A 1S57A 2ZUGA 2OSQA 3H4BA 2HW3A 2E7WA 3DLLQ 3FDSA 1L3KA 1M5HA 4CLSA 4Y65A 5DETA 3QWUA 1FNXH 4R5PB 4AFFA 2LXUA 1Y0HA 3KDOA 4M5KA 3EGNA 4JOUA 5A0YB 4DWIA 2HVIA 1JLAA 2VKZG 3CMAS 1LFWA 4B9UA 3UWTA 3ETMA 1YRUA 3MM6B 5KFTA 4CZCA 4YY3J 1CQNA 1RAOA 4HH1A 2NSBA 2XO6A 1DY3A 2QA2A 2QMUB 1MN9A 3KK3B 1RTHA 2FGOA 3OHAA 1R0AA 3W5YA 4LSZB 1TL1B 3PKMA 3PYEA 3BGOP 1N54B 2AJQA 4L73A 2GZOA 4O4GA 2CZVC 1JLGA 5B08A 1NK7A 4XDDA 1VRQC 4M5IA 3RTVA 1YJTA 4HH0A 2U2FA 2G2YA 2DB1A 2DHGA 3PRVA 3ZZZA 2CDQA 3GJSB 4A8XA 3J7A1 3QJLA 3W3SA 2C22A 2IYIA 2KZMA 1S1XB 1T7PA 1IKWB 3KHLA 1LV5A 4FF3A 2M2BA 2NS1B 1MNEA 4KSEB 4DSFA 2GS8A 2B4VA 3X1LB 1LKZA 2QA1A 5D4PA 4CYUA 3GSIA 5E3RA 4NA2A 3D6MB 1WDTA 3EDRB 1EB0A 1S0MA 4PEOA 3N6MA 1VMBA 4J91A 3VQSA 8AT1B 2W7OA 3MCNA 1SUQB 2ZBQA 3AOCA 4ER8A 3TUPA 2BABA 4FYXB 3UD3P 3IM8A 5F3ZA 1I94J 1P9QC 1IM4A 3IS9B 1DQ9A 3ENWA 3O1LA 1H6KX 1VJQA 4X66J 4A8OA 4DR1J 4I56A 1QAYA 4ZVUB 1LW0A 3DHXA 4WFAQ 2WSFC 1X60A 3C66A 3TAPA 3MMAB 5D0HA 2UUCJ 1S6OA 2MDAA 1MWZA 2AX1A 3BEGB 1JLFB 4P72A 1H98A 2XSJB 5KG4A 3TW0A 3K8WA 3QFWA 4NZ6A 4CLZA 7AT1B 3UPFA 2GNKA 3HKWA 2OPRA 3FCWA 1OQ6A 3CGIA 3BDPA 4X62J 2QLJB 4RW7A 1XERA 3GJTB 3CTRA 4Y00A 1XNQF 3KTQA 2WVBA 2IAJA 3O8WA 5KT3A 1FRJA 1G3OA 4TYBA 3OTEA 4DR1F 2R8JA 2ZUAA 3DLHA 1NPPA 2R42A 4DPTA 2HK3A 3BGRB 3I0SA 4Y2MA 4WIIA 3WX4A 4CLWA 1L3UA 4JV2A 3GG0A 5KT2A 5K5MA 2UP1A 4NLPA 2FJAB 2E7XA 1FE0A 3WIUA 4DEZA 4ZA1A 2KHCA 4TYAA 1F9FA 4C3KA 4KHPJ 3NBPB 5DS7A 2FGCA 5EWGA 4ECTA 1XNQJ 1UVMA 3A13A 4O44A 5E5NA 4C2MA 3KJFB 1HNZJ 1HYSB 3NNCA 2BRLA 3JTOA 4NLGA 2R4FA 2XY5A 4IO1A 3PW4A 4WYWA 3RUBL 3KUEA 2DEJA 1NK0A 1S77D 1HYSA 1HL6A 1WC3A 3FMBA 1JXLA 4KKOB 1WHWA 4KC5A 3HVRA 3D6FB 2ZVIA 3HX9A 1QE1B 2KM8B 5LMNJ 3PJ9A 2HMIB 4O3SA 3NY0A 1G4CA 1RBOB 4MYUA 4I2QA 3W2VB 1KSPA 3JXOA 3KJQB 1REGX 2ADCA 2HBQB 2VG5A 4DLGA 3PW5A 2YH0A 1WC0A 4LMZA 4ZLLA 2E9RX 2HS4A 1VRTB 1YK9A 2EW9A 3RAXA 5ETRA 2VG6B 3JQMA 1H73A 3M9NB 1FVSA 2KXNB 3KK2A 1LK7A 4NX9A 4PXCA 2JRSA 2OMLA 4UTGA 1NDCA 3CJ5A 2E44A 2MKCA 1IKXA 2IMWP 3MM8A 4ENOA 4UOHA 3G8TA 4DN9A 1KTQA 1YJWS 3BQ2A 3NL0A 2Q66A 4DPWA 5JVHQ 1WHXA 2ILYA 3U1LA 1R89A 4IFYB 1PILA 4DUZF 4FF4A 3JS9A 3VHQA 4KBIA 2R2UA 4LF6J 5K9FA 1RAEB 2GMJA 5D4LA 4AT1B 3SSRA 2F9DA 4PPZA 2GMHA 3AD7C 3R7BB 4NXMJ 3F0NA 2CQBA 4GRSA 2G0JA 3TVZA 3EVMA 2P6SA 4KAIA 2VD3A 2XLIA 1N56A 3V6KA 3C15A 1FKPA 1S7HA 1YWXA 2YXLA 5ETQA 3BO3A 1VQ9S 4LSNB 2HQ3A 2I5JA 3M6UA 2HFZA 1WI8A 2DNOA 4DQPA 4K4YA 3BGFA 4F0KA 5B0BA 4O3QA 1IKWA 3SFUA 5LJ5Y 2KG0A 2CPYA 4K4VA 1X5PA 3OXGA 4LREA 2F5GA 4ZIVA 4CT9A 4RX6A 3HF5A 2HKEA 3H25A 1FRXA 4JP8A 4P2FA 2M8HA 2IBOA 2AF6A 3NGRA 3QZ7A 2IM1A 3KLGA 1GK8A 4NLUA 5DG7A 3MTJA 1QSYA 2NLWA 1JLGB 4HVZA 1J5OA 1HNXJ 2HBYB 2DITA 1I51B 3W65A 4RLEA 5IV4A 4B9VA 5L39A 2J0XA 3TJ9A 1RHUB 2YNHB 1WJ9A 3KLIB 3QNWB 4I1TA 4ANCA 2X1FA 1Z4UA 3DM2B 2V0NA 3E51A 3DKDA 4G6VB 2A6MA 1B70B 4TN2A 3KK3A 1U1NA 2Q3PA 5DQHA 4OI0A 1RKJA 2HVHA 3GYXB 2WOMB 2J76E 3HVTA 1T94A 3C8YA 1LXNA 1KN6A 2RVJA 4LBIA 3TYTA 1NJWA 1GMVA 2M3DA 4N7TA 1RKIA 3U1NA 4DQSA 2YX7A 1VR6A 1CBKA 2V63A 2E1AA 1YRTA 7FDRA 4I0WA 5L1JA 2AQ4A 2A6OA 4XTTA 5KFPA 3R5CA 1PG5B 4Y0FA 1UFWA 4DG1A 3M9MB 1RP5A 3TX8A 2K2PA 3M30B 2BKNA 3RW6A 1BQXA 2V8PA 3LPEA 1RLCL 4LSNA 4X4NA 4CM2A 4F4WA 3CJ8A 2WSEC 3C15B 2C2RA 2YNIA 4DSIA 1RU1A 3H7HB 2AJ1A 3K5OA 4QWCA 2PE8A 1F5BA 3MM5B 3GU0A 4NRTA 3HFKA 3MOZA 4P52A 2XO7A 2ZH2A 2G0CA 2ALZA 3IC1A 4ED4A 3V81B 1D0EA 5IS2A 4UQGA 1M5PC 2IM0A 2E5LJ 4FF1A 1WF2A 3DRPA 1S9EA 1HWLA 2HK2A 2RE1A 5D0GA 4DL4A 3V4MA 3NGSA 1U8WA 2MZRA 1XIQA 1PO6A 5E7OB 5HVGA 4EUVA 5ETLA 4X64F 3AQOA 3GIJA 1OY8A 5AE3A 3PX0A 3BV8A 3GFZA 2RHSB 2WW8A 1MN7A 3DI6B 1RGVA 3VAIA 1BY9A 2UV8G 4LR9A 1JB0C 3JAMY 3FZBA 3H90A 4ZS6A 1I3OB 2EFOA 4LF9J 1M0SA 2J0SD 3G96A 2K3KA 3OVSA 3KK2B 1H2TZ 2MPUA 1C4AA 4WK1A 2EFPA 1HWJA 4RUBA 1VRTA 2C2ZB 3OLAA 2M88A 5IFMA 2V2QA 2LECA 2BV3A 2VG5B 3ISZA 3UE2A 1UFKA 2P9EA 2AGQA 3IBFB 3C6TA 2XCAA 2J0QD 5J2PB 2BJ8A 1JLCA 2VZ9A 5IOLA 3IGVA 4FXVA 3ZO7A 1QE1A 1TTHB 3WHIA 5J1EB 4RPFA 2HRUA 1HPZA 1RWWB 2HNZB 2HNDA 4WCEQ 4X4QA 1HR0J 1NNDA 2ZFHA 1WDDA 1F1BB 4Y2IA 4F0MA 1Q8BA 3U7JA 2XTJP 4X4PA 1BHNA 4OIXA 1ZBTA 3BN7A 1T9WA 1DTQB 1K47A 2V34A 1HBMB 4MFBB 3TAMB 2LA6A 3ZTPA 2FVQA 2XYPB 4RUCA 3O2IA 3HM9A 3K58A 3OTCA 4K59A 1X4FA 1IR1A 1TMMA 2BM1A 2XC9A 1WF0A 3B78A 2EI5A 2CPHA 3CD7A 3DXBA 4LVNP 4RW9B 1BQNB 2FUG9 2GFFA 3OR1A 4UUWA 3RBZA 2KFNA 3AD8C 1EX8A 3OJUA 1TMJA 1TAQA 4JV5J 4KJIA 4FXWA 3ENQA 3Q8PB 4DJBA 1VC5A 2BUNA 1FXRA 2IAJB 2CJXB 4BWJA 5HMWA 2Y8WA 2A10A 2VV5A 4IG0B 4LFBJ 2AEFA 2XCPA 5EUHA 2UUCF 3I96A 1HQUA 3DOLB 2HHWA 1LOUA 2LKZA 1QUVA 5B0EA 1JLFA 1SL2A 2HHVA 5KT4A 4UUXA 4OZ0A 1WORA 1HNWF 5IM0A 3BSCA 1WI6A 1N8RT 4PG7A 2B8PA 1KD1T 2HHSA 3IFEA 4JI5F 3D9BA 4QWAA 1IXKA 2KXHA 1JX4A 3HZGA 1U49A 1NEEA 2BANA 1T05A 3D66A 3JQKA 3JSRA 2F1FA 1HQ2A 1KVKA 1SUQA 3MR6A 4J9QA 2MZTA 1U1KA 1S4FA 3JTNA 2E1PA 3FNNA 4ZHRB 3X3UA 2MKYA 1YTYA 1HQEB 3CCQS 1KDNA 4RNHA 3DOLA 2PDAA 2JC1A 5ETTA 5F3TA 3SCLE 4FBTA 4LF8J 1C0UA 1VQSA 2GAHC 3K5NA 1SJRA 2XNQA 1LWFB 3D0HE 4NYZA 4ZVTB 2R2TA 2AYGA 2RU3A 2ZH4A 3Q8UA 5D4OA 3VZHA 1FJ7A 4OFZA 2W8KA 2MSSA 4FBUA 2KB2A 3DU6A 1L3VA 4LF6F 4DX6A 1WACA 1ZPWX 1O5JA 1RQ0A 2RUSA 3I82A 5D78A 3PW0A 3BO4A 2R8KA 4Q8EA 3OR1B 1WELA 2DR9A 1RLDA 1VBYA 2AKWB 4RW9A 5K20B 2V6AA 4ZCKA 1FE4A 2WONA 2I2YA 1D09B 2BJ1A 2EC2A 4LRAA 1RZMA 5EX0A 2UXCJ 2MHEA 1FXDA 2FY1A 2A18A 1DTQA 2XNRA 5ETKA 2HQDA 4LBHA 2WAQD 3V6HA 1NUEA 3MECA 5KFBA 3J7ZT 1B64A 2LDIA 3MM6A 2PIIA 2BKOA 4UZCA 1FRMA 2NXJA 4OQJA 2R7TA 1I6JA 1RAFB 3KJNB 4PR6A 1S6QA 3A12A 3AHPA 2AEMA 4PCQA 5GAEI 5A0YA 4F4AA 5J1EA 4PG6A 4IUFA 1FHTA 3GQCA 2QMWA 4KO0B 4DFJA 1SQEA 2R7XA 1GX5A 1KEKA 4Y6IA 4WP9A 1VQ8S 1K0TA 4NE9C 1B99A 1HNIB 1QAXA 2LQ9A 2H5JB 3SDEB 5DM7Q 4TXSA 4ZCIA 3LAMA 1WTFA 3FFIB 1HNXF 1RTDA 2D69A 4KPCA 3G87A 3DGVA 3IR7B 3AD9C 2X51A 1VHIA 3QLHA 2OFGX 5F9NA 2GJIA 2JH3A 4OYOA 5HAOA 4U96A 2QSWA 4IH5A 2UVUA 2QLWA 2XGQA 1KVJA 5F8JA 3ZZUA 2WHOA 4GVBB 3KLEB 1UZDA 4CNZA 3MPVA 1AB8A 1OJ4A 3EWGA 2JOQA 1VC6A 1JJ4A 1RT7B 1BD6A 1UJ4A 2Q1LA 2WVDA 2YNFA 1GXTA 3DRPB 1HBNA 3O3LA 4DSKA 1TKTB 2XMVA 2EG2A 4ZKAA 5IT0A 5I3QA 1LWEA 2XY7A 2F4VJ 3B6BA 1HI1A 3AB2B 3ZTRA 5F0UA 3MM5A 4ED7A 1RUSA 4WE1B 2IFXA 1KBRA 3T9ZA 2M70A 3K7RA 4OV6A 4DV1F 4ZITA 1I94F 3NNHA 8ATCB 2XM3A 1H2VZ 2CADA 3EE3A 1FNOA 3R2CJ 2GQ2A 1RSCA 1UJ5A 1TL3B 4RUHA 4F4XA 3M30A 3IMQJ 5F9LA 5GADI 2ZHBA 5CH7B 3V6JA 4LQ3A 2QN6B 2H3EB 2KDOA 5L9NA 2AYBA 4ED8A 1FDDA 2OP5A 3DGPA 3FCVA 4WFZA 1X4CA 5BYQA 5J1NA 3PV8A 1D3WA 2V4JA 1WC4A 4P2XA 4ED2A 2KVIA 5D15A 5GAHI 3TARA 4JI8F 4USJC 4YB7A 4DLEA 4JI6J 4I6WA 2KN4A 3TUJC 1U1QA 1OIAA 2ASYA 4I6AA 1S6QB 2EBEA 3MMBB 2E1RA 1BQMA 2FPHX 4KPYA 6FDRA 4DUYJ 4PPDA 3MAHA 5LSRA 2ZOGA 3UW1A 5FDLB 1S0VA 2ACYA 3NLCA 3PZPA 3MTKA 4TQSA 5MLCV 1W26A 2D7SA 3MAAA 9ATCB 1WC1A 2KRBA 3H2UB 5KFKA 4BS2A 3KJVA 2H4YB 3CD5A 1QTMA 4F36A 2CJYB 3FKBA 4JI8J 3BR8A 2F65A 2WONB 1UL3A 1J5OB 1DHMA 2AEJA 4QJVA 1M1KT 4OX9J 1RAAB 1VC0A 2XZDB 3PYFA 4A8FA 3DMJA 1IWGA 2A2CA 3HFVA 2HFSA 5ETNA 4R8UB 1G7CB 1WEZA 5G0RB 4URGA 1Q8KA 3MCSA 2JFDA 4JI0J 2AZ3A 3SQOP 2G1DA 3NMRA 4HKQA 4NA1A 3Q83A 4D3GA 2F40A 2YKMB 3IA0A 4KIAA 4O4RA 4PXDA 2W24A 3EZUA 2Y9HA 1CJVB 1Q8IA 4EBEA 5I3PA 4K8RA 1IM6A 1HQEA 2QIFA 4QU6A 4NI2A 4OI2A 4ZHRA 1XNRF 4ZIWA 3PTWA 3T5JA 2PD1A 5LT5A 2RKIB 1ZH5A 1RWVB 1SC6A 1RE1B 3O44A 3C14B 3T6BA 5KFOA 1U48A 3B8HA 4JI2F 1T05B 1FKAF 4ELVA 3R2DJ 1JK9B 3GFYA 4ZJLA 3N0VA 2VBZA 2AJFE 3IGNA 3CDBA 3QBCA 2WVFA 4DMZA 4ECWA 5H9FK 3MURP 2MQNA 2YWGA 3SIPB 3LP2A 4RL1A 3M8RA 2JEFA 4DL2A 1GQEA 2JL9A 3BJYA 2DKOB 3ILLA 3SV3A 1HARA 3AFGA 4DUZJ 4X2BA 4N5SA 4ZPBA 2CKWA 3FQLA 2XWYA 4ETZA 2RT3A 3G6YA 2DPIA 3M2UA 3TI0A 1S97A 4X65J 1EQMA 2RH3A 3RB6A 1KRPA 3KG4A 1QUPA 4WP8A 2KFYA 1R8PA 5AE2A 4DV0F 1X5SA 2DR5A 4NOHA 2VUGA 2EXUA 3QGHA 4P6QA 4ECRA 4FVCA 5FIIA 3H42A 2O66A 2XB2D 1J5EJ 4HLBA 1PKUA 2R2RA 1WSVA 1RAIB 2N4CA 3GLJA 4M5DA 4V19X 1S76D 3TQEA 1WEXA 1SJFA 2EC0A 2EEYA 3KG1A 5HQLA 1RU2A 1FK9B 1MW7A 4PWDB 3K17A 3LAKA 4NYPA 4TU7A 2KM8C 1X9SA 2PI4A 3W9JA 3FMWA 3OV7A 1UTAA 2DCUB 1VFJA 1SB6A 4DPYA 5SZTA 5AXLA 4AXIA 2ZH3A 2QX0A 3L7OA 3EYZA 1UVLA 4WZMA 5EN1A 3WBZA 5HSPA 3QT6A 4F02A 4TLRA 2XZWA 1JJCB 1C0TA 1NM2A 2J7KA 2V2VA 2WRMA 3HJVA 3M7VA 5KG0A 3TWZA 3DRXA 2ATLA 4V19J 2AU0A 4QIEA 1TFWA 4LR7A 1U1MA 4W4MA 3J81Y 2AHOB 2ZH9A 3JB9k 3ITHB 4DR3F 4YOEA 1NK4A 3DFEA 1X9WA 2RRNA 2HQGA 2FYXA 1S9GB 5KFWA 2CNLB 2W4DA 3BQ0A 1HKAA 2YNGB 3B4MA 3NS6A 2FVRA 1PBUA 3AAWB 1MMLA 2XBPA 3T1HJ 5IC4B 1WUUA 4ERDA 2QLFB 4C0BA 1YJNS 4DZ6A 4QR0A 3TUZC 3QIPA 3MAQA 5E33A 1RWPB 2RQ4A 2JEGA 1NJIT 3MR2A 1TK5A 2E5HA 1J27A 1RWUA 1ROFA 2WK4A 1A7GE 2YWHA 4L74A 4YB5A 1KNZA 3MD3A 4NLRA 1D9AA 4Q45A 2YKAA 5BXIA 4A8SA 3M8SA 2XS5A 4QW8A 4DFKA 5KFQA 4O23A 2QFJA 2CNOB 3RR7A 3OTOJ 1YZ7A 4DG1B 4JI3J 1MWQA 3DYAB 4ED1A 1AXQA 2X3GA 3P4UB 2DH9A 2B4UA 3R97A 5HATA 2C3OA 3RYLA 1P27B 3MWBA 4NPOA 4EO6A 3G71S 2OKQA 1Q4RA 3K8VA 1NHKL 2E29A 1RTIB 2Y1JA 3W7BA 3H20A 4M5NA 1R0CB 4DI6A 1SIWB 4DL7A 3BM7A 3ELHA 4DR6F 1U1OA 1N52B 1RI7A 3J80U 4EEYA 2M9KA 1NCLA 3MMJA 2X1GA 1R6YA 3KLIA 2YNHA 2OPQA 3LANA 4ZVPB 2CNNB 1OYDA 2RU9A 5KG1A 4Z2XA 2MGZA 4Q0BB 1PAEX 2YKOA 1EP4A 1TVRB 3WQPA 2GCFA 1UFLA 3QPIA 2B7BB 4IOCQ 3VGTA 3RU0A 1ZM4A 2MYFA 3OUYA 2HZVA 1HNWJ 3OFHA 3PRDA 1JJHA 2JWNA 3QFHA 4WPAA 5HMXA 5E41A 5KT7A 4DV6F 1ZM9A 1ELOA 2KT2A 2MQLA 4ZVGA 4LF5J 1VQMS 3FJ2A 2V8GA 1SJ1A 1V9OA 2DR8A 1EETB 2DNZA 3HT0A 4Q2LA 4USWA 1FKOA 2ZDOA 5C2GA 3VAMA 2L3MA 4YDXA 1E6YA 1Q5YA 1U0HA 2EWHA 2DNGA 2VBWA 5FD1A 5KG5A 3I6PA 3MCMA 2R7VA 5ETMA 4JV5F 5HMZA 4HL9A 2DNHA 1KWMA 1PAUB 3OVAA 4DV6J 1IR2A 2VASA 1FJGJ 1KQGB 2MMYA 4FVMA 3GV8B 1WC6A 1RABB 3MEEA 4WKRA 3G9CA 3MEEB 2D3OR 4F4KA 3D1HA 2V8DA 2MQOA 4ECQA 2EK6A 2PO4A 4CO1A 2WB1D 4FNHA 4QU7A 1SC1B 1FX2A 3HHKA 1IR0A 1UCNA 3T6JA 2WVEA 2ZWOA 3N6LA 4K0KF 2JJ4D 1Y4ZB 2YQ1A 2VL1A 3B82A 1ZAVA 5H9FJ 5F8MA 2W9BA 1RT3B 2H9ZA 4B3TF 1OY6A 2EKNA 2HEKA 3HHLC 3M8PA 2J5AA 2LQ5A 1EARA 1PSDA 2GO9A 3R6LB 3GIKA 2LCWA 3S1TA 2K06A 3BYRA 4ICLA 5H9EJ 2CJBA 4DR2F 5HL7Q 2JEJA 2D74B 3L9ZA 1B7FA 3BKUA 5IQ6A 2VG6A 3EZ5A 3CC4S 2O3DA 3IBWA 1GTEA 4DBQA 1UWBA 4RNOA 4YFUA 2DPJA 2C3YA 3PCOB 4LJMA 3DHWC 1W7WA 1RK8A 2CQ1A 3CCLS 5K14B 1O0PA 4FKYA 2HMIA 1PC5A 3BYPA 3THTA 4ZJQA 3HSZA 3CJ2A 4PYDA 5AXKA 1T9YA 2ZOFA 3MEGB 4U7UK 4G3IA 1Z2LA 3H5XA 5CYJA 3Q22A 1DTTB 1REVA 3KNGA 2OEKA 1QM9A 4IKAA 3DLEA 3ZZYA 2VQEF 2FHMA 2Y1RI 3R7SB 3NBPA 1U1PA 3RR8A 2RDDA 3I4PA 1N5QA 2ZD1A 5E3CA 4X4UA 2KI2A 3FC9A 2IJNA 3H8YA 4DN0A 2RAQA 2BM0A 1KLMB 2GHVC 3THVA 1U26A 4YR3A 3J7AN 2KJWA 2LA4A 5BYSA 5IZHA 4ZPAA 1YKWA 4CLFA 2F63A 1M5VC 1WSRA 2VDIA 4RW4A 5KTQA 4QWBA 2K8GA 1GMWA 1TKXB 5HBMB 2I9SA 3NEKA 3TUIC 2ZNZA 2BX6A 1RHJB 2D3O1 2P8IA 1F2HA 2C1EB 2EG1A 2IDEA 2HIQA 2BJ3A 2L9DA 3M8QA 1S5ZA 2Z56B 1PJ5A 4WU2A 3POTB 1F5CA 1S1TB 5HROA 3QGPA 3CDAA 3POTA 5HROB 1N36J 3IR5B 2R7QA 4PG4A 4CH1A 1BMQB 1XJWB 4AL7A 4WXOA 2EVZA 3D3BJ 4ZVHA 5LSOA 3L95X 4ELTA 4NASA 1CEZA 2FHOB 4OYBA 5F8GA 4ED6A 1TKXA 4H4KA 5HBMA 3GE9A 1HD0A 4FP9A 4RW4B 1UPPA 3SSQA 3WZ0A 1YG0A 2QYGA 4A48A 2KFZA 1RWOB 1TKZA 2CG4A 2P9GA 3VALA 1TK0A 4JYAF 3W63A 2G1HA 4MT1A 3TRGA 4MIWA 2XWXA 4IFVB 2YPYA 3DRRA 5B0CA 2CDRB 2MLYA 3CCRS 3N9UC 1HBOA 2IPOB 4G1QB 1DARA 5IWAF 2B0GA 1AA1B 1L3SA 3CCVS 2BW7A 4CCHA 3BBCA 2CVEA 3LP0B 2VBYA 3MI7X 4B02A 4W92B 5D4NA 3A1YG 1FNMA 2MJNA 3D1QA 4KGXB 2RRBA 3WC0A 2ERRA 3P6YC 3HK2A 1F60B 4FYDA 1REVB 5F8IA 2BE2A 4QIGA 3ZFVA 2MLZA 1X4BA 2V2ZA 2WBRA 2XMWA 3EJMA 1APSA 1RTHB 1EZZB 3PACA 3JAMU 4F2RA 3CVKA 4AYBD 2D3ZA 1PIEA 5HO4A 4OI3A 1U25A 2J8SA 3T3FA 5KFXA 2DNKA 1FESA 4USVA 4Y2AA 2K7JA 5K14A 1LQ9A 1Q53A 5KFVA 2XHCA 5KOWA 1FT8A 3N5BA 3UCZP 2DNRA 1VBXA 3PYDA 4I68A 1FDAA 2CG8A 3I5AA 4OJGA 4J9VA 1D8ZA 4TLQA 1HLWA 1TL7A 2BDPA 3EXYA 1RACB 2F7VA 2UU9F 1VQ7S 4C8LA 3DRSB 4WYLA 4DX8H 1DBDA 1CG2A 2VC0A 2JSXA 1X4AA 2NZ4A 2VBXA 4H4OA 4IRCA 3R27A 1FO1A 2J7UA 1VIOA 1S6PB 3RG6A 1KFDA 1RA7A 1RWNB 4R0JA 5U47A 4RJVA 2WZ1A 2DNLA 3UN5A 4R25A 5CZVA 4AQYJ 2CQ3A 2HLTA 1KHVA 3LP2B 1JIHA 3CULA 1ULRA 4OX7A 1C2PA 3GYGA 2MY8A 3R8YA 3OT9A 3HULA 1XTZA 1VLYA 1Q7YT 3HFZB 2HHHF 5IC6B 4NA3A 3H4DA 1RT6B 2GIFA 3T9NA 5KFUA 2ZBRA 4A47A 5I3UA 1VQOS 4G1PA 1WTBA 3BH7B 5KT5A 4U6PA 1EJ7L 3KKFA 2R7SA 4LRFA 3TZWA 4IYQA 3VGSA 4WZQA 1RWMB 3A8IA 4OZJA 1CLFA 1RDRA 1K44A 3BGLA 1QVFR 4Y2CA 1I5OB 3F41A 2VQFF 2OPPA 1HW8A 2XQCA 2YWKA 2CQIA 2E9ZA 1X31C 2DXDA 3CJQA 3R5AA 2NREA 3OUYB 3AQPA 4WFYA 1M5SA 1N33F 2J0WA 4I69A 4CTAA 4ID5B 1EP4B 1TVRA 2B7CB 1KLNA 2A1BA 3I9V9 3MF5A 2VH7A 4Q0BA 2NXUA 5T7LB 2IDLA 1X4GA 2F8EX 4DR5F 3TQ1A 1R7IA 5KFZA 4J9PA 1JLQA 4K4ZA 4BLGA 5A8KA 4UT4A 2U1AA 2R7UA 2GVZA 3FVYA 4LF5F 3HVWA 2GVZB 1OQ3A 1Y7PA 4CLYA 2V5HG 4Z37A 2LU1A 1UETA 3MMBA 4JI1J 2HNYB 1S1VB 2DJWA 1Q82T 2F9JA 3UNGC 1DQAA 2ZDPA 3IRXB 4EBDA 3I32A 5J2NB 2EFVA 4UW2A 1FX4A 3QT7A 2YX4A 4A8MP 5A8RA 2M5YA 2A0FB 2VPXB 2YWEA 3CDUA 1TV6A 2RD5C 3DGPB 3KDNA 1Y00A 2HHXA 5T14A 4H4MB 1SKRA 1SV5B 2L9NA 2LLZA 4U8YA 4Y34A 5IV3A 3PO4A 4O3OA 2AJ4A 2JVRA 5ETSA 3MR7A 2DK2A 1TR0A 2GV1A 2NCKL 2ROPA 3FBEA 2UXDF 2DYAA 2FJEB 3THPA 5DG9A 4DSLA 3DOMA 3NGUA 3RRGA 1RJJA 5HLFA 1LWEB 2W2OP 1VQYA 2MHNA 4E0DA 3LALA 2B9EA 1M5OC 1SKSA 1MROB 3CEDA 3OXFA 3LH2S 2AMCB 1JXVA 1KS2A 3DLGA 3QZ8A 2PMWA 5EWFA 2IVYA 3PHTA 4DV3J 4IQXA 5DDQC 1S79A 2ZWPA 3IN5A 3VAFA 5D6GA 2CYYA 4OHXA 4KFBB 4IR1A 3HHEA 5C42A 2FJDB 2ZKTA 1QSSA 2KG1A 2H5IB 3PO5A 4LRBA 3TR5A 1RAJA 2DR6A 4ECVA 2AIRB 2RUGA 1Y9OA 2FHJA 3ITHA 1VQLS 3QLHB 3DXSX 3M6WA 3BS9A 2GIQA 2V94A 2DY9A 5GMEA 3W9HA 4JI7J 1XN9A 2Z2MA 1R27B 2OMOA 2QZ8A 3WIVA 3VV2B 3W5XA 3CXCR 1KTVA 1TL7B 2APOA 1F6TA 1FDNA 4HACB 4IH6A 4FYYB 3AOAA 4B9LA 3TVYA 1QDUB 2F4VF 1IVZA 5CAAA 4WFBQ 1EHWA 2PSZA 3GZ7A 1NMEB 2Q43A 3HSJA 3PR5B 3OTOF 4O3RA 1FK9A 1WC5A 2XGPA 3QJPA 1WHVA 2NXNA 2CQCA 2BACA 2ZITA 3QO9A 4B3SJ 3QO9B 2PFFB 2CVIA 1RA6A 3GP9A 2RS8A 4M5DB 3RJMB 4I6YA 4Q43A 1ACMB 2H54B 3HP6A 1G6BA 5ETOA 2MZQA 5DM6Q 1G1XA 2OGUA 1KFSA 2FJBB 1NU4A 2KYXA 5ITHA 2MY7A 1D9FA 2QO3A 2FLPA 5JMNA 3TEGA 3M1VA 1S0NA 3A3OB 1N0VC 2DEIA 4CRJA 4X4RA 4USTA 1S48A 1P6TA 1RHMB 3H40A 2QJ3A 5EX3A 3KXDA 4IFVA 3M2UB 1VCTA 2L48A 4ZPWR 1C0UB 3ZNUA 2DNPA 5L1IA 1CJTA 2IM2A 3OFFA 3MPUB 3R3TA 2V4QA 4UY85 1TKZB 3P3DA 4H4KC 2B6AB 4RWWA 2BQRA 4K2XA 4OYWA 4DPUA 1VDHA 1R6VA 5J2MA 2VDHA 1SIZA 2H65B 3ENAA 4LUBA 2BVZA 4QR1A 5KFSA 5A2QU 1RTJB 4N76A 2BQ3A 4CNYA 1H72C 2KL8A 3EPIA 1HWIA 1VLOA 3MCOA 3VR1A 3P8BB 1S7IA 4ZLPA 4ZPVR 4DL0C 2RQMA 4DR3J 4WKYA 2W8LA 4EI2A 4JI4F 1DAXA 2YVSA 2QA4G 3MOJB 3GWCA 4WK3A 3PKYA 2RRAA 2HPUA 5HLFB 3I4HX 1IKYA 4TU8A 1F5AA 2QT7A 2CQGA 1HQUB 1Q86T 2IC3B 3CUNA 2HGNA 4FNIA 2CPXA 3MEDA 4KRWA 1IBMJ 2J6SA 1JWWA 4C3LA 5IT9Y 2QTWA 1BUXA 2LQ8A 3W8GA 4F8RA 2IJRA 1C1BA 1VI7A 1VBKA 2YPZA 3U1MA 4CIOA 1Y10A 2JDJA 2WW4A 2Z8QA 5G0RA 4UY8T 3IR6B 1R8AA 3N6NA 3C2PA 3GIIA 1TV6B 2BXJA 2CZ4A 4FYWB 3QSIA 4CLPA 4F4YA 3PRBA 1ZZFA 2PEHA 2BJDA 3AXMA 3DLKB 1H3DA 4G1IA 5J2NA 1VQKS 1AW0A 3KJVB 2ADBA 2VF3A 3MAAB 1C1CA 1AUSL 4ZP6A 2CJKA 2UUTA 4WTOB 1XK8A 2XMKA 2MQQA 4JI7F 3UR0A 1YITS 1Q78A 2HG4A 4MYTA 3SSSA 1GT8A 2LU2A 4H54A 3TEHB 5F41A 4DU8A 3SZ2A 4X4VA 3MEGA 2ABYA 3G82A 1JLQB 1NH8A 3N5FA 2GVDB 2OEJA 4MK7A 1SKWA 1BLUA 3P5BP 1B4SA 3V6DB 4N77A 2JC0A 2B4PA 2FY8A 1JLCB 2OI2A 1TL4A 2QLBB 3E8OA 3UCGA 2MTLA 4C8ZA 3MM9A 4DL3A 3Q23A 3BGUA 3CO9A 3OHBA 1NKEA 4P75A 4OI1A 5J2QB 2HS3A 5JXSA 3R5BA 3MMCA 4J9MA 1X0PA 3FRYA 3R5JB 4ECXA 3KNAA 1YBAA 2OPPB 4S0MA 4C9DA 3BN4A 3D0IE 4B3OA 1SKUB 3MGJA 2Y3YA 5E3PA 5BR8J 4WE1A 1AFJA 5CZXA 1B3TA 1HR0F 2CA9A 1K9MT 3CJKB 1ICEB 2CQHA 2ZE2B 4A8YA 4F3MA 4WXWA 5HMYA 9RUBA 1T8EA 1YI2S 3NOGA 5ETPA 1JLEB 1JKHB 2VC1A 5KFIA 1NSQA 1NKCA 4OI6A 3CNQP 1P9YA 2A3JA 1Q0NA 3DOKB 2ZOMA 3I9ZA 3M05A 3MUVP 4D3HA 2ROEA 2BW2A 4DV2J 1N33J 2CRLA 3UNYA 4OV1A 2PA3A 3M32B 4URSA 4YQWA 1TFYA 1Q8LA 1W25A 4HTJA 4PG8A 1ZM3A 2DIVA 3HHLB 4WWSA 1UVJA 3KK1B 2CJQA 4GO5X 3UFCX 4DSEA 1S6PA 1IBLF 5KFRA 4WIQA 5E2QA 4H4OB 3DNCA 5E3QA 4DPOA 3OXLA 1RT4A 2B5JB 1DZ5A 1CS4B 2E5GA 4ALZA 1HNIA 4F04B 4DS4A 3DRSA 2D9OA 4P7VA 2HQFA 3H5SA 3CW2C 2DGVA 3Q2SC 2HVDA 3SBMA 1YJRA 1ZETA 4X64J 1ITPA 2Z0GA 2O01C 3ZZ0A 2CIMA 2DD8S 3LTOA 4OJ3A 3ADAC 3J81U 4E8UA 1NPKA 2V4RA 2CPIA 3R1HA 1NK5A 4FS1A 4LF4F 1UMJA 3AOBA 2UXBJ 1S1WB 3K89A 4ZVEA 3S01A 4EU0A 4K4TA 2RQKA 1HWKA 4I7FA 2RDJA 3K5MA 1Q1KA 3H2VE 4IRDA 4YHHF 4UOCA 2Q79A 3H5UA 2ZH1A 2KKHA 3CCES 2E9TA 2ATCB 4RBVA 4NZ7A 3PW2A 1H2UX 4PQUB 4XPCA 3KLGB 1RTIA 4NEZA 1Q79A 4CH7A 3GYNA 1QSLA 1T03A 4L3NA 2YQ0A 4LR8A 5L38A 3NGTA 1QY7A 4U8VA 1YRXA 2LFVA 4DV4J 1BC6A 1X4EA 2QG9B 4USHA 4JI2J 1HBOB 4G1QA 4OHYA 1FRKA 2IVMA 4PXEA 3UN3A 4EK2A 3VQTA 1ZTTA 1LWFA 3CDWA 5EDWA 1LWCA 1UEKA 4M63A 2J7WA 4NLDA 5B09A 4PZVA 4LF7J 1RADB 2EPIA 4EYIB 1WG4A 3NRBA 5HANA 4DL6A 3SFGA 2HFVA 2E1MC 4J9SA 2DCLA 1NDPA 4M8LA 5I42A 2W7PA 2OD6A 1RAHB 3QIPB 1DLOB 4C0HA 2UUAF 5IXUA 3FCHA 2IY5B 5GMDA 3UVJA 2LVWA 3S8SA 1CULA 3JYTA 5HQ8A 1N48A 4IFYA 3T1YJ 3M8QB 5IM0B 4LF2A 4Q5VA 3ETOA 4QBUA 4CI0B 3BSOA 3OL6A 4LFBF 5C25B 4DQIA 3B54A 1S10A 3MZIA 1OO0B 1GAOA 1S9GA 2NYIA 1QTNB 3CJ4A 3MM8B 2OD4A 3SXLA 5GAHU 1ZAXA 2GA7A 2CPFA 4JI6F 1UEUA 2QL9B 2VPYB 1U47A 3SMZA 2YKNB 3P5TL 1JMTA 1HI0P 2VFRA 2QGFB 1YBUA 5KOXA 3GCWP 1XR6A 2HBRB 5GVQA 2NYHA 3OSNA 3MEKA 4ANDA 3UDCA 1KLMA 1RCOB 1TQLA 1C0TB 3FQKA 2XMTA 3ZZRA 2MKKA 2ZD1B 5LXRA 1SQFA 5DO2A 4JI4J 1U7LA 3IM9A 4PYAA 1UA0A 3GFXA 4K50A 2V9WA 2DR7A 1D9DA 4QWEA 3J7YI 4KKOA 1HFEL 3DLEB 4ZN1A 1HHTP 3UDLA 5MAOA 4DV5F 4NCGB 1P1TA 4QW9A 3JSYA 1PC4A 5A6WA 3Q86A 4TY8A 3NWRA 4ZP7A 4PUOB 2HNZA 4B3RF 1PYTA 1SC3B 1X8DA 2IIHA 1HI8A 1S99A 3TP2A 2M8DB 1YX2A 4C6AA 1V3RA 5J2PA 3Q2TC 1RWKB 1AYEA 2WB4A 2AYEA 2QV6A 2MZJA 2F8HA 4M1KA 3L3CA 4AXJA 3FEXB 1XMQJ 1IBKF 4R0EA 4KY3A 4C97A 1SI9A 4MIAA 4IO9Q 2FJXA 1OSCA 1NO8A 5H1SV 5HP1A 3DDNA 3HHNB 4MTPA 2N3LA 3BKTA 1WF1A 7FD1A 1UWAA 2YKNA 1EQ0A 3Q89A 2IA0A 1QVGR 2HSEB 4OI4A 2DHSA 2LYVA 3M8PB 2VJUA 4WF9Q 2PMHA 5B0FA 5C25A 3FBBA 3MMAA 4LF9F 4DR2J 4TNOA 2ZM6J 3QAUA 1CULB 3JYTB 3GTYX 4J37A 3CCUS 4QPXA 3L7PA 5CCLA 3F56A 1DLOA 5L9XA 4C11B 2W9AA 3TZZA 4X4OA 3V81A 5HVHA 2RIJA 3W5ZA 4XAKA 2N7CA 5D3GB 2WTFA 3QRRA 4J7CA 4GKJJ 1JNRB 1VQNS 4WTYA 4X4SA 5DZ7A 4YP3A 1OS5A 2RQCA 3BBBA 3LO3A 2E1CA 1U0HB 3HXMA 2W01A 4F50A 2DTJA 3RBEA 2JLEA 3O5TB 4ZCLA 4YMEA 1MLAA 2YWFA 3A8EA 1CJVA 4FDFA 1YGYA 5LOQA 3FSIA 2OHDA 3EVWA 2CQ2A 4IDKB 4LIRA 2XZTB 2AP6A 3E01B 4OZ5A 1S1XA 1NJYA 2QA4S 3A8KA 1O51A 4NLOA 3VGVA 2J8AA 2J6TA 1M1HA 4LQ9A 4F3OA 1EKRA 2MKHA 3ZTSA 3VTIA 4C4WA 3T1AA 3PM9A 1QD1A 4PQUA 5A2QY 4B9SA 3SQGA 2MZ1A 1XR7A 1TL5A 2QFIA 4OJHA 2KH9A 4O4GB 4DV7J 2XYGB 2HWTA 2AJ0A 1T9XA 1NJZA 4I7FB 3IAS9 4DSJA 4K5SA 2SXLA 4C8OA 3DM2A 4N41A 5GADU 3HDSA 2XLJA 3FUYA 2NUUG 1FFGB 1LK5A 3C6UA 1YLXA 1NZ8A 3R5DA 5F0WA 4YS2A 4NXNJ 1BQMB 5L8RC 2VPWB 1KQKA 4OYPA 1H7WA 3G8SA 2FHKA 4CLLA 3RB4A 1RAGB 1RTZA 5CYMB 1S0OA 1NSKL 4ED3A 1TAUA 1WOPA 3QRQA 3QGGA 4JI5J 1NSAA 2QYCA 2Y0BB 2QL5B 3ILOA 4TKTA 1NJXA 1X7VA 3EXCX 4ZVOB 1TL3A 2R3VA 2I5JB 2MSTA 1MU2B 1RT2B 3C19A 4V1Ak 2HQCA 3EICA 3E3XA 2CZ9A 4ELUA 5RUBA 4XK8C 4YHHJ 2VFVA 5D3GA 1NSPA 1FRIA 3CF5Q 3QAEA 4RBUA 4USKA 1RHRB 4C11A 2BYCA 1HW9A 4CO0A 2ASJA 4DV4F 1Z2ZA 1U1RA 2HHUA 4Q7AA 4IG3A 3RGIA 4P74A 3J7YU 3D3CJ 1HMVA 3LW5C 3M2VA 2LQBA 2OUGA 2YNGA 3NS5A 2WCXA 1WEYA 1N5TA 1AUDA 1KOOA 2EKYA 2KT5A 3CJKA 6FD1A 2CPDA 1WOOA 2VOOA 3DLBA 1FA0A 1UW9A 3NGKA 3PFEA 2E5IA 2DH8A 5K8NA 1K0VA 3OFEA 3HSDA 4A8WA 5BYRA 3V4IB 3IWLA 1FTRA 4DV3F 3LQVA 2FJVA 3MMCB 4KB7A 3BO2A 4CP5A 2VODA 3LP1B 3SDEA 4IQMA 3NWGA 4RWXA 2A2DA 5CD4H 4ES3A 1D1UA 1GXUA 4KO0A 4I2QB 3W2VA 4OHVA 4IOBA 4GKJF 5HK4A 4PKDB 3R6GB 3HCXA 5D77A 3V6DA 3D68A 2POKA 2PMZD 1X0FA 1FXLA 1IBMF 1UAWA 3A3NB 4DR7J 2NQPA 1KONA 2ZH6A 1VISA 3I0RB 5LMUF 1B0VA 3DLJA 4TY8B 3RRKA 2MQPA 3MD1A 1TK8A 4OLPA 2P9CA 1JLBA 2WBMA 4JI3F 1CJKA 5KG3A 4Q2MA 3A4TA 2GHWA 4PWDA 4DR4F 4RR5A 3IG1B 2DXEA 5B7WA 1U6BA 1MSWD 3ZTOA 1VK3A 1XMOJ 3MUMP 3CD6S 4DPXA 4U7UD 4WFXA 2LDYA 2FC8A 6AT1B 5BR8F 3PXGa 3FZ2A 2NR0A 3QJJA 4J5OA 2MLXA 3G86A 4MK9A 2XS2A 1YJ7A 4CT8A 2UUAJ 2J9CA 3BGRA 3I0SB 4DL5A 3TA0A 2BJ9A 4AUKA 2AYMA 2XI2A 1N5YA 2FDNA 1N36F 5LXYA 5J1PA 5GMKa 3GV7B 5B0GA 4RW7B 3E2EA 1GMUA 1WHYA 2KTQA 1HBUB 2R7OA 4FPRA 3Q0AA 2IC3A 2XI3A 3C16A 5DDRC 4PWUA 1PGZA 4L76A 3PY8A 2HQIA 4JI1F 2XSJA 2UV8A 1OYEA 2PI5A 4ZJOA 3HJFA 2RMLA 3KWMA 4X62F 3VAGA 1EIYB 2ZH7A 4DQQA 1V5VA 2I0XA 5KAKA 4FPIA 3UVJB 1N88A 2G9OA 3BPDA 3EMTA 3QMQA 4CQ1A 2DGOA 5CA5A 1Y3JA 3IS9A 2COLA 2ZHAA 5DQGA 4B08A 1RTJA 2BEFA 2CUYA 3ZTQA 2CQDA 2KU7A 5DG8A 4M5HA 3MR3A 3HPOA 2NSCA 1H0HB 4QIFA 4YEAA 2KO1A 4DCPB 3FEZA 5F8LA 1HIYA 4QYZJ 1R3NA 4NI2B 2OTLS 4CYUB 2CWKA 3EX7B 4ED5A 4OMFG 2VG7A 1CJTB 4RW6A 4DV5J 4RU2A 1HBUA 4NEYA 5DRKA 5SUHA 1AT1B 3PW7A 4M94A 4IG0A 3P49B 4EZ9A 2M0GB 3BDEA 1N5VA 1GFWB 3EVOA 2B9WA 3N28A 1W2BR 3ICLA 1LWXA 2NPIA 3M1VB 4L3KA 4LSLA 3HSGA 5LMNF 2Y1LB 4DCJB 3DMJB 2W2QP 4ZPDA 1UVKA 1BQNA 2GJFA 3PIOQ 3UN2A 4J90A 3GJQB 1PYSB 3DU5A 1Y5NB 4RNFA 1YIJS 2MKSA 3BB5A 2XMJA 1NK6A 1HBMA 2YBVA 1TL1A 2Z58B 1BWEA 1Y5IB 3ENVA 3HKZD 5GAGU 1CJKB 2G0IA 1FRLA 1MMNA 5DGBA 1WD6A 1U2FA 3SEOA 4C7QA 4HHHA 2LQJA 4NLYA 2GIRA 3K59A 2CQ4A 4ZVFA 4LRDA 4QPTA 3TJAA 4LF7F 1YJVA 3GMGA 5KFGA 3UD5A 4Q8FA 3AY0A 5L1LA 4OZ2A 3NXZA 2H4WB 2GW8A 3C6TB 4DR7F 5LSLA 3FSXA 3KMSA 1AROP 5LMUJ 1IN0A 1OY9A 2O67A 4QWDA 1WOSA 1TUGB 5E3AA 4O3NA 4DFPA 4ITSA 1ZZNA 3KHRA 3PJWA 2X3DA 5M2UA 2YX1A 3W8PA 2FB0A 3CJSA 1BXNA 4RU9A 4A8KA 4B3SF 3AA8A 1OWXA 3Q8QB 2HFOA 2HS0A 4KGKA 5A6PA 3KLHB 2BR0A 2XLKA 1RBAA 1Q7LB 4GO7X 1Y5LB 2BA9A 2BZ2A 3KHGA 3RBXA 2Z2ZA 1RYRA 3Q8YA 3M32A 2IRXA 1IKVA 1UJ6A 2W2NP 1FFSB 2O1PA 4OZNA 4HT7A 2GJ2A 4LRCA 2I6WA 4CO3A 1TKTA 2ZBCA 3RZAA 4P73A 4DS5A 4B17A 1SJQA 3DOKA 2XSFA 3KMQA 4F26A 3CWJA 1U1LA 1RT7A 3H98A 2ZJPQ 2Y1IA 1K8AT 1JLEA 2ZJQQ 1LFPA 3TJ8A 3ET6A 2MQ8A 2N3OA 2KJVA 4AE5A 3V2UC 2OIHA 1IKVB 4NMXA 2VA3A 5JJBA 3ZZTA 3SCJE 3OL8A 1J5EF 1UA1A 2YNIB 2M4MA 4B3OB 2CAJA 2HLUA 3BSAA 3FRZA 4DU7A 1SXLA 3W60A 5GAGI 1MU2A 1RT2A 4I4BA 5KFAA 4PQAA 1MWYA 2ZVSA 1VQ6S 3T1YF 1DJ0A 1ZA1B 4MKAA 5C2CA 4U9RA 2EFGA 5KG2A 3PVXA 3OTDA 2W9CA 3PG9A 4ID8A 4B3RJ 3D54A 3OJSA 1J2VA 2DGTA 1RT1A 2NXCA 2ASDA 1JXEA 2VIHA 1CPZA 1R31A 4F7VA 2HNYA 1RT5A 4TY9A 2EFQA 3G82B 4LVOP 1RHKB 1KHWA 2V2KA 3GILA 3LWLA 1GEHA 1FD2A 4EYHB 4GKKF 3A3PB 4YB6A 2UU9J 2B56A 3MECB 1VJWA 3MR5A 2G4BA 2D9PA 1C1CB 3D5MA 1RB0A 4HI2A 3U27A 4C98A 4ZMMA 5IWAJ 2FVSA 4ILLA 4CLKA 3CSKA 3DLKA 5IT9U 3NG8A 2HRTA 3SQGB 5DJBA 1ZOTA 3GB0A 2QC3A 3S6EA 4BC9A 2ZH8A 2DIUA 3NAHA 3CIZA 2CWXA 1YHQS 2B4OA 4LSLB 5KFYA 2QRRA 2K7KA 3NNAA 3LGMA 2C2MB 4UZBA 4WFNQ 4XIUA 2V68A 3E01A 4ES1A 3MEDB 4RNMA 2KZZA 2C2OB 5LM7E 4ZLNA 1GNKA 3D6TB 4RW6B 1ZA2B 2HHHJ 4DR4J 3AJ2A 2DRDA 3T5LA 3CD0A 1P1LA 2G2ZA 4HR2A 4Y3CA 3US5A 4YDDB 2R7WA 5CQGA 1QJHA 1VS3A 4X66F 1VQ4S 1PJ6A 1H74A 3OBIA 2N7YA 5H9EK 3LWMA 2PT0A 4P9SA 3GR0A 4KYZA 1ZAWA 2M7SA 3AB4B 4F67A 2FC9A 2C3UA 4JV0A 3TX0A 4B3MF 3HHDA 3HI9A 5DDPC 3BKFA 3PNIA 4OZ3A 4K7QA 4BBYA 4N56A 3T5KA 3L7UA 1Q16B 3VVUA 4RKUC 4OYIA 1XNRJ 2DGUA 3B4DA 1VQ5S 2G2OA 3PR4A 4NLXA 1HWUA 3IP0A 4G65A 2ZBIA 3C16B 3CMES 1T3OA 3PJXA 4DHVA 2QLXA 4P2MA 4MAKA 4NWBA 4A4JA 2IA6A 1N5YB 1YBTA 1U45A 2HBZB 4UOGA 4NLVA 2QL7B 5KFFA 3JSMA 4ECZA 4EGLA 2J9DE 2KRRA 2YWWA 3PHEA 4DCOB 5KFMA 3LPYA 3ISND 2ZC4A 1MMDA 3TA2A 4BWMA 2XMUA 2HURA 1C4CA 2FVCA 3LF0A 3W64A 3CCWA 2VJVA 5KFNA 1N34F 4JB8B 2RJZA 2XG8A 4J9OA 3J81j 5IQQA 2VQFJ 3PYGA 2FZKB 2I8EA 3CE8A 3M6XA 3IG1A 1WKKA 4ZP8A 4PABA 3ZZOA 4CO4A 2D3UA 4F2SA 4YN3B 2P6TA 2OH2A 2E5JA 1JLBB 2BE2B 4NCGA 3I31A 3MFHA 2HZCA 2ZZNA 3I0RA 3ONQA 2C2NA 2HNDB 1N5SA 3AODA 2L08A 3W9IA 4O44B 3CC7S 1O8BA 3VZIA 2OJ3A 2BRKA 3QT8A 4CO5A 3LP0A 3R9LA 1UPMB 4DR5J 3M6VA 4HACA 5G4DA 3FBFA 3K0JA 1HNZF 5D0EA 3EM1A 2VICA 4USUA 3LP1A 2ILZA 2ZNYA 1F3VA 3ISNC 4ILMA 1A0OB 4NXNF 4IOAQ 4MK8A 2BBEA 1E6VB 2FQQB 4ILRA 5CABA 2J9EA 4RBTA 3J80Y 3QSYB 3QRPA 1F2GA 4KQZA 3ULHA 2OPSB 2OPRB 4U67Q 2IRYA 2LEBA 4B3TJ 1IUJA 2W2MP 3HVAA 1IBLJ 4HHJA 5C42B 2CJ9A 1TELA 3HD2A 2H1YA 1YDLA 4QYZK 1S1UA 4J9UE 1OPIA 1DURA 1HNVB 1PBAA 2B51A 4HEA9 4QQBA 4IG3B 4F25A 5M2PA 4OX6A 4M5GA 3Q8SB 2C28A 1N0UA 3DLGB 1S9EB 5K8PA 3TOQA 1SVDA 1UEVA 2DO4A 1KP6A 3UD4P 3DDKA 5AT1B 2ZZTA 4FYVB 3V5RA 3P96A 4M5LA 4USIA 5I42B 1A9NB 1TZ0A 3PIPQ 2J6UA 3NMAA 3DRYA 2AGOA 2UVWA 3I5CA 1IJEB 1OMSA 2HVEA 5IT4A 4TQRA 4K4UA 4KV8B 2C2EA 5KFLA 2HVZA 3GIRA 2GGPB 2FHJD 3LGHA 3S7RA 2YY3A 2K1RA 2CPJA 2WSCC 3AXKA 2PGCA 3TZYA 4E98A 2AX0A 3OL9A 3M4XA 1MG7A 1SJ3P 4OHZA 5A8RB 4ETXA 4MKVA 4NYOA 5CYMA 2DNNA 1T03B 2FJWA 3BF4A 2OTJS 1W2IA 4W98A 3K57A 4LIWA 2V50A 2W1BA 2LXFA 2WOMA 3HVTB 1RISA 3M8WA 1NRKA 5AXNA 3RB0A 3C6UB 2V8HA 1FJCA 5A8KB 4PXBA 1R0AB 1T02A 1Q81T 2FIUA 1N6QA 3UCUP 1GX6A 4O0IA 5T7LA 1SL0A 3F73A 3H5YA 3OL7A 1V3ZA 1JLAB 4U95A 1XBWA 4ID5A 1NH7A 3SYZA 1RXOB 3LOUA 3CPWR 4HT5A 4NZ0A 3EDQB 4I2PB 3W66A 3WDOA 2C3PA 3D28A 2HHPA 3BQ1A 1IBCB 2JEIA 1AZSA 1XMBA 2RHQB 5KFJA 3KLFA 1HD1A 1CS4A 1T11A 3L09A 1RT4B 2B5JA 5HVFA 4IDKA 4ICLB 1IWAA 3HMJG 5KT6A 3VAHA 2V67A 4N8OA 2FTRA 1UW4A 2VKRA 3AJ1A 2LP4A 1ZS6A 3GR1A 2ZBPA 4QR2A 5ADZA 2AGPA 1FKPB 4EMDA 3KK1A 4ZCMA 2XHWA 3CB4A 1VRUB 4GVLA 4RW8A 1N32F 1KC8T 2C42A 3GCXP 3F44A 2OELA 2HWHA 3BSNA 2CFXA 2R9LA 3P45B 3QWPA 3D4JA 1S9FA 1IQZA 2IYGA 3BZQA 2E66A 2L9WA 3G2XA 2KYZA 4ANEA 4M5JA 5DLFA 1IQTA 4P10A 4O3PA 4NRUA 3R1LA 2ZKUA 1JKHA 1DQ8A 2IHR1 2MKJA 1VRUA 4RW8B 2UUWA 3OFGA 4WBFA 4KT0C 3OW2R 3EGWB 1FFWB 3CCZA 4P71A 1IKXB 3TA1A 4FF2A 3R7NB 4OL8A 5JVGQ 4RZRA 3UDEA 2E5LF 4BDPA 3VGUA 3KHHA 2VONA 1AZSB 2AZ1A 3RBDA 2RDIA 5HP1B 2UXBF 1PJ7A 3CCSS 1FCAA 1XWLA 1FDBA 2DRBA 1SL1A 5J2QA 2RNEA 3CCTA 3MXHP 2OAUA 3GIMA 3OVBA 4FN5A 2RSQA 3KUHA 3MM9B 4N8NA 4OX9F 4EO8A 2ZEJA 2HYIB 4LF8F 3TANA 4IH7A 1UP1A 4BC7A 2UXCF 5DQIA 2DVIA 1R8BA 4QYRA 2OPQB 2C2DA 1HHQA 4PUOA 4E2FB 3ZC4A 1WKJA 1N6QB 4IRKA 4I67A 4TVAB 1T9TA 3CT9A 3KUGA 5CHCB 3H0PA 4JI0F 4QIVA 3CO0P 2DXFA 3C46A 2C3MA 3CCMS 2RF2A 1M1GA 1V5IB 3O6QA 5C5JA 5K8OA 5KFDA 2RILA 3TVKA 4BHQA 2EBGA 1U6FA 4DOZA 3ILJA 2DNMA 2IRUA 3M2RB 1WKLA 3G8QA 3PX4A 2CXEA 2ZM6F 3HD1A 3EUNA 3ZXWA 1XQIA 1CC7A 3M8YA 4MKBA 3TNVA 4AL6A 2DH7A 2DNYA 3M8ZA 1K1QA 1RCXB 2HAIA 3DRRB 1SQGA 3KG0A 4OYZA 4QOTA 4WU3A 2GGPA 2QEXS 2DRAA 1UVNA 2ALYB 2KHDA 3N4WA 3MPDA 2ZZMA 2CJAA 1NAQA 3CIMA 4ZK7M 2C2KB 3TAQA 4KV8A 1XMOF 2DGXA 3I56S 2KVQE 4K4XA 1U24A 2MQMA 1VHFA 2VFSA 1U4BA 2VA2A 2Q6CA 1JQGA 5C24B 5LL6d 4KGMA 3Q24A 3QT5A 3PEHA 4EBCA 2W2PP 2B9YA 2P5VA 4HTIA 4RO0A 1Q5VA 3D0GE 3LUYA 4C3MA 5I4MA 4RUAA 4ZOSA 1LW0B 2H48B 2ZH5A 2MXYA 1EAYC 4NCBA 5L1KA 5D0RA 1HNVA 1OPZA 4B9NA 2LXIA 4FKXA 4NLQA 1Y11A 1HHSA 3EZOA 5LJ3Y 5HJXA 3J7Z5 3ILIA 1K1SA 3U02A 2KT3A 4ZPCA 5C24A 1JJ2R 2N82B 4Q44A 1M90T 2IBKA 4DV7F 2F3JA 5J2MB 1FI4A 1S4EA 2BJ7A 4M95A 4DQRA 2PC6A 5FLXY 2B6AA 3IWXA 4I64A 4F4ZA 4DX5A 2DHAA 4C8KA 1LWCB 1NK8A 1GTHA 2UZAA 3QYYA 3K5PA 4YY3F 2W4PA 5B0DA 2Z2LA 2BOPA 2VOPA 2BKPA 4LF4J 2ZHOA 1AFIA 2VFUA 3H2LA 4FZVA 3K5LA 5AJ3F 2DT9A 3M2RA 2VPZB 1I1GA 1U6ZA 4MKYA 2Y0SD 5K8MA 4P2SA 2QE5A 1URRA 2MJUA 3OD2A 5KG6A 4X4TA 1ZPVA 4YR2A 3RB3A 4EWTA 4JYAJ 2RF2B 3KYLA 3EGVA 3LA0A 4ECYA 1S1WA 4YUDA 2HZAA 1RWXB 2ZJRQ 2LEPA 2V9KA 3GPAA 4DZDA 4F0HA 1UVIA 4HDGA 5AJ3J 3SCKE 5EHHA 5FJ4A 3EPGA 5L46A 4ATNA 2YKQA 2MB0B 2AT1B 3JSMB 3GG1A 2GAGC 5AXMA 3UQSA 2BOAA 3UI3A 2HRYA 2B3TB 1UWBB 4R5PA 1WG1A 2K3IA 3T1HF 1YVFA 2NZCA 1NBEB 3GSDA 4DX7A 1CQMA 1R8CA 1FERA 3VCDA 2FZCB 2JX2A 4ZPTR 3HHLD 1V3SA 5E0OA 3TZXA 3AT1B 2HHQA 1Y3KA 3NAIA 2F4FA 4C8MA 1NDKA 2XYHB 4CH0S 1S72S 2B9XA 3HT3A 2HIYA 2W9BB 2FLOA 3NP5A 1EKSA 1UZHA 3HHLA 4N47A 3JTPA 5A8WB 5FLXU 2OSRA 4WJBA 3CJ0A 2R8GA 3DDIA 3KFWX 2ACMA 2BE9B 4KFBA 5CYQA 3IXQA 1CJUB 4OZLA 1TUWA 3G4SS 1X5TA 1RYSA 3W1YC 2PN6A 3GV5B 1X5OA 2OO4A 2AV5A 3C3LA 2RKIA 5T41A 2GMLA 4HHUA 4OHWA 1U8SA 3GJRB 4NCAA 4ECSA 4URQU 1SH2A 2XY6A 2FZGB 2DISA 2ZE2A 3GONA 2IM3A 2LMIA 3N01A 2L41A 3NCRA 1FWLA 1NLKL 2X7IA 4HYKA 2NXEA 1YJUA 4KHPF 3NGDA 2YKMA 1N32J 3VF0B 4DR6J 3KLFB 4B3MJ 2W7AA 2X1BA 1PCAA 3MPYA 5AE1A 3OR2B 1SV5A 2B43A 3UR3C 4H4MA 4I2PA 1S59A 2I1RA 4YR0A 3MM7A 4DUTA 2FLNA 2D1CA 2CPEA 4NLSA 2RS2A 4K0KJ 5ETVA 3IRXA 4EFAC 3NS7B 1WNEA 2GHPA 1NXIA 1B0PA 4WP3A 2GQQA 2MGZB 2GVDA 1T95A 1T9VA 4X65F 1GXLA 3G6ES 5F8NA 3Q8VA 1SC4B 1FVQA 1NZAA 5FDLA 1XMQF 4LT6A 3BREA 1BGXT 3MDFA 2DGWA 4K2JA 1GMWD 5DDOC 1IBKJ 1XR5A 3ZZPA 1A6LA 4L72B 2FLLA 1VOMA 2R8IA 1RT5B 4CO2A 1H38A 3FEYB 1KQSR 4EZ6A 1UKUA 4J9KA 1U02A 5F8HA 3G6XA 1RT1B 4ZP9A 3BPSP 4LF1A 2UUBJ 1KVIA 4KHMA 4W90B 3QGIA 2W9CB 4J9RA 4C8YA 3JSBA 1G2EA 1Z1ZA 4KTQA 2E7VA 2H51B 1OSDA 3DYAA 3I87A 4PRFA 2K1RB 3A8JA 1FJEB 3W2WA 2HGMA 4ES2A 1C1BB 3I55S 3OR2A 1VQPS 3HLUA 4K4WA 2Z4PA 2Y8YA 4ZLJA 3RW7A 4ED0A 4DF8A 3OSPA 2JVOA 1ZYQA 2GX8A 4OZ1A 4FXDA 2D41A
chains in the Genus database with same CATH topology
1SH0A 3RAQA 3IO1A 1FD8A 3AH6A 4TU9A 3K2YA 4LFAF 2XULA 2UUBF 1IKYB 2AW0A 3H59A 3MUTP 4BCAA 2YH1A 2F8MA 1K73T 2IVFB 3N79A 1HBNB 1X4HA 1RT6A 2KXFA 2G13A 5I3UB 4RNNA 3D2WA 1GH8A 4HI1A 4J9LA 1URNA 4PG5A 2X1AA 1FTCA 3CDEA 2GO8A 1S1UB 2DGQA 3KLEA 5M2RA 3G6VA 3FGVA 1R43A 2J9DA 2OPSA 3NCPA 2DBBA 3MPWA 2M52A 2YTCA 3IWNC 3OPKA 2XS7A 1VGYA 1E6VA 2JZ5A 1LW2B 4MH8A 3KLHA 3CJ3A 3PEJA 1CSJA 4KE5A 1DFDA 3FFIA 1RTDB 1VK8A 5DLGA 1KOHA 1M5KC 1YJ9S 2R7RA 4K5RA 4QCLA 4KHRA 1H7XA 1V6HA 2IJFA 2JHEA 2ROGA 1TP7A 1VBZA 5CXTA 2N4DA 1WG5A 1IJFB 3PDNA 3QIDA 1QLNA 1P8GA 4X84A 4JBCA 2CQPA 4NLWA 4P7TA 4F3QA 2YQ3A 1NK9A 5HI7A 5BJRA 5KFCA 3MHYA 4IR9A 1QAIA 5EWEA 5DGAA 4DDFA 5B0AA 4OLOA 4JUZA 2HGLA 3GFHA 4MJKA 3FSYA 4C0OC 2NPFA 3DN9A 2QMXA 2RB7A 2W4CA 4MIBA 1XC9A 2DHXA 1L5UA 4NL5A 1SH3A 2NUHA 5HN0A 3IAM9 3NKYA 2Q6BA 4UQTA 5KG7A 1N4LA 2VFTA 2UVRA 2DNQA 2V8VA 2MKIA 2VG7B 2XMMA 1LW2A 1NB7A 2EFNA 1JNZB 5JUMA 4ECUA 2IMOA 2QSFA 2MZSA 3D1OA 4OX8A 2AWZA 3EGZA 1CVJA 3VAKA 2BANB 1NKBA 3IRWP 4NMLA 4HDHA 2R2SA 3HK2A 1HA1A 1LXJA 3RAMA 4A8QA 1S1TA 3HO1A 4QIWD 5KFHA 1FEHA 2I38A 1FEEA 2LEAA 1MROA 1ZTWA 3I5BA 1TUVA 3T5HA 2O5DA 2DO0A 3OLBA 2ASLA 4QZVB 3DC2A 1D8YA 1XEZA 4DV2F 2HWIA 2DGSA 1R8HA 2GC8A 5THWA 5KFEA 4U7CA 3W2WB 3SCIE 3CCJS 4R8UA 1U2RA 1NHVA 4AL5A 2R8HA 4B9TA 1FRHA 4XPEA 3TO8A 4LFCF 3DCAA 3VWSA 1S1VA 1S6UA 1X4DA 1ZM2A 3BR9A 4MFBA 3TAMA 4KR0B 2PA8D 1SJ4P 1SBRA 1DTTA 3HZEA 1KQFB 3M9OB 2HFNA 3OQ2A 4XO0A 4DF4A 2UVVA 2EK1A 2W25A 4A46A 2CQ0A 2HHTA 1HPZB 3OTBA 1L3TA 4K4SA 2H5EA 1F0XA 4AQYF 3KLVA 2CPZA 2V4JB 1B0TA 4CTAB 3MM7B 4OJ1A 3NCQA 2BJEA 4ZDNA 2JLGA 3PFOA 3Q8RB 3RRHA 2JFKA 4DFMA 4GMKA 2BQUA 2AD9A 4NLTA 3V4IA 1NHUA 2YKPA 4Y28C 4NXMF 3PX6A 4Y2KA 1S49A 1YQHA 4FS2A 3SV4A 2FD2A 2JLFA 4L6V3 4JV1A 5GAEU 4GC7A 3DI6A 1RT3A 3LGNA 5EGYA 3M2VB 1FF2A 1HMVB 2XEXA 2GQCA 1WWHA 2YNFB 3AA9A 4J9NA 1QAJA 2VB6A 5CCMA 5D8HB 1DRZA 3VAJA 5CYQB 3SI8A 1X9MA 1TKDA 3CC2S 4GC6A 1YSJA 2OLWA 1KR4A 4B9MA 5A8WA 4YB1P 1E6YB 2ZC3A 4MMOA 4C8NA 3T19A 3MFIA 1FKOB 1T3NA 1U09A 2OFHX 3WC2A 1FJGF 4DUYF 1EETA 1CC8A 4XDCA 1VIXA 3H4BA 2ZUGA 2OSQA 2HW3A 2E7WA 3DLLQ 3FDSA 1L3KA 1M5HA 4Y65A 5DETA 3QWUA 1FNXH 4R5PB 4AFFA 2LXUA 1Y0HA 3EGNA 4JOUA 5A0YB 4DWIA 2HVIA 1JLAA 2VKZG 3CMAS 1LFWA 4B9UA 3UWTA 1YRUA 3MM6B 5KFTA 4CZCA 1CQNA 4HH1A 3KK3B 2NSBA 2QA2A 1R0AA 1RTHA 2FGOA 3OHAA 1TL1B 3PKMA 2AJQA 1N54B 4O4GA 2CZVC 1JLGA 5B08A 1NK7A 4XDDA 3RTVA 1YJTA 4HH0A 2U2FA 2DB1A 2DHGA 3ZZZA 4A8XA 2CDQA 3J7A1 3QJLA 3W3SA 2KZMA 2C22A 2IYIA 1S1XB 1T7PA 1IKWB 3KHLA 1LV5A 4FF3A 2M2BA 2NS1B 1MNEA 4KSEB 4DSFA 2B4VA 3X1LB 1LKZA 2QA1A 5D4PA 5E3RA 4NA2A 1S0MA 3N6MA 1VMBA 3VQSA 2W7OA 1SUQB 2BABA 3UD3P 5F3ZA 1P9QC 1IM4A 3IS9B 1DQ9A 3ENWA 3O1LA 1H6KX 4A8OA 4I56A 1QAYA 1LW0A 3DHXA 4WFAQ 2WSFC 3C66A 3TAPA 3MMAB 1S6OA 2MDAA 1MWZA 2AX1A 3BEGB 1JLFB 5KG4A 1H98A 2XSJB 3TW0A 3UPFA 3K8WA 2HHWA 4NZ6A 2GNKA 3HKWA 2OPRA 1OQ6A 3CGIA 3BDPA 4RW7A 1XERA 4Y00A 3CTRA 1XNQF 3KTQA 2IAJA 3O8WA 5KT3A 1FRJA 1G3OA 4TYBA 3OTEA 4DR1F 2R8JA 3DLHA 3CMES 3BGRB 3I0SA 4Y2MA 3WX4A 4WIIA 1L3UA 4JV2A 3GG0A 5KT2A 5K5MA 2UP1A 4NLPA 2FJAB 2E7XA 1FE0A 4DEZA 4ZA1A 2KHCA 4TYAA 1F9FA 4C3KA 3NBPB 5DS7A 2FGCA 5EWGA 4ECTA 1UVMA 4O44A 5E5NA 4C2MA 3NNCA 2BRLA 3JTOA 4NLGA 2R4FA 2XY5A 4IO1A 3PW4A 4WYWA 1NK0A 1HYSA 1HL6A 3FMBA 1JXLA 4KKOB 1WHWA 4KC5A 3HVRA 3HX9A 4O3SA 2KM8B 1QE1B 2HMIB 4MYUA 4I2QA 3W2VB 1KSPA 2ADCA 2VG5A 4DLGA 3PW5A 2YH0A 4LMZA 2E9RX 2HS4A 1VRTB 2EW9A 3RAXA 2VG6B 3M9NB 1FVSA 2KXNB 3KK2A 1LK7A 4NX9A 4PXCA 2JRSA 2OMLA 3CJ5A 2E44A 2MKCA 1IKXA 3MM8A 3G8TA 4DN9A 1KTQA 1YJWS 3BQ2A 3NL0A 2Q66A 5JVHQ 1WHXA 2ILYA 3U1LA 1R89A 4IFYB 1PILA 4DUZF 4FF4A 4KBIA 2R2UA 5K9FA 2GMJA 5D4LA 3SSRA 2F9DA 4PPZA 2GMHA 2CQBA 3TVZA 1N56A 2P6SA 4KAIA 2VD3A 2XLIA 3V6KA 1VQ9S 1FKPA 1S7HA 1YWXA 3BO3A 4LSNB 2HQ3A 2I5JA 3M6UA 2HFZA 1WI8A 2DNOA 4DQPA 4K4YA 3BGFA 5B0BA 5LJ5Y 4O3QA 1IKWA 3SFUA 2KG0A 2CPYA 4K4VA 1X5PA 3OXGA 4CT9A 4RX6A 3HF5A 3H25A 1FXLA 1FRXA 3QZ7A 2M8HA 2IBOA 2AF6A 2IM1A 3KLGA 4NLUA 5DG7A 3MTJA 1QSYA 2NLWA 1JLGB 4HVZA 1J5OA 2DITA 4RLEA 4B9VA 5L39A 2J0XA 2YNHB 3KLIB 2X1FA 4I1TA 1Z4UA 3DM2B 2V0NA 3E51A 4G6VB 4TN2A 3KK3A 1U1NA 2Q3PA 5DQHA 4OI0A 1RKJA 2HVHA 3GYXB 2WOMB 2J76E 3HVTA 1T94A 3C8YA 1LXNA 1KN6A 2RVJA 3TYTA 1NJWA 2M3DA 3U1NA 1RKIA 4DQSA 2YX7A 2E1AA 1YRTA 7FDRA 4I0WA 5L1JA 2AQ4A 5KFPA 3R5CA 4Y0FA 1UFWA 4DG1A 3M9MB 1RP5A 3TX8A 2K2PA 3M30B 3RW6A 1BQXA 4X4NA 4LSNA 4F4WA 2WSEC 4DSIA 2C2RA 2YNIA 3K5OA 2AJ1A 4QWCA 2PE8A 1F5BA 3MM5B 4NRTA 2XO7A 3HFKA 3MOZA 2ALZA 2ZH2A 2G0CA 3IC1A 3V81B 1D0EA 5IS2A 4UQGA 1M5PC 2IM0A 4FF1A 1WF2A 3DRPA 1S9EA 1HWLA 2RE1A 2DRBA 4DL4A 3V4MA 2MZRA 1PO6A 5E7OB 3GIJA 4EUVA 4X64F 3PX0A 3AQOA 5AE3A 3GFZA 3DI6B 2WW8A 1RGVA 3VAIA 1BY9A 2UV8G 1JB0C 3JAMY 3FZBA 4ZS6A 2EFOA 1M0SA