1WF6A

The third brca1 c-terminus (brct) domain of similar to s.pombe rad4+/cut5+ product
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
132
structure length
132
Chain Sequence
GSSGSSGSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLECFSKGYMLSEEPYIHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Similar to S.pombe -rad4+/cut5+product (A40727)
total genus 17
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1wf6A01
4Y2GA 1T15A 2XNHA 2D8MA 2COEA 4N40A 3PC8C 3K15A 3PA6A 3PC8A 1T29A 2ADOA 1JNXX 4BMDA 3K05A 3UEOA 2INGX 2K6GA 3K0KA 3K16A 3PD7A 3PXCX 3PXEA 3T7KA 2COUA 2K7FA 1T2UA 1IN1A 2XNKA 3HUEA 3T7IA 2VXCA 2COKA 3I0NA 3HUFA 2EP8A 3PXAA 4XPZA 2R1ZA 3AL3A 3L40A 4IFIA 3PC6A 2EBUA 3I0MA 4U4AA 2EBWA 3COJA 2LE0A 3EF1A 1GZHB 4BU1A 4Y18A 3AL2A 2VXBA 3K0HA 1T2VA 2DUNA 1IMOA 3SHVA 1Y98A 3SZMA 3T1NA 5ECGC 1L0BA 1N5OX 3QVGA 2AZMA 1L7BA 3L46A 4BMCA 4OFBA 4BU0A 3SHTA 3PXDA 4IGKA 1KZYC 3UENA 1WF6A 1Z56C 3OLCX 3U3ZA 2ETXA 1OQAA 2WT8A 2M2IA 3FA2A 2E2WA 3L41A 2NTEA 3QVGB 4XQ0A 3PXBA 2HTFA 4JLUA 3T7JA 1CDZA 3SQDA 4ID3A 2L42A 3EF0A 2JW5A 3PC7A 3KTFA 3JVEA 3II6X
chains in the Genus database with same CATH superfamily
4M1YA 4A9AA 1EVKA 1PTJA 3R0XA 1GFIA 4NF2A 4Z4EA 4RJKA 3TQQA 2JFFA 1ADFA 4M8SA 2PUGA 3LVRE 5AT1A 3HYSA 4F9EA 3KEFA 1AQJA 4G1MB 1QRAA 4X0EA 1M8KA 3C4VA 3NGMA 4PC1A 1PLJA 1ZNWA 4EH1A 3DO6A 4XWOA 2V6FA 2OENG 4TL6A 2H1OA 5G4LA 5AVYA 4CG1A 1RAHA 4OGKA 1R8XA 3N7UA 621PA 5E1OA 4UASA 2ZULA 4A7PA 5HKOA 3DZBA 3U48A 2HJGA 1YL5A 4LI3X 4D0SA 5M5BA 3CQ9A 3WAGA 3I45A 1IZ8A 1QPGA 4G9BA 2V7XA 3A1NA 3KT6A 4Y8VA 4RHUA 1QWSA 3ZNOA 1KEUA 2HOQA 5CP8A 1I6LA 3WWOA 3EXIA 4MLPA 1M0SA 2SKEA 1QHHB 1JI3A 2OZLA 1MTZA 2P75A 3MRTA 4UHBA 3VOAA 4C0JA 2CLFB 1V1JA 2YQ5A 2QR3A 3LFHA 1X86B 4TYQA 1GWNA 4QVKA 3ZH9B 1JA9A 3UOAB 1WXIA 3H4TA 3ZDBA 1L1RA 1EEHA 3I5MA 3N2LA 4YBRA 5ELXA 4AZ3A 3NHSA 4URVR 2JA2A 5KOHA 4N7RA 3HXOA 1JECA 2FEOA 4ZDIA 2V3CC 4YREA 1SKQA 1JEOA 1AO3A 1RQ2A 4JLBA 3R24A 1IWOA 3EC2A 3LPAA 3NAMA 4LYJA 4M1KA 4S2EA 1WETA 1U3UA 1KGDA 1CK4A 3B6ZA 3HBNA 2VTDA 3M1AA 4M9RA 3UGTA 1U8CB 3V7YA 3VYUB 2VNJA 3SYKA 4G2NA 3ZGYA 3JZMA 4GLJA 5KYWB 2HA0A 5ALOA 4CGYA 5JADA 3BKWA 5ALZA 4DXAA 4JA2A 2ZJAA 5J1TB 3O0DA 1C50A 4UU0A 3FXAA 3L6CA 2QLMA 1E18A 4TX1A 1SVLA 3MTQA 1YHZA 4AI6A 3N86A 5BR1A 4A4DA 2OAP1 3VNVA 3C6MA 3FHTA 3ZGOA 4IDCA 1PSWA 3VSBA 1QFYA 5K5EA 5KEIA 4C2BA 1P8AA 4PZ9A 4HC4A 4QGHA 3SR3A 4GOLD 2J0VA 3S2SA 3UATA 3BEDA 4GXQA 4EO9A 4JR2A 4LGYA 1KE1A 3KQLA 1QZXA 4P34A 1CQIB 1F6BA 4PAGA 1TQHA 2Q5EA 4IGIA 4LMRA 5DMHA 3BHJA 3NJ8A 2X1HA 2HIAA 1B0PA 3TJRA 2H2GA 1IVNA 1IEXA 1P19A 2IHVA 4FC7A 2CFRA 3KHKA 3V8PA 1WMDA 3RRYA 1ZI8A 2I2DA 2ONYA 4ARSA 2QUKA 2XQJA 8GPBA 4MS3A 3PHBE 4RE6A 4PZEA 2REBA 2X40A 2WG0A 4HRAA 4ZARA 2R1VB 3H97A 4C4AA 1BQ4A 1TTQB 4HVAA 3JVIA 2O05A 1HDYA 1MQAA 3CKYA 3HBFA 1DOAA 3PBKA 4Q4JB 3EEIA 4FKZA 4C4PA 4UW9A 2QM8A 3HXPA 3RG8A 1Z7WA 4UU7A 3PRKE 4PANA 3DVRX 3A70A 3HKBB 1C2TA 2R6AA 2R7NA 1AZLA 5FPHA 1RKBA 2DWUA 3GFOA 3HO6A 2E7ZA 4QUAA 3C3CA 2RIRA 4M1ZA 5BUZA 2ENUA 5AI6A 1D2RA 2DPHA 2AVNA 2TMKA 1NBHA 3AKCA 1NR5A 3R0ZA 3LNTA 3ZXSA 4PC7A 1IZ9A 4B6PA 2EQ5A 4G5YA 3VTFA 2O8CB 4GOKA 2MU1A 1JEJA 3N2GA 5ARDA 2XXBA 3QI2A 5FWDA 2Q6VA 2EIHA 1UIRA 4UJ5A 5H16A 3SYMA 1NQTA 3HVUA 5JWRA 3C5VA 1JR3D 2W98A 1E3DA 3NHKA 1ZZGA 4ISCA 4WECA 4CEHA 5DIFA 2R5NA 4JI2B 3T9AA 2FWAA 4DBLE 2PUDA 4CLOA 5CVEA 4KXXA 4POOA 3KELA 1LX7A 3NCHA 1R10A 3EIQA 2TMYA 1W87A 2K2WA 4OHUA 4BFZA 5L3VA 1W36B 2AR7A 4KO1S 4C6HA 3ONVA 2C42A 4LXQA 3WNVA 4A92A 1Z06A 5K0NA 4S3MA 4NDZA 4PG7A 3JWPA 5CGQB 3SR0A 3NKVA 2XUKA 1ONNA 1CS0B 4S1VA 1XFAA 4RPCA 4AICA 4IWXA 3TBHA 3L05A 4EYSA 5C8ZA 3WMRA 3IUNA 4ZAVA 5SZHB 2NXJA 3OIDA 5E38A 5CA0B 3HNRA 1KQ3A 2F17A 4EG6A 4JB3A 3H05A 3NG1A 3JQBA 3OQ6A 1HL7A 3LQQA 4P83A 1NQ5A 1DG9A 2FUKA 1XN1A 3GJTA 4JJ4A 1G21E 4EFMA 5JXGA 1SRQA 2BSAA 3N8NA 5HE8A 2OXTA 3PCRB 4PNPA 1CNMA 5ERGB 2GN9A 3UMVA 3UTCA 4I6EA 3RVJA 3GLFA 3RFXA 1OD6A 4YCNA 5EJ2A 2I65A 4GOXA 1WVIA 3AF4A 2AG5A 4MO9A 2BUBA 2JRLA 1BX1A 1SXJE 1XYYA 3IURA 5LZ8A 3ODPA 1DJMA 1WKBA 1NT2A 1O8CA 5FL7A 3B1YA 5CG2A 3L1UA 3B5JA 1JAIA 4D74A 1T5BA 2GVDC 1E7MA 3NM5A 1XQWA 3PQ7A 1JDSA 4TXNA 1P2TA 3CUTA 3WKCA 4NCKA 2Z3ZA 2NSJA 2FW8A 4QTZA 4OM8A 4N5IX 4ZWNA 1GT91 3ZHOA 5CFMA 4UMEA 2LD4A 5LYJB 2E0IA 4A8JA 3F3SA 3JAWB 1SVIA 3EGWA 4IGKA 5G4KB 2Q1UA 3HFJA 1E94E 1EGHA 3A7DA 1BZYA 2JATA 3DTVA 3KD2A 5GQSA 3ULKA 2V6MA 4BDTA 5JAMA 2ZJ6A 1E8NA 2PSHA 2PX8A 2IS4A 2VEOA 1JI0A 4HN4B 2ZSIA 3AR7A 2IH2A 2IGTA 3ED1A 2QM3A 3U37A 2HQ1A 2M1XA 4X8LA 1ZA2A 4MV5A 1OPXA 4EYKA 1MQSA 3OJLA 2ZREA 2BRUA 3O8OA 2FOIA 2HJ9A 3C3BA 1C0LA 1U3WA 2GCIA 5CX1B 5IF9A 4J49A 2HF7A 1X1SA 1BXKA 1L2TA 1SQ0A 2GRAA 3DF9A 1M7BA 3P2IA 3M8KA 3RRMA 1N1MA 5EWMB 1GRRA 1V41E 4L8VA 4MCIA 5B6IA 3IKTA 1Y9DA 1RPTA 2H1WA 3CX3A 3B1WA 2H51A 1NATA 1X2BA 1F2UA 1IZZA 2FWPA 4D96A 1P9OA 1CDZA 2DKFA 2PXXA 3DBVO 3MELA 3RFUA 2E18A 5J1SB 1Z0SA 2NZWA 1K2WA 1MAUA 1VSQA 3RG2A 4YLYA 4QXQA 5AIBA 9ATCA 1TCBA 1L3IA 3JQFC 3LM8A 2PSFA 1R4NB 3OCYA 4OUKX 4ON9A 2AGVA 3ESDA 4GBMA 3V7FA 4A16A 3B1XA 4NXNB 3R3HA 1M34A 3WYGA 2V9CA 1PHRA 5E7JA 1XLVA 3QEMB 4U7HA 2IHJA 1R9GA 5LYYA 4AD8A 1O2DA 1O94A 3UAWA 3K9QO 2DHEA 5JNRA 5IYZA 1LBHA 1ILEA 5DYGA 3UFXA 4TZTA 3KO8A 2IPLA 2ODAA 1MAWA 4IUDS 1GUDA 1KYZA 1E3TA 2CLIB 3KCQA 3MSCA 2BR5A 4RY8A 2I6FA 1P3JA 5IRCD 1SBCA 3C14C 1L3CA 1DG3A 3I6QA 1YUBA 4FOSA 4BMDA 1JSLA 4AK9A 1JALA 1XJWA 5FJJA 4J2TA 1XHLA 2NQ2C 2GFQA 4A27A 3NVMB 2O8DB 2ZZMA 5FUXA 2WIJA 3OE7A 4QNRA 3M6WA 1KEEA 1XALA 2P9BA 5AW9A 1EUQA 1NFRA 4N48A 1CB7A 2UZAA 2DFKB 5AH0A 2J07A 1XMSA 5ALDA 1WULS 2IEGA 1P2BA 5ED4A 1HYGA 4HZGA 3VM6A 2ABWA 1FYEA 2B4TO 1JKJB 2WM9B 3F8TA 3K2IA 1LF5A 1DX9A 4G89A 4H15A 5FFFA 4BNMA 1CUVA 3BYZA 3CNBA 3WQSB 3H8SA 3T0GA 2BPOA 4IHJB 4RMJA 2Q4TA 1A76A 2DOKA 4KKXB 4E6EA 2FNAA 3D2LA 3C3MA 4LXGA 4JI8B 4OHWA 3DMPA 2O2YA 3VU0A 1GOTA 1I4OA 2X5NA 1RE1A 1CWUA 1ECLA 1X1TA 2HC9A 2L69A 5T4BA 5C53B 4AQ7A 2WHYA 3QEAZ 1SVNA 3CNHA 4M55A 2BMWA 4RWEA 3O8CA 2XKKA 3ENQA 3WIBA 4HXFB 4BNNA 3VYWA 3UAGA 3QPAA 2AYZA 2CDBA 4LY3A 4WFQA 1KI7A 3AV3A 1X8XA 3HL4A 2W2OA 4NX2A 1MC8A 4MPDA 4PGAA 1PS0A 3LHIA 5AVQA 4K2AA 1Y8RB 2VKTA 1TO2E 1L9XA 4K6GA 3DCYA 1NKSA 3C4JA 1XEWY 1FBTA 1BWQA 5FI3A 1TO6A 1VHWA 5BSHA 3OETA 3O93A 1IPFA 5TPWB 1E20A 2YZ7A 1VE6A 1UJCA 2B3DA 2NU6A 5H82A 4QKQA 1Z56C 2VYVA 4DQVA 2LKDA 4JI6B 4C4OA 1KPIA 2C2OA 3EVFA 5GM2A 4CM7A 3RARA 3OCJA 3NPMA 5BW8A 1WV0A 3FHJA 1ACMA 4X6LA 1ZH0A 4DA8A 4WT7A 4B2IA 1KDOA 2GEJA 2UDPA 2O1WA 3FRJA 3JW8A 3L7IA 4S1NA 4EYOA 2C2YA 4XRRA 3VR2D 3R9XB 3O8RA 5LA6F 5AIAA 4RIEA 1QYWA 1TCUA 2O8EA 4F6CA 1JLSA 4KO8A 2XLBA 4BNHA 2QM7A 3E82A 4OSPA 3U1TA 1EX9A 5F1YA 1P4SA 5TGTA 4ZJPA 1OA0A 5AVRA 2V0GA 4FFPA 4LYEA 5JD6A 3L93A 1XEWX 1H4VB 3ZLVA 5AW2A 1EHYA 3BM5A 2GN0A 1BCSA 2XWBF 3SXPA 3ZUGA 2Q28A 5LD2C 2FETA 2AK3A 4XX0B 1PI3A 4G0NA 3L04A 5EHIA 5KWIA 2PL9A 1DJPA 4RPLA 4UUMA 4HEQA 5DK6A 2OORA 4L5AA 4OQPA 4RCVA 4H6VA 4QRHA 5CW2A 4D6YA 3RSFA 5B55A 2ZAMA 1USUA 4ZVRA 1FSGA 5DWVA 2DC1A 4L6AA 5HPYB 2ZRDA 2XE7A 5HF8A 5B4VA 1PR2A 4CUZA 1NPTO 5M34A 3OFKA 3IP8A 3GNQA 3ZOZA 3H3XA 3N76A 2O7VA 4JMPA 3T99A 4JC4A 3NHLA 1YACA 1XQVA 1Z4PX 3UYLA 1GTJ1 1A8QA 3DKKA 1P75A 1UC9A 4B71A 2QT9A 1O0BA 3F74A 1BOFA 4N39A 4UFNA 3O1IC 4QTUB 2YMMA 3DMHA 4MGIR 4Y0AA 5DBEX 5J40A 1V26A 2K6GA 1Y8QB 3K72B 1J4AA 2DERA 1XLTA 1PFGA 3RAEC 1GL6A 1AUVA 3B53X 3R5TA 3OQMA 4ENQA 3ML1A 4MI9A 1S2GA 3KR9A 4HH3C 1L5KA 3AM3A 2XNKA 1N3BA 4FZ3A 3EQ8A 3KKLA 4K28A 3RRBA 4D0NA 4GE3A 1W36D 4MUNA 1J8QA 1EXMA 2WIBA 1M6WA 2A6PA 4TYWA 2PUJA 2G9QA 3NBYC 4B3FX 4Z0NA 5IJXA 5GZ3A 2J8ZA 4ER5A 3A14A 5HKAA 2AKEA 1GPJA 4EF4A 4KG7A 3IGFA 4L76A 1P73A 2OVFA 2QAGA 3OZEA 5ETJA 4YAUA 1DBVO 4OSEA 1PDVA 1CQJB 1YB1A 4BPBA 1R0RE 4BTLA 1E9AA 2CHEA 3M3PA 2A0FA 3MC1A 2VC2B 4NSNA 5U4QA 3RS7A 4W99A 4BGVA 1I94B 1ZRSA 4DJ5X 3BFXA 1YKGA 3AR6A 3K6KA 5F1KA 4CKCA 2AT1A 2PUHA 2QXYA 1LWOA 1BEEA 2RBKA 4FI3F 1P1HA 5LBTA 4BWFB 5B4TA 1Y5NA 3NDJA 3OUZA 3PNQA 2Q3JA 4ARZB 1JG4A 2WIFA 4M54A 2PNFA 4JI0B 3KP1A 3ZQUA 5G02A 5JMPA 3L6DA 4BO7A 3N2KB 5IC4A 3ZJ5A 1E5XA 1FFAA 4NI5A 1LCIA 5TQ2A 2FLVA 5AHRA 1OWNA 1X8KA 1YHNA 4DLZA 4G1EB 1T8SA 2QMQA 4DREA 3P9PA 4CIBA 3CZ4A 2O2JA 4FX2A 4CKBA 3GH1A 2YHBA 2LGJA 4DG5A 1PBNA 1Y6JA 2VHVA 3OZFA 5SYNA 4EYGA 4Z0PA 4OJYA 3WLPA 1RRCA 1FOEB 1J5EB 5JH7B 4EKGA 5AJTA 2JH3A 1WTCA 4RX1A 2B98A 1LTKA 1L1QA 4D9MA 2GD1O 2CY0A 2VDOB 3FMOB 4CMEC 2QIPA 3VSCA 1WVMA 2FCAA 3EZGA 2WM2A 3FLAA 4KLNA 3O90A 4PLCA 4ZA2A 3ESCA 1FIUA 4MVJE 3OOEA 3F7NA 1CUCA 2G83A 4JFAA 4TYMA 3IIEA 2QHXA 3IC5A 4NYIR 4F4JA 2IYAA 4RZQA 3H17A 1V37A 3WIEA 4NXMB 2HWYA 2Z57A 4RK7A 2XVMA 2HHCA 4ZI3A 2PG3A 4G1CA 4B4DA 4QLOA 3B3QA 3EDOA 1W4RA 3C7DB 5HIKA 4U2DA 1ZNXA 2W2QA 2BFEB 1QOPB 4FDUA 2YYZA 4HO1X 4YJHA 3WLTA 1AS3A 2W4IA 1U8XX 2AWNA 5CLJA 2Y1FA 3HN2A 1V8DA 2JJQA 4QA9A 1NX9A 3O03A 3TWOA 4QBTA 4CLHA 3MXOA 4TMXA 3AHEA 4NEQA 1LLCA 1YZ3A 2FPSA 3OPMA 1YJXA 4FS8A 4EJ6A 4HF7A 5B64A 4KE8A 2QD2A 5AI9A 4GZLA 2YJNA 4MP8A 1NY6A 2PO7A 3S1AB 2QLNA 5IDWA 2ZWAA 2FEPA 1T6BY 1RYBA 3IBSA 2OFFA 2W6CX 1GA1A 4M8IA 1W47A 4B85A 1X77A 3ABZA 1IE3A 2WJ6A 3EXFA 1W4CA 4A5OA 3E9CA 1QFZA 3F4LA 4DCOA 1KMMA 5DM70 4OHPA 3JRNA 5SY4A 2P4QA 2PLNA 3T7KA 5LQJA 2HQBA 2QRMA 3AHFA 3ESZA 5KX5B 1Z38A 4RTRA 1DXOA 4BZZA 4WY2A 5IT4A 4P92A 3QF4B 3GDFA 4B7CA 4CCWA 3OLXA 4GP7A 1UP7A 3CTPA 4N5MA 4X9XA 4LJAA 1V1RA 1CUFA 2J7PD 2HHJA 5H9VA 4ENRA 1ID1A 2F1IA 2W90A 4LE2A 1BD3A 3SWWA 4ZT2A 2FZ5A 3TW8A 1NW8A 2HW8A 3EIFA 1AV7A 1WUJS 3GL9A 1B8VA 4G25A 1MX3A 1IQUA 1W6UA 4Y0NA 2OO3A 2NMVA 4IXMA 2H31A 1WE2A 1L7EA 3O1HB 4JQYA 4EW6A 2D1FA 2ECPA 2JHGA 4LHVA 4TPKA 2O8BB 2PWAA 4FKBA 5D3MB 2W2KA 4D8UA 4AKEA 5L3RA 1JQBA 1Q7TA 2NZXA 4GX1A 3DR5A 3HN7A 3R09A 3TTWA 3WK8A 1XKTA 4JR0A 4XB1A 1SUAA 4G8CA 5IP5A 4DSZA 1DUSA 1E2EA 2GPJA 4GWLA 3UB2A 4MJ7A 4ZO7A 3ZVKA 5CYPA 1VIYA 1WBDA 3GN2A 1NI4B 2KWIA 3EOZA 2PUBA 1G7RA 5EWJB 2YBEA 3GLIA 2XOEA 2YR0A 1WDKA 1M34E 2BKUA 5CCBA 2DT5A 3CLKA 3BD8A 2VPQA 3P71T 1P31A 2EZ4A 2XBLA 4P4TA 1Y8RA 3NOQA 4LX0A 4F21A 1QYCA 1Y3HA 2RI0A 1A95A 2ZYSA 1H9BA 4GPIB 3RK1A 1S4QA 1TEHA 4HP8A 2JIPA 4EYQA 3D4OA 2FPLA 2YXLA 3BMQB 3Q87B 4PHHA 3LC1O 4PS1A 4ZT5A 3W0LB 5BUQA 5KPJA 3OJ0A 4C0HA 1LSUA 4NICA 3RREA 3VNUA 1TZKA 2Y1LA 3HBLA 2X2FA 4ZI5A 4AX4A 4BVEA 5C1BA 4DV5B 1EDEA 4UTZA 2XKAA 1JHOA 1ZGAA 3BHIA 4IL5A 4NBUA 1R6VA 5CDFE 2UXCB 1G8PA 4O4JA 4RY0A 3VYSB 5DRYA 3GFQA 1OH5A 1Q7RA 2WYIA 5DMXA 1F6WA 3QBJA 3SCZA 2GMWA 2AEJA 2VQ3A 1N2XA 2VDVE 3MHPA 3ZV7A 2OV3A 4PPYA 3FBTA 1YE3A 2AEFA 2P68A 2XD9A 3BTOA 3PFWO 1BSVA 3QPUA 3RM3A 4YWJA 2DQYA 5BQ5A 5AOCA 2IUFA 4F96A 4JLAA 3F7OA 2FJ0A 2X14A 1T4DA 2WYOA 2BR3A 5D8DA 2H8KA 1XG5A 4CCYA 1R0XA 1FU4A 2AQIA 3A11A 3PE4A 4MJXA 2BUCA 2B69A 4UXHA 2CJYA 3K2BA 3NRBA 4RLSA 2AD1A 4JLJA 5FTMA 1ZK1A 1ZXXA 2AJDA 3KEGA 4UTVA 5JWOA 1KKUA 2Q0XA 3FBGA 3FVTA 4N40A 4IIHA 5G53C 1CY2A 5F9HA 4FLEA 4NBLA 1K8XB 2W2XA 3CEPB 3GWGA 4MVJA 4P36A 2XR1A 5REQB 4PAQA 3K15A 5AJWA 2BFNA 3ZQJA 4ECEA 1KGSA 1I7LA 2F1JA 4H3KB 1F0KA 3NTUA 4DCGA 1OOEA 4CKXA 3K4QA 1MX1A 3K9GA 1M1UA 3TOSA 3W2GA 3E15A 3TG8A 1PW5A 3L4BA 5G41A 4B17A 4AAYA 1KEZA 3G7UA 3SFZA 2F3UA 1G98A 1YJ8A 5CDSA 5EMMA 5JRDS 1SFRA 5KBYA 3C3DA 4X63A 5AJVB 4NS4A 2DPXA 3TLJA 1I1NA 4BLQA 1C7FA 1R6BX 3BWMA 3EIEA 3PXEA 3I0ZA 5DSZA 2YN0A 1R8YA 2XZLA 4IIDA 2B7BA 2AIRA 5C5IA 5ALXA 4DILA 4L4ZA 3WNBA 4QUJA 3VOTA 4GKVA 2ZIXA 2BGWA 4FGZA 3SIWA 1A7JA 1PJLA 2WYWA 4FTWA 5EXSA 2ZQ5A 4TXMA 5BURA 4S24A 2HRRA 5AXBA 4Z4HA 1M7HA 3SEQA 4EFKA 4F1JA 2FQYA 3A4VA 1GNTA 4HJXA 1EUDA 4M0DA 3GR6A 4O25A 1GTSA 4EQ6A 3BGSA 4NONA 1F1JA 4L5IA 1VYTA 2QTAA 4DR3B 1TC1A 2GBGA 4BUZA 3OI7A 1Y1RA 3M9XA 4S12A 1GPWB 2WFLA 4G8JA 4OB7A 2H07A 5FL3A 2CZCA 4N6NA 1OKKD 2Q4OA 4FFNA 1OZAA 1KAMA 1SOWA 2OHGA 2VHTA 1U81A 4KE9A 3SHQA 1DCFA 5IVIA 1E5TA 2X9VA 5ALFA 5L3SB 3KPVA 1K08A 2RKBA 4KLAA 2E1RA 4CI0B 5GOTA 3RANA 4U39A 5GGYA 1R0SA 4P5DA 1RM3A 3KR0A 1C9NA 4UD6A 4YMGA 5CYGA 3RBXA 2RDMA 3OE1A 4RHCA 1HNXB 3ND8A 2PEYA 4B4VA 1RQXA 2EDCA 1KE2A 2J4CA 1IIRA 2BGJA 1LK0A 2VI5A 1OI4A 2Z6UA 4MYSA 4KDFA 3HO1A 3HCDA 5KHLB 3TLGA 2UXDB 4V0MA 2X7XA 2GGSA 3CO0S 1UJ2A 3CRMA 4O3FA 1L7RA 3JR7A 2JLZA 3PHIA 1L5MA 1XXHB 4D56A 2ZJZA 1B8UA 4CT4B 4IDBA 4LPKA 1QQ5A 2F4NA 4HEJA 3RD5A 5B57C 5EKDA 1G16A 1Z4QA 3A4YA 4EFLA 4KUEA 4OP2A 721PA 2GD2A 2FMIA 2IKSA 4EVQA 5KAPA 2GYWA 3E7XA 5IN4A 1TW3A 4RK0A 3REOA 2HBQA 4CNQA 4DUZB 4Q3DA 1D2NA 1FS4A 1U7WA 1D1SA 3GPBA 4QFDA 5B1EA 2EOAA 2JLBA 1UPXA 3NBUA 4KZKA 1T2DA 3FZYA 1KSFX 4JHLA 3S40A 2RAPA 3SJAA 1JZQA 3IB3A 3OX2A 1W59A 1KVTA 1YBMA 4PW0A 3UV3A 5ESRA 1E59A 1OB5A 1NIPA 4MVJG 3A2KA 2EEPA 2QTVA 1EYZA 2FSVC 3LCVB 1K6XA 1RAEA 1U2DA 2PV0A 3HUDA 1CRPA 3OAAD 4MV9A 3L6EA 4AN0A 1EVIA 1H0HA 1R9MA 1TCAA 1I80A 2CKMA 2PH7A 3QXJA 5KB3A 1G5PA 2XUOA 3TQRA 4ID3A 3AERA 4DWWA 1RMYA 1GTRA 1EJBA 2AOXA 4MUBA 4URHA 3H42B 4ENUA 1J25A 3PFBA 4LK2A 2IHNA 1X8JA 4CDGA 3CRW1 5CNJA 2EJTA 4EITA 1C8VB 3FAKA 3KHTA 1R7RA 4YRGA 1I2DA 1M7GA 4BO1A 4YROA 1E6KA 5LZ2A 3OZGA 4W5WA 1EE2A 2H17A 3NALA 3QGMA 1ESZA 5E6RA 4MIEA 1MRSA 3OHMA 3ZS9A 1HKUA 1PFVA 1KJJA 2IHTA 2KS6A 2OD7A 4INJA 3TSCA 4QUGA 1FS6A 3OY2A 3EH2A 1KOJA 1ZPDA 3IT3A 3ZDRA 5BN3A 3CA8A 1O9BA 4FCCA 4P35A 1I3MA 2JGKA 2ZWMA 3U9SA 1BVUA 4UM7A 2IP2A 1KP3A 2IYFA 5JCZA 3H8JA 3WL8A 3M1YA 4KMOA 2XUIA 5IZCC 4D9JA 3UV7A 5GIPE 4D9NA 4JT8A 5KSZA 1JIKA 4FXOA 5LWHA 2NU7A 2Q2VA 1X7GA 3RIEA 1IEVA 1NP7A 1A71A 2CJXA 3TD9A 2AX4A 3TZEA 2XB4A 2QPTA 1YIDA 2I5PO 4V2UA 1YZYA 2DUUA 2WJHA 4XPZA 1C7EA 4WNAB 4WGGA 3T3HA 1DKRA 1FFHA 3INNA 4CM1A 4DTIA 3RADC 2XE8A 1CS0A 3U7EB 3OTGA 3VZRA 1H5NA 5HP4A 1ZH2A 2RK3A 1TMGE 4JGIA 2CB9A 4NMHA 1HNWB 1KK0A 3THRA 4LECA 2EF1A 1QE5A 2V1UA 3KLPX 3FCAA 4XQCA 1EVZA 3IRUA 4YV0A 4F4DA 1BQEA 1FY2A 3LS2A 1I01A 1ZGZA 3CN9A 1H2XA 1ZLYA 2QXUA 3BJRA 2AOTB 3LUJA 5EZYB 3EC7A 3GG2A 4B4UA 4PIVA 4WACA 2AX3A 3QKSB 5DXFA 4BNDA 4FWTA 3WRXC 1MOQA 3L06A 2XCQA 2PXHA 1KMHA 1LK7A 4M4SA 1JQDA 2PWZA 3E05A 1BO6A 2P7IA 2WKPA 5C9ZA 2NIPA 3DBRB 3VUFA 4BB0A 3OQBA 4GE0A 5AVZA 3EH1A 1C7ZA 4I50A 4KMRA 2VPPA 1QYDA 4HG2A 1SC9A 2HDNB 2JASA 3IB6A 3D6AA 1X0VA 3MCUA 3UO8B 5TC4A 5A5VA 2PANA 3WB0A 3KE9A 5CA0A 4L57A 2QNIA 2GVZC 2C2GA 2Y92A 3RWOA 1CUHA 2BY4A 2XA9A 4MMYB 5KTNA 1F38A 4TYPA 3DLIA 4V0LA 3F96A 2IODA 2WVJA 4QYWA 1V1MA 3EHEA 3UXEA 4YRAA 2R8EA 2XTMA 4R2MA 4F86A 1AQYA 1AUXA 1QTIA 2GPNA 2XVZA 3EC1A 4EG5A 2XCTB 4R1QA 2JBHA 3AOEC 3MIIA 4HXEB 4AJLA 3NX4A 3UT6A 1K6IA 1MGOA 2QQ0A 2QRNA 3RBVA 1NNUA 3G0BA 4AZTA 1F8YA 4R0MA 1VKNA 3LY5A 3RLIA 3V3KA 3QVGB 4ZI2A 4H7PA 1XMVA 4LF5B 1CIJA 1GXSB 2NUTB 4Q03A 4F5WA 2B7LA 2F8TA 3W4KA 3FWHA 2BI8A 4IR7A 3RWMB 4BNIA 3DV0A 1V3TA 5JMOA 5LQCA 2HI0A 2ODQA 1E3JA 1TUEA 3F1KA 3JASB 3C39A 2XADA 5DX1A 2IOHA 4GI5A 1EM8A 3NXSA 4UCXA 2QLJA 4GLOA 1RM5A 1E58A 3P9RA 2YY7A 4FE7A 2GJKA 1Z75A 3SLKA 5LPNA 4Z99A 1T5IA 3K5WA 2KMLA 2B9VA 2Z04A 4L4YA 3L4JA 2ZANA 2F9FA 2FMKA 4EFDA 4YRSA 1A8PA 2G17A 1CY7A 4IINA 4KXMA 3KUKA 3MB8A 2CVFA 4IJ6A 4FYHA 3PD0A 1HTWA 1X7YB 1ORHA 3RFTA 2A0WA 2PHZA 2W83A 4ML3A 1KYXA 1E5DA 2K4MA 3Q0EA 2VA8A 3VC7A 3LUDA 5K3AA 1B6TA 2AE1A 2VYNA 2RBEA 4JBXA 2H4WA 1YUMA 4O1IA 1SBTA 1XK7A 3PI6A 1O94C 4RF2A 3M33A 3HVIA 2XSZA 3L7BA 4M1QA 5DZSA 5E4JA 1OBVA 3OESA 4UMDA 1M72A 2JIZA 2XT6A 3WR5A 5KNBD 1GRQA 3OF3A 5COQA 2VPZA 1ESCA 3MINB 4Q9NA 2GZMA 1CFZA 2ZYGA 2HEIA 5EWLB 4OHYA 1UXIA 3UC9A 1WV1A 3TTSA 2P11A 2RHCA 5AJYA 5IXYA 2ATEA 1Z26A 1YZLA 2P5YA 3GY0A 5AMXA 5I6DA 3QKIA 2YV3A 5CDYA 1HTBA 1QFMA 2A94A 1JF8A 4AZ0B 9ABPA 4NBKA 2Z2JA 2QE6A 4AG3A 4D82A 2XB9A 3OFNA 4AN4A 1F3LA 2ID8A 4ZI7B 5DOVA 3U4CA 2QT0A 2ZJ2A 1P1FA 2QRZA 1LNZA 2A14A 4NYJR 1YF3A 4B6OA 1JR3A 3E4DA 4MXDA 1U0SY 2V4ZA 1ZNZA 2Z95A 2QG6A 2UZ1B 4FT4A 3DYBA 4ZQIA 4JMLA 3WLMA 1W5FA 2Z5GA 1NURA 3QX8A 1LF0A 3P96A 4N0DA 3K2EA 4ALNA 2O07A 1GNPA 3KZVA 3LUKA 3Q2OA 3R5SA 4YP0A 3QV1A 4ZZ3A 1RKUA 1D4OA 1ZESA 4D8XA 5LQRA 2DQSA 1OR8A 3K6RA 1IG0A 5AUQA 2BGMA 4G0OA 4NYMR 4X71A 4NP6A 3TIFA 1GFWA 4ETWA 4R40A 2QZ9A 5EUCA 3S2GA 4Q1BA 4RQUA 4Z4GA 1M2HA 3DLAA 4IRMA 3HM9A 1E5VA 3VAZA 3RUAA 4DTCA 4JNCA 2NUPB 4K9PA 5DBHX 3UCFA 5B12A 3LCUA 4LRUA 1XK6A 5SY6A 2G7ZA 3GLFB 3R7WA 1L8XA 3RW9A 3F46A 2IP4A 3Q6MA 2QU8A 3SI7A 4C0QC 5LLSA 1BKSB 2B36A 4BQOA 1A50B 1Z4OA 2AXNA 3M6AA 5TPWA 4P0QB 1SKYE 3GARA 1L4UA 3RTBA 1PWXA 1GSIA 4ND7A 1NDUA 4NJMA 2YJ3A 4XJSA 2B2NA 2PNJA 2RSLA 4CMBA 2X4DA 4ETMA 5JC1A 2H3EA 2RH5A 5LQNA 4HGRA 1L4HA 3EY9A 3OTOB 3OCUA 3S1LA 1DTSA 1CYEA 1T1EA 3Q5DA 3OEEA 2F1KA 4HFMA 3SQXA 1CY1A 1U28A 4HGOA 4DLRA 2QQ5A 4W8HA 2ANBA 4L78A 3EDYA 3OIVA 2GZ3A 5KKAA 4GZ3A 5DLEA 4DPMA 3GDHA 3PVSA 1OFIA 4AL4A 5AESA 2PCJA 1PV2A 4RK1A 2QP4A 1E1DA 4DF3A 5AWFC 4UDYX 3GRVA 2FKNA 2YW2A 4FC6A 1O57A 4HD8A 1FP4B 1BDJA 2NOAA 3JATB 2XZDA 4MWGA 4NE9A 3O8OB 3RSSA 3UB4A 1K89A 3G8YA 4H16A 4LCBA 4GSYA 2ZJ3A 3F6PA 2C4KA 4I1OA 3ZZMA 3ZEAA 3I23A 5T41A 2ZAIA 3VTKA 2SECE 2R8PA 2BIFA 4BFTA 4CEHB 1IM5A 1G55A 2XDWA 3EOBI 5EPUA 4ZVOA 3TD6A 1O97C 1U28C 5KYNA 4N3NA 5TV2A 5K20A 3EYWA 3L18A 2Q9BA 4H0NA 4JI1B 2R0QC 3OTHA 4QJ3A 3D31A 3B1VA 1YS2X 4QX6A 3ZIUA 4CM3A 4BLOA 1UAGA 5LFAA 3WWZA 4TVSA 1IXRC 2EIXA 1N7GA 2XDQB 2I4RA 2OCPA 4N4AA 5HRCA 1RYNA 1I1OA 4P82A 3E0XA 1Z8NA 4TLMB 3D2AA 5AUOB 1X0XA 5E1BA 4P3NA 4JS0A 3KBOA 4R9RA 1UFVA 2P1DA 3H4MA 4HXGA 3AFNA 4EW1A 2R8ZA 2JLUA 4LF4B 2O5VA 5IG2A 4U7PB 3SQLA 4YHHB 1UJNA 3PNYA 1RJFA 3HA3A 4DUGA 2DFTA 3IR5A 4F8EA 1DQPA 2P9JA 4RADA 2I6GA 3AR8A 4GRDA 2R85A 1FDVA 3PKIA 1SCDA 2UVPB 4GW3A 3AJDA 1NJSA 1H6AA 4H6PA 3ADKA 3FVVA 2YFHA 5HKKA 3P94A 3MXTA 1NMZA 3N8DA 2OZPA 3HBMA 4MV0A 4X91A 2MSEB 3KXDA 1FRNA 2CLMB 4RCYA 3OSUA 5JJCA 4YVFA 1IMOA 1EFPB 2RKOA 1TVKB 4OLFA 3CBGA 1Z7EA 3DV9A 3OZWA 1ZU5A 1GZ7A 1TVMA 5E2BA 1ITZA 1QH8B 3DL4A 4DLUA 4XUEA 1ZYUA 4ZEVA 5A3VA 5HZGA 2A9PA 4TWAA 1E89A 2FN9A 3C87A 1DKNA 1HDIA 2P9EA 1X1CA 3LA8A 5CLQA 2CXSA 2WDZA 2OFOA 4NKRA 4AURA 2AI2A 5F2KA 3UTDA 3SN6A 2C59A 3FSGD 1ZGGA 4W8OA 1W0JA 1OSNA 3D1LA 3KPUA 2RI1A 2FSVA 3I1IA 2XCUA 4FEYA 1N9GB 3WJ7A 1A82A 1SU4A 3JQPA 4BV3A 3GRZA 4D26A 2O50A 3UFXB 1LRKA 1DC6A 3QVTA 1Y5IA 2C7VA 3BPSA 4XGIA 4E5VA 4RA9B 3RABA 2GERA 5L53A 1ML3A 2XAUA 2P90A 1A5SB 4IQFA 3RC2A 1EWVA 4M83A 4GRIA 2CWDA 4XWWA 3KQHA 1D6JA 4GSLA 2P4EA 1QONA 2YXEA 3O8NA 2H0QA 2B0CA 4MYTA 3DAOA 5BPHA 1SXQA 2CV2A 4I08A 4RF5A 1SHZA 3RYIB 4JT9A 3WIDA 2WJJA 2NP7A 1AKVA 3MLAA 3U0VA 4BEJA 2J7PA 1G18A 1CRWG 5A4FS 4QBHA 2AJ8A 3JQGB 3AJEA 4MMXB 4LG1A 2C4HA 3BD9A 3N6VA 1FFXA 5B6JA 2I91A 4KQIA 3DUFB 1SU6A 2WNIA 5TE9A 4LKOA 2K2QB 2RHJA 3X1ZA 1XTZA 1DHTA 3GHYA 1GNVA 3KU1A 4ITVA 4LQCA 4E13A 1G59A 3M6UA 1B1CA 2RAUA 5TQ0A 1T0PA 1Z0ZA 2JH8A 3FD8A 5EPEA 2OTCA 5LKRA 3EGVA 1EUZA 2BI7A 3C3WA 1NI3A 4G9GA 3HP7A 4QGFA 3PGXA 3WGZA 1CR6A 4GT1A 4WBNF 1V4VA 2H3HA 3ILXA 5EEHA 3B3FA 3CE6A 1N4DA 1N0IA 3DQPA 1A4XA 3G5LA 3A8TA 4W1PA 4EJ2A 3NW9A 3PQ8A 1YGYA 3UAZA 1VJGA 1PNRA 1BWPA 5K0ZA 1R12A 1N5DA 1TKRA 2C9YA 3I2FA 1QCYA 4GBGA 2FVXA 2IPXA 4B4WA 3F78A 2FSGA 3OFND 3RC3A 1BFUA 4WY5A 2GF9A 2ZIUB 2I76A 3IE1A 1KL7A 3PFNA 3EN0A 4JBGA 5C4IA 3DZDA 1T8UA 3FCXA 2WFAA 4S2UA 1L8AA 4B6SA 2DF8A 1A0OA 2X86A 4FBLA 3R7DA 4ZT7A 3MOIA 2WHEA 3IS3A 3ORHA 3C8MA 4C0AC 2C4MA 1ODJA 1S7GA 2ZAOA 3CPJB 3VH2A 4ZICA 2QLTA 4PBSA 2YZGA 2FZEA 1NVVR 5F7ZA 1T3TA 1Z73A 2FWNA 4FYKA 2QTMA 4U7JA 5GGXA 4N7MA 3EWSA 2VIIA 4COKA 5AW3A 3OIUA 3BX1A 4X84A 3MJHA 4IMIB 4EQZA 2E87A 3KC2A 4MGHA 2ONJA 1TOAA 2EJCA 1EDDA 3RSLA 3SKVA 3WG9A 1NVFA 4EUSA 4Y2JA 4G97A 2WIGA 5F73A 5T5QA 2R97A 2C20A 5G3YA 3ZK8A 1AU9A 3VVLA 4Y6GB 4YY3B 2XUJA 3A3OA 4QBGB 3U0BA 2BGKA 4GMKA 4UFOA 4KLZA 5TQ2B 4B2PA 1YCHA 1OX4A 4BNTA 4RVSA 1EHCA 1NBME 2ORVA 2QX7A 3LO8A 1P0QA 4I1RA 4MV8A 3UK1A 4QUHA 4BBJA 2ZWVA 4CFSA 1N5RA 4YMIA 1FLNA 3LBIA 3O9MA 4WCFC 2O7SA 1CUGA 4H77A 1OAKA 3AF3A 2WUVA 2GCNA 5I48A 4KIUA 3W05A 2FPUA 2ZBGA 5JSYA 3ZCRA 1VE5A 2BDUA 4BMCA 3GRYA 3U7IA 1A9PA 2XF8A 3EOAI 2B83A 3AFMA 3FTFA 3AESA 4RD6A 2Z08A 1XRSB 3CUVA 1P9NA 1ZD8A 4RHTA 5EP2A 2BM1A 1RW4A 3D3EA 1OBOA 1XMXA 3H2BA 4DQDA 3UAYA 1X92A 1ZK4A 4YAKA 2EARA 3SHWA 4PO3X 1Q7CA 4UARA 2BWJA 3LMKA 4K9KA 2JLWA 4YMUA 3IELA 4FOLA 4QEZA 4BCCA 3KKNA 3MCAA 1TO1E 2VHCA 4LWOA 1UIMA 1D2CA 5A4AA 3LZ6A 3MOGA 4QAJA 2OHOA 1ZR2A 3U6KA 3EUWA 3EFOA 1YUNA 1QKJA 3NVKI 1H2BA 3C1AA 4E1VA 3R9XA 1OWLA 3I62A 3BH6A 1XEXA 1Y1QA 3THYB 3AFGA 3WB9A 1JHRA 3T7JA 1RPJA 1U8FO 1Q1EA 3W5DA 1H8ED 1NWHA 1LI4A 3RFFA 1C3OB 3W06A 1WQ4A 2FZLA 5TMBA 2C1XA 4I1YA 1W76A 3MGKA 3UOGA 4CMJA 1UKZA 5ESDA 4IBOA 3LF1A 1JLKA 3PK0A 1GTL1 1JPVA 4QC2A 4ZOLF 1E69A 2WJ4A 4RMGA 2E82A 3V4VB 5K8TA 5K03A 1MJ5A 3GCZA 1U7DA 3LBAA 2QW1A 2Q3LA 4NENB 4C1BA 1H9AA 1SZJG 1RXYA 2VP0A 5JS1A 4EL0A 1FFBA 3KU4A 1E98A 4YRJA 2D2FA 4I1UA 3HV2A 4U63A 4WXPA 3I6YA 5HS6A 4ARUA 1H8EA 1HK7A 2AN5A 1OLXB 2WHPA 4KAJA 2V03A 1DPGA 4PVDA 4NEGA 1EX7A 1RZ3A 4F85A 5CEEA 3SE0A 1N6PA 3VFDA 2RGNA 3IP1A 2LDBA 1KMIY 1YA8A 3NXKA 4M49A 3LX8A 5KNDA 5P8WA 1XVLA 4Z4FA 5AM0A 1RYDA 2XUDA 2REXB 4ZD6A 4WPGA 3QTBA 3PL5A 2VPYA 1XP8A 3PX2A 4OMCA 3OZSA 5GONA 1KDYA 4ZCMA 3U4QB 1SWVA 3KQVA 1NQOA 2YJ4A 4RENA 5LMCA 1B93A 1MBZA 3NYIA 3PNKA 4FFDA 3WWDA 1QZZA 4O8CA 5BSFA 1UWCA 3C45A 5TF4A 2GFIA 3V4LA 1G9XA 2HCRA 1FSSA 1ADBA 1BCRB 2FCRA 1XBTA 3IEXA 3JRXA 4UHFA 4JP1A 4XSGA 1HE8B 4B5LA 1TF5A 1CR4A 3LLCA 3JQCA 4QFCA 1EXVA 3GJ7A 4D81A 3ASVA 3ASYA 4KR7A 4KFCA 1L4KA 2ST1A 5K6AA 4G1FA 3TLZA 3C6BA 4OEHA 1ETUA 5DPMA 1MJGM 5MN5A 4EQ6B 3D8HA 4REOA 5AK3A 1HQDA 1X13A 2C8KA 5J58A 3N3AC 4DJDC 2DSNA 2HJWA 1N6RA 4OI4A 1X1DA 4WL0A 1EESA 2II6A 4WOBA 2DB3A 2AXQA 4XQGA 4EHDA 5A02A 2H29A 1LTHR 1PSDA 5DXJA 4GZMA 3TB6A 1UKAA 2FLKA 2GD6A 2OXEA 1IN5A 1OGYA 1N0WA 4BB6A 4LMAA 4OI2A 1E1QD 4P31A 4NH4A 1H4QA 1MG0A 4PNEA 3I9MA 1ODLA 3NBFA 3AZOA 5T6BA 5CX4A 4BY9E 4N9WA 4YX9A 4MV1A 4UXIA 3AHHA 2GEFA 1CUUA 1JFRA 3THWB 2GF2A 4V1CI 1JLHA 4RVUA 2VHJA 1JMYA 1NF8A 2VJYA 2IBSA 5K3CA 2CUTA 2GA9A 2QL7A 2ZE8A 1JDBC 1O6ZA 2DSTA 5IT9A 1FUKA 1CUXA 4IGEA 3F98A 4CCSA 3PGMA 1DKLA 4Z4CA 3QWHA 1C1XB 3L2OB 5EHXA 3CKKA 5A1JA 1FA9A 1U2RA 2QW0X 2BEWB 3KYJB 2CLHB 1G8MA 1U0NA 4JYBA 1M8PA 3C7AA 2JGMA 2JLXA 1QB7A 3ABRB 2GM4A 1MIHA 5H4HA 3TLEA 4ZDWA 3OH8A 3I2IA 4MCAA 5HSGA 3PS9A 5DFAA 5EE9A 5JFOA 4C88A 1B8PA 4XVUA 1MAAA 4M60A 2ZUEA 4OTZA 3BUSA 1VG1A 1E1MA 1P81A 1R4MB 4YDHB 1H85A 2BEUB 1NKTA 3FPAA 1Q6YA 4TM7A 1QGZA 2OFWA 5DM0A 1YCGA 3F8SA 2B25A 2Z56A 4FMCF 3TJZA 4DMFA 2QVBA 2H59A 1ECPA 3N87A 4HUJA 2XNHA 3EGEA 5LZ4A 2HR1A 2GZSA 2GA8A 2WTMA 3PKZA 4RAOA 5K6AC 1B00A 4CTJA 4DUYB 2C92A 4IEIA 4FT2A 4IIBA 3T9FA 3PA6A 4GH5A 2P6PA 3F5SA 2L18A 4BLUA 5BW4A 5IXSA 4C7OA 1LPAB 2O20A 1OKKA 3V80A 2CXOA 3T1TA 3NBZC 1PJ8A 3ZXYA 1U80A 4CQMB 3ZV3A 5KJ1A 4DR6B 1KEWA 2G70A 1TTTA 5DHPA 2VXYA 4F8YA 3DDNA 3I04A 4C0LA 2DU8A 5DNUA 2COUA 5H5JA 3TRDA 3PHHA 2IF0A 3COSA 4HVCA 2BELA 1QHFA 3IYLW 3HPRA 1PJRA 4O2BA 3HKEB 2P67A 1VC2A 2J5XA 3HP1A 1A4RA 4LJYA 2V59A 5KYXB 5HWSA 3I0NA 3G5AA 5ALIA 4TWZA 4FN5A 4QXMA 1KF0A 1G2IA 2NGRA 4ZALA 1VOTA 3JYPA 3WMGA 4D3SA 5IKXA 1P5RA 3EGIA 4LRTB 1ISGA 3ST7A 4Q15A 2AOUA 2G1KA 3SXUA 2G1AA 4R6WA 4ABYA 5TPZD 4NCJA 4NZNA 2IWHA 2JVKA 1IN4A 2H9YA 5ERYA 1KBQA 1Q12A 2LE0A 1G3UA 4TV9A 3IIMA 4REQA 3T38A 3UY4A 4ODIA 2DECA 1QYXA 4OQEA 3B7WA 4QULA 2F4VB 2JKVA 2VXBA 1DC4A 2A30A 1T3SA 2D6FA 2BE7A 1VSTA 2V6GA 1V5EA 3KB2A 4PZ0A 1MAHA 2A67A 1A5TA 4QHTA 4NU8X 4A2PA 4WOCA 5T67A 5EVCA 5FUVA 5FJIA 5KKCA 3HDQA 3IJEB 5EZ5A 1R0BA 5DK4A 1O89A 3H5LA 1G3MA 2CMKA 2J32A 1DAEA 5K0JA 3U4DA 1FRQA 2PMCA 2VG8A 4ZRNA 1BD4A 4IIUA 3RYFA 1P2GA 1MQ9A 3HLKA 4LF6B 2JHFA 2OUIA 4LC1A 3JQAD 5EE5B 1M76A 1U8ZA 2GTIA 4D9HA 2A84A 2BBSA 5KWEA 1QPZA 1PTJC 2Z9DA 1I14A 3ZCXA 1ZAYA 1KJZA 3H19A 3DFFA 5MF6A 4GL4A 2A9VA 1KMQA 2LZ0A 3AFIA 4M9XA 4ZEOA 1QHYA 2BRUC 4KQXA 3HU5A 3QLVC 4LC0A 5NLLA 3IQXA 4Y9UA 3T1QA 1DAKA 2ZWIA 5HS4A 4MVCA 3F5MA 4DWOA 2AFIA 2C3PA 1F20A 4FNOA 3DBHA 1SUDA 2SBTA 3UUWA 3FGOA 4MI1A 1BDIA 3LX6A 3MTEA 4LFCB 2OZKA 5B58C 3UG7A 2PH5A 3LCRA 4IZIA 1O97D 3K5HA 5IULC 1N6KA 1SUWA 2OLJA 3GEGA 3HFGA 1ML4A 2PLFA 5JAUA 3HGQA 2O3JA 1C3XA 4X3PA 1PWHA 2X8JA 4N54A 1UJ6A 4I4CA 3ZI0A 3OZAA 5JY6A 5CBPA 1V47A 2QYSA 2E4ZA 4ER7A 5DCLA 2ZJ8A 3MAAC 4D02A 3KLNA 4CRWB 5T7BA 4MA5A 2CZGA 1LEHA 3KZNA 4IQGA 3STUA 4AKGA 1LKZA 1ZJ5A 4M6WA 1ZM2A 1GUAA 4KJXA 5AJHA 5D3ZA 3DEYX 2FZKA 2GM3A 4DGSA 5EJ8A 2I2WA 2ZB7A 2P6RA 4LOLA 5AOBA 1SU7A 3VO9A 4BVBA 1G63A 1ZN9A 4YP6A 2C7OA 2HSWA 2EDAA 2IIVA 1NW9B 4YJ2A 5I4CA 3L7AA 1B0UA 3TEJA 4DADA 4QBKA 1ECBA 4OOFA 3H7AA 1AZTA 2A1UA 4W1RA 5FKJA 4IDEA 2MTBA 4Q7QA 3EXHA 2ODNA 1XTPA 4XIIA 3I2YX 1Y6FA 3RKRA 4OAOA 3ELBA 3A26A 3NTRA 1U3DA 1IHYA 2FEWB 2RHWA 5CLGA 3WB1A 3DONA 3M6MD 3FLEA 1ZMXA 3W5AA 5KTTA 1D7AA 1HA3A 3IUBA 4DMUB 3KV1A 3EASA 2IS1A 1XELA 3KJXA 3KKEA 4JJ6A 2GHIA 1YZHA 1P1RA 3VV3A 4DG9A 5HKKD 3Q9SA 3KHSA 2VXOA 4HMOA 1E2IA 3KKQA 2IXDA 3UN1A 4TXJA 3I9V1 3CVOA 3NEJA 2OCYC 3HJFA 2JAOA 2AUTA 2V8BA 4G5XA 3THXB 4C4SA 1YMUA 4RLHA 2ZATA 4FDTA 4CL0A 4DEYA 2P41A 4B8ZA 3JD2A 3ZVLA 4ZEXA 4V38A 3L1VA 3OCCA 4PGFA 1KMHB 5HJ2A 521PA 3K96A 5CH5A 1VPDA 1TU4A 3M81A 1L5RA 3DDUA 4WOPA 2BGTA 1ESNA 5JJLA 1XE3A 2VT2A 3GRAA 1TLTA 4OQXA 1E9FA 1AGNA 2I3GA 1ISSA 3DZFA 3OJOA 4XH9B 4Y1RB 4TWRA 1FYVA 2V7TA 5EGNA 4BLVA 3AM4A 3MHTA 2EXXA 2PD6A 3R0JA 2YOGA 4B44A 5HQ3A 4L7VA 2XHEA 3EMVA 4X7PA 1W6RA 1IHXA 1Z6PA 5B1SA 1L4FA 1RU3A 2LWIA 2ZITA 3CUSA 1QYIA 4L6CA 3VR0A 4DDVA 3BS4A 1SUIA 3LU1A 4B45A 1BU8A 3OLWA 4CKWB 4F3YA 1XPUA 3OPYA 2O8CA 3ZHBA 4HSGA 5C32A 1J24A 2YYAA 1PD0A 4R9NA 4YCDA 4XEUA 3U62A 3WY9A 4WA7A 1HEYA 4B3IA 5KNLA 1WB6A 3F7MA 5I9TA 2KPOA 3ZBUA 3J7AC 3VO8A 4D92A 3B38A 4I4IA 7YASA 4DSUA 3TM5A 3CVYA 3M49A 1SULA 2FRDC 4QQ8A 4WN3A 2OM6A 1B43A 1RXUA 3O1JC 1B0AA 3D3KA 3HEMA 4GUDA 3BMXA 3ZWDA 3HL0A 1YQUA 3AUTA 5TVKA 4YAFA 1SK9A 2HA2A 2JD0A 2AMLA 4F5YA 1NMQA 4QTTB 1YU9A 3L6BA 5LQAA 2FW1A 1QP4A 3MGCA 2G5PA 2V55B 2BTEA 3H5TA 3U17A 2W5UA 3J81k 1N6HA 2EKLA 1NBAA 2W58A 4AN1A 1DRWA 4MIOA 5I45A 1DO0A 4BC0A 1OX5A 2FA9A 3VYRB 1QPBA 3WO1A 5AM3A 4KR3A 1CY0A 4OJNA 2A4MA 3NAZA 3N2KA 5JHGB 1E64A 4A03A 2F2TA 3CF2A 3E2MA 4NNPA 5L8VA 2C57A 1IXZA 2OR3A 2AFVA 4FYWA 5A5FA 1J0CA 1Q1ZA 2OCDA 2R8BA 4TTSA 1R88A 5ALHA 1HG0A 1SCBA 4EG0A 2E4YA 5KMGA 4C7MA 1V48A 2VDRB 3FCYA 1MLDA 1NXQA 4WK2B 5G0SA 2QKYA 3TCKA 1NZJA 2R96A 2ZAYA 3A6JA 4CF6A 4CM6A 4KUHA 1SPXA 4S0ZA 1UT6A 4MTLA 2X15A 1Z2PX 2BFCB 3QITA 2TSYB 4A8TA 1MXFA 4XYEA 3ZV5A 3KZCA 4FW8A 4W5JA 3VXKA 1NBMD 3K35A 1E2JA 2HSDA 2VJQA 4JJ8A 4GHWA 2AOTA 1MCZA 2GHTA 4GEKA 1FP4A 1DBQA 2O19A 1AGPA 1RKVA 4JUIA 3H9CA 5LP6A 4WZAE 3DTNA 2E48A 2ZZKA 4DC0A 4YUAA 4ZQHA 1M2OB 1BYUA 1GAEO 1SK8A 1ZVQA 3RRZA 4DCUA 3WWEA 1DL5A 1RLJA 1HLDA 4DRXB 5BMVB 5JRZA 3KSRA 2VUHB 3MMXA 1SOUA 3SFVA 1DQSA 1Z29A 3AJ8A 4DCSA 3H1AA 1WWKA 1YR8A 3IR6A 4M9ZA 1U2TA 2C8LA 2I62A 2ZXFA 4GM4A 2OFPA 1XTTA 3GG9A 4WN9A 1M5RA 4AYTA 5JZSA 1VKRA 5EKUA 5JSZA 2CL6X 1ZL2A 3KSBC 3NMUF 1ULZA 1X9IA 4CV3A 4UBLA 3ZD9A 3ZE9A 3GJ4A 4OHCA 2AA3A 5K09A 3DOCA 2NW6A 3CLUD 1P0MA 1YJQA 4S1PA 1ZUWA 1T26A 2JAQA 2YOHA 3ITDA 3KZKA 3TPFA 1C1DA 3WQHA 2Z4RA 1YJAA 3DZ8A 3GCXA 3I9V6 4I5EA 4PC6A 4EBFA 2GNPA 2HJHA 2V96A 1C9DB 5DVZA 5HCNA 5EZYA 4H9GA 1M66A 2DPGA 3D6UA 1Q15A 3KAQA 1JSZA 3KYCB 5ECDA 3BQNB 5ADHA 1QIMA 4FGLA 4JN6B 3DOUA 5C1OA 1YO6A 1GN9A 1PUXA 3K9NA 4XJVA 2DHCA 3OLYA 4LN1A 3E23A 2ERXA 1RRGA 1KVQA 4I9HA 3JASA 3USZA 3WJ2A 5M04A 2GPSA 4DQLA 1ZVMA 2QRVB 4A0GA 1USKA 3CNEA 3BDVA 1TJNA 2ZPUA 3AVXA 3U4MA 2CSXA 1RZRA 4A6DA 1PJAA 3DZIA 2EJVA 4G5OA 2CLKB 4CIAA 4JNKA 1X7XB 3IA7A 2FZVA 1JHZA 1MQ8B 4ISBA 4GKAA 5J2TF 1KYQA 2XV1A 5IVHA 1OJ7A 2Y1WA 3N8IA 4G36A 4JYPA 2Z98A 1XCJA 2YWGA 1P7YA 4RTSA 1E9CA 2WNSA 2CHQA 3OEHD 3R0QA 2R65A 3A1CA 3S3TA 3VHLB 2HK6A 4IVQA 4KR2A 3NKFA 4HAIA 2AUNA 4IS2A 4OY3A 3G85A 3H84A 3ZHVA 1TD9A 4OXQA 2PRYA 4PO9A 5DP1A 5FAKA 5F9FA 2CL7X 2NU9A 4UZSA 4LBVA 1EINA 1V7ZA 1LQ2A 3C8HA 1KIAA 3FYHA 4FMBB 2CFCA 5IDVA 1ZSNA 3VSDA 1VMDA 1PEDA 1G291 3PJFA 4WEQA 4NHOA 4C21A 1OB2A 1J90A 1RAFA 3CZ9A 3QSGA 4C87A 1XMQB 4F45A 4RZHA 3QELB 3WYAA 4XOIA 1I0IA 1QRSA 3SM9A 5CLFA 1GPYA 1KZ6A 1QBKC 1Y1PA 1YZQA 2FSSA 3MWEB 4Y2GA 3RUHA 4URFA 3ZWAA 6GPBA 3B3AA 2C5SA 2O3QA 5GJBA 1PJ4A 1E9VA 3B7PA 4PZAA 2XMDA 4IIJB 4KR6A 1HQYE 2ZBEA 1I7QB 1XNJA 1VMAA 3LDGA 3JYHA 3PF8A 4UBKA 3WNZA 4BMNA 4IQ8A 5HJ5A 5IX8A 3INRA 4S05A 1HNZB 1O96A 3DO5A 3PC8A 2OGZA 2R86A 5E0KB 3V6MA 2I9KA 5EP4A 3H9GA 5J4YA 2GNAA 4X7RA 1U04A 1VIVA 5F3DA 1Q50A 3SLRA 1KJWA 1SRRA 1SB8A 2AFHB 3AFHA 4OLAA 2P2ZA 2NSLA 2BHSA 3N2GB 1POWA 2PAAA 4DLYA 4HWSA 2VUUA 4B5KA 1Z2EA 4DDUA 5LD2B 3DOJA 3Q8LA 2XWJI 4BBZA 3KXLA 1TGVA 1DFHA 1RNLA 3NBKA 5HIJA 1IM8A 1V5IA 4OCZA 4Q9DA 3FUVA 1YRQA 2XGOA 4WRRA 3FBWA 3U7QB 4DR1B 4P4SA 1Y5MA 1EUCB 1T1SA 1UWVA 1Z16A 4PHGA 4AWAA 2C9MA 3J80A 1Q0TA 4UVGA 1KR5A 1EFVB 1S8NA 1YD7A 2FVYA 3VI3B 1UQTA 3R3ZA 4TKUA 2ONCA 1M83A 4OBBA 2YVUA 4I6GA 5G0WA 3BXEA 1JN0A 3CRQA 2VZEA 1JBKA 2A9JA 2IYNA 3ESBA 4LGVA 4MP6A 3UHPA 3P4XA 3VDNB 3KQPA 3GA5A 5FR1A 1TGYA 4N3CA 1PQWA 4AUNA 4O2AF 3J81A 4JX8A 4B6RA 2PJUA 1Q14A 4QOJA 1DT3A 1U4NA 4L9AA 1YC2A 3W9SA 3ZLJA 1JHYA 4KVAA 5IF3A 5LP6B 1SWWA 2D1YA 4QHYA 3IJ5A 4XCQA 4HNUA 4FNGA 1WQ1R 1UMBB 2GYUA 2MYUA 2PSEA 5G1NA 2LCFA 4PCLA 3ZZNA 3IUJA 1W34A 4Y0VA 3SF0A 1LSJA 2D7CA 3CMCO 2PX0A 3FOWA 3FVRA 4YONB 5ELMA 2E49A 3RJZA 4E12A 3R5XA 4BKUA 3A6DA 4XOUA 3TX2A 1T9GR 4MWZA 4HWOA 3SS9X 3F6SA 3IMCA 4H7DA 3LUPA 3IAEA 5HRAA 2QROA 2FF7A 1QO0A 4LC9A 1XMJA 3FHCB 1I3CA 4ZCLA 1A27A 4E46A 1FNNA 3HLYA 2HMSA 4HQKA 3FWYA 4BXOA 4Q7MB 3NUZA 5DE3A 1PT6A 5HGXA 1CUWA 2C7GA 2JLSA 3ELWA 4JJKA 1H69A 1C1DB 1VJ1A 3Q9LA 1U5AA 3R7WB 1I3KA 2Q27A 3IPAA 3D6NB 1D3AA 3WS7A 1JXQA 1FYXA 2GRJA 3ITKA 1Z5GA 1YCDA 2GAFA 1MO4A 2QXTA 5CHYA 1I2MA 1PUJA 3MS7A 3RU3A 2Z8YM 4HR7A 1GQSA 4AKTA 4KSCA 1ZZEA 4PX5A 3ZU6A 2N42A 4Y67A 3NHWA 4C3VA 4PF1A 4TT3D 2NTVA 3W1EA 8ADHA 3K1TA 2IHZA 3RSHA 2VBIA 1ZK0A 3IHKA 3NBAA 3QUSA 5EWMA 2GZ2A 3C6YA 1PV4A 4DKXA 4ER0A 1GRCA 3SNHA 4YDRA 1RWQA 3GXBA 3E7WA 3MSXA 4E08A 1U7HA 4C0WA 2XOXA 2JFPA 4FGJA 2YC4C 3FMPB 1WXFA 4CM5A 1U0GA 1CZNA 1DLIA 2WF9A 1PDOA 4TTVA 4RE5A 3WGGA 5CB4A 1DT5A 1JH9A 2HDOA 5G0VA 2WTNA 3ICEA 4NMMA 4GSKA 2BV3A 1S6YA 2V9PA 4YPVA 3A32A 4RGBA 1HY3A 3EUFA 4DPKA 1Q5PA 4NENA 2NPIA 4CKEA 4EDHA 4XZ3A 3MJSA 4US2R 5FTJA 2WTEA 5KREA 3B85A 3LUGA 3BILA 3I1YA 4O63O 1PVDA 3L8HA 1UINA 3N70A 5SZKB 4AC9A 5F52A 5FULA 4MKZA 4KQGA 2BF4A 1CY8A 1XHEA 3QXSA 4COOA 1OWOA 2OC4A 4GGPA 2JGDA 1VE9A 4KZPA 2AE2A 4B4OA 4QLBA 3G0GA 4LJ5A 4GXRA 4D7AA 3ONEA 5DTIA 4KC0A 1A9ZA 4NQRA 3S44A 3ZJTA 1IVYA 1WOYA 2ZUSA 1ZS9A 4YCLA 1LBIA 1YV9A 3ICWA 4HEA1 4HADA 4G09A 2ZB8A 3AB7A 3P27A 3TOZA 3RRXA 2A5YB 5A1TA 3P9XA 2WWVD 2PY6A 3JQBC 5TEVA 2W7TA 3SEAA 4ZEWA 4XPIB 2PGNA 3EF1A 3E7FA 4PICA 3A9CA 3CRNA 4H59A 4D0GA 1QKKA 3RS4A 4V39A 4U6SA 4M1OA 4PYQA 4ZV7A 3VPCA 1W4LA 1EFTA 1ZCJA 2VPXA 2UXBB 4OH7A 3SZGA 3VHRA 4UNPA 2D0DA 5FV4A 5K45A 1I2AA 1E4VA 2GBCA 3DUFA 1HURA 3G2KA 2G08A 5JNWA 3X1KA 3TDKA 4L0QA 2R48A 2DCUA 1MTOA 4FFOA 1L0BA 4ZYZA 1VE7A 3OQJA 2C4UA 3VTAA 2BUAA 5LN1A 1JFLA 1MN6A 3OJWA 4KXYA 1KZ9A 3OUUA 4FOOA 2AN4A 4UNIA 3FPLA 3GLHA 3GC6A 2QIOA 4R1TA 5GJCA 1GUFA 4BRSA 2QTNA 3FUCA 5F5XA 3VRHA 5LJIA 1AXGA 3H2JA 4RDCA 2OGUA 2Q49A 2I7XA 2QV7A 3ZW9A 1OFUA 3HC7A 5H7XA 5D3QA 3RU7A 1I32A 4MRVA 4NBNA 3ZWNA 3EZ6A 5AR1A 1SUSA 1Y48E 3IBYA 2NO4A 4RYDA 3RS2A 5DX8A 3EEBA 4X6UA 4HI0E 2YNMC 4BEBA 2FFAA 1D6NA 4TKVA 1OWMA 2RBGA 3TRIA 5FRDA 1FS5A 1XR3A 3KL2A 1XDDA 5A03A 4XTCS 2XZOA 3ZCTA 3L01A 5IBPA 3BGVA 4CMCA 3S2YA 3U3RA 3EF3A 4BYMA 4YV2A 5BN1A 5FBHA 2P35A 3UCEA 3WLKX 1RYZA 3W5CA 3HKBA 4RVOA 5JO0A 5GINE 4I4LA 3PUZA 4MI3A 3EVTA 1Z0JA 2LIPA 4N65A 4JEUA 3TZQA 2OZEA 4QDOA 2VAPA 1JYEA 4PEVA 2X5KO 1MPTA 5EQJB 1XMOB 2WHPB 3ANXA 5IAJA 4Z54A 1M8FA 2WU0A 1C4XA 4PN3A 2DY1A 2H7XA 3MCWA 1UQUA 4JODA 1NSYA 2W6ZA 4ZOEA 3U3MA 3W3ZB 4FHGA 1XCMA 3AY6A 1CJUC 1NC1A 3CVUA 3S2FA 2W2NA 4QG7A 4H1VA 4C5BA 1Z07A 1B4DA 2IZ6A 5EVJA 3RIMA 4A2QA 5JNTA 2CBZA 3LW7A 3FOCA 3WGIA 2ERYA 4EZIA 1T1GA 1U4OA 3NHMA 2ZUWA 1XJ5A 3GZJA 4J3JA 4JVOA 1IWBB 1N2OA 2N0SA 2ZCVA 3DFZA 4P7GA 4R69A 4BO0A 1OLUA 2I34A 4XQEA 2JFYA 3A2MA 3OBBA 3GLFE 3ZHXA 2CT8A 1L6RA 2IS2A 4UULA 4BJ1A 3IERA 1U90A 3R44A 2B8EA 3T7IA 4XIJA 4QYTA 3Q6IA 4FQ5A 1ZOPA 2IQIA 3COZA 1C0KA 2W6NA 3IV7A 3NNSA 1BE8A 3HUFA 4I4TF 1WJGA 5FQNA 1SKYB 3RVDA 1ZR4A 3M70A 4DV0B 1NVKA 2P91A 3H2YA 4Y7CA 1PJTA 3FOZA 2IVZA 5KOJB 3F1LA 1HT1E 2YX1A 4BLWA 1RSZA 3HKEA 1R1DA 1N2SA 2G40A 4LJ7A 3GJ6A 5A9TA 3QVKA 3W9BA 1L7AA 2OQ2A 1N0UA 4JLVA 4S04A 1QU3A 1MB0A 3LCCA 4F9TA 2QN8A 2HMYB 4HBZA 4J4TA 4TUYB 5G0UA 4TLCA 1TVEA 5TJ9A 2E1PA 2A7QA 3A1EA 3H87A 3LXUX 4URYR 2CCKA 1KP9A 1YE5A 4JLDA 4U9IS 5KHAA 1YCFA 5C1IA 4DBVO 2G7MC 3ENKA 1BFDA 3MRXA 3TRJA 5JQGA 1HV8A 5DDIP 1FNCA 1UBSB 4FMDB 1YKFA 4MYRA 5CR9A 1C0IA 1YA4A 3BSWA 2ZRFA 2DQZA 4IPTA 1JQEA 3LLSA 4OU4A 5DBGA 3I2KA 3QVGA 2J3MA 5ALJA 1FMJA 4PRLA 2GAIA 5JV5A 1USWA 4RD2A 1J2TA 2WJPA 2AFHE 4MKHA 5BQOA 4AQDA 4ITUA 2HZBA 3Q9UA 4J7XA 3AH8A 4JLMA 4UUQA 4DOMA 3KAPA 3WGUA 5G4KA 3W3AH 4DMLA 1J2RA 2H48A 3HZHA 4KL8S 5D01A 2GBLC 2VJMB 2C2MA 2O7QA 1PYOA 4RU1A 1VYUA 1DFGA 1ESEA 1FNBA 1M1YE 2BMDA 2UAGA 2OHFA 2Y2VA 1ISJA 3I39X 3OPNA 2J3HA 4K2HA 1XSEA 1U2SA 2JHCA 2W8ZA 3WA7A 5LP6C 1FFCA 1JG1A 2FW9A 3T7AA 3EVEA 3ZGXA 1FJGB 3IQHX 3PP8A 2DKNA 3SSMA 3BD7A 3WDSA 3W2EA 1KQPA 2W70A 3OIGA 2NQTA 4B7ZA 2BEUA 1KFJB 2C31A 3ILYA 5AXCA 2JLAA 3ZXUB 2GQ0A 3I2JA 4ZRMA 3N8GA 3U49A 3U16A 1QBGA 1XRPA 5C7OO 3M6VA 1SY7A 3LZDA 2RGYA 3B2QA 3SZUA 3DKVA 5CA1B 2Z8XA 1M6YA 1IY8A 5ISMA 1RYHA 2GARA 2VTBA 5J2UA 1HZZC 3AEQB 4YCJA 3GLQA 3K53A 1MZPA 2C9DA 5P21A 1I1HA 4K9QA 3C7CB 4UCFA 1LZKA 3JATA 1C3LA 2LV8A 1UBCA 1T9KA 5KWJA 1AMUA 3BQMB 1WVGA 3DE7X 1SQSA 2X1MA 1GR0A 4JC0A 3EODA 1SU8A 2W0MA 1II0A 5AVUA 1AKNA 2VZ0A 1ST3A 1ZMOA 3O21A 3Q7EA 4KX5A 4N5HX 1Q57A 1X9HA 1TI7A 1TYZA 2YDXA 3KPWA 3ORRA 2BHLA 1RLOA 2ZS9A 3UAVA 3VR2A 1E77A 3Q10A 1U4SA 2O0LA 4Q7KA 3VHQA 2Y3IA 1UBEA 4O2BF 3PR3A 1FLDA 1UJ5A 2WEKA 1DAMA 4XCVA 1RDFA 3VPFA 1UXJA 1R4MA 1JDTA 4GGMX 4KYIB 1RWBA 2ILTA 1CZLA 2P8JA 2Z1NA 4MYCA 3TGPA 3ZU3A 4HTFB 3RBAA 2RK4A 1VLQA 3FZQA 5B3JC 4PX2A 1W49A 3T5AA 3C1OA 3W8NA 1KI6A 3GUYA 1IHDA 3HR4A 4GKBA 4G4GA 1T8YA 1J42A 4Q0MA 4YV7A 3AB8A 3IVMA 3JQDA 3G0OA 1RQNA 1JW9B 5AI4A 5A5DA 2CW5A 3SX0A 3DDZX 4X45A 5T57A 4E2XA 3GEIA 2REQB 1QJ4A 1TT7A 3W3AA 4LBYA 5KYVA 2JZCA 1S3FA 2O2GA 3BQ9A 1WLSA 5GOZA 5IWCA 2YJ5A 4L3WA 1TECE 2ZJBA 4IVRA 5FNVB 4RV5A 3QLTA 3WGLA 4WNCA 5FUQA 1W2WB 2OC9A 3GMDA 3MWDB 1T2VA 5GVSA 3P9IA 4PYKA 3MS4A 2QYOA 2Q5CA 4MUIA 4OP3A 2PD3A 1IUNA 4C6RA 4F5EA 4JBWA 3R2JA 1XZQA 3NFYA 1QH8A 2IYOA 4LJ6A 2AD5A 3IVCA 4LRWA 4R2KA 3U7JA 3UK6A 3CT6A 3MQ4A 2RGXA 4LXHA 5FWYA 2CVPA 5F64A 1O6FA 1P2DA 3WHPA 5JEEA 2PL1A 4EHIA 4KFUA 3P45A 5EEGA 2OLKA 1Z47A 2YWJA 3FFXA 1E61A 4FYYA 1XA0A 1ZNQO 2QI9C 3BXPA 4LJ9A 1E2NA 4LEIA 4TS9A 2QMUA 2G9NA 2ZE5A 2WP0A 4WFIA 5DSXA 3VHXB 1P4GA 1S7CA 1DGQA 3SE7A 1OYOA 4O4LF 1CJTC 3RNLA 2ZB2A 1AS0A 4RNCA 5EE3A 2DWCA 1E4YA 2CHVA 1I1QB 5JXJA 4OHBA 1M9NA 5T8KC 2YHIB 2PVCA 2H1SA 3QWBA 1HXHA 3Q7PA 1L5QA 4RKYA 4PSCA 4K9OA 3A25A 3PPXA 3SJZA 1T5SA 2PPVA 1YR1A 4TKVB 2C77A 1XVTA 1Y3BE 1NZFA 3N74A 2JLQA 4ZCSA 1SZDA 3TVDA 1KO7A 3RUPA 3QMMA 5HMLA 3DQQA 3HRIA 5JPDA 3CLRC 3L7DA 7ABPA 4PN7A 4IMPA 2XVXA 1R0WA 3ETEA 1LU9A 2F9MA 1N5JA 1W46A 1IOLA 4NULA 2C3OA 1ND5A 4B3CA 4CFZA 1T1RA 2PMDA 2HAEA 1UT8A 2ZJ5A 5IJ0A 2ZG6A 3NC0C 3D0QA 3NEAA 2J9XB 1CRLA 4G5HA 4MWSA 1TF2A 2OBBA 3TMKA 1C4OA 4Q16A 3WOHA 4MEAA 4QICA 4JL5A 1E0JA 1RWPA 2IEIA 4KR0A 5FBRB 5CH3A 3G9QA 3OMLA 2YOFA 4B7XA 4ZVMA 2D2VA 5JMTA 3S2EA 1U9CA 2J3IA 3LC7O 3LC2O 1Z0FA 5IUKC 2WTBA 4I66A 4RO0A 3DBHB 2DPMA 1F4VA 1TA4A 1PJQA 4BX3A 1VA5A 5KTKA 5FT9A 2OA0A 2AXEA 4HPWA 2NN3C 4LMBA 4DLAA 3INTA 3CLRD 2HHLA 1FQJA 4CL8A 2W93A 3SC2B 3AZQA 3TTYA 1EGMB 5CA0F 2DR0A 3BT7A 1KAGA 1T36B 3G5TA 4UCWA 3TD2A 1KORA 3PEYA 2P1RA 1CEYA 3B51X 1WHSA 2AUMA 2JANA 1NW7A 2DBQA 2ZYDA 3JR3A 4KQWA 4O29A 4YALA 4AMUA 3P2KA 4ED9A 2B92A 1LSOA 1S8OA 1US8A 3QYFA 3O95A 4RYLA 3TB4A 5BR4A 3JQ9C 2W6MA 4AZ0A 2C7RA 4Z5XA 4Q9AA 1J22A 2Z83A 3DMTA 1JDVA 1EJ2A 1IH8A 1QVWA 4ICIA 5CFPA 2AVDA 2L19A 3DOFA 2BFFB 3O4IA 5GTDA 3THSA 4AJ9A 3V7NA 2O5EA 4DBLC 4CKCB 4HN9A 3DZCA 3S7TA 2CUNA 1YS7A 4B87A 5DT9A 3X1MA 4IO0A 1JFTA 2J3DA 3VYTB 4OQDA 3OFJA 1CNFA 1K97A 3PJDA 5KKNB 4W5TA 1AGYA 4WFJA 3E9NA 4M9SA 1TJYA 1UT5A 1XEFA 3BJEA 3T7CA 2VNAA 1YT5A 3WBBA 4DA9A 1DOZA 2YZMA 2FK8A 1NRJB 5I7EA 1E4EA 4KXLA 3EYAA 4WKCA 1KH3A 3RE1A 3LX4A 1JU9A 4O4HB 5KYWA 1DX4A 2OV2A 3EJWA 1FSPA 4FZRA 1IFXA 3PDUA 3AY0A 3P9KA 3CEHA 4R31A 1ZSVA 2FN8A 2GN2A 1HLPA 1K7CA 3AESB 4QDXA 3UJ3X 5EXPA 1QO0D 3LUAA 1DQYA 1UJBA 1GU1A 3AG5A 4Q21A 4W1QA 5K0EA 2G06A 2IYTA 4YJGB 5KDDA 5HRUA 1OH7A 2JKYA 4AMYA 3HSYA 4WVLA 1L4GA 1TM4E 1W5SA 2X41A 3DKRA 2A92A 4C7VA 4ALKA 3MQFA 1U5BA 2A0XA 2C2BA 4UQOA 2Q4DA 3ECCA 2HXSA 1Y4ZA 2RH9B 3LSYA 4JWKA 1BDMA 2VO1A 2FHPA 3DFKA 4H27A 5ALMA 4DE5A 1TQ2A 1AHPA 5ALVA 5K3FA 1GGNA 2BHNA 2F8MA 4JUBA 2XYQA 5GV8A 3ANTA 5IK2A 4K3VA 1RYMA 4MKRA 4EB6A 3HCOA 3VR3A 4GO1A 5FI5A 3U9LA 1RLUA 3Q8XB 2R1VA 1T2FA 2ZS7A 5CXQA 3V00A 2FWMX 4EB0A 1HDEA 1H05A 1EGVB 1PNOA 2DM6A 1JBEA 4I9NA 4LHZA 1G38A 2OXCA 2WLTA 1KYIA 3T5BA 3UWOA 5CT8A 3E9EA 1X94A 3I12A 3H7IA 3T94A 3FHOA 2MWMA 2F43A 3SKXA 1TMOA 3O5AA 1PYGA 3M4YA 1U3CA 3H11A 1TJPB 3MK31 4MQ5A 5EI5A 1V7QA 2IP1A 2XTJA 4QUKA 2ROQA 4M46A 4PYNA 1WXGA 2QRKA 2FWJA 2IEZA 3T5GA 2F1RA 2J0QA 3BHNA 1CUBA 2FUCA 3L8DA 2ZGVA 1PGJA 4OL9A 1KVUA 1E8MA 4YJ2B 1VIMA 2O2XA 2J0SA 5AW0A 1LFDB 1P18A 1QUEA 3VMMA 3A6EA 3BE5A 1T2AA 1EE1A 1I5RA 2XIQA 2O8FA 2ZVJA 1B1AA 1T3GA 3UAXA 2B1IA 3CGGA 3EFOB 3EZXA 3KUXA 3A2LA 3VR5D 3DE2X 3BEOA 4LXXA 2ACEA 3NC4A 1P5HA 1SD1A 3VOSA 2WU3A 2RGGA 3OHSX 1PVOA 1TYBE 3KTAA 1A9XB 4DFDA 1OXMA 2ZDHA 1HE1C 5DB4A 1M1YB 3AVTA 3L7KA 4G4SO 2PDAA 4PLYA 3I5XA 4OBEA 1GGKA 1Z0DA 3M1IA 1V6AA 4M21A 4O1MA 4RL4A 1Z6AA 3HXTA 2WPDA 4RL6A 4S1WA 5J43A 2ETVA 3HWX1 1SC4A 2WSBA 3SVTA 1BDHA 4L9RA 1LW7A 2QUAA 2O48X 1QYVA 1E4OA 4EY5A 1GPUA 3CF4G 3I0MA 1BW9A 3GEBA 4WZBE 3A4LA 3GEMA 2YIVX 3ZKWB 3ZVRA 3N2EA 1N2CE 2G71A 2CBXA 1DBSA 2OGSA 3KZXA 5U4XA 3R7AA 1ZVVA 1QC5B 3FMGA 1JHPA 2VHXA 1E3QA 3G02A 3IUQA 3VU8A 1Z5NA 3WV5A 4MR7B 4E88A 2J5RA 4NCNA 4EAAA 3PI7A 2BTQA 4OHXA 4ZQCB 3RRJA 5BV1A 1NLMA 4LXTA 1ZW1A 4ZCQA 5JCXA 4NJOA 5K99A 1CJCA 3GQBB 2ISSD 4F97A 4NYIQ 1PT5A 2JFOA 5JW6A 3AF2A 5H3HA 1M10A 5JSFA 5GONB 2H85A 4BVFA 1J99A 1ZJWA 4BQRA 4BP9A 4Q3BA 2QTLA 2I6QA 4BU0A 3WZ2A 4B3GA 4JASB 4P93A 4MVYA 3WL5A 3HA5A 4OKSA 3O4FA 4O2AA 4P86A 1GZ3A 2W43A 3QQ5A 2QP9X 3U4HA 5K3DA 1QU2A 3G2QA 1G5TA 2GWHA 3H99A 4ENPA 5DHTA 4D41A 1YFKA 2CXXA 2KBFA 3DGFC 1TJ5A 4IJWA 3KLOA 1IY2A 1EXWA 4TZKA 4DV6B 3KSMA 1NUSA 1V16A 2NQ8A 1GZVA 3GIDA 4LWZA 1E1RA 4J76A 1AMOA 1O58A 1ULSA 1JEQB 1WU7A 2OEPA 2P6NA 2AG1A 4G24A 3FJOA 3WJAA 1KBZA 3CXUA 5JTTA 3FDZB 1AGXA 2JLYA 3HB1A 1J1ZA 3QU7A 5C8YA 2VWGA 1M2NA 3FNBA 3NAQA 4I50F 4L4SA 1FNDA 4KRGA 1Y8AA 3RHFA 4BLRA 2E4WA 4B09A 4F9FA 1SHUX 2XEDA 3HCFA 1J70A 2XB6A 3CEJA 4WEOA 1ZMRA 3FRHA 1KY3A 2WY2D 2YIJA 2O2CA 1NRIA 4DGQA 3V48A 4QXAA 5ULLA 2Q3BA 3GPIA 3IEUA 4ZPXA 3NI2A 4GP9A 4EVSA 3PQDA 2ALJA 1QIKA 4XLZA 2FWRA 5JDCA 1L5ZA 3IOYA 4J1NA 1VL8A 4AQYB 1QMGA 2G0TA 1A9TA 3BCSA 1QF7A 1XJQA 2JFWA 4QFBA 4CWAA 3E18A 3QLVA 4HKTA 4RWZA 5B6PA 4F3RA 1M2VA 4MB2A 1E6WA 1YL7A 1JA1A 2WE7A 3FIUA 2YASA 3UF0A 1T5LA 4AY5A 5LZ7A 4L51A 2IQ5A 4YR7A 1KR2A 4K6KA 4F2HA 3PZBA 3LRXA 3U26A 5EHQA 5EESA 5E9QA 2RG7A 1U0HC 1CNEA 3R9WA 4KRXA 4E6PA 3HADA 3PR1A 5EJMA 1E60A 2GRUA 4QZVA 5SYAA 3I28A 1Z28A 5KVVA 4JDPA 1IAVA 3QOXA 1YOVA 1JVSA 1W35A 2C0PA 2J33A 3EQ7A 3QOYA 4AROA 1INLA 5AHKA 2JAPA 2MR5A 3BXOA 3FPBA 3N59A 3GK3A 5CFQA 1A1SA 3L4KA 2PUAA 1RBQA 1Q0UA 3KVNA 1DEAA 4NABA 4OJMX 2IY9A 4QREA 3PPIA 2HK8A 4EHLA 2YWEA 4ROTA 4OAPA 1RWKA 1DIHA 1AN0A 4I81A 2CBGA 2Q3FA 4RLQA 1Z4MA 4TLEA 4F11A 2J0UB 3QFHA 3QLEA 1NVAA 2VSXA 3QV2A 1F6DA 3AXTA 3UBMA 7MHTA 2EZ8A 2R11A 1OXKB 2QZZA 3BIWA 3L7OA 3WK4A 3D4LA 1NDQA 3R9KA 3UJNA 4R5HA 4C6SA 2DR3A 1JHUA 5BXQC 4BLSA 4GKJB 4OLHA 5LXTB 3WLOA 2I67A 1OLUB 1ZO8A 1JDZA 3MILA 4OYRA 3PGVA 1V8ZA 4Z9BA 4L9SA 3KKMA 4K5QA 4KSBA 5TJHA 4KAFA 2DWPA 1U9JA 2E55A 1RJDA 1TK2A 2AKAB 2X8AA 4R2WA 2H52A 3EDMA 1WP4A 4JU8A 5DNAA 1A4UA 1SC6A 1QG0A 1H1TA 4Q3KA 2WUFA 4OQ4A 3UUGA 4TSKA 1FDIA 2NNWB 3P2JA 1OAOC 1B6SA 4YAOA 5C51B 3LF2A 2QL6A 4ZHQF 1RZVA 5IM4F 3LLUA 3S68A 4HSEA 3T1VA 2OG2A 3WGNA 4AYWA 2HRQA 3RV4A 5IAOA 1P0FA 3IAHA 1K4KA 3IP5A 4OFXA 1LBSA 4V0KA 1NRWA 3P1JA 4MJ3A 4Y9SA 4MH0R 1PNTA 4FNAA 3R75A 2IK8A 1XNHA 4C4YA 2IBMA 3DAFA 2ZT6A 3ZY5A 2OQRA 3KWLA 2R6R1 2JJYA 1E8DA 4UMVA 2P27A 4Z7JA 2KQUA 1WRBA 4CKZA 3T12A 4S0XA 1E6EA 1HE3A 3E84A 2RIPA 1B14A 4YT5A 4UHHA 1MT0A 2WAMA 2QW8A 1J9ZA 4WKGA 2XW6A 1Z0AA 1WPRA 4YO8A 4C30A 4WXHA 3ECSA 2F43B 3MGGA 2VS1A 1AKMA 2WPDD 1NAHA 2TMGA 3IPXA 4JSYA 3JQ9A 3DBLB 3GOQA 4GOOD 1CUDA 1D6MA 3AUJB 3QBDA 5KJEA 1SA0B 2F1HA 2WMYA 1VG0B 3DEIA 1X7YA 3MJDA 3UPUA 1RRPA 3E81A 1CVRA 3FDZA 1M1NA 3DHNA 1OC2A 4MJLA 5FXMA 3TLYA 4LDZA 1P8JA 4CTMA 2FMXA 5BSWA 2J6HA 1XD2A 3EIXA 1KC1A 3FMVA 3IEMA 2NSYA 3EXAA 1TZ2A 5DF1A 4ND5A 3TXXA 5K7SA 2OB1A 3ROTA 1EFDN 4ND8B 1KHTA 3LT4A