1WEYA

Solution structure of rrm domain in calcipressin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGLIACVANDDVFSESETRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calcipressin 1
publication title Solution structure of RRM domain in calcipressin 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1weyA00
1K73T 2SXLA 1DZ5A 1HA1A 1U1KA 2OSQA 1Q82T 2L41A 1YJ9S 3G96A 2HGNA 2RS2A 3NNAA 3NS6A 1KQSR 2MKIA 1R8PA 1X4AA 2YH0A 2LXIA 5IM0B 3CC4S 3ZZZA 3CD6S 1WI6A 2DGWA 1FJ7A 3NS5A 2XS5A 1D8ZA 2VOOA 1YHQS 2D9OA 3TP2A 4QU6A 4CQ1A 3R27A 2M7SA 3HI9A 2OJ3A 2X1GA 1VBZA 4IOAQ 1WG4A 1X4GA 3CCJS 1SXLA 1M5KC 1SJRA 2DH7A 2YTCA 1FT8A 2HZCA 2KRRA 2RUGA 1YITS 3CCLS 3S8SA 2MZSA 2EK6A 1M5VC 1X4FA 3VAGA 3D2WA 2MZ1A 2MJUA 2HGMA 4UQTA 2OTJS 2DK2A 5GVQA 4YB1P 3CXCR 1G2EA 2AYEA 3VAKA 5LSOA 2KRBA 1RK8A 1DBDA 2I2YA 3DLLQ 1H2UX 3H2VE 1VQ8S 2CPHA 1L3KA 1ZZFA 2XB2D 3G9CA 1HD1A 3P6YC 3UWTA 2FPHX 2Q79A 2DITA 1FNXH 2MGZB 4FXWA 1SJFA 1AUDA 3MUMP 1NJIT 1WHVA 3V4MA 3SDEB 1KC8T 3MXHP 2AYGA 3FEYB 4OZ1A 2KU7A 1VC5A 3U1LA 4Z2XA 4TU7A 1X5PA 3PIPQ 2CQBA 3MDFA 2OSRA 1X5SA 2DGTA 1OIAA 2DO4A 2DNKA 2LEAA 3MUVP 3VALA 1OWXA 2KM8C 1NO8A 3SMZA 2MQMA 1WF0A 2CQIA 1WEXA 3G8TA 2DH9A 5JVHQ 2GO9A 1NU4A 3MOJB 2FY1A 5IQQA 3MUTP 2ADCA 1W2BR 3U1MA 2M4MA 1PO6A 2DNHA 4PR6A 1A7GE 5ITHA 4WKRA 3CMES 2MYFA 3IRWP 3CPWR 2KT5A 2KXHA 5BJRA 2ZJQQ 1DRZA 2LECA 1K9MT 2PE8A 1QM9A 2J0SD 4QU7A 2N7CA 2KXNB 2M2BA 1VBXA 5CA5A 1YWXA 1U1OA 5D78A 3EGNA 1U1LA 2DH8A 1X4EA 4C7QA 1VQOS 1WWHA 2N3LA 5MLCV 2MKKA 1M5PC 1FJCA 1JJHA 4OZ0A 2CPYA 5LJ3Y 4CH1A 3LQVA 3B4MA 3BO3A 1X0FA 2AYMA 2JWNA 2DNMA 5DDOC 1HL6A 5GADU 2MZTA 1WHWA 2E5GA 2DGSA 1VQMS 1VBYA 1WHXA 1WHYA 1KD1T 4WFNQ 2DGUA 2QEXS 3B4DA 3SXLA 2MY8A 4EGLA 3RW6A 2JVRA 4IO9Q 5HO4A 3CUNA 5DDQC 1IQTA 2MMYA 4CIOA 2L08A 2J0QD 3VAIA 2K8GA 2M8DB 2CPJA 2KFYA 3R1HA 3PIOQ 2L9WA 1F9FA 5GAGU 1K8AT 5DDRC 2XNQA 3BO2A 3S7RA 1U1PA 2KXFA 4YUDA 4W90B 3MURP 1U2FA 2PEHA 1VQ4S 2DGOA 3OW2R 2U1AA 2I38A 2DIUA 2LXUA 3MD3A 3VAJA 1KOHA 2RS8A 1WEZA 4IUFA 2MZRA 4TU9A 1YJNS 2MSTA 2DNRA 2DNLA 3MD1A 4F25A 5GAHU 4WCEQ 1WG5A 1OO0B 2VOPA 5CXTA 4WIIA 2RT3A 3P3DA 2QA4S 4FXVA 3TO8A 1CVJA 2CQGA 3IWNC 3CCMS 2MJNA 3G71S 2LKZA 2BOPA 3CC7S 2DO0A 3UCUP 1YTYA 1YIJS 1VQLS 1U1NA 1QVGR 4F26A 4LJMA 4IOCQ 1WG1A 2XSFA 2MQPA 2KN4A 3NNCA 2LMIA 2N3OA 1X5OA 2DIVA 1KOOA 1HD0A 3UCZP 2J8AA 5LXRA 3P49B 5HL7Q 4A8XA 1S72S 2DNOA 3UD3P 4UY8T 5IFMA 3CCES 1M90T 5EN1A 4TU8A 1U6BA 3CTRA 2DGXA 2JX2A 3ULHA 5LSLA 1FHTA 3VAFA 3CCUS 2RU3A 4LIRA 1UW4A 2MKCA 2MKHA 1WI8A 2DISA 3JB9k 2AD9A 1U1RA 1SJ4P 1X4DA 5GAEU 1U1QA 2G0CA 2MPUA 5JVGQ 2ERRA 1YI2S 1X4BA 3G4SS 2DNNA 4W92B 1VQ5S 1VQ6S 1WF2A 3CMAS 4U67Q 1DHMA 2MSSA 3CCSS 5DDPC 2BZ2A 3I55S 1UFWA 2MY7A 2CQPA 3BS9A 2E44A 3NMRA 2M9KA 1YJWS 2MZJA 1URNA 1U1MA 2CQDA 2X1FA 4ED5A 2FC9A 4Y00A 1S79A 1N52B 2HVZA 2CQHA 2LYVA 1VQNS 1X4CA 4RU2A 1VC0A 2M8HA 3THTA 2UP1A 3MI7X 2ZJRQ 5DM7Q 3HHNB 2MQNA 3S01A 2MXYA 3RW7A 4QPTA 3FEXB 3NNHA 2M70A 3US5A 1SJQA 3BEGB 5DM6Q 2DNYA 2KYXA 4F02A 4J5OA 4V19X 1FO1A 2CPIA 1WEYA 1A9NB 2RVJA 2GHPA 4PKDB 3L3CA 2E5HA 3CCQS 3CULA 2F9DA 1H6KX 4PRFA 3Q2SC 2ADBA 2D9PA 3UE2A 2JRSA 2KH9A 1XN9A 3DXBA 2LEBA 1B7FA 1P1TA 2LA6A 3S6EA 3EX7B 2DB1A 1VQ9S 1VQPS 2RRAA 2D3OR 2CPXA 2ZJPQ 2DNZA 4WFBQ 1ZH5A 2G4BA 2XNRA 3CCVS 2E5JA 2DNQA 2LCWA 1OPIA 1X4HA 2B0GA 1D9AA 3THPA 5LXYA 2KG0A 2CQ3A 2DNGA 5IM0A 4BS2A 3K0JA 2CQ2A 2MQLA 1U6FA 3G8SA 3VAMA 2CPDA 1JJ2R 2MKSA 1M1KT 2MKJA 4TLQA 2M52A 2OTLS 2F3JA 1Q86T 2DHGA 2XS7A 1O0PA 2KVIA 2CQ4A 1WF1A 2N82B 2CJKA 2M0GB 2V94A 5LJ5Y 1N88A 2FHOB 2WBRA 3BO4A 1N54B 1H2TZ 1QVFR 2J76E 2NLWA 2CPZA 3J7YU 1JJ4A 4C4WA 2VONA 2KHCA 2LA4A 2M88A 2EVZA 3H2UB 2CPFA 1WTBA 3UD4P 2MQOA 2KG1A 3ZZYA 2OIHA 1Q81T 2YKAA 1M5OC 2O3DA 1N8RT 5D77A 1VC6A 2HYIB 3J7ZT 3Q2TC 2MHNA 3VF0B 2MB0B 5FJ4A 1H2VZ 4QQBA 4CH0S 5DETA 2MGZA 2E5IA 2LQ5A 4C0OC 3EGZA 2RRBA 4Y0FA 3G6ES 2AYBA 3CCRS 2X1BA 3SDEA 2RQCA 2X1AA 1UP1A 5GMKa 5CYJA 3UCGA 2NZ4A 4P6QA 1JMTA 2DHXA 1VQ7S 2K3KA 2RQ4A 1X5TA 2CPEA 1SJ3P 2CQ1A 2DNPA 1RKJA 2MQQA 5H1SV 3I56S 1FXLA 2RNEA 3CF5Q 1VQKS 2JVOA 4M5DB 2XS2A 4ERDA 2KI2A 2U2FA 3N9UC 3P5TL 1PGZA 1P27B 4ZKAA 2FC8A 2KM8B 2CQ0A 4LMZA 2HGLA 2VODA 4YOEA 3LPYA 1UAWA 4WFAQ 2F9JA 2DGQA 1R8HA 2EK1A 2A3JA 2MZQA 3TYTA 2DGVA 1ZZNA 2QFJA 2YH1A 1WELA 1FJEB 4WF9Q 2DHAA 3CC2S 2CQCA 3VAHA 2DHSA 2G1DA 1Q7YT 3R1LA 1BY9A 2YWKA
chains in the Genus database with same CATH superfamily
4AFFA 3LOUA 2ZBCA 3NNAA 2QL9B 2PO4A 1CC7A 1Z2ZA 3HFKA 1RT5A 1R7IA 5AJ3F 2IRXA 4JI4J 2QLWA 2ZH4A 5BYRA 5A8KB 3FCWA 2WVFA 4KPCA 3ZNUA 3OVAA 4UZBA 4ZN3A 2QZ8A 2AEFA 1T11A 2QLBB 2LQ8A 3CCWA 4Q44A 3CCZA 3SIPB 2XMAA 3H42A 1RABB 4KJIA 2QA1A 2JC0A 4WYLA 3M8QA 1SI9A 2VG7A 3KDOA 4DU8A 4EWTA 2AX0A 1UEVA 3CJQA 2CDQA 1GNKA 3PIPQ 2DNKA 3IGVA 4CM2A 2GC8A 3Q86A 3CEDA 3G87A 1WSVA 1FNOA 3OTEA 2ZE2A 4IH7A 2ASLA 2MLXA 1W7WA 1RDRA 1UFKA 3PJ9A 4DR2F 4K2JA 3KTQA 5A6PA 2WVDA 2QGFB 4KGKA 2Y8WA 2BM0A 1KHWA 3GFHA 3ENWA 3BDEA 1TTHB 3BQ0A 1ZTWA 4NL5A 2CG4A 1DARA 4I69A 1S6QB 3I31A 3BKUA 1XMQJ 3JSMA 4TYAA 1WHXA 2YQ1A 3K5PA 2CVIA 1Z4UA 2MTLA 3CMQA 3B4DA 3CW2C 4LBIA 3EVMA 2JVRA 3RAMA 3BN4A 2BW2A 1SQEA 2AW0A 2HQGA 5GAGU 1GT8A 3DLGA 4HH0A 5HN0A 3I5CA 4NLSA 4TU9A 5K20B 2EXUA 3KLFA 3CIZA 2DNLA 3AJ2A 5CXTA 1F1BB 2DCUB 4FXVA 1X0PA 5DGBA 2ZH2A 2UUCF 2VQFJ 2AX1A 3H7HB 4A8KA 4F0MA 1YTYA 3L7OA 2V8PA 3NRBA 1ZOTA 4GKJJ 1WG1A 4NA3A 3PTWA 3VVTA 4QIVA 2LEPA 3NGRA 3UD3P 3CCES 1URRA 4NEZA 3PYEA 1KDNA 5LSLA 1Y4ZB 1SKSA 1QJHA 2DNNA 2BA9A 4DSEA 3VVUA 2UUAJ 2HFNA 5DQHA 2VFSA 2M8HA 3A12A 4A8QA 4UQGA 4TNOA 3US5A 4DF4A 1RCOB 5M2UA 1LFWA 3D6HB 2OUGA 1B70B 3Q24A 1QE1A 1HWIA 1U8SA 2EC2A 5CYQA 4ER8A 3Q2SC 5FLXY 4LUBA 2BJ8A 2HIYA 2ACYA 2VFRA 3GSDA 9RUBA 1VRQC 1Y7PA 4K8RA 2DNGA 3UN2A 2BMBA 1KVJA 1M1KT 1S4FA 1Q86T 3EJMA 1NDCA 2YKNA 2ZHBA 1ZM2A 2HHSA 5FIIA 4O3NA 1H2TZ 2J76E 4DL7A 3LALA 5KFKA 2IAJA 4XIUA 4NPOA 1EARA 2AWZA 2ZDOA 4ELVA 3FBFA 2MHNA 4B02A 2JFDA 1TAUA 4WTYA 4FS1A 4CH0S 3A8EA 1JLFB 1YVFA 2LQ5A 4C0OC 4ECSA 2X1BA 1LK7A 1J27A 2IVMA 1RAGB 4KKOB 4BCAA 3I0SA 3TZYA 5A76A 2R8HA 1PGZA 3GIKA 1V6HA 2VA2A 1FRIA 1JLBA 3KJFB 4OMFG 3WX4A 3LP1A 4LF9F 4J9QA 2Y9HA 1PSDA 3OVSA 3MTKA 1BY9A 1XR6A 4O3SA 5CZVA 1GXLA 5A8WA 1X4AA 1BGXT 1WI6A 1BD6A 1LQ9A 3TP2A 5KFAA 2V4RA 4Y2MA 1EKRA 2VB6A 1M5KC 2RMLA 4M5IA 4A8MP 1FT8A 2JH3A 3RRHA 2RUGA 1HR0F 3NCRA 4USUA 5LOQA 5GVQA 4QWDA 5ETPA 3UFCX 3X1LB 4PEOA 1ZZFA 1X60A 4DR6F 3DM2B 1HW9A 5K8MA 4ZIVA 3KNAA 2MGZB 1XERA 1FVQA 2YNHB 1W25A 3MPYA 3V4MA 4DBQA 4ANEA 4G3IA 5EDWA 4OI3A 4TQSA 2J9CA 1PKUA 2KU7A 2JLFA 2OSRA 1RHMB 1X5SA 2DGTA 4NLQA 5HQMA 3VALA 1B4SA 1ZS6A 2HVDA 2HNDA 1W2BR 2OH2A 3T1HF 4ZP9A 4RW9A 3JTNA 3JQMA 3CPWR 3DU6A 4FF1A 2ZJQQ 1DRZA 1UPPA 4F4KA 4P2MA 4UZCA 4QU7A 3AY0A 3NGTA 2DH8A 2N3LA 3CDEA 3NS7B 4B3RF 2ASJA 2RQKA 1E6YB 3G6XA 3D1HA 3BO3A 5KT2A 4UOGA 4CO1A 1RA6A 3BR8A 4ZP7A 1AB8A 4USMA 2ZUGA 3W9HA 3IBCB 3WIVA 3MR7A 3L7UA 1S9GB 3R5CA 4R8UA 3TW0A 4G65A 4IO9Q 1RT1B 4OI6A 1HWKA 2X51A 2HW3A 4K4VA 2QA4G 1N32J 2CADA 3R1HA 5IC6B 2V50A 3KK2A 4FBTA 3OTOJ 4IFYA 1RE1B 2U1AA 2FJBB 3MD3A 1HYSB 5LMNJ 4IUFA 3MPUB 3H5YA 3GIIA 2WOMB 3CDBA 4GVBA 1QD1A 2AJ4A 4WIIA 2QA4S 3T9NA 4PQAA 8ATCB 3EVWA 3UCUP 5E3RA 4LREA 3GYXB 2M5YA 3OL9A 1L3UA 2QYCA 2WBMA 4JI6J 4LJMA 2JC1A 4OV6A 4WE1A 1APSA 2R8JA 3MM6A 3DNCA 5HL7Q 4TN2A 2ZZTA 5F8HA 1S7IA 3AOBA 4PWUA 3EXCX 3JB9k 2MKHA 4C2MA 2B8PA 5C7PA 2YNFB 3ILLA 5KFTA 2VKRA 3DHWC 4LF5J 1C4AA 2MSSA 5L39A 1UFWA 4KBIA 2QO3A 5KFPA 1URNA 1XNQJ 4DN0A 2DEJA 2FC9A 3JSRA 3OR1A 4KQZA 3QJLA 1UPMB 1REVA 3EDQB 3KK1B 4C8MA 4O0IA 1M1HA 2AJ2A 3RB0A 1SUQB 4GKKJ 2QG9B 1KLMA 3DOMB 1FO1A 3QO9B 2RVJA 4FVCA 4PRFA 4YB6A 3DXBA 1B7FA 1P1TA 4EYHB 2G4BA 4NA2A 3HFZB 4C48A 4ECUA 2P9EA 2B4UA 5T7LA 1S1UB 2B51A 1HPZA 2OEKA 5IM0A 4LF7J 2WB4A 2HBYB 4G1QA 4DV5J 1FF2A 4ZVTB 2MKJA 2RDIA 1S1TA 2DHGA 2MHEA 3AQPA 1O0PA 2ZC4A 1T9VA 1S1VA 1U24A 4I68A 2OPPB 2GJIA 3K2YA 4RLEA 2PI5A 2UUBF 2HWHA 5T41A 1ZAXA 2OHDA 1HBOB 4YY3F 4CO4A 1Q81T 2YKAA 3MMCB 4A8FA 5D77A 2IMOA 4KB7A 4IO1A 2UXCF 2BKOA 2YY3A 4PYDA 2AYBA 4DR1F 3BR9A 5CCLA 2RQ4A 3O2IA 1RKJA 2B8QA 2D3ZA 2MQQA 4IFVA 1VQKS 2HFZA 4OX7A 2B4PA 1F9EB 3MAAB 3C66A 5A0YB 2QL7B 3RB3A 2PA8D 1WKKA 1K73T 3QZ7A 3AJ1A 5AXNA 2J7UA 3NS6A 2MKIA 3IWXA 2LQ9A 2YH0A 3J81U 3ZZZA 3NS5A 2XS5A 5J1EA 1YHQS 1VRUB 2CRLA 2V4QA 5F8GA 4KPYA 4X4OA 3T19A 3TZWA 3D2WA 1U02A 3ZZUA 2BRKA 2YWHA 1DTTA 2VG5A 2R7QA 2V8DA 3VAKA 1GX5A 1RK8A 1K0TA 5KG4A 3QIPB 3UWTA 3MAQA 1IBMJ 4C8KA 3F0NA 2CYYA 3EICA 4ANDA 1OSDA 1ZYQA 5GADI 1ZPVA 4NZ7A 2HHTA 3SMZA 3FGVA 3RBDA 2VFUA 3ONQA 4CLPA 2ZBQA 3ICLA 2FY1A 1RAJA 3CO0P 3M1VA 3IP0A 3HD1A 2V2ZA 4I1TA 4WU2A 3I0RA 1NSQA 3HVAA 2RD5C 4QR2A 1XMQF 4FYDA 3FQLA 2WZ1A 1NNDA 4X65F 2QLJB 2ZHAA 4JYAJ 3JSMB 3DLEB 2CZ4A 1IR2A 3Q8SB 1WD6A 2AIRB 3H90A 1XQIA 1NHVA 1TK5A 4USKA 4JI0F 1N5YB 3PRDA 3R97A 2XO6A 3Q8RB 4EGLA 3R5GA 2B3TB 4LFAJ 2V8GA 3BSNA 5D0GA 1DURA 5DDRC 3ITHB 1LWEB 4OHWA 4H4OB 2C3PA 5E41A 4B3TJ 3P8BB 1WC0A 1KOHA 2NYIA 4LRCA 1VMBA 4GKJF 3D5MA 3MEEB 4WCEQ 4I7FA 2B43A 4X62J 3EM1A 3ILOA 3CB4A 2ZM6F 2HWTA 1GEHA 2Q1LA 3W2WA 1C0TA 1RB0A 3JYTA 4IOCQ 1G7CB 3M2RA 2W9BB 3C14A 1UWAA 3OFHA 3OXGA 2R7RA 4ALZA 2DNOA 4KY3A 4DMZA 1VCTA 4HDGA 2HFUA 2QIFA 1S77D 5AT1B 2UUAF 1LWCB 5AXMA 4DV3J 3WC2A 1AZSA 3M6VA 1Z2LA 3G4SS 2OPSA 2Y1LB 1SVDA 4PG7A 1FDNA 2ATLA 3BS9A 3TA2A 3I9V9 3HMJG 4MFBB 1RQ0A 4O23A 3QATA 3M6XA 3NAHA 2B6AA 4DR4F 5CYQB 4P2FA 1T03A 3MM5A 1L5UA 1D3WA 1F9HA 1Y3KA 1RWXB 4F02A 5E7OB 1RHJB 4DL2A 4PKDB 3CCQS 4F67A 2FHKA 4NI2A 3BKTA 1SJ1A 4U95A 3DDKA 1H7WA 2XNRA 3M4XA 2DCLA 4Q2LA 4B9UA 4WFZA 2RKIB 2R42A 5F8NA 1SC3B 3RRGA 1TL1B 4ZPAA 1IKXA 1JLGB 1D1UA 2K1RA 3UO0A 4FYXB 3H2UB 4LR9A 3TA0A 1HI0P 4QQBA 4O3QA 3I0SB 2XLJA 1LW0B 4F50A 3MMAA 3CCRS 3HXMA 2PEBA 1HI1A 5DG8A 1UP1A 2CNKB 2Y0SD 3QT7A 3BYRA 4URQU 2OPRA 4EFAC 1XR7A 2ZVIA 1S10A 4ID5B 2XZDB 3AOCA 4WZMA 2YKOA 4QIWD 4WK3A 2Y1JA 3LP1B 4YEAA 1TV6B 3D54A 2KHDA 5IOLA 2OMLA 2QFJA 4KTQA 2B4OA 4ZCMA 2WVCA 1FWLA 2HNZA 2WSEC 2W4DA 3PX6A 2DY9A 2LXIA 2ASDA 2CNLB 1O8BA 1S0MA 4QU6A 1VI7A 1KTQA 1PILA 4DPUA 3MZIA 4PQUA 3RBXA 3VAGA 1DTQA 1KONA 3UNYA 4ZOSA 1IKYA 4DR7J 2DK2A 4OHXA 1CS4A 5E0OA 4ED0A 3H2VE 2FZCB 3TVZA 3PACA 3J80Y 3K58A 5BYQA 1NB2A 3Q23A 1NJWA 1YRTA 5B08A 1XMOF 2I5JB 1VDHA 1FVSA 1X9SA 3KYLA 2GGPA 3BPDA 3M2VB 3CO9A 4KHRA 3KHGA 1DAXA 1NCLA 2XC9A 4DCPB 2DNHA 3JS9A 2HURA 1FRHA 3M6UA 3R7NB 3NLCA 3PHTA 2C2EA 1RWWB 1FKPA 4FNHA 3IRXB 2N7CA 5GAGI 2GQCA 4I4BA 2QMXA 3DKDA 2BYCA 5U47A 5K9FA 4HH1A 5LJ3Y 4HKQA 1UJ5A 3SZ2A 2OPQB 1D0EA 2FVSA 1IKWB 1N32F 4R8UB 2W1BA 2EW9A 2P5VA 1U4BA 4P7TA 3OTOF 1YJUA 1UZHA 3R7SB 4I6AA 3PJWA 3QJPA 2W2QP 4Q8FA 5DDQC 1F6TA 2CNOB 2NUHA 4LT6A 4EZ9A 4AL6A 4JI6F 1S0VA 2Y0BB 1YJNS 3HPOA 2W9AA 4ZDNA 2WSFC 4H4KA 1QAJA 2VOPA 3HVWA 3HLUA 3R8YA 4BBYA 1O6XA 4NLGA 1T9XA 1H73A 3CD5A 2XSFA 4LSNA 4LF5F 4A8XA 1C0UB 3H8YA 3NL0A 1XNQF 1CJVB 3PX4A 1FHTA 2YXLA 2RU3A 4Q43A 1XK8A 1ULRA 5FLXU 2HHQA 2I6WA 1VQ5S 4RBUA 5F3TA 4DPYA 5DDPC 2UZAA 4LR8A 5CH7B 1HHTP 2MZJA 2X1FA 3MFIA 2VFTA 3LGHA 3MPDA 1VQNS 2EEYA 2GW8A 4C0HA 3G6VA 4QPTA 3E01A 3M9OB 2JEFA 2B9XA 2CPIA 2QMUB 3L3CA 2E5HA 3WDOA 5T7LB 2D9PA 5B0AA 2OAUA 4CO0A 3S6EA 2KJWA 2GQ2A 3FZ2A 2IVFB 5HQ8A 2E9ZA 4AXJA 4ZCKA 1GXTA 1MNEA 1S1TB 4J9SA 1EX8A 2OD6A 4K4SA 3THPA 4B3OA 4DU7A 1PAEX 3M8ZA 2HHXA 3O8WA 3BDPA 4PWDB 1S1VB 3WIUA 1UWBB 4ES1A 1Y00A 4RU9A 5LL6d 4N7TA 1S48A 5M2RA 1FX4A 4URSA 1Y5NB 4DF8A 2BACA 1FD8A 2CPFA 3KUHA 2OIHA 1M5OC 2NXUA 3E51A 1MWZA 2HYIB 2VV5A 3TX0A 3GJQB 1U25A 3F56A 4RUHA 1U49A 1JWWA 3QSIA 2GMLA 2W9CB 2RQCA 4IFVB 4LF8F 1JIHA 3QAEA 2K3KA 4ID8A 2NXNA 4URGA 1NKEA 2V2VA 2IJFA 2XS2A 5KFBA 1ZAWA 4NYPA 5HBMA 2HQ3A 1CQMA 3D67A 4KAIA 1RT6B 3THVA 4JBCA 2CAJA 4OI1A 1C2PA 3QGPA 4ZCIA 3A1YG 1TKDA 1XBWA 3H5UA 1HBNA 1WC4A 2A0FB 2XBPA 3VTIA 2CQCA 4ETXA 4CTAA 5FDLA 1HA1A 3JTOA 1MU2A 4B9VA 2XHCA 4B9LA 3DI6A 4X4VA 1S97A 3L09A 2HK3A 2ZOFA 3A8JA 1J5EJ 4IOAQ 1WG4A 2G2YA 2HPUA 3L7PA 5EWEA 3JSYA 1YJ7A 4J9OA 2WTFA 2GO8A 3IR5B 2YBVA 5LSOA 1DBDA 2Y8YA 4FXDA 4X4QA 1VQYA 4TY8B 2R7VA 1H2UX 1VQ8S 1L3KA 4OZ2A 2D74B 1HIYA 2GA7A 4QW9A 1YKWA 2EPIA 5ETKA 3BGRB 2I0XA 4DR5J 1AROP 1YJRA 4KFBA 3W5XA 1OWXA 2CJ9A 1B64A 2WSCC 4D3GA 3DRSA 1BLUA 4JYAF 2GCFA 4P74A 1UFLA 1RADB 2F8HA 1KTVA 2F8EX 2AMCB 2K7KA 5D3GB 2ZH1A 1EETA 4AL5A 1QM9A 5BYSA 2C1EB 2BE2A 3R5AA 5CYMB 1R89A 4Q2MA 4CI0B 3LA0A 4DEZA 3M32B 4C7QA 3QT6A 2AF6A 3B4MA 3W5YA 4KGMA 4X4UA 5DDOC 1HL6A 1JX4A 2QLFB 2DGSA 4ED4A 1FJGF 4C11A 4UT4A 3I4HX 4WBFA 2D3UA 3DOKA 3HHLC 3CJ2A 2C42A 2ZKUA 1SQFA 5CD4A 4QR0A 3MECB 1VR6A 2C2OB 2MMYA 2CZ9A 2FB0A 2YKQA 4X62F 4MTPA 2VUGA 3S7RA 4I7FB 1U1PA 5KOWA 4NCAA 2E9TA 3CJ5A 3OW2R 4CNYA 1S9EA 2RS8A 1FXRA 9ATCB 3BBCA 5GAHU 3PNIA 4RPFA 4AD6A 4ILLA 1LWXA 4ATNA 3MM7B 3TAMB 3UN3A 2ZH3A 4PUOB 1FRXA 3C14B 3CE8A 3CC7S 1XNRF 2YWFA 1Q8BA 4MK8A 5KG0A 4DV3F 4KGVB 1OMSA 1RTDB 3W5ZA 3VHQA 1MWYA 2GIQA 3HO1A 1FESA 4K4WA 2PC6A 3ULHA 4E2FB 1Z1ZA 1WI8A 4K4XA 3AT1B 4CT9A 4NXMF 2IBKA 2WVEA 1X4BA 3ZTRA 4W92B 5KTQA 1P9QC 1VQ6S 3BGOP 3CMAS 3O3LA 4U67Q 3NGDA 4CLZA 1Q7LB 3WX8A 4ETZA 4DPTA 1H38A 3GYGA 2PFFB 2DR5A 2WB1D 3KLVA 3PFEA 1BQNA 1KVIA 3W2VB 2RDJA 1MSWD 2O5DA 3HVTB 3E8OA 3R5BA 3D9BA 4YS2A 4B3SJ 1TVRA 4JOUA 2BE9B 3OSNA 3BN7A 1BWVA 5DQGA 3UVJA 1DLOB 2XMWA 4JV5J 3A3OB 4WXOA 4FYYB 1IM6A 2XMMA 2KG0A 2CQ3A 4KHPF 1IKXB 2CQ2A 1G4CA 5JXSA 2IBOA 2OTLS 3GV8B 5H9EK 3TUZC 2CQ4A 5A8KA 3BGLA 1N88A 4DZ6A 3BO4A 3ZZPA 1RA7A 4ZA1A 3AAWB 4UOCA 5H9EJ 5LMUJ 2LA4A 2EVZA 3M8YA 2EKNA 4MJKA 1GQEA 3J7ZT 5FJ4A 3KG1A 3EGZA 4AUKA 1T8EA 2RH3A 2RB7A 3SI8A 4NLOA 5HMWA 3SQGB 2Z8QA 3BSOA 2J6SA 4F4XA 3W9IA 3KK3B 1E6VB 3VGSA 1RT7A 4KH1B 2XYHB 1TUWA 2UUWA 2ZNZA 2FC8A 2NZCA 2NQPA 3GR0A 2HGLA 3HHKA 4NZ6A 3ADAC 3W8GA 1IXKA 3IXQA 3UN5A 4X2BA 4FF3A 2HNZB 2DGVA 1LW2B 1NSKL 3R2DJ 1WOSA 3TRGA 2XY7A 1ITPA 2FGOA 1WUUA 4MKAA 1P1LA 4J9VA 4OLPA 3RBZA 4LSLA 3GV7B 4C8OA 1U09A 3OVBA 1R8PA 3CD6S 4K0KJ 2R8IA 4TVAB 1S6QA 2VOOA 4N77A 1N33J 2LXFA 3PKYA 4MT1A 4Y34A 2LQJA 3HI9A 2X1GA 3KUEA 2VBWA 4QWAA 4LRAA 1RBLA 4LRBA 3QZ8A 2A2DA 4WZQA 3W1YC 1CS4B 4HEA9 1YITS 5BR8F 3SYZA 3NOCA 1HHSA 3FSXA 4YB1P 4QW8A 1NZAA 2E5LJ 3RGIA 1HWUA 1RLDA 2VQEF 2FLNA 4AYBD 3DLBA 4NRTA 1WHVA 5KFDA 3KHHA 3FEYB 2VBZA 2F8MA 3GILA 1X5PA 2QT7A 2J6UA 4L73A 3HULA 2HNYB 3MUVP 3V81B 2AGPA 3EMTA 2XHWA 3H20A 4K2XA 2M4MA 1QAIA 2EFVA 3LWMA 3QYYA 4NE9C 2YKPA 1VOMA 4MAKA 4U6PA 2W8LA 1SBRA 1S1WB 1T95A 4J91A 2EKYA 4DV6J 1SPBP 2BQ3A 2R8KA 5IWAJ 2VJVA 1RYRA 2BABA 3EE3A 1RLCL 4OZ0A 4OX9J 3HHDA 5CAAA 2XG8A 4WPAA 4CH1A 3KJVA 2BV3A 1X0FA 2AJ1A 3RTVA 1UEKA 2CIMA 5E33A 3TVKA 2C2NA 5C25A 5GMEA 1GAOA 4WWSA 4J9MA 4X64J 3Q8YA 2F63A 4OIXA 2J6TA 2XMKA 1U2FA 2DGOA 3TI0A 1KQKA 5IZHA 2ZH6A 5D0RA 1A6LA 1N5TA 6FDRA 4NYZA 3QRRA 4RUCA 2BQUA 5KG3A 3IWNC 2ZH7A 2LKZA 1TL4A 2IRYA 3HHLD 4OL8A 4DPOA 2JL9A 4WKYA 3GIMA 2HWIA 2DRAA 2BJ3A 3FUYA 2VICA 3AXKA 5D4LA 1R8AA 1CJTB 3O6QA 2AJFE 4AQYF 1T05A 3H98A 1FK9B 1Q1KA 1FKOB 5IFMA 3JXOA 5E3QA 3GP9A 2EFPA 2GIRA 1TKTB 1RAOA 5F8IA 2CA9A 1SKRA 4MKBA 1PBUA 4CM0A 4X84A 4PXDA 5HMXA 2C3UA 1JLFA 1H0HB 2MY7A 2GJ2A 4KGXB 3NGUA 1KWMA 4KKOA 4YMEA 5EUHA 2EBGA 2CQHA 4WYWA 4BC9A 3RYLA 2XLIA 1LXNA 2MEWA 4DV7F 4L74A 2P8IA 4HT7A 1N0VC 3I9ZA 4ZVHA 1M5HA 6FD1A 3G6YA 2V2KA 4PAAA 2DY1A 3HCXA 3CULA 5KFQA 1SL1A 5KOXA 3KJQB 4ZPWR 1YBTA 2ADBA 3UE2A 4B3OB 2LA6A 1HNIA 4P72A 2YQ3A 1D8YA 2D69A 4S0MA 4ZHRB 2H9ZA 4IH6A 2XULA 1OPIA 1D9AA 2Q43A 5LXYA 3Q8VA 4ZJLA 2D3O1 4RL1A 1T0TV 1YG0A 1HQUA 3IS9B 3GG1A 3VZIA 2J9DE 4OZ5A 2BDPA 1N54B 2ZC3A 2C3MA 4MMOA 1V5VA 2ZH9A 4OYIA 1VQSA 3FBCA 2EFQA 3J81Y 2KT2A 3FQKA 2GAHC 3W64A 4M5JA 2DPIA 2IJRA 3PR5B 1H2VZ 1IJEB 3OSPA 3PKMA 3DM2A 4K7QA 2MGZA 4XTTA 2YNHA 1WC1A 5B09A 1TKXB 5L9NA 4L76A 1R0AB 4RW4A 4P6QA 2DHXA 3KKFA 1JQGA 4FKYA 4GC6A 4JI1F 1Q95G 3PJXA 4ZKAA 1H74A 5K14A 3OLAA 2HLUA 2F9JA 3I32A 1ZZNA 2NCKL 5JJBA 1PG5B 2AJQA 1LV5A 4ZPVR 1IBLJ 2H65B 3EGVA 5D6GA 1E6YA 1FJ7A 5ETSA 2KO1A 3R27A 4O3PA 1A0OB 1KQFB 2HZAA 3K57A 1S9GA 3H4DA 4JI8J 1B0PA 1RT1A 1VBKA 4C3LA 4QIEA 2HVEA 3AB2B 2I2YA 2RF2B 2JEGA 1FKAF 1CJUB 3P6YC 3FFIB 3T1AA 1FNXH 1HYSA 4EU0A 3BV8A 3SDEB 4RBVA 3BYPA 3U1LA 4DLGA 1YRXA 4ECZA 2V9KA 4PG4A 1EETB 3N4WA 4ZVRB 3U1MA 3FC9A 3MTJA 2E7WA 4WKRA 2J9DA 3CMES 1W26A 3T3FA 4LBHA 2XMUA 4DV1J 3MCSA 2K3IA 2YX4A 5E3CA 1OY6A 1S12A 4OHVA 5ETQA 1IBKJ 5D78A 2XWYA 3QLHB 3TR5A 2F1FA 3MMBA 3BJYA 1S57A 3V6DB 5K5MA 3E2EA 2JNJA 4FYWB 4RX6A 4QWCA 1V3ZA 4WFXA 3B54A 4LR7A 2RJZA 3OFGA 3Q8UA 5EGYA 2GS8A 3DRYA 1UETA 3W9JA 2QEXS 2CJYB 4V19J 3M05A 3KK1A 4TXSA 5I3UA 4USVA 1SUQA 3HDSA 4CLFA 3CJRA 3IBFB 1UEUA 3DOMA 4FF4A 2FJWA 1MG7A 5KFHA 2PEHA 3RAQA 3GR1A 4DCJB 4QR1A 2KDOA 1RT4B 3QSYB 2JOQA 2DPJA 1CVJA 2VL1A 4A46A 1S1UA 5KT7A 3KLGB 1G6BA 5KAKA 5ETLA 3U02A 1EHWA 1NMEB 4LF6J 1U1NA 3OPKA 3A8KA 5T14A 2DR9A 5C42B 4ZP6A 2HZVA 5A8RB 4K4UA 3SEOA 3R2CJ 1HD0A 5LXRA 4HACA 3HF5A 4TQRA 1KNZA 4ECXA 2P9GA 2OPPA 2HKEA 1GK8A 3EVOA 4H4MB 3N5FA 1QSYA 5ETRA 2VBXA 2XSJA 1HBOA 1UW4A 1X4DA 1KFDA 3MMCA 4QJVA 3PZPA 1VIOA 3I5AA 4W98A 2K2PA 1WOPA 1WACA 3I55S 2FZKB 2QFIA 4X66F 4ZPCA 4DJBA 4DV0J 3GCWP 5C5JA 2RSQA 3GIRA 2EG2A 4FP9A 1PYSB 5DM6Q 4MH8A 4DFKA 4F0KA 3MAAA 3POTB 2A1BA 3NWGA 1ACMB 2X3GA 2LEBA 5HP1B 5A0YA 3H0PA 3M30B 5A2QY 2APOA 3ZC4A 4TYBA 2CPXA 3EPIA 4PG6A 2AP6A 1U2CA 1RYSA 3OV7A 1NXIA 1TR0A 5LMUF 1NM2A 3TEHB 1VRUA 3IAS9 5AXKA 5D4NA 5JUMA 2W8KA 2KVIA 3T6BA 2P6TA 3HSZA 4CO2A 4ZPDA 1K47A 1QVFR 3HJVA 2NLWA 2YNGA 2IJNA 1DQAA 1RISA 2VONA 3MGJA 3PEHA 5SUHA 1D9FA 4LFBF 2VFVA 1WTBA 2KG1A 4USIA 1T9WA 2B9EA 3QIPA 3CJTA 1F3FA 1AA1B 3V6KA 2BKPA 3OXFA 4DV2J 2DXDA 1RT7B 2BW7A 1QSSA 5HSPA 4C9DA 4P9SA 4K4YA 2CPEA 2DNPA 3EPGA 2RNEA 2DXFA 5M2PA 2FVPA 4ANCA 2NYHA 2YQ0A 4P2SA 3N28A 2GV1A 2VODA 3CJ3A 4K0KF 2DGQA 3FBBA 1HNWJ 3LANA 2IYGA 4LSLB 3A4TA 1FJEB 3MFHA 2IMWP 4WF9Q 3VQSA 1YK9A 1KR4A 2DHSA 1U0SA 2SXLA 3CGIA 1T02A 3DLEA 1AFJA 3JAMU 4C8LA 4DN9A 2ZWPA 4DXLA 4ED7A 4NEYA 3CDUA 2R7XA 1F3VA 1JK9B 2D9OA 2OJ3A 2JLGA 2E5LF 1N5YA 1SXLA 3OUYA 3QAUA 4RUBA 2HZCA 2W2PP 1J5OB 3AB4B 2EK6A 2DHHA 4NA1A 3EGWB 2HGMA 4EK2A 1FRMA 4DV4J 3LF0A 3G9CA 3ITHA 4HTJA 1LWEA 4LF4F 4H4OA 4U8YA 4LVOP 3OL8A 3ENVA 4M5GA 2JJ4D 3MEEA 2AYGA 1VC5A 4ELUA 2HEKA 4TU7A 2RILA 3H2LA 4DV6F 2IM0A 1BQMB 2BJEA 2DH9A 3IR6B 1RTJB 5IWAF 3ZFVA 1MWQA 2IDEA 3MUTP 2GVDB 1U2RA 5DLGA 5F9LA 4DQIA 3N79A 1JLQB 4PR6A 3GJRB 3T41A 2W9BA 5BJRA 3CCTA 2AEJA 2R2UA 2LECA 1K9MT 3KJVB 1YZ6A 4C3MA 1IR0A 1U1LA 1LWCA 1DQ9A 4B9TA 4K5SA 3C16B 5C25B 2PA3A 4NLYA 3MAHA 1ZM3A 3GFZA 2KT3A 4A8WA 4JV2A 3MWBA 1VQMS 4C3KA 3ISZA 4N5SA 3FCVA 4MFBA 5KFCA 1HWLA 1SQGA 3AOAA 4I0WA 1N48A 2ILYA 3NKYA 4IR1A 3FVYA 2DGUA 4QWBA 4J9KA 3LGMA 2D7SA 1IQTA 4EO8A 1S99A 2AKWB 4JI5F 2R8GA 2OKQA 1BMQB 4EEYA 4YUDA 4O3RA 4OHZA 1PC4A 5AJ3J 3ENAA 2D41A 3IGNA 3MD1A 3AH6A 4F3MA 4J9LA 4BWMA 2ZBRA 1GTEA 3R7BB 5KFLA 4MYTA 1ZTTA 1T05B 5L9XA 5DZ6A 2RKIA 1FDDA 5KFRA 1FE0A 1BXNA 2DEIA 4PABA 1LEOA 2FYXA 1TL1A 2WONA 4NMLA 3N0VA 3PRVA 1JLGA 4UY8T 1VHFA 2LDYA 3NXZA 3GSIA 5IV4A 2HHWA 5IT0A 3VAFA 2MKCA 4ZN1A 4ZITA 1XR5A 2AD9A 1CLFA 3U27A 2RIJA 2BVZA 2DYAA 4ECRA 1RAAB 2XI3A 2BZ2A 3NMAA 1LW0A 4CLKA 3KHLA 4O3OA 4DR2J 2LYVA 3HKZD 3TJAA 5DLFA 3HHNB 1CQNA 2MQNA 4GMKA 4ID5A 3LWLA 4CP5A 4P2XA 4WP8A 1HNIB 1TV6A 2KYXA 1RTHA 2ILZA 1WEYA 4G1PA 1V3RA 1SIZA 3C15B 2ABYA 3VR1A 2F9DA 3NCQA 2W4CA 1XN9A 2DB1A 1U8WA 1RTIB 1ZBTA 3M9NB 2IPOB 2Z58B 2LVWA 2DNQA 1HQUB 5L1KA 2LFVA 1N36F 1WKJA 2MQLA 3G8SA 2Z2YB 3IG1B 1FA0A 2P9CA 1HARA 1OYDA 1ZA2B 3CJ4A 4OV1A 1CC8A 5KFMA 5E2QA 3C6TA 3T1YJ 2EFGA 4KGZB 3V6JA 7FD1A 4P7VA 3W65A 1HBMB 4ZVUB 5KFYA 1VC6A 1HNXF 1GX6A 3VF0B 2UUCJ 4RW4B 2UXDJ 3PVXA 4RNFA 3BQ1A 3ET6B 2VC0A 5EX0A 3M8PB 2ZOMA 2I5JA 2E1CA 2C2ZB 5K14B 4OJHA 3KXDA 3VQTA 2FGCA 2CZVC 4YDXA 2JVOA 3M2VA 3LP0B 1IBLF 4BDPA 2CJXB 1L3TA 2ZWOA 3GYNA 4ZK7M 3CDAA 3FJ2A 3NY0A 3Q8QB 4IG0B 1WKLA 5K8PA 3IRXA 4UW2A 1REGX 5D15A 2E1AA 3CC2S 3KMSA 1S6OA 3MR3A 5IT9Y 1NH7A 4OI0A 3O1LA 2C3OA 3NBPB 4ZVSB 2ACMA 4JI8F 1AFIA 2OPQA 4K4ZA 1IKWA 1D8ZA 3UDEA 4DG1B 4UTGA 2RHSB 1SC4B 3I82A 3TAPA 3VZHA 3EZOA 3BSAA 1UL3A 5IS2A 4IQXA 4ZVEA 3OJSA 3ZTQA 4JI7F 2FHJD 3KMQA 2HHHJ 1IJFB 3CCLS 3S8SA 1CBKA 2KB2A 2PMWA 4V1Ak 4EBCA 2MJUA 1L3SA 5GAEI 1VJQA 3BF4A 4DR3J 2DKOB 1RHKB 3AJDA 2ASYA 1HD1A 1S1XA 2ZHOA 3DRXA 2EG1A 2NSCA 2IC3B 5EX3A 3ZO7A 3G86A 1YLXA 3C6UB 1KC8T 3JQJA 3MHYA 3TEGA 4OZ1A 4Z7CA 4DV1F 3OR2B 2CQBA 4NLRA 3DLKB 2XGPA 1BQXA 3G8TA 1IBKF 4IRKA 1RWPB 1JKHB 2AGQA 1EJ7L 2W4PA 1A7GE 4ZVFA 2EFOA 5KT5A 2MYFA 3HZGA 3IRWP 1UKUA 3MMBB 3MR2A 1C0UA 3PRBA 4BHQA 1GMVA 1VBXA 1H3DA 3A8IA 3RJMB 4WFYA 1CJVA 3SFGA 3LQVA 2BQRA 1GMWD 2AYMA 1NK7A 1NLKL 4PG5A 2VPZB 5I3UB 3GB0A 4WFNQ 1S6PB 3SSSA 3SXLA 4JI3J 2NSBA 4HHUA 2VBYA 5E5NA 4DLEA 2E7XA 4AL7A 2UV8A 3GTYX 4LF6F 2R7TA 2I38A 4O4GA 5DJBA 1RWUA 2QSWA 4IRDA 3PW2A 1F5BA 4ZLNA 4NLUA 1IKVB 1KLNA 3NCPA 3MR5A 3EZUA 3QMQA 1HR0J 4OLOA 2EWHA 4PWDA 4HACB 1UWBA 3HKWA 3T5LA 5H9FK 1F60B 1R8CA 1U45A 2MQPA 4K59A 4A8SA 2LMIA 2XSJB 4U8VA 2V68A 2J8AA 5F3ZA 5H9FJ 1ZM4A 2GZOA 1VRTA 4YQWA 2AU0A 4UUWA 4E0DA 1SJ4P 5F8LA 3N5BA 4QWEA 4DV0F 4A8YA 1CG2A 2GMHA 1N34F 1DHMA 3KFWX 5HLFA 2W9CA 3GPAA 1S79A 1HQEB 4XDDA 1R8BA 1JLCB 3THTA 4F2RA 2H48B 1TL3B 1QUVA 2M70A 4QYRA 1RT6A 4JI4F 5E3PA 4V19X 3CNQP 3DRRA 3VCDA 1AT1B 2A6OA 1NPRA 3GJTB 3EX7B 1Y5LB 1TK8A 4MIWA 4I6YA 2V9WA 2V8VA 8AT1B 3BSCA 3DFEA 2Z30B 3CCVS 5J2QB 4JI2J 2YPZA 1Q5VA 4BS2A 2L9DA 4Z37A 4CNZA 4TLQA 3CIMA 5LT5A 3ZNJ1 4HL9A 5L46A 2XMTA 2YNGB 5G4DA 4DPWA 1UW9A 1K44A 2UVUA 3IM8A 2HG4A 2FDNA 3VV2B 5KG5A 4DSFA 5K8OA 3G8QA 5DO2A 1ICEB 3BH7B 2W2MP 4DHVA 4PXEA 2HMIA 3IWLA 3L95X 4Y6IA 4TY8A 3Q8PB 2W25A 3R9LA 1FERA 2DRBA 3QRPA 1ROFA 2CJBA 2G9OA 4O0NA 4QIFA 2PI4A 5CD4H 4NLTA 3ZZTA 3BGRA 4KHMA 3UCGA 1PJ6A 2XCPA 4YDDB 3ZZRA 1JMTA 3I6PA 1HNWF 2PIIA 1VQ7S 2G1HA 2B5JB 3QGHA 1TMMA 2OEJA 3W60A 3LP2B 2C28A 5H1SV 3I56S 1JJCB 3M2UB 1P27B 1MMDA 2RHQB 4DWIA 4FYVB 5D3GA 1UAWA 2Y1IA 3DDIA 1R8HA 1HWJA 4IOBA 5G0RB 1NH8A 1QY7A 4Y2CA 5CYMA 1FEHA 1QUPA 1F2GA 4NX9A 2YWKA 3QJJA 3M32A 7AT1B 2JLEA 4F4AA 4H54A 3OUYB 3IFEA 2GAGC 4Y2KA 3D6FB 5KG2A 1NHKL 3FSYA 2ZFHA 1NB7A 1P9YA 1CSJA 2Z0GA 4RR5A 2VQFF 4ILMA 2FJAB 2Q6CA 2MZ1A 3MECA 4PCQA 3PW7A 4C8ZA 2GHWA 3KWMA 4DUZJ 3B8HA 5DS7A 1U0HB 2AYEA 4Q5VA 4JV1A 3GMGA 4A48A 1TQLA 3TUJC 1TFYA 1B7YB 2QLXA 1AUDA 1NJIT 4KE5A 1IQZA 1TMJA 5L38A 1EQMA 3ELHA 3MM7A 3TAMA 3T9ZA 1T9UA 2LEAA 4PUOA 2CXEA 2KM8C 3DGVA 2UUBJ 2FJXA 3C3LA 3G82B 2BE7D 1OQ3A 3QGIA 2VG6A 2E66A 1QAXA 1RTDA 4RNHA 5HANA 4KV8B 1SCJB 5I42B 3MCMA 2M2BA 3O5TB 4ECWA 4HLBA 5DG9A 1WWHA 1VLOA 5MLCV 4DS4A 5DG7A 2CPYA 4PPDA 1HHQA 2F40A 2JWNA 4Q45A 2WRMA 2MZTA 1WHWA 3MM8B 2ZUAA 2KFNA 1RACB 4F0HA 4FPRA 4LF2A 3RB4A 1Y9OA 3UQSA 1JB0C 2MLYA 1KEKA 3PR4A 2JEJA 4F4WA 2E1RA 1S4EA 3TOQA 3W2VA 4ZP8A 3HVTA 1F9FA 1PJ7A 5GMDA 2KXFA 3LH2S 5KT6A 2HHVA 3GU0A 3NWRA 3PXGa 1NKCA 3R5JB 2XLKA 1Q79A 2DNRA 1FDBA 1DLOA 4HHHA 4F25A 2DD8S 1M1GA 1RAHB 2XGQA 2ZVSA 3BPSP 2I8EA 3G71S 4C98A 2WONB 4R5PB 3CJKA 4LBPA 3QWPA 5DZ7A 3SSQA 1QSLA 4F04B 4O44B 5D4OA 1X5OA 3KG0A 2KJVA 1KOOA 1OY8A 4KC5A 5HVFA 2UXBJ 3AHPA 2WCXA 3MMJA 5EN1A 3DLHA 3SV4A 1BUXA 2JFKA 1TZ0A 4EZ6A 4F3OA 2XY6A 5MAOA 3MEGB 5A2QU 5KFUA 3W66A 5EWGA 5J1NA 2IA0A 2G2OA 4A4JA 1C1BA 2M9KA 2B7CB 2HVZA 3DLJA 1NAQA 3CWJA 2O66A 3SQGA 5D0HA 3BREA 1RTHB 4KO0B 5JMNA 2QX0A 4X65J 2AV5A 3S01A 3KK3A 3RW7A 3KOAA 1E6VA 1LWFB 3HHEA 4B9SA 3KHRA 4NCBA 2W7AA 5KFIA 2I1RA 1TAQA 1A9NB 4U96A 4XDCA 2VF3A 3UR3C 1LW2A 4K4TA 4JI0J 1YRUA 2RUSA 1ZH5A 4WK1A 3D3CJ 1NPKA 2ROEA 4Q0BB 3MF5A 3FZBA 4RW6B 4C6AA 3T1YF 4B17A 1NK0A 3MM9B 1TUGB 2FIUA 1RU2A 3C6TB 4M5NA 2YPYA 3BBBA 2UXDF 3DMJB 1RBOB 2FZGB 2ROPA 3DYAB 3GZ7A 3CD7A 1RWKB 1U6ZA 1QLNA 2ZD1B 2KHCA 3FMWA 2F4VJ 3HHLA 3WHIA 2ZM6J 4OJGA 2MB0B 1TFWA 4DX5A 4DSJA 4L3NA 2J9EA 2NZ4A 4DPXA 3CSKA 2HNYA 3JTPA 4HI1A 1SJ3P 2G0JA 3V81A 4M5DB 3M8WA 4G6VB 2B4VA 4QPXA 2KM8B 2XO7A 4Q7AA 4F8RA 3LPYA 3V5RA 1DJ0A 4U7CA 4UF4A 1S1WA 5SZTA 3QGGA 3ETOA 1G1XA 3VAHA 1YJTA 3A13A 4CH7A 3HVRA 3K5MA 3GFYA 2HHHF 4ZIWA 3FMBA 4MK7A 1H7XA 2V6AA 4DR4J 3FCHA 2UVVA 3AD7C 4DR3F 5LMNF 4ZLPA 4KR0B 3ZZOA 2GNKA 1SJRA 2YTCA 4I2QB 2CWKA 2EBEA 4OZLA 1YBUA 2MZSA 1S1XB 1X4FA 3HFVA 1VK3A 3IR7B 4HTIA 5B0EA 3ILIA 1U26A 2PMHA 1RAEB 2FD2A 4EBDA 3HSJA 5J2NA 4U7UK 1KS2A 2XB2D 4USJC 2Q79A 4ZVGA 1TL5A 1HBUB 2LP4A 5DRKA 5C2CA 1B0TA 4Z2XA 5KG1A 4WJBA 4OYMA 4CDIA 1N5VA 2CQIA 5IQQA 3W7BA 2BKNA 1F2HA 6AT1B 2BUNA 1N6QA 2CKWA 1CJTA 1S59A 2OELA 3BGUA 1FX2A 1FK9A 2C22A 1FKOA 5F8MA 5CA5A 2E29A 3LW5C 4GKKF 4ES2A 3RU0A 1TKTA 4WP3A 2FVRA 1JJHA 2GFFA 1WC6A 2IDLA 1WSRA 4JI3F 2RU9A 3D6TB 3AD8C 3K59A 1JLAA 2FJEB 2E1MC 4Y2AA 5ETOA 3HT0A 1VBYA 1UVIA 2R2RA 1KD1T 5D0EA 3AQOA 1J2VA 4EMDA 4TLRA 3RW6A 4LF7F 3NOGA 1SC6A 4HR2A 4O4GB 1TL7B 4DV5F 4EYIB 1TP7A 3QPIA 3UI3A 1C1CB 3BM7A 1LKZA 4ES3A 2BANA 1KRPA 1VQ4S 1NK4A 3D3BJ 1I51B 1SKUB 4TKTA 1R6VA 3PO4A 3KLHB 2A10A 4ZHRA 5IV3A 1OO0B 1JNZB 3DDNA 4DX6A 4XPEA 4AE5A 2PDAA 2PGCA 3CCMS 1R6YA 2MJNA 4C0BA 1ZPWX 2UU9J 1YIJS 1RWVB 3HZEA 2UV8G 2NPIA 3D1QA 3PDNA 4NWBA 1VRTB 4XO0A 4KRWA 3K89A 4RNMA 3N01A 5HROB 1FCAA 3IS9A 3UNGC 1GTHA 3UD5A 1OQ6A 2DIVA 1NBEB 4ZJQA 2ZEJA 2FLLA 4N76A 2ZZMA 4B9MA 1XMOJ 4XK8C 2QA2A 5HLFB 1YI2S 2YKMB 2HQIA 4I64A 2HHUA 1RT2B 1CULB 3CCSS 3MCOA 1VJWA 3NMRA 5B0BA 4P71A 1TKXA 4PXCA 1R0AA 2CQDA 1KHVA 2V8HA 2EI5A 3WC0A 1F0XA 2K06A 3GONA 5J2MA 2UP1A 3R6LB 3UDLA 4M5LA 3HSGA 5ETNA 3TUPA 4PXBA 3PG9A 3DRRB 3HJFA 1RHQB 2UVRA 4JI2F 3PYDA 4J5OA 3EUNA 1PAUB 2VPWB 1RAFB 2W01A 2WW8A 4F7VA 1NPPA 1TKZB 4NASA 1V5IB 1QTNB 1VQPS 3KUGA 1SIWB 1S76D 2E5JA 2LCWA 3SSRA 2H3EB 4RW8B 2B0GA 4WIQA 3J7A1 1IBMF 2H5EA 2GQQA 4NYOA 1S0OA 2HS0A 4OYZA 3KLEB 1LK5A 3PFOA 4RJVA 2HMIB 4QIGA 1HMVB 1XJWB 4CWBA 1VISA 3IMQJ 2F65A 4ED3A 1KP6A 3BGFA 3D0IE 3J7YU 1JJ4A 3JAMY 3NGKA 1HKAA 3DGPB 1N8RT 3SFUA 3CD0A 2RF2A 3D66A 2WW4A 1YZ7A 2KYZA 1CJUA 3FFIA 1T7PA 4MKYA 5KT3A 1PBAA 2EC0A 5IT9U 2W2NP 2FJDB 1IR1A 1SKWA 3SDEA 5KFWA 5IXUA 1CEZA 1JXVA 5IT4A 4NCGA 1X5TA 1MN7A 3MEDB 2VH7A 4YR0A 3ILJA 4RZRA 4RW7B 3RZAA 3R3TA 1AXQA 4DSKA 5I4MA 3Q83A 1TELA 5F8JA 2Q3PA 1AUSL 3TYTA 3AA8A 4EBEA 1KFSA 4J9UE 2YH1A 2DHAA 2V4JB 1JLEA 4LFAF 1Q7YT 2C2RA 4Q8EA 3QLHA 4LVNP 4GO5X 3G96A 2RS2A 2NREA 2HS3A 2HK2A 3UDVA 3V6DA 3EWGA 4OYAA 2DGWA 4B3TF 4RWWA 4CZCA 4DUZF 1FFSB 3VGUA 3WBZA 1ELOA 1RT3B 1VBZA 1V9OA 2DR8A 4ENOA 3K17A 5C2GA 1CJKB 4ED2A 4KIAA 5IQ6A 2HRYA 3EDRB 3AODA 3IN5A 1M5VC 2F5GA 1S7HA 4YR2A 3AD9C 4R0JA 2Q66A 4YFUA 2CNNB 1HLWA 2KRBA 3DLLQ 2GHVC 2OO4A 2RQMA 1DQ8A 5BXIA 4FN5A 3DHXA 2DITA 3D0GE 1EQ0A 2W2OP 1T9YA 2R3VA 1LXJA 1I94J 1RT4A 2E1PA 1XC9A 2XMVA 1YBAA 2VG6B 2QYGA 4GO7X 2DO4A 3TA1A 2FJVA 3KLGA 5C24B 2ALYB 4LFCJ 3FKBA 3MOJB 4DZDA 1GH8A 2R7WA 2ZBPA 1TU0B 3N6MA 2VD3A 5C42A 5L8RC 5A8RA 3V4IB 4DQSA 1FNMA 4ECQA 4N47A 4LF8J 1LFPA 4H4MA 2YNIB 3CT9A 1X4EA 4HI2A 2MKKA 1ZM9A 3MPVA 1FJCA 2R2SA 4YB5A 3RBEA 2M3DA 1Y0HA 2AEMA 1RT5B 2HFVA 4ILRA 1AW0A 2IRUA 2E5GA 2HAFA 4EI2A 2CVEA 4I6WA 3QT5A 3J7Z5 1Q4RA 1S5ZA 4HHJA 2MY8A 3QIDA 4DX7A 4DL3A 2R7UA 5CZXA 1YQHA 1CPZA 3PW0A 3VAIA 4FBUA 3OFFA 2KZZA 2NUUG 1LOUA 2XYPB 2CFXA 2FLOA 3JSBA 3POTA 3M8QB 3FEZA 5HP1A 2PN6A 2VG7B 3M30A 3CJKB 4DQRA 3H5XA 3TZZA 2GVZA 3R5DA 4CYUA 3M8SA 2UXBF 4N56A 4PYAA 3M9MB 3IAM9 2LDIA 1T3OA 2ZE2B 1NJZA 5KG7A 1VHIA 2KN4A 2OFHX 4IKAA 3UCZP 3SCKE 1FTCA 3MOZA 4Y28C 1U6BA 2R2TA 2JX2A 3K8VA 3D6MB 2OMOA 2JHEA 1C1BB 3LTOA 3T5JA 2ERRA 2FTRA 5I3QA 2HSEB 5AE3A 2XCAA 1I5OB 2ZNYA 4DQPA 4HT5A 2XMJA 1BWEA 1VC0A 4FZVA 3B82A 2AJ0A 2XWXA 3F41A 4IRCA 1G3OA 3SV3A 4NLXA 4NZ0A 3GIJA 4UOFA 2HFSA 3DLGB 2GHPA 1C4CA 3MEKA 3GE9A 1X9WA 1WC3A 3KDNA 2JRSA 2VPXB 4M5KA 4MKVA 1UA0A 3IO1A 1NHUA 3KLFB 3TWZA 4U9RA 5DQIA 4J9PA 1FJGJ 1X8DA 4DR7F 5KFEA 5B7WA 4FS2A 2CDRB 1X4HA 3BB5A 2RE1A 4A47A 2HBZB 4Y65A 3HT3A 3RR7A 2CUYA 1JJ2R 2KTQA 2F4VF 3A3NB 1D9DA 3DRPA 4J9RA 3ZTOA 1MW7A 2N82B 2V94A 2HVIA 1FI4A 2FHOB 3PW5A 3HHLB 1J5OA 2L3MA 3GWCA 2CWXA 2R7OA 1NK6A 4QOTA 2O3DA 5KT4A 1RWNB 3O44A 1XNRJ 3W61A 2FVCA 4DUYJ 2YX1A 4FDFA 4GRSA 1NK9A 4OI4A 2KFZA 4Y0FA 1SH3A 1RKIA 2X1AA 2NXCA 4C8YA 2DJWA 1Y10A 1B0VA 3J81j 1MROA 5CCMA 3ZTPA 1BQMA 2CJQA 1RTJA 2VA3A 2U2FA 3M7VA 3P5TL 4OJ3A 2GVDA 2IM2A 1JLQA 4NXMJ 1QE1B 3SCJE 2W7OA 2EK1A 4ED8A 3H4BA 4ZLJA 1UVKA 2PFDA 1R0CB 2PD1A 5HO4A 2OSQA 4CO5A 1Q82T 1YJ9S 2C3YA 3C16A 1HQ2A 2RRNA 4P75A 3ENQA 2V67A 2VU5A 3CC4S 2JZ5A 3I4PA 1UJ6A 4CQ1A 2B56A 3C19A 2YKNB 3TX8A 4OFZA 1PC5A 4E98A 8RUCA 4RBTA 5J2NB 2VC1A 2NPFA 2J0XA 1H98A 1JXEA 2IAJB 5EWFA 5K8NA 1G2EA 3H25A 3C8YA 3PM9A 4IYQA 4DL4A 4KHPJ 4ZS6A 5F0WA 1RJJA 1RHUB 4KH0B 3MXHP 3W62A 1UVLA 1IVZA 1EAYC 3QFHA 2HAIA 2V0NA 3FK4A 1OIAA 1FWKA 1NO8A 1N6QB 2BEFA 2QJ3A 4WP9A 1Q5YA 1GMUA 3TANA 1PO6A 4NRUA 4EO6A 4DL6A 3OTBA 2FY8A 1JLBB 2BM1A 2Q6BA 3WZ0A 3EZ5A 2KXNB 3PV8A 2BOAA 3DN9A 4MK9A 2OEMA 4OYXA 2EFNA 1UJ4A 4NXNJ 1U1OA 3EGNA 1JLAB 1FRLA 4LF1A 1RWOB 4ECYA 1NSPA 4QCLA 5A8WB 3GFXA 2BJ9A 4C97A 3J7AN 1RHRB 1UVJA 4ZVOB 1TUVA 1P6TA 3P4UB 2FVQA 1NK5A 4CCHA 2Y1RI 5KFVA 2BANB 1F5CA 4CIOA 1I1GA 1EP4A 4W4MA 2CJAA 2CPJA 4MIBA 3B78A 3BO2A 2XEXA 1KSPA 3C15A 1XEZA 2UU9F 1WOOA 1HNZJ 2IYIA 1MMLA 2FHJA 1RTIA 2HHPA 2IM3A 3HK2A 1NSAA 3P45B 3HM9A 2N7YA 4XPCA 5BR8J 4DS5A 2I9SA 4DX8H 3K5LA 2VKZG 1IN0A 2HNDB 4USTA 3IG1A 2HFOA 4F26A 4RW9B 1FE4A 2UVWA 2VDIA 1B3TA 2VQEJ 4YHHJ 4FKXA 3BH6B 3TQEA 1BHNA 3LUYA 4ZPBA 2OFGX 4MIAA 4CLSA 2COLA 4LIRA 2BR0A 2Z2MA 2DVIA 5CABA 2G0CA 1HBMA 1RAIB 5CHCB 2XI2A 4LRFA 5J2MB 1WORA 2CQPA 3ET6A 2POKA 3S1TA 3M8PA 4BWJA 4ED5A 3FBEA 2Z57B 3V6HA 2PT0A 3UR0A 4RU2A 1VFJA 4XAKA 5DM7Q 4RKUC 2BXJA 2MXYA 3SQOP 3LP0A 3FEXB 1SJQA 1J5EF 3RR8A 4ZLLA 1GMWA 1RZMA 1S0NA 2G13A 2A2CA 3KK2B 4ED6A 4PPZA 4IFYB 3OJUA 5F9NA 4IG0A 4P52A 3QRQA 4L75A 2C2DA 5KFNA 1R3NA 4N41A 1PCAA 4GVBB 2IA6A 2DNZA 1KKHA 2XTJP 4I2PA 1UA1A 1X7VA 3OD2A 3NBPA 2AQ4A 3M6WA 4B9NA 1U6FA 2MDAA 3TQ1A 4DG1A 3CDWA 1IUJA 4DR5F 5HVHA 1FDAA 5B0DA 3PY8A 4WE1B 3MM6B 3RRKA 2WBRA 2CPZA 2GMJA 4OYOA 4EUVA 4FF2A 3UD4P 2MQOA 1NRKA 1PIEA 1MN9A 3SCLE 4DOZA 5HMYA 1Y5IB 5DETA 1RBAA 4NCGB 1P8GA 2E5IA 2LU2A 2IC3A 3D68A 3DU5A 3G6ES 3D28A 3C6UA 3CJ0A 3KJNB 5GMKa 2L9NA 3OR1B 4A8OA 2H4WB 3KNGA 3DXSX 3OR2A 2J7WA 1REVB 4AQYJ 2CQ1A 3DLKA 1HI8A 4ERDA 1JKHA 3U7JA 2B9YA 4NOHA 4DDFA 3PHEA 1KLMB 1JLEB 2CQ0A 4M5HA 5B0FA 1XIQA 3DOLA 2L48A 3LO3A 3GCXP 5LSRA 1U47A 2ZOGA 1X9MA 4Y3CA 2HBQB 1YSJA 2G1DA 3PW4A 3F73A 2F4FA 4OI2A 2E9RX 2FQQB 3DC2A 2L41A 1M5SA 1HPZB 1KQSR 3QFWA 5IM0B 4DV7J 4LRDA 2C2KB 1VYAA 2ATCB 3FSIA 2WHOA 4G1QB 5HATA 1Q8IA 2M7SA 5KFGA 3OL6A 1JNRB 1QTMA 3W3SA 3FRYA 3L9ZA 3GQCA 1S6PA 3I96A 1I94F 1FD2A 1EKSA 3HP6A 5J2PA 4UQTA 1O5JA 3TNVA 1OYEA 1EB0A 2ALZA 1SL2A 2XY5A 1WTFA 5ETTA 3LAKA 1B99A 2FPHX 3EXYA 4LFCF 3BZQA 3OT9A 5HJYA 4FNIA 3HX9A 2H1YA 1IKVA 2VPYB 4KYZA 4ICLA 3MDFA 3PYGA 5B0CA 2MQMA 2P2CB 3TUIC 2GO9A 5JVHQ 4B08A 4OX6A 2HRUA 3AA9A 4DFMA 3OHBA 4PZVA 2BX6A 2HLTA 2UUTA 1SV5A 3H40A 1SB6A 2AT1B 2QSFA 2KXHA 1X31C 4NLDA 4E8UA 2E7VA 2HQCA 2DT9A 4M1KA 2MLZA 2P6SA 1MLAA 2B9WA 4F36A 4B3SF 4JI1J 3JQKA 5J1EB 3K5OA 4Z7YA 3QQCD 3T5HA 2V63A 1IWAA 4B3MJ 4JV5F 3VGTA 1HQEA 1JLCA 2NS1B 1W2IA 1DTTB 2VG5B 3MPWA 1H72C 1TL3A 1VK8A 2K8GA 1HNVA 2KFYA 3PIOQ 2IM1A 1L3VA 1PJ5A 4W90B 2GVZB 4CYUB 1FFGB 2LXUA 3VAJA 1UMJA 2MZRA 2VZ9A 4DFPA 2QN6B 3P3DA 5J2QA 1EIYB 4ZJOA 5L1JA 2A18A 2B7BB 2NXEA 2BOPA 3SCIE 5KFFA 1QVGR 1N4LA 1NJXA 1N5SA 4F4YA 3HSDA 1VGYA 3M1VB 3NNCA 3I0RB 4HVZA 2YVSA 2N4DA 1GFWB 1WJ9A 5L1LA 5AXLA 4TU8A 3CTRA 2DGXA 5F0UA 1Y3JA 1U1RA 3KLIA 1U1QA 4BC7A 2MPUA 5JVGQ 3UW1A 3RB6A 2IIHA 4YP3A 2XQCA 2E44A 2G0IA 4BLGA 4Y00A 2LLZA 1R43A 2LU1A 3UPFA 2W24A 2B5JA 1S9FA 2J5AA 4X4PA 3LP2A 4ECVA 3QT8A 2ZJRQ 4PG8A 4HYKA 3M2UA 4PWWA 1N33F 4FVMA 3J7YI 5D4PA 2WK4A 4OZ3A 1H6KX 5HJXA 1AYEA 2KH9A 5G0RA 2C2MB 4NMXA 7FDRA 1RWMB 4OYBA 5RUBA 1FWPA 2D3OR 2JEIA 2HQDA 4M5MA 4USWA 2DTJA 3MCNA 3PX0A 1S6UA 4KSEB 3DRPB 1RI7A 2J8SA 3U1NA 3X3UA 3K0JA 5L1IA 3W2WB 2CPDA 1C0TB 1DY3A 2M52A 3JYTB 2F3JA 1NDLA 2OGUA 3M2RB 2GJFA 1DFDA 4DUYF 5LJ5Y 2CJKA 2IY5B 1I6JA 2HVHA 4NLPA 2IFXA 1U0HA 4NLVA 5KFZA 1AZSB 2X7IA 4LQ9A 4O4RA 2OPSB 2VJUA 1NEEA 4IDKA 1NDKA 1MROB 2W7PA 2DR6A 3B6BA 4K50A 1K1QA 5AE2A 4OX9F 2B6AB 3NEKA 3DCAA 3OBIA 1FXLA 1T03B 2OD4A 2KI2A 3MM5B 3TVYA 3N9UC 3G82A 1XWLA 4CLWA 5ADZA 4USHA 5B0GA 1S49A 3NG8A 4LMZA 1GXUA 4YOEA 3TZXA 4H4KC 5D8HB 4DUTA 2MZQA 4NI2B 5KFXA 4KV8A 4IG3A 2YWGA 5GAHI 5I42A 4X66J 4X64F 3R1LA 1DZ5A 1U1KA 3GJSB 2OP5A 1XTZA 4HDHA 4MYUA 5HQLA 2F7VA 4QBUA 4L6V3 4UY85 1UTAA 3OHAA 4DSLA 2ZKTA 1X4GA 1IBCB 3OXLA 3MM8A 5F41A 2DH7A 1NK8A 3OTCA 1NJYA 2KRRA 2LQBA 4ZVPB 2K1RB 1VLYA 3N6LA 4L3KA 4D3HA 2HRTA 3ISNC 2MKYA 5EHHA 1IM4A 1YJVA 2HQFA 3CVKA 4ZMMA 4DQQA 2H4YB 4OX8A 3IA0A 1Q8LA 2O01C 3MUMP 3R6GB 3MMAB 3IC1A 2NR0A 1KBRA 1K0VA 3CJSA 3N6NA 2OPRB 4TY9A 2V2QA 1WF0A 3A3PB 1Q0NA 4R5PA 4NXNF 2VIHA 3K5NA 4LFBJ 2PSZA 4O44A 4CT8A 2YWWA 4IQMA 1QAYA 2PE8A 2J0SD 4X4RA 3CJ8A 1KN6A 4DL0C 3I5BA 1YWXA 5HVGA 1VQOS 2QV6A 1M0SA 1Q8KA 3H59A 2ZITA 3MEGA 2DNMA 1U7LA 2GIFA 4DSIA 4I67A 2MQ8A 2DR7A 1FRJA 1BE4A 1EP4B 3AFGA 2BRLA 4ITSA 4DFJA 1HNZF 4PQUB 4KO0A 2QC3A 1DTQB 3CUNA 1IKYB 4N8OA 4X4NA 2FLPA 5ETMA 3OLBA 4CLUA 4ECTA 1LWFA 3Q89A 1YDLA 2Z4PA 3MURP 1HW8A 1QDUB 2DIUA 5J1PA 1WEZA 1OJ4A 4P73A 2G2ZA 1NUEA 2V5HG 1WG5A 2GX8A 2RT3A 4YHHF 3KG4A 5HI7A 4Q0BA 4J7CA 2CQGA 2GGPB 4K5RA 4RW6A 4J37A 1VQLS 3G2XA 3MM9A 2Y3YA 1Q53A 1I3OB 1SH2A 1FFWB 4LF4J 1NKBA 2R9LA 3QNWB 2DXEA 4YN3B 3AXMA 1FKPB 3DMJA 3HD2A 1N0UA 3DYAA 1WDDA 3VGVA 2ZD1A 1R27B 4M63A 2DISA 2R4FA 5GAEU 3D1OA 4RNNA 1T9TA 3NAIA 4YB7A 1WF2A 1UVMA 4ELTA 1RGVA 2ZZNA 4WTOB 1UVNA 4WU3A 1YJWS 1YGYA 1U1MA 4J9NA 1N52B 2H5JB 1X4CA 1N5QA 5THWA 3MI7X 4ZVQB 4M5DA 4YR3A 2PMZD 3NNHA 2BJ7A 4OHYA 2DNYA 1SC1B 1IWGA 2XZTB 2AZ3A 4I2PB 3LGNA 4KT0C 1VQ9S 4I56A 3ZXWA 5FD1A 4G1IA 2H5IB 5KG6A 3OFEA 2MKSA 3GG0A 4JI5J 1K1SA 4RNOA 4RUAA 4JUZA 4R0EA 4LSNB 4GC7A 1ZAVA 3ETMA 4I2QA 2BJ1A 4OYPA 3MR6A 1V3SA 4C4WA 3TAQA 4Y2IA 2M88A 1FRKA 4C8NA 2AHOB 3TJ9A 3Q2TC 4LSZB 3PO5A 1N56A 4CLLA 3GLJA 1MMNA 3NP5A 1HBUA 5KFSA 3NGSA 2J0WA 5CYJA 3RG6A 2HIQA 4CLTA 3PCOB 5CQGA 3P96A 3DOLB 3EYZA 3E01B 2OLWA 4X4SA 3BBFA 2Z2LA 1NDPA 1RCXB 1KQGB 4CLYA 4WFAQ 3H5SA 1NZ8A 1O51A 1WELA 2DBBA 2H51B 3I87A 3BKFA 2QL5B 2HGNA 2FHMA 4ZCLA 4OYWA 1WC5A 4LF9J 3CCJS 5J2PB 3D7SB 5LM7E 4OZNA 1WDTA 5A6WA 3T6JA 2XZWA 2BJDA 2HBRB 5IC4B 5HMZA 3P5BP 3IM9A 4DI6A 2OTJS 1FXDA 2ZDPA 1TL7A 5I3PA 3CXCR 1Q16B 1C1CA 2CPHA 3OTDA 1N36J 3BQ2A 2WAQD 4ICLB 2JSXA 4FXWA 1SJFA 4R25A 2VDHA 1YX2A 3KLHA 2DRDA 4FPIA 3ZZ0A 4IH5A 3K7RA 4DL5A 2QE5A 2KL8A 1PYOB 2H54B 2ZBIA 2ZH5A 4ED1A 1HFEL 4U7UD 1SV5B 1SL0A 4DR6J 1WEXA 3TJ8A 4DCOB 3QBCA 5HBMB 1NU4A 2ADCA 2YWEA 3ISND 5ITHA 5HROA 2AGOA 1HNXJ 1WNEA 3L4BC 2KT5A 1HBNB 4QYZK 5KFJA 4B3MF 4CTAB 1RXOB 4JP8A 2K7JA 5FDLB 1F5AA 3T1HJ 3D4JA 1M5PC 4QYZJ 4LQ3A 4AXIA 3FRZA 2YKMA 2WVBA 1MU2B 2Z2ZA 3Q22A 3DI6B 1RSCA 4QZVB 1RT2A 5AE1A 1CULA 3J80U 5GADU 5HAOA 2D1CA 1T94A 4GVLA 4OQJA 1WHYA 2HS4A 1HNVB 4B3RJ 1UZDA 4X4TA 1R31A 2L08A 3WQPA 2J0QD 4OZJA 2M8DB 1U48A 2X3DA 2L9WA 3PEJA 1K8AT 2XNQA 3UDCA 2YX7A 3C2PA 5ETVA 3W63A 4RO0A 2QTWA 1RU1A 4M94A 2KZMA 1Y11A 1TKZA 2V34A 1KVKA 2MSTA 1VIXA 3F44A 3T5KA 5KFOA 3IBWA 4JI7J 4M8LA 4KFBB 4RW8A 3TO8A 2AZ1A 3DRSB 4M95A 1PYTA 2DO0A 2WOMA 4N8NA 4CO3A 4DV2F 3TARA 4LIWA 3KLEA 1UCNA 5HK4A 1XMBA 2J7KA 2N3OA 1HMVA 3P49B 3KLIB 2KVQE 1S72S 4J90A 2BE2B 4UUXA 1OPZA 1M90T 4F3QA 3SBMA 4IR9A 1R0BG 3CCUS 2A6MA 2QMWA 3DGPA 5DGAA 1FEEA 1D09B 3C46A 4UOHA 3K8WA 4AT1B 1BC6A 4C11B 2YNFA 2KKHA 3ZTSA 1TK0A 3D0HE 3DOKB 2VASA 3MEDA 1LNQA 3W8PA 1Q78A 4RW7A 3BEGB 2XYGB 4OJ1A 2R7SA 3VWSA 2FUG9 1S9EB 2ROGA 3GV5B 2RRAA 2V4JA 1JXLA 2ZJPQ 3QO9A 4WFBQ 2Z56B 1RUSA 4DV4F 3FDSA 5E3AA 3QWUA 4ZPTR 1OY9A 2O67A 2VHGA 2ZH8A 3M8RA 2O1PA 3PYFA 3VAMA 4P10A 1EZZB 1RT3A 4L72B 2RDDA 2N4CA 2XS7A 2XM3A 1CJKA 3LPEA 1WF1A 1ZA1B 2M0GB 2NXJA 4CRJA 1T3NA 2RAQA 3OL7A 4F4ZA 4IDKB 4JB8B 3ZZYA 2BBEA 1SH0A 3FNNA 4F2SA 3Q0AA 3V2UC 2IHR1 1OSCA 3E3XA 2RRBA 3RUBL 2V69A 4YY3J 3RAXA 4WXWA 2QRRA 5C24A 1BQNB 2OI2A 2UXCJ 3CF5Q 3LAMA 1RTZA 4RWXA 4IG3B 4DR1J 2JDJA 1VS3A 1ZETA 2IVYA 1TVRB 3V4IA 4JV0A 2A3JA 1N34J 2CG8A 1FTRA 4NLWA 3UVJB 1OS5A 3OQ2A 2YNIA 1RP5A
chains in the Genus database with same CATH topology
5FDLA 4OI0A 4AFFA 1HA1A 2OSQA 3O1LA 4CO5A 1Q82T 3LOUA 2C3OA 3NBPB 2ZBCA 1YJ9S 2C3YA 2RRNA 3JTOA 3NNAA 4JI8F 3ENQA 1AFIA 2PO4A 3CC4S 1MU2A 2OPQA 4B9VA 1CC7A 4B9LA 1Z2ZA 4K4ZA 1IKWA 3HFKA 1D8ZA 2JZ5A 1RT5A 3DI6A 4DG1B 3I4PA 3L09A 1S97A 4X4VA 1R7IA 2ZOFA 1UJ6A 5AJ3F 4CQ1A 3I82A 3TAPA 4IOAQ 3VZHA 1WG4A 2IRXA 2B56A 2HPUA 2YKNB 3BSAA 1UL3A 2QLWA 5IS2A 3L7PA 3TX8A 5EWEA 4OFZA 2ZH4A 4IQXA 5BYRA 5A8KB 4ZVEA 3OJSA 1PC5A 4JI7F 4E98A 2FHJD 4RBTA 5J2NB 3KMQA 3JSYA 2VC1A 1IJFB 2NPFA 3CCLS 3S8SA 3OVAA 2J0XA 4J9OA 1H98A 2KB2A 2QZ8A 4EBCA 2MJUA 1JXEA 2IAJB 5EWFA 1L3SA 2WTFA 3CCWA 5GAEI 2GO8A 5K8NA 3BF4A 3IR5B 1G2EA 4Q44A 3H25A 5LSOA 3CCZA 3C8YA 1DBDA 4FXDA 2ASYA 4X4QA 1VQYA 4TY8B 2R7VA 1H2UX 1VQ8S 1HD1A 1L3KA 1S1XA 3PM9A 4IYQA 2D74B 4DL4A 4ZS6A 4KJIA 2GA7A 2ZHOA 4QW9A 3DRXA 2EG1A 2QA1A 2JC0A 5F0WA 4WYLA 2NSCA 2EPIA 1RJJA 3M8QA 1SI9A 2IC3B 3BGRB 5EX3A 2I0XA 3G86A 2VG7A 3C6UB 1KC8T 4EWTA 3MXHP 3MHYA 1UVLA 2AX0A 4OZ1A 1AROP 1UEVA 4DV1F 1YJRA 2CDQA 1GNKA 3PIPQ 3OR2B 2CQBA 2HAIA 4KFBA 2V0NA 4NLRA 1OIAA 2DNKA 3IGVA 1OWXA 3DLKB 2CJ9A 1B64A 1NO8A 2WSCC 4D3GA 3DRSA 2GC8A 1BLUA 1BQXA 3CEDA 2XGPA 1N6QB 4JYAF 1FNOA 3G8TA 1IBKF 3OTEA 2ZE2A 4IH7A 2ASLA 4IRKA 3TANA 1JKHB 2GCFA 1UFLA 2AGQA 2F8HA 1RDRA 1PO6A 4NRUA 1KTVA 2W4PA 4EO6A 1A7GE 2F8EX 2EFOA 4ZVFA 5KT5A 4DL6A 2K7KA 3OTBA 2MYFA 5D3GB 3HZGA 2ZH1A 3IRWP 1UKUA 1JLBB 3MMBB 4DR2F 1EETA 3KTQA 4AL5A 3MR2A 2BM1A 2Q6BA 3WZ0A 1C0UA 1QM9A 5BYSA 3PRBA 3EZ5A 2BE2A 3R5AA 5CYMB 2KXNB 3PV8A 3DN9A 5A6PA 4MK9A 4BHQA 1R89A 1VBXA 2EFNA 1UJ4A 1H3DA 4Q2MA 4WFYA 4CI0B 1U1OA 3EGNA 3SFGA 4DEZA 1JLAB 4KGKA 3M32B 4C7QA 2BM0A 1FRLA 1KHWA 3GFHA 4ECYA 3ENWA 3BDEA 3BQ0A 4QCLA 2AF6A 1ZTWA 4NL5A 5A8WB 3LQVA 3B4MA 3GFXA 2BQRA 4C97A 4KGMA 2CG4A 1DARA 4I69A 1UVJA 1S6QB 4X4UA 2AYMA 1NK7A 3I31A 5DDOC 4PG5A 1HL6A 3JSMA 1TUVA 2VPZB 4TYAA 1JX4A 2DGSA 1P6TA 2FVQA 1FJGF 4C11A 5I3UB 1WHXA 1NK5A 4CCHA 3GB0A 3I4HX 2Y1RI 3K5PA 4WFNQ 2D3UA 1S6PB 2CVIA 1Z4UA 3DOKA 3HHLC 3SSSA 3CJ2A 3B4DA 3SXLA 5KFVA 2C42A 2BANB 2ZKUA 1F5CA 2NSBA 2JVRA 3RAMA 3BN4A 3MECB 4QR0A 2BW2A 2MMYA 4CIOA 1I1GA 1EP4A 2VBYA 2FB0A 1SQEA 2AW0A 1VQMS 2YKQA 2CJAA 2CPJA 4X62F 5E5NA 4MIBA 4DLEA 4MTPA 5GAGU 3B78A 2E7XA 2VUGA 1GT8A 3BO2A 2XEXA 1KSPA 3S7RA 4I7FB 2UV8A 4AL7A 1U1PA 3DLGA 4HH0A 5KOWA 4NCAA 5HN0A 1XEZA 2UU9F 3CJ5A 4LF6F 2E9TA 3I5CA 3OW2R 2R7TA 2I38A 4NLSA 4CNYA 4O4GA 1S9EA 2IYIA 2RS8A 5DJBA 1RWUA 2QSWA 4IRDA 1MMLA 4TU9A 3PW2A 1FXRA 1F5BA 2FHJA 1RTIA 3KLFA 3CIZA 2DNLA 4NLUA 2HHPA 5GAHU 2IM3A 1IKVB 3PNIA 3HK2A 3AJ2A 1KLNA 4ILLA 4ATNA 5CXTA 2DCUB 3MM7B 3NCPA 3TAMB 3MR5A 3HM9A 2N7YA 1X0PA 3EZUA 4FXVA 5DGBA 3QMQA 4XPCA 2ZH2A 2ZH3A 4DS5A 2I9SA 4PUOB 4DX8H 2UUCF 1FRXA 3K5LA 4OLOA 2EWHA 3CE8A 2VKZG 3CC7S 1XNRF 1IN0A 2AX1A 2YWFA 4PWDA 1Q8BA 4A8KA 1YTYA 3L7OA 2HNDB 1UWBA 3HKWA 3T5LA 3NRBA 3IG1A 1ZOTA 2HFOA 4MK8A 1F60B 4F26A 1R8CA 1U45A 1WG1A 4NA3A 5KG0A 4DV3F 4RW9B 2MQPA 4K59A 1FE4A 2UVWA 4A8SA 2LMIA 2XSJB 4QIVA 1RTDB 2J8AA 5F3ZA 2LEPA 5H9FJ 1ZM4A 1MWYA 3UD3P 3CCES 1URRA 1VRTA 2GIQA 1FESA 4YQWA 2AU0A 4K4WA 4UUWA 3LUYA 4ZPBA 3HO1A 2OFGX 2PC6A 3ULHA 5LSLA 1Y4ZB 4MIAA 1Z1ZA 2COLA 4LIRA 2BR0A 1WI8A 4K4XA 1SJ4P 2Z2MA 4E0DA 1SKSA 2DVIA 4CT9A 4NXMF 5F8LA 2G0CA 1HBMA 2IBKA 1X4BA 3N5BA 4QWEA 1QJHA 4DV0F 5CHCB 2DNNA 2XI2A 4W92B 4A8YA 5KTQA 1CG2A 1P9QC 1VQ6S 2GMHA 3CMAS 3O3LA 4U67Q 1N34F 1DHMA 3NGDA 3KFWX 2BA9A 5J2MB 2CQPA 5HLFA 1Q7LB 2POKA 2W9CA 3S1TA 3M8PA 4BWJA 4DSEA 4ED5A 4ETZA 2HFNA 1S79A 3V6HA 2PT0A 3UR0A 1H38A 5DQHA 2PFFB 1HQEB 4RU2A 1VFJA 4XDDA 2VFSA 1R8BA 1JLCB 2M8HA 4XAKA 3THTA 2DR5A 4F2RA 2WB1D 3KLVA 5DM7Q 3PFEA 4RKUC 4A8QA 1BQNA 1KVIA 2BXJA 2MXYA 1TL3B 4UQGA 1QUVA 3LP0A 3FEXB 3W2VB 2RDJA 1MSWD 2M70A 2O5DA 4TNOA 3US5A 1SJQA 3HVTB 1J5EF 4DF4A 3E8OA 3RR8A 3R5BA 5M2UA 4QYRA 1RT6A 1LFWA 1S0NA 2G13A 2A2CA 5E3PA 4JI4F 3Q24A 1TVRA 3KK2B 4ED6A 4V19X 4PPZA 1QE1A 4IFYB 1HWIA 4JOUA 3OJUA 1U8SA 5F9NA 5CYQA 4IG0A 3Q2SC 2C2DA 3DRRA 3VCDA 5FLXY 4LUBA 3OSNA 3BN7A 3EX7B 5KFNA 1R3NA 5DQGA 1Y5LB 4N41A 1TK8A 1DLOB 4MIWA 4I6YA 2IA6A 2XMWA 2V9WA 2V8VA 2DNZA 2ACYA 3BSCA 3DFEA 2VFRA 3GSDA 3CCVS 5J2QB 4I2PA 1UA1A 4WXOA 1X7VA 1Y7PA 3NBPA 2AQ4A 3M6WA 2XMMA 2KG0A 2CQ3A 2DNGA 4B9NA 4BS2A 2L9DA 4KHPF 2XS2A 1IKXB 2CQ2A 4Z37A 1U6FA 2MDAA 3TQ1A 4DG1A 1KVJA 3CDWA 1M1KT 1S4FA 5JXSA 2IBOA 4CNZA 4TLQA 3CIMA 5LT5A 2OTLS 1IUJA 3GV8B 4HL9A 1Q86T 2XMTA 4DR5F 2YNGB 5G4DA 2YKNA 1FDAA 5B0DA 3TUZC 3PY8A 2UVUA 2CQ4A 2ZHBA 4WE1B 5A8KA 2HG4A 2FDNA 5KG5A 3BGLA 1N88A 3MM6B 4DSFA 1ZM2A 3RRKA 2HHSA 2WBRA 5FIIA 4O3NA 3BO4A 1H2TZ 3ZZPA 1RA7A 2J76E 4DL7A 4ZA1A 3AAWB 2CPZA 4UOCA 5K8OA 2GMJA 5H9EJ 3G8QA 3LALA 5DO2A 5KFKA 4DHVA 4PXEA 2HMIA 2LA4A 2IAJA 3IWLA 4EUVA 4FF2A 2EVZA 4XIUA 4NPOA 3L95X 3UD4P 2MQOA 1NRKA 4MJKA 1GQEA 2AWZA 2ZDOA