1WF6A

The third brca1 c-terminus (brct) domain of similar to s.pombe rad4+/cut5+ product
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
132
structure length
132
Chain Sequence
GSSGSSGSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLECFSKGYMLSEEPYIHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similar to S.pombe -rad4+/cut5+product (A40727)
publication title The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 17
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1wf6A01
3SZMA 3T7JA 2K6GA 3PC7A 1T15A 3SQDA 2INGX 3PXCX 1CDZA 2D8MA 1L7BA 3UENA 3AL3A 1GZHB 2HTFA 3QVGB 2XNKA 2EBWA 3L40A 2VXCA 2COEA 3EF0A 1IN1A 4Y18A 4N40A 4XPZA 3FA2A 1IMOA 4IGKA 4JLUA 3PXBA 2ETXA 1T29A 1JNXX 1WF6A 4Y2GA 2E2WA 2EBUA 3PD7A 4U4AA 3L46A 2JW5A 2AZMA 3QVGA 2LE0A 1OQAA 1Y98A 1Z56C 2VXBA 3K0HA 2COKA 3K16A 3OLCX 3PC8C 2DUNA 3EF1A 2R1ZA 3II6X 3COJA 3PXDA 2COUA 3PXEA 2WT8A 3PXAA 3T7KA 1N5OX 3K05A 3SHVA 4BMDA 2M2IA 2K7FA 2EP8A 4BU1A 3I0NA 1L0BA 4BMCA 4ID3A 3PA6A 3T1NA 3K0KA 3SHTA 2ADOA 3JVEA 2XNHA 3AL2A 3T7IA 4OFBA 2L42A 4IFIA 3KTFA 1KZYC 2NTEA 4XQ0A 3HUEA 3PC8A 3L41A 1T2UA 3UEOA 3K15A 3I0MA 3HUFA 3PC6A 4BU0A 5ECGC 1T2VA 3U3ZA
chains in the Genus database with same CATH superfamily
5HF8A 1C7IA 3BBPA 2Q99A 5KHLB 2I2WA 3FYUC 3TRIA 3D4NA 1MW9X 2ZU0C 1MVNA 1VRVA 3CZ5A 5F2KA 3H1EA 3OX3A 1KEKA 1J97A 1OMOA 2JLRA 2WIJA 4EFMA 3EUAA 4WTOA 2VP3A 3TKAA 2XNCA 2YRFA 3P0RA 1JKFA 4O1HA 8OHMA 2XVMA 5ES4B 1G7CA 4M99A 4HYQA 3EQ9A 5AW9A 3THSA 3ZOKA 3T1QA 1JR3A 4G56A 1BHSA 5EKSA 1FXWA 4CCYA 1IHXA 1PL7A 1JWAB 4X91A 5HZMA 3P71T 3S1SA 1JG7A 2ZFUA 3HO6A 2J0UA 1NBAA 2VXCA 3BSSA 1KFKB 3CNOA 2YNMC 3OPNA 4K9DA 4OP1A 4ZT5A 4CDGA 7REQB 5HPYB 4P98A 4BGVA 2UU9B 2O0MA 4CDRA 3UB3A 2G82A 2BUCA 4CLEA 4DMKA 1RJFA 2ZCJA 4KO2S 3IEIA 4ZAYA 2DM6A 4JQSA 1AKYA 1BJRE 3UT0A 2ZG6A 4R9RA 5F5NA 2P68A 1QF7A 1V48A 1UKBA 4JWTA 2BZSA 4W82A 1O9HA 3CLKA 4ROSA 5FPQA 1SVOA 5A71A 2QE7D 3CF6R 2X3YA 3ACBA 2I6XA 3FOEC 5E4TA 5HDBB 1U7ZA 3PFIA 3I2IA 2FDCA 3RVJA 4XJTA 2XGGA 1IVYA 2HWXA 3K9BA 3KYDB 3NHRA 3O9MA 2B8JA 4QPNA 1ZM7A 5GIOE 3KX2A 4JOSA 5KBYA 4K9OA 4M1YA 4PG4A 2HOQA 3FYUA 5AM2A 1IQPA 4FFMA 1E7MA 1OZGA 4U9HS 4QVIA 3JQ8B 5GV8A 3C5WP 4IZ6A 3AF0A 1U5BB 4K0RA 1MD9A 1P2TA 2YDXA 4CEJB 4LE2A 1U2RA 3U48A 2X19A 2O6HA 1E9DA 1Z68A 4TXMA 4I1YA 5JOQA 3P2OA 1E0DA 3HRKA 3K5WA 3TSWA 3K4QA 4BO3A 1HV8A 3T7KA 2V3WA 3K05A 3CM0A 4HDSA 4OP3A 3Q88A 4HRXA 1XX6A 1YFKA 5CA1A 1BCSB 1UBKS 2HMSA 5KYWA 2HSGA 3QQ5A 4UCWA 2WOJA 1KJJA 5FCDA 4JLDA 3U49A 4TYWA 1ZAKA 1VMKA 4N7JA 4L5BA 4D4GA 3E22B 2AE2A 5K9ZA 3HXMA 3GNTA 1AE1A 1SJ9A 2A6PA 1O4VA 4GW3A 2YWRA 1JA1A 4HZUA 4DG5A 4DPMA 4TYPA 4LGMA 1Y3IA 1BTOA 5FNZA 5EZYA 1YR3A 1Q3HA 3GFQA 3K2EA 2DVMA 5BN5A 5HUQA 2VH1A 3AERB 2WJHA 4QO8A 5LP1A 4MGEA 3NJ8A 2OZVA 2YJ6A 3G7NA 3QMMA 5F52A 2MSKA 2N46A 2VO1A 4PC3A 2QP9X 4BP1A 5KVQA 5JECA 1KO4A 4GX2A 4UNPA 1YS4A 2G7ZA 5JBQA 1ZITA 5C8YF 3NKVA 1L2TA 4GMDA 4L4SA 5JZ9A 5SV2A 3VR4H 2Y2VA 2GOYA 4QUAA 2AHRA 3HFRA 4I55F 4Q7MB 3Q8KA 3NETA 4LC9A 5GONA 4YUVA 2EU8A 1BZYA 3OTIA 5DXAA 4BNVA 3E8MA 5BRNA 4ESHA 4ZYWA 1GL9B 2Z83A 1CQPA 3GGJA 4FP9A 4F2DA 1N6IA 2GTPA 1JKIA 1QTIA 4DM4A 2C7OA 4Q4CA 3IPAA 4A23A 2OR3A 4I4TB 1J2YA 1LPPA 1IG3A 3DFKA 4QT4A 3G0GA 4QG7A 1CB0A 1KAHA 4GKBA 1RXVA 1TYCA 4PHCA 5CAEB 3ZVRA 4UXIA 4G0YA 5DDIP 1SGWA 1PHPA 3VBCA 4E4RA 2MYPA 5GINE 4NR0A 3IEPA 3G59A 1WCV1 1I6MA 1OI4A 2LIPA 3B6JA 3DOJA 4TS1A 5K4AA 5AW6A 5LIPA 2ZAYA 2Q49A 3HRIA 1QV6A 4C6TA 2BE7A 2FPIB 3SJ7A 1YQXA 1ZI9A 1MO3A 1UZAA 3S5JA 3SZGA 4YAUA 3H2ZA 2EIHA 4M1KA 1AQIA 2AE1A 3O8QB 4LYFA 1KTVA 1VPDA 3RFCA 3KB8A 3WMGA 5LQMA 3BEOA 3D7KA 3GOQA 3VAZA 2PY6A 3AEQA 3HADA 3D3EA 3OPYA 5T57A 3W78A 3U44A 2J67A 1V7ZA 2UYQA 3LWZA 4P4UA 2ATCA 2WDZA 1K27A 4KYVA 4HDAA 4MI1A 4FNGA 1TZMA 5E6SB 3K0CC 5CX1B 1N6KA 3WL7A 5FLXA 2JEZA 2LP4Y 3P94A 4BZQA 3IIEA 1W36B 4GI1A 1YZUA 2O0JA 4NK4A 3UJHA 2DAPA 3BWXA 3DKRA 1GZSA 3PJGA 4NS4A 3PS9A 2NTYC 2WPDD 4G5OA 3ER9A 2I2BA 3IBSA 5F23A 2X6TA 4XQ9A 1BKSB 3P2EA 5KSPA 1H5QA 2RBEA 4KNWA 3ZI4A 1QGDA 3PQDA 4MQFB 1P4AA 5LA6A 1PR3A 5KNDD 3JQBC 1YT5A 2C2YA 3DAGA 1U28C 3SQWA 2CB0A 3ZK7A 3AVXA 2XBUA 5D85A 3RR2A 3URKA 5LQSA 4P4TA 5F7JA 1NMZA 3AUUA 5CEEA 1RZRA 3OE1A 5AD1A 3FPLA 4PGGA 1CRLA 1P1IA 1U0GA 1JMYA 4M49A 4WH0A 4R9SA 1DAEA 4DWWA 3E9CA 4NCBA 2C5LA 2PX4A 3IEXA 5A5DA 5B4TA 1ADYA 1EK0A 2IYOA 1S8AA 4IFEA 5KWVA 1LJLA 1TUBA 2G72A 2ZIGA 3EIOA 5KOHA 2J7KA 1QYWA 4O33A 4BMDA 3NBAA 5K09A 2ZUEA 3BFJA 1DMRA 3ETNA 4E5VA 4EP1A 3IELA 5CAEA 4UTOA 2E37A 2GBIA 5EOVA 1ADBA 4EB0A 5AR1A 1O94D 3EGDA 4UNRA 1YA6A 1CPYA 4YQEA 1MIOA 2JEOA 3O7MA 3K0CA 4PZUA 5BNFA 2ATIA 1DKMA 4REOA 1JEAA 2ZE6A 3WLSA 3KLPX 4HAUA 1P2DA 1MC5A 1A69A 2OMKA 3KOUA 1E79A 1FMJA 1T2DA 3IEUA 4XJSA 4XIIA 3STTA 5DBEX 4IKOA 3LVBA 4PW0A 1L1QA 4TSRA 4G37A 5A6SA 4JI7B 2D3TA 2HCBA 3PDCA 3N28A 3FZGA 4N5IX 3T5CA 1FNBA 1Y8RB 2Q2OA 2H7CA 3B82A 3E1GA 4B5LA 1U28A 2GYWA 2XXAA 1RPNA 5AUPB 1BIFA 5JO0A 3AKEA 4KPFC 2P1DA 1Z5PA 1Z83A 3KKQA 1BWQA 1D2AA 5AW0A 1XSEA 3RIXA 3CZMA 1UOPA 4YJFA 4ZZIA 1CRWG 1C0LA 4PHHA 2D0PB 5AFSA 2NO5A 1DO2A 1F6BA 10MHA 3K1YA 4GXNA 3V4VB 2WJVA 4PVCA 3UHJA 4DR6B 1UBUS 2C57A 1JMKC 4U1RA 4JUFA 2GF2A 3EIEA 4E51A 2QZZA 1LXCA 5C32A 1X1QA 3KKLA 2BMEA 5IVHA 4WNAA 5E7MA 1JBQA 2E5WA 3CIOA 3TVDA 2QD5A 1IWOA 3P8ZA 1OWMA 2GMWA 3WR5A 4AM8A 3NNSA 5J43A 5JAHA 3JCZA 5FTLA 4LZOA 3WWOA 3K0BA 1B8NA 4EB6B 2YS7A 2C5AA 3IQIX 2NXJA 3QLVA 5EJEA 4R0MA 2J30A 3R3HA 3K9QO 4X90A 4V1CB 3HEBA 1H8HA 3SQOA 2AW5A 3UCEA 4E5NA 5FPSA 1V26A 2H5LA 2XDWA 4WCFC 4WA7A 4D0LB 4K03A 2JIOA 4Z7JA 4P53A 1VC2A 2AOXA 1XMIA 3GRCA 2PKEA 3U62A 3TPFA 4UOZA 3QV2A 2OCLA 1IZ8A 5EUMA 2R79A 2VCHA 4CHGA 2ZTMA 3LY7A 1NLMA 5F4ZA 3I09A 4FC6A 2CDBA 4DE5A 2VQEB 3UAGA 3QRWA 3OO0A 4KXUA 2R68A 2WINI 5FBWB 1WQ4A 2X22A 4QDOA 3KQLA 1Q6YA 1C2TA 4GPBA 2W6JD 2HA4A 1KS2A 5LD2C 2B61A 3CVVA 3HDGA 2PGJA 4EUEA 4KFRA 3G0BA 3TAXA 4OHFA 3ZD9A 3BXGA 5H02A 2I71A 2FOIA 4RZSA 1ESEA 1XTKA 1U3VA 1A98A 3B52X 3AIOA 1SB8A 3B1WA 3KSMA 4PY2A 1C9DB 1QH8B 5IDYA 4LV8B 3LUPA 4F6LA 1XA0A 4HR7A 1QNFA 5JMPA 4N39A 4QRDA 4YJ3A 3E0QA 5FOVA 3ZWMA 2VQDA 1U1DA 3NYQA 1KQGA 6CHYA 2ZSFA 5DP2A 2NUBA 4RPIA 2JGIA 4I7EA 4F5ZA 4QM6A 2Z6QA 3KAPA 1LI7A 3ICVA 2P6MA 4YMGA 1LF0A 4FC7A 2CNDA 3FBGA 1FW8A 1GITA 2C00A 3CUYA 1DG9A 2DFKB 2F48A 3PQ5A 4MULA 4P7BA 3DW1X 4QNMA 2E4ZA 4ZT3A 1KE1A 4DRXA 4WCFA 3WMEA 1OCEA 4O5OA 1QCCA 1WQ3A 4RVUA 1NLUA 2UVQA 3SC4A 3WKEA 4QLAA 5JCXA 1JV2B 1NBME 2PMWB 1WSDA 1H6DA 2BL4A 2FEMA 3CZCA 4KB5A 4QPZA 3IUBA 1W94A 1ZJJA 1JHAA 2I2DA 4FR2A 4XVQA 4CTKA 5BSVA 2F43A 1JH8A 3EXHC 1RKXA 3IVGA 4JYCA 2I65A 1R6DA 4PYOA 4AZTA 1D4FA 4ND1A 4PVDA 5FADA 4D79A 4FMDF 1ATZA 1IWPB 3SXJA 4HWRA 3T54A 2O3JA 2GCIA 3EXG2 3HP7A 1XL0A 2PDAA 4YFYA 1OC4A 1IQ0A 2FVYA 3RO7A 1JNYA 3UC9A 3W2EA 4DDKA 3QX3A 4D4JA 2DFDA 4ZCMA 2Q8NA 5LQRA 2AZXA 1YUBA 1RWWA 2AQ8A 4X3CA 1RI3A 2QLNA 4A0RA 3HR4A 4I1UA 4KSYA 4Q1EA 4Q03A 4ZTUB 5C8ZA 3KWMA 2W6PA 1DO8A 3L0PA 1A9RA 1DUIA 4KL8S 4M0KA 1JTFA 4OI1A 4RTSA 3P52A 4DVGA 2GN1A 4HMQA 5ALQA 5EWLA 3KB2A 3WHIA 3SZ3A 3QEKA 1VCIA 1WULS 2BTEA 1B6SA 2AG6A 4OLJA 3PWZA 1B1AA 1HYGA 5AOVA 1FSSA 5ALZA 4ZHQF 1ECCA 1CIJA 4EY3A 3DD5A 4Y6GB 3VNAA 3WRVA 3CWCA 3KALA 3WV5A 2F3TA 2NTJA 3BTUA 4EI2A 2QTMA 3SM3A 1LRLA 5GTDA 4B83A 4EGAA 2IFTA 5T64A 5JDIA 3KJIA 1L7OA 3VVMA 4AZVA 1XZEA 2YHUA 2CLKB 3AKCA 5EJ2A 2H0RA 3S3TA 4YRMA 4H1WA 1H66A 2NIPA 2HGSA 5K8VA 1O0SA 1WG8A 1HEUA 2CGEA 3EXHA 3LY9A 4MVJA 3QVJA 2RGYA 4NONA 1ZQ1A 3C7TA 4H6VA 2GBGA 3CF0A 4PR0A 1E2FA 2F9LA 3BXOA 2R6ZA 1U0SY 3OQIB 1DBPA 3NHJA 8ATCA 1WF6A 2E2WA 1KERA 1VYTA 3A05A 3LDAA 1K4MA 3FW1A 5EKUA 5IN5A 3R74A 3VYRB 4LSWA 5HR5A 5KINB 1CDDA 1XK6A 2YIJA 4Z4EA 1KETA 1UPUA 1KVUA 4L4UA 4QULA 4EF6A 2C5FA 4EOGA 3AM5A 3CLHA 5AKKA 2FUNB 3GVPA 2HA2A 2R2GA 3RABA 4D6XA 1VBKA 2DLDA 1XRJA 4GXQA 2WHRA 3BKXA 1H94A 4ZCRA 1QVAA 2P78A 3C3DA 4GGPA 3JR7A 1I3CA 2E4YA 2OVBA 1CXZA 1I3MA 5B4VA 3DVAA 2A9PA 4R6XA 4ZHSA 5AMXA 5BN4A 1MKYA 2HT6A 3KAKA 1UK7A 1VL6A 4KDEA 3VR5A 1AF4A 1EP1B 3MJTA 4JGGA 1LK0A 4X44A 1V3TA 2JFPA 2DBYA 2NUAA 2XIQA 3MWYW 3PX3A 3T52A 2WNHA 4TUYA 2GDZA 4EYEA 4ZOAA 4F1KA 4IJ5A 3LP6A 4R83A 1SUEA 1IXSB 3ROMA 3G9QA 5L7TA 4KI7A 1MAWA 4R9VA 1I33A 2ORYA 2WWIA 4HDSB 4IDBA 3FUCA 3I2GA 1OXUA 3SU8A 2VRNA 5CA1B 2VHZA 2UXDB 2C82A 3FY4A 3GEGA 2HREA 1NMXA 3JVUA 5D01A 3SGLA 3HJFA 1VB5A 4C1NA 5F7OA 2SICE 3HB5X 3SSOA 5KWIA 1LNZA 2PMDA 2ZVDA 2EWWA 4Q19A 4CBVA 2BF7A 2HZ7A 5ADHA 2L69A 1ZHOA 2HRQA 1Z17A 1UXOA 1ZCZA 4HVTA 5K2MA 4ACAA 1IMJA 2VNSA 4TZKA 2VTKA 1G3UA 2NSDA 3GLQA 3RHSA 3VPSA 4RVFA 4JP8A 2QTBA 1NVFA 3ICEA 3OOYA 3KVYA 3N53A 5EZYB 2FW1A 3EW7A 1OI3A 3M7IA 1S89A 2HF7A 5BN5B 4BFVA 3L4SO 5ALKA 2Y67A 1M7HA 1VKRA 2WJGA 1OBVA 4U2DA 3ORRA 4TTQA 2G9UA 2Y0BA 1ESMA 1YU9A 1SOVA 3R5TA 5IAEA 3UT5A 5IJ0A 3E8XA 2W6MA 1M8FA 4P7GA 2BFFA 2JRCA 4MTCA 5EHNA 3KD3A 4B35A 1I2CA 3UGJA 1TUIA 3INGA 3WTCA 3GC6A 3RG2A 1JLHA 3B3GA 2Y4OA 5CB0A 1IBLB 4D25A 3VISA 4E5YA 1I4TD 1H0SA 3KR2A 4HNGA 1VG8A 4ZHQB 5K3OA 1DCTA 3WHPA 1QPGA 1YMUA 4YRFA 3GGSA 3W7BA 3QLUC 1H5NA 4E03A 1K7SN 2ZYRA 3E3LA 3FVRA 5AICA 3ZV3A 2B1QA 2I9KA 3L6UA 3NAZA 5A4FS 2SKEA 1MOSA 5DOVA 1HGXA 2IH5A 5GJCA 1RPJA 3UJNA 4FFDA 2QY6A 3TH5A 1YDMA 2FMXA 3UOGA 4OLAA 2VTBA 4WINA 1QPZA 4L7VA 1PR6A 4UPVA 1KJWA 2DUWA 3LNCA 4PLYA 1ZRSA 2R11A 2JJMA 4LJAA 3UMGA 2C4MA 4OBXA 2A9OA 4XSGA 2PVSA 4FMCB 1I2AA 4R98A 1V7QA 2B7LA 2REOA 3MOGA 2LCFA 3SICE 4PU0A 1QO0A 5AVVA 1CUVA 3D7NA 5FV7A 4BV3A 2QT0A 2YHAA 3AEQB 3OPYB 1FYWA 4XQGA 3H2YA 1VJRA 4UDNA 1Q17A 2P9YA 2XUHA 1EE2A 1C9NA 1D9ZA 2ZDHA 2G25A 1W44A 3C15C 3FBWA 3H2HA 4PLGA 4A2PA 2Z8ZA 2A0WA 3K09C 3MOSA 4DDWA 2K7ZA 1F2VA 2C3YA 2GEJA 2KSQA 3KZCA 3H42B 2Z2JA 3B7GA 2IYAA 4Q4JA 1OW3B 3SHOA 1Q91A 3TXXA 4C0AC 4ZV4A 1OBCA 2V97A 16PKA 4BRWA 3FFXA 3C3BA 4FYKA 3E5NA 5DOZA 4KODA 4ER0A 2ZB7A 3A6JA 1GGVA 2VZ0A 4QT0A 4XB1A 2AL7A 2PZBA 2Q3DA 3PQFA 1SZPA 4S1NA 4B5KA 1NJSA 5HJ7A 3U4AA 1GTJ1 5BMVA 1MAHA 1HBJA 3AESA 2PD6A 2W4MA 5LYJF 4CODB 3QLUA 5LA6B 4FJ0A 4WLNA 3BSYA 3R7DA 1HE5A 2BGRA 2W2OA 5HS4A 2PKRA 3N1UA 4HQRA 2O7NA 4KFSA 2F17A 3O4FA 2I4NA 1OE0A 4C20A 4E5SA 1TZCA 3TDKA 4BGUA 2ST1A 1R9JA 1VKZA 3OEED 3BH7A 1L7NA 4J3FA 2AC7A 5G53C 1FW6A 5E9JA 3NEPX 3I4FA 1BO6A 4WT7A 1DZ3A 4I9FA 2EP8A 1GU7A 4AYWA 4QUBA 1TUBB 1O95D 4WXRA 1XG5A 4XUEA 2O5EA 2JASA 2Z98A 2I03A 3UPDA 2BISA 3E61A 3ND6A 1HMYA 4HH0A 4ROTA 2HLPA 3CR8A 2GBLC 2QQFA 3FUUA 2UZ0A 2O48X 4MARA 2XT6A 2IDJA 3BWMA 3K09A 2E87A 3TTYA 1P81A 4G85A 1C3EA 1MIOB 3V33A 1EHCA 2HQ1A 1YS7A 4UVHA 2IEAA 3ED1A 4A6XA 1P7ZA 2ACKA 1XROA 1SC1A 1I5OA 3CU5A 4OYLA 2ZKLA 1GV0A 2OQRA 2OOKA 3AUAA 1PGOA 3L7BA 4M1TA 4TN1A 1L5VA 4Q7QA 4EG1A 3H9JA 3IQXA 4NH4A 1D1PA 1CNFA 1Z45A 4LFCB 1ZP6A 5LC1A 3ISJA 1T2UA 2BCJQ 2HWYA 1CFZA 3ZHRA 3K92A 1PV1A 5A6SB 4A9AA 4LZWA 3UKDA 3Q3CA 3VRHA 1XEWX 1U94A 3QE0A 2NAFA 4IIUA 3H65A 1SCAA 1UXKA 4QHTA 4C7JA 3VPAA 1M66A 1ADCA 1MH9A 1TZBA 2G8LA 2VKTA 3GLRA 3ZBUA 4N8SA 4WCDA 5F3RA 1QQ7A 4I08A 1G5IA 4MWSA 4MUNA 5JAUA 4BTEA 4HNRA 3CVXA 4L76A 1PE0A 4HYYA 1NQOA 5JWHA 3DJFA 4M1MA 4UQOA 4CCWA 4RENA 3B1FA 1FRVA 2YN0A 4NL4H 4YJFB 2P41A 1Q22A 3F1KA 3R6TA 3HVRA 1OXSC 2GEVA 3O21A 4QBTA 4BQPA 4BVBA 3JQRA 3SF8B 1V3VA 3K4PA 4P3PA 1YB2A 2FRDC 2E82A 2KQUA 5LDGA 1ZVVA 1ULAA 2I1WA 1ACMA 2JGMA 3AK4A 4KO4S 1ILEA 3UYKA 2IZZA 4UULA 3E3MA 2BJVA 1M33A 5H9WA 2PRJA 3HXLA 3A0UA 3I1YA 1FJGB 3KB6A 3FOFC 2W2VA 5HFAA 3RH0A 3EDOA 1NQTA 4KXNA 2AJTA 3CUWA 4GI3A 3Q9UA 2H65A 3ON5A 1CU1A 2J45A 2Q5JA 2QB5A 2BDTA 3GCDA 3L82B 1PEYA 3OEHD 4LNHA 4Q6BA 3JARB 1LSSA 3I01M 4WGFA 2O1XA 5EYPA 1SULA 4KRYA 4DS3A 1H4QA 4LZLA 4HDMA 3LLUA 4W9NC 1GUZA 1P1KA 2C5HA 2XMPA 2WZDA 4P83A 4AO8A 4ML3A 1SOMA 4YP9A 1T1EA 4HCJA 2QTRA 3ASZA 2D2EA 4KV9A 5JV5A 5FOUA 3OCVA 2ZRGA 3KHTA 2WJJA 4KQ6A 4D5EA 4AY5A 1L1FA 1NXVA 1TFUA 5DPMA 3EQ2A 1A9OA 2JBAB 2H9IA 1H2XA 2FQQA 4EZEA 4IX9A 4ZMSA 3GLHB 4K1XA 3RIYA 4F3YA 1S3FA 2PWYA 2WZBA 4NJOA 5GWXA 3TSOA 3L7LA 3PU6A 1U8EA 2ACEA 4G9EA 3YASA 1BWPA 3QU9A 2FMHA 2K2QB 3MUNA 4J0IA 4B43A 1Z39A 3E2IA 3G2NA 3HDQA 3IILA 2AN9A 5FR2A 2W70A 4OXRA 3T8YA 1H0RA 1NJ5A 1SVIA 2FRDA 2WAYA 2ZYVX 4TS9A 3DYIA 2VJPA 2WHQA 1B42A 3QUTA 2X8BA 3QWIA 4L16A 4LXXA 1JWBB 2HA5A 1UOEA 5FRDA 2X8WA 2BPOA 3AKDA 3RVPA 3VYTB 2OMEA 2IOYA 2I91A 4INAA 4M87A 4GKVA 5AKEA 2OA0A 4DIBA 3NVKI 3HE3A 1UMKA 1GZDA 5FUWA 4YLYA 1WV0A 1NMQA 3UOAB 2W2KA 4W9NA 1ZXXA 2QQ0A 1BFKA 3JQAA 1LK5A 1TRKA 3ZY2A 4NZZA 1JIVA 3OQMA 2ZBQA 3CLSC 3TO5A 3RAFC 4BNUA 2ZJOA 1QIHA 2F3SA 2GAAA 3HBAA 1MXFA 2BM9A 1NX6A 3EH1A 3NYWA 1JQJC 1VA4A 4TTAA 1OD6A 3EC1A 3R3SA 3RFUA 4BIIA 2XQFA 3HJAA 5ARDA 4YX9A 1CZNA 2F43B 1QYRA 3SSAA 3V6LA 4TM8A 3HGTA 1WVIA 1Z07A 4MV1A 2J3KA 3MJHA 4ZI5A 3EBOA 4L78A 5ALHA 5LD2B 1DJQA 2WT4A 4B6PA 3P0IA 1RMQA 3MWLA 4Q3EA 4W8OA 4ZEWA 3WQQA 3KJZA 4B3IA 2VA9A 4B6EA 3D6JA 3WZ2A 4ARVA 2VQSA 4B8YA 2Q2VA 4AY3A 4OHPA 3SP1A 5M04A 4HY3A 3HL4A 5D87A 4B2IA 2HSDA 3R6GA 4H7EA 1MX9A 1YGPA 1HDGO 1U7TA 4N5HX 4BLVA 3GROA 4C4PA 2DHRA 2VNJA 2NUPA 1KO5A 5DTIA 4D3YA 1RAIA 2IDMA 4YJ2A 5FP0A 1O6GA 1WPRA 3H97A 3HYSA 5BNIA 4P0QB 3G79A 2DR0A 3H9CA 4KMRA 4LZAA 3K70D 1XZGA 4US0R 2AXEA 3PDUA 4Q3NA 1IM5A 3QSGA 1L4MA 3IJRA 2COEA 3KOZA 5BXYA 1B1CA 1R0ZA 5BY2A 4N3AA 3AIIA 4EEKA 2QM0A 1A4RA 1XU4A 1YQWA 4UVEA 1WSWA 1PQYA 3NXSA 1QIDA 3C8DA 3R9WA 1X7YA 2QDKA 2XQJA 4EUNA 4LHXA 3ACCA 4HAIA 2JGLA 2PRYA 3ZYZA 3D64A 1T2CA 2ZJZA 1UK9A 1V5FA 3DWEX 3QBDA 1U0RA 2OUKA 3LHDA 3RVRA 4DSAA 1LY1A 3GEPA 5IMSA 3WGIA 4OAQA 1VG0B 3R20A 2CXQA 2NN3C 1QDEA 3EXHB 3O3CA 4BFSA 4U0KA 2CY0A 1CJSA 5FFNA 1QH0A 4KZKA 3TXAA 4CM1A 2ZK7A 2DBVO 3PXUA 1MZPA 3WB2A 1DINA 4IFTA 4BE7B 1GEEA 3BIJA 3ZWCA 1XIVA 4PHGA 2PGOA 1K68A 3N3AC 4WK4B 2AHOA 1E4OA 4WK0B 2LPMA 1K7CA 4FMPA 1OT3A 5JS2A 4IJQA 2ESRA 4UU7A 3D7LA 1LB1B 3A4LA 3L7MA 3VC2A 3PUZA 2G4VA 1NZFA 4J91A 3L0BA 2Q46A 4JI2B 3E5RA 2P6UA 4K9NA 2M6SA 3DB1A 4NZ9A 3LLVA 4LDJA 4QXPA 1DXQA 3TZKA 1JDNA 1U8FO 2O1EA 3BTVA 1C7RA 2DQKA 1Q3TA 1UAGA 2CC2A 5BN4B 1GCGA 1JS1X 1U2DA 3T6KA 4ARBA 4IMRA 4BQNA 1MEEA 1MQAA 5JXJA 4GM1A 3KZNA 2B99A 3EGWA 4KXMA 3WLPA 1BMTA 1WBBA 1NFFA 4TUYB 2IITA 2BBSA 3O8BA 1LTKA 3B13B 4RAOA 4AMZA 4OJQA 4YY3B 5AHOA 3CFYA 4CF7A 4JXZA 2OESA 2P4EA 2IXAA 3G0IA 5L7YA 5LMCA 1J42A 1F1JA 5ALNA 1JU4A 5REQA 2JLYA 3Q6IA 2P4QA 3MD9A 1EEXB 1NLZA 2VDLB 5DCWA 4KPUA 2X7HA 2P0AA 2EIXA 1GYPA 2HMVA 2V4MA 4DSNA 3IURA 1LFAA 1XD9A 1EJ0A 3DE3X 3GAZA 2RGEA 3CIFA 3IP3A 1HZJA 2PGNA 2A7XA 3N86A 4G0XA 2ZTVA 3CLRD 1FVHA 5TARA 2PX3A 4L50A 2GJ9A 2BZGA 5BVGB 4TT8A 1JQBA 5L3SA 1QRAA 4EY5A 1FBNA 3WMRA 4WLFA 3W9BA 3G23A 4LRSB 2YWDA 3D2AA 1VXOA 3OZVA 3HY6A 4LDNA 3KEMA 1FNNA 1VMIA 1PKXA 1YK0A 2HQBA 3GGOA 4TWRA 2FEAA 2O59A 4MMXB 4O8CA 3IKTA 5LNK6 3EBPA 1FPQA 4FFBA 4MP8A 4PYNA 1MB4A 4D9MA 2GPNA 1JAIA 2OCBA 2BFFB 1RP1A 4S1TA 2QW0X 1NE7A 3AH8A 1GM5A 3BN3A 1F5NA 3WL8A 2NTVA 3BMNA 3FSJX 3PLAE 1UZMA 3L5OA 3TEFA 5E7QA 5C46F 4FT4A 4DCOA 2DTEA 4OATA 2IIBA 2IH4A 3QELA 1U1CA 4X0EA 1E8DA 4JI8B 3I62A 4IAOA 2CBXA 3G9ZA 1VKOA 4BQOA 5H68A 1TUGA 3K71B 3GT7A 3RUEA 1C41A 4AB1A 5C53B 3C97A 3AR5A 1Q19A 3DBVO 4BX2A 4MQ4A 1GNTA 3H4VA 3OKFA 4HB4A 3L79A 3BZUA 3GIWA 3VHLB 3UWKA 4Z86A 1KYTA 1I7DA 1JF8A 4O2AA 3PPVA 1LI5A 5TRTA 4F5EA 3BXPA 3RUHA 1BJKA 4C3ZA 1C1HA 4OQLA 4RL4A 1H22A 1Y8ZA 5FNVF 1BS2A 1U0FA 1Z0UA 1ZRMA 1FE8A 1UXJA 3H84A 3IAXA 4FLEA 2LE0A 4RGVA 5C18A 2OAEA 4WLEA 3M1IA 1SIBE 5FXMA 5ITSA 1O97D 5JQGF 2CK3A 4B48A 4CEHA 3VNUA 1PWXA 2ZRNA 1TMKA 2Q45A 3G49A 1VYUA 3GX1A 4LXHA 5SYAA 4REQB 4Q4JB 1PT6A 1XQYA 3Q3IA 1LZLA 1BS1A 1OILA 2ACWA 3T99A 2IPLA 4PSCA 1MG0A 4G1MB 4BS9A 2XRZA 1CR2A 3QY0A 3K70B 2B78A 3PTZA 4ZAXA 5C37A 1J9GA 4MPPA 5E3JA 3JX9A 3LT5A 3MWDB 2HLDA 4DUGA 3AF5A 5DF1A 3M3PA 1YL5A 4ZVRA 4D92A 2X1VA 5BMVB 2O2GA 1L3CA 2E55A 4EKNB 4O8ZA 4Y7DA 1XU7A 2VHJA 4WY8A 5B7QA 3OX1A 5BWNA 2QEQA 2LCIA 2SECE 4MYUA 1MMFB 3SFTA 1DJMA 4WFJA 1J8DA 2ECPA 5FL3A 5FL7D 5FYQA 3S68A 4YCNA 1OFGA 2VYQA 3IP8A 4NBUA 3WLLA 3RKSA 3KZXA 3H5WA 3KCQA 3BJRA 3U4IA 4Z4QA 1Q0LA 1UPTA 2GRJA 1P1FA 2KYRA 2QR5A 3PT9A 3MQ2A 1RZ3A 4B6GA 3BFVA 2GJAA 1O87A 5J4LA 1GAEO 3ETCA 2ZJ7A 3PFGA 3SR0A 3CGGA 5DEIA 3SIXA 1XCPA 4LYGA 5CDTA 1G8MA 1T9BA 1BMQA 2DY1A 1F7UA 1WIWA 1HSOA 2MYTA 3S55A 2HY7A 4C0SA 1DRKA 5JC1A 3ZDBA 4FYWA 4O4IA 2AH5A 1Y1SA 3PEUA 5DGHA 2ZM6B 3FVVA 5CW1A 1Y3CE 3LLSA 3MCVA 1TIKA 3HJRA 4HRYA 4CIYA 2ON6A 4QQ8A 5KHAA 5IS2A 5F7ZA 1XTQA 4Q82A 5F2OA 4D9FA 3THXA 4KQHA 2Q5QA 4DWVA 1P17A 3MGKA 2GLUA 1L7DA 5KREA 4OO3A 3SZOA 4CRWB 4GR4A 5JWRA 4Z3KA 5B2ZA 4DLYA 4YUAA 1T5LA 1X1AA 1XF1A 3LMKA 4JA2A 5EIHA 1CX9B 1CY2A 1MAAA 1N4DA 1SOAA 1M7GA 2JARA 2VPPA 2GBFA 3QKRA 3D43A 4LG1A 2EQBA 5AKLA 1QAMA 3X44A 1KRWA 1Y7HA 5E3HA 5HIJA 2FSPA 3BDVA 2XQKA 1L5LA 4DA8A 4EUFA 1MO2A 3ZN2A 4ETMA 1N5LA 1UQTA 1BQ4A 1YDFA 3TZHA 5IVKA 4I8IA 4GPAA 1F60A 1P2SA 2CL5A 4K6FA 4CV2A 1ONSA 4UHDA 5D5QA 1K92A 3JQCA 4MR8A 1CP2A 2GZSA 3AR2A 1T8UA 3P2YA 2XV1A 1FZTA 4OMDA 4KGDA 2J7PD 2BFMA 4HG2A 3B5IA 2WFLB 2I5PO 1IEVA 2R6DA 4U7WA 3RT7A 2XBMA 1ETHA 4QGAA 3QBEA 4TWZA 4CV3A 4XPIA 3QE2A 5C1PA 1OXTA 4Z4GA 1MX5A 1ZK4A 3A58B 1Z4LA 3PUKA 4G9GA 4H1HA 2QYSA 3O4IA 5LDDC 1PJTA 2WSSD 5K8JB 2B4TO 1YE8A 2BEVA 4FFRA 1U6KA 1MB9A 4G1BA 4MUIA 4UEJA 4ZI7A 5JG7A 1EBUA 3WO0A 2FY8A 2XOEA 1AUXA 3F6SA 3SS7X 4YAEA 4EPVA 2WF5A 1BEEA 4JLKA 5CITA 3N0VA 3SR3A 1Q92A 4DBLC 3K5IA 3E9YA 3PP8A 1SD2A 1H6AA 1F48A 2PXHA 2IHUA 3I2FA 1R4AA 5H4HA 2CV0A 1I5RA 1QG4A 3HSSA 3OHSX 1JB9A 1KYQA 3HWX1 3COYA 1Y98A 1IOZA 4AZ0B 4XFDA 1TM3E 3ZWWA 3LY5A 3IT2A 4CR6A 3K0HA 4LY9A 2JJYA 1V9LA 3HCNA 1I9GA 4TYYA 2YHBA 1K2VN 2CLDX 2G28A 2BJWA 4JBXA 4NBRA 2GAIA 3I3OA 1WY5A 4U6NA 5EP3A 3V4LA 3VKWA 3VR3D 4RBNA 2F1KA 1DAHA 1EM6A 2GPWA 2O2CA 2Y6UA 4ZOBA 4C0HA 2KWIA 4QNRA 2CJXA 3AI7A 1W6RA 4HEJA 4KUHA 2XEDA 1UIRA 4II2A 4DQVA 3ZDRA 5JNTA 4LMAA 1WW3A 3KD2A 2CDAA 1UBSB 4HN9A 3AB7A 3HWRA 4PTZA 2DLCX 3SQXA 2XCLA 1VCOA 3N3BC 3U3XA 1QIIA 4BBAA 1FIUA 3LK7A 1RBMA 1V6CA 1H0KA 1NWCA 1VE7A 1XN4A 2EFEB 2IYLD 4IR7A 1EWQA 5CYFA 4FGWA 5ALFA 1OU4A 1E5VA 1QS0B 3FWYA 1FEZA 4Y1GA 5C5DA 2FW6A 4D26A 4D6PA 3DMHA 1TCUA 1KMMA 4MHOA 2YW2A 5IKEA 1GAXA 4R7TA 1QG0A 2BV3A 4EJ6A 1THZA 1ONPA 2Z8YM 1N2XA 4XI9A 3NUGA 4C3OB 6AT1A 3GY0A 5KSOA 4C87A 2ANCA 2ZSEA 3ZY6A 1QPBA 5IVPA 3RVDA 4IO0A 4QUHA 4Y98A 1IUPA 3ELWA 3HKCB 4HK4A 1E7SA 5DI9A 3DF9A 3WX0A 1NXQA 5HXAA 2FGKA 4YECA 1E6CA 1KMHA 3FFTA 4JLBA 2FLWA 1DAGA 3BE6A 2IW3A 3B38A 1OUMA 3TIGA 3M6VA 4OXXA 2RKBA 5IAGA 1H1TA 2R8ZA 3MD0A 5TQ0A 5L4SA 1D2NA 2RONA 2VLBA 4A0FA 4B6FA 2YWCA 4DJAA 3TZLA 4EW3A 3HCDA 4WD3A 3DL4A 2VH5R 3SLRA 5CIQA 1JSRA 1PLLA 2WTMA 4G8CA 3RUCA 5E6UA 4LRYA 1Y1TA 1QLWA 1RYZA 3PK0A 3RE1A 2PD4A 3CLVA 4H2DA 2PUCA 2YJGA 1HC7A 1Q6ZA 2BSXA 2Q3HA 2YQ4A 3QF4A 4MVXA 2G0NA 1ULUA 3REOA 5CD1A 2C5SA 1CJMA 2DCMA 2JFGA 3MJFA 3R0QA 3GHYA 4K88A 4G4SP 4MIEA 5GQSA 3ZHSA 4F2GA 1UBMS 5AHWA 1H6BA 2PJDA 4OXIA 3HPRA 4AG5A 3EQ8A 3INRA 3JD0A 2YV4A 1S2DA 2FZKA 3L07A 2MHCA 3WLRA 1NMEA 5KU7A 1LS1A 3AIMA 5D51S 3BF8A 1PUXA 2H3HA 1NOIA 3B70A 5B6PA 2D8MA 1HF3A 1W93A 1ZONA 2QE6A 4JUIA 1WDLA 3INNA 4Y2PA 4D80A 4F04A 2OZPA 4RJTA 2PQMA 2MTBA 3ZWXA 5L45A 4FKZA 2BGNA 4WEQA 1SHZA 4DIEA 3P9XA 1ND5A 1U3TA 1F17A 4NAHA 3S2FA 1RQXA 4ZWNA 2F4NA 1SC4A 2NQ8A 2NUPB 3SZUA 4EY6A 5ITZA 4JYZA 4N0QA 1U3DA 1XMSA 2P2ZA 4QYSA 1NHGA 5CP8A 4ZVNA 5LZ2A 3JRWA 4TMWA 3V46A 1IRIA 1ZPDA 2BZ0A 3LGSA 4CL8A 1K97A 2OGWA 3Q9SA 5KSZA 2FXIA 1QV7A 1GYQA 4JLNA 1N1DA 4LF9B 1AJEA 2ZRQA 1H93A 1I3OA 2C4WA 1WAMA 1R10A 2IU0A 4DV5B 3DDUA 3B7PA 5CXQA 3N2EA 3GZTB 3VH3A 3PD7A 4F7WA 1TPYA 2WB2A 3TSYA 1ZS9A 2HRCA 3UJPA 2WV7A 4JYAB 1A5SB 1P77A 3ZHVA 1ADGA 4RPKA 5HBGA 5K8TA 3K8YA 2ZYHA 4GGOA 3IP9A 3M83A 6ABPA 5C3MA 1A2OA 3DL0A 4RVNA 4GMGA 4H59A 1Q0ZA 2HA0A 4N3CA 4TMYA 3U39A 4F56A 2QTZA 2V3VA 3AEXA 4QDUA 2EKQA 1N4AA 2A9VA 5HF5A 4Q9IA 3ZZ1A 4RFVA 2R96A 4Z7QB 2N42A 2V7EA 2QL7A 3DC2A 2G88A 5D3ZA 2H2GA 2UZIR 3AHFA 4Y9UA 1Z6XA 5FF9A 3VU8A 2NX2A 4XFJA 1BQ3A 2YWBA 4H7JA 3RSOA 4JC8A 3F90A 1ZJ4A 2AF4C 1VGRA 1VP3A 1XWFA 1U80A 1I4LD 2WUFA 4RZUA 1DU4A 2J9FB 1GZ4A 4EH1A 2DH5A 1F38A 2C7GA 1GT6A 4E13A 1CYEA 2ZI3A 2B3DA 1RJWA 4EAAA 1LV8A 1W9HA 2JAQA 2I6TA 1OGIA 1EI9A 1KR2A 1YHNA 3Q6MA 3ZOZA 3T3NA 1K6EA 3PJEA 2BGKA 5HE8A 3SZRA 4B17A 1OYWA 2WA2A 2VN8A 2YUTA 1FUYB 5BR7A 2RH8A 1JBKA 3ZWOA 1O6FA 4QATA 5D5HA 1C7EA 3AR4A 4ILEA 1KY2A 3KXIA 1D8AA 4FTWA 5JSKA 2NWQA 2R8BA 3C85A 3UWMA 1KXZA 2BFOA 5DXJA 3VH4A 2IYXA 2YX1A 1YS9A 3HACA 4GBMA 3O1LA 1NBOA 3ITDA 5BXQC 4EENA 2RHBA 2IYEA 4PGAA 3WISA 2XR1A 1IK6A 1GPLA 1P1JA 5KAMA 5KNCD 4PO3X 3NH6A 4WL0A 1T2AA 3JR3A 4AD8A 2JFWA 2XZTA 3TTWA 3G1TA 4JUCA 2NT3A 1RCUA 3D3WA 4DNQA 2C92A 3DE4X 4NZMA 1HUQA 3D6VA 1G5QA 3EFHA 4GVXA 3DNPA 1I01A 1ICEA 1WUHS 1YIOA 3I6QA 4G07A 1W29A 2GB4A 1MO4A 4BMSA 5L3SB 2R8YA 4G0WA 4XTCS 3WADA 4ND3A 4OXYA 5K3FA 1O94C 3O9VA 4ZMBA 1KHHA 5LXTF 3ZI7A 1YBFA 3Q2OA 5KTTA 1J06A 2QXUA 5LZ8A 3P5BA 3HNOA 1PVVA 3P2JA 1SC9A 3FLMA 3LWBA 4FFBB 2XKKA 4GDMA 4NAVA 2GZAA 3H05A 1OFTA 3VR6A 1WLSA 2FKAA 4N5MA 2IW1A 4AQDA 2NSLA 1OHHD 3WNCA 3BMNB 1Z2NX 5I7OA 5EERA 3DCNA 1Z47A 1ZOSA 3SIRA 3UG6A 3GVHA 1QVZA 4FXOA 2Z3VA 5KNDA 3H2JA 3AUTA 3I9LA 1IZ0A 1K63A 3FSEA 4NARA 4M9RA 2A9RA 1PYGA 1M0TA 2AXPA 1Z3CA 3L1HA 4BE4A 1HX7A 2PL5A 1Z2OX 3NH9A 1NSTA 3PJDA 2CT8A 2PV7A 2DB3A 2QVXX 3GJYA 4Q3CA 4CTJA 3GMIA 3KEOA 4HLUC 4UTVA 3FNIA 4BVGA 3SFZA 1GL3A 3R77A 2BKEA 4ZC1A 1LLDA 4WESA 2FWBA 4YWJA 2QYTA 3RCBA 2HUPA 3TRFA 5CT4A 3I5YA 5U1PA 2GKSA 5M29A 3IQHX 2C4HA 1RR6A 4UREA 1T8TA 2AI1A 3WLMA 4ESOA 1TVKA 1O94A 4IJWA 5A03A 4TWAA 4CEHB 3RF7A 4JT8A 5AVWA 3UV6A 2X2FA 1MC8A 5LBTA 1VHTA 4J3JA 1IN8A 1E9SA 4RXTA 3KJQA 5TT0A 2ZREA 4WACA 3A6GA 4J0EA 3UNXA 1FDOA 1M1YE 1RAHA 2Z9CA 2VEDA 3PR3A 1FFBA 4MYHA 1KTIA 4ZTBA 1YS2X 3OF3A 1ZUNA 1CVIA 1TO2E 1TF5A 1U7WA 1X7DA 2I3BA 3IB6A 4G26A 1G8JA 4TKZA 1TE2A 3ZX5A 4W5NA 1RQGA 1DUSA 1W5AA 4BVHA 1RRKA 4DHWA 1A5TA 4YAKA 1FQWA 1D5CA 4YV7A 4I50A 1TU0A 1KQ3A 4L6IA 5FPPA 4R3UC 5CRIA 5AVUA 3KRTA 4HB2A 1AF7A 1DL5A 3RAPR 4ER7A 5EGNA 2WOOA 2X9NA 3UFXA 3EFOA 3G2HA 1R7RA 2WHYA 3IBYA 1P7WA 3SHQA 2RGDA 3WQHA 1JHZA 2YDYA 2KB0A 3IP5A 4IG9A 3RAEC 2P5YA 4YP1A 2D2XA 4HLUA 5AJHA 2YR0A 3JD4A 4RO0A 1XYYA 3U7FB 3TUZC 1N7GA 1Q0RA 5DYIA 1U7OA 5G1NA 4CL3A 1CT9A 3H2BA 3GDWA 1XLTC 4X63A 3WKAA 2Z04A 1EA5A 3KOXA 1P80A 1X1BA 4PLHA 3OZBA 4GKJB 2WJAA 3MB8A 3BE8A 1UPFA 3OOEA 5IH7A 1FRNA 4XGKA 5CDYA 2EDCA 2DF8A 4O4IB 4O08A 1DUVG 5I7VA 1IN7A 1NJGA 1F9EA 1D4AA 4K6HA 4MX8A 3W5UA 5LXTB 4L07A 1C81A 2FXVA 4C9BA 2JFVA 1ZW1A 2NZWA 4ZT6A 3GIDA 2HMTA 2IIVA 2FWAA 3HA5A 1U2EA 2ZB2A 4F3RA 3NOXA 1RCTE 2I3DA 3F2IA 4TV9F 1LSJA 2VDJA 3JQGB 1I14A 4NG4A 3PQEA 1E66A 2H2HA 3IUNA 2IBSA 1PJ3A 4FE7A 4EIWA 1HORA 2DQYA 1ZVKA 2PX5A 3QKRB 2XLCA 5IAJA 2INGX 5E6RB 1S2OA 1SKYB 1JALA 3NDRA 2FJ0A 5ANRB 3KO8A 3PICA 5TB5A 5JMOA 1JR6A 2FUG6 2X77A 3DSRA 2JFYA 3N6XA 3NIWA 4OHMA 4UUMA 3NHWA 2PBZA 2QMYA 4PYQA 4ZODA 4ZO7A 3VHXB 4Q37A 3B36A 2ZSBA 4GVPA 4QJBA 3VYSB 4B3BA 3EDCA 3CF4A 1YR9A 4QFMA 4MR8B 4G5SA 2CXSA 4N41A 2G09A 2CVOA 3SQNA 2XD4A 2R84A 1PIWA 1NW3A 1RYYA 1XLTA 2H08A 2PYIA 2Z2KA 4IRMA 2HSWA 4A0HA 4BJ3A 4XPIB 2P1ZA 1S8NA 1VMEA 2VDPB 4MRAA 2BDUA 2ID8A 4OL0A 4RKQA 1V2HE 3A32A 3GGDA 2R6AA 1GO2A 1LC3A 4LBVA 4ME6A 4ZI7B 5CB6A 2XNSA 1NP3A 1HDXA 1D2MA 3GAAA 1RRFA 4KCGA 4QSMA 3IAUA 3D81A 2PT5A 3NHKA 4CMGA 4KR6A 1CUBA 4W1RA 1KKLA 5BV0A 3QU2A 3BOSA 3U7RA 2CHEA 3T5AA 4BTLA 4L5AA 2QX9A 3VVBA 1JI0A 1H8EA 2GO7A 4GLFA 4UU8A 3N9IA 3WL3A 4LSGA 2ZRPA 3OWHA 1P9NA 1F8GA 1XZDA 4AYTA 4NTZA 4KEAA 1D2RA 3PNBA 1Z6YA 3GXBA 3RHTA 2J6IA 3NTLA 3RS8A 1WZCA 3WGKA 1LK7A 3ELYA 4Q1BA 4V0MA 4YB8A 2SHKA 1DADA 1PR0A 1U2PA 2RG1A 3BGWA 1FYXA 1OAOC 1LH0A 5LP6C 3V7FA 2G4CA 5AW3A 1MB0A 1K8RA 4IV5A 4BNJA 2NO7A 1CQIA 1LEHA 3LPLA 1MBZA 4LAFA 4XASA 4LJ7A 1N5DA 3L0ZA 4NH0A 2DBQA 5HZHA 4IH9A 2VT3A 5BRJA 5JXIA 3V4PB 2YRWA 3DDNA 5BSRA 3TZBA 2CHVA 2PZMA 4JVSB 5TVKA 3H9GA 3PF9A 3PHHA 3PNLA 1RDFA 2WRZA 4KFUA 1YR6A 3UFBA 5IANA 2AA3A 4Y7CA 3V4SA 1SUDA 4AG6A 1J2RA 1YJXA 1T8PA 4OP2A 1MXHA 4QOHA 4AK9A 4F6RA 4DLWA 1E6UA 4B7XA 2DOKA 2YXPX 4DSUA 1ENZA 2XE6A 1RC8A 3ABIA 3EXG1 3IT0A 2BM0A 3KUKA 4TROA 5HKKA 2NSYA 1LGYA 1JPUA 1W4AA 1Z7GA 3DKVA 3GCWA 4RQUA 3A1FA 4H4EA 5DHSA 3ESYA 3F4BA 4YP5A 3S2YA 4RY2A 3UM9A 3MVEA 1S2IA 2CN1A 2SBTA 1NONA 3OKPA 3PIIA 4M55A 1K6IA 4MITA 3IUJA 5TQ0B 3WIVA 5HW0A 3FI0A 2CNKA 2EGGA 2XAUA 3HUFA 1NDQA 3NVAA 1IXKA 5E0OA 1U0LA 5HUJA 3JYQA 1GFWA 1GNVA 4KQGA 5DLQC 3VX4A 2FX5A 4HAOA 3WOHA 1JX6A 2FEKA 4YRDA 5E6UB 1OAOA 2JHGA 3P2IA 4DW8A 2IX3A 3SZMA 5LP6A 3T3OA 2RMKA 3U40A 8ADHA 4CMEA 2HXYA 3GQBA 4KE9A 4NV0A 4UM5A 1PJZA 2AMFA 3O93A 3QF4B 4QHYA 4EKYA 3N8DA 4ETNA 3A27A 3OAAA 4ZARA 1DBSA 3C3CA 4RA6B 4PX9A 3EOZA 2Q3MA 3R3WA 2X5XA 4J6FA 5FLKA 3SBXA 2QTHA 4RKWA 2NU8B 4DRYA 3W90A 4D82A 3KTAA 2YZMA 3MLAA 2EJVA 1JXMA 1T34A 3LBAA 2Q7OE 2ZJYA 2RG7A 1L5RA 2M6KA 4A82A 1DO0A 1MB3A 2OHHA 3B78A 3ESDA 3GFVA 4XLZA 4NCAA 5FPKA 4CR8A 1U02A 1KK0A 3B51X 3KEFA 4RE5A 1JN0A 2PKYX 2OAQ1 2XGMA 3EJ6A 5AI0A 4B3HA 2DJIA 1CVLA 1WXWA 2HQSA 3AX6A 3LLMA 4Q7LA 2GKGA 2YWHA 4RLQA 5BW6B 5BNTA 1LW7A 1IG0A 3VYUB 1PUIA 1YQ9A 2AOTA 2QX6A 4KN8A 4I9NA 3KR9A 1YGYA 3ZH9B 5KMGA 4HZGA 3CBGA 3A9WA 4JC5A 2PGDA 2QRNA 3H4MA 4F86A 1BCRB 3N39C 2PT9A 4IP0A 1KY5A 1USUA 3OA2A 1AQ6A 4QOEA 1YJ8A 5AJVB 1B2LA 3U5ZB 2R65A 4AJ4A 2E49A 3RC9A 1MOQA 2FZCA 4P7FA 3ZIUA 4Q12A 3UKJA 3G3EA 5I8ZA 5P8WA 2WDPA 2WG1A 2L82A 1T0UA 2Z3ZA 1R0KA 1XCOA 3L0OA 3I5MA 3QZUA 3UUWA 4DQDA 4KNYA 2Q1XA 4OL9A 3WXMA 4DQXA 1VRWA 1X1CA 1E18A 1E9VA 2ERCA 1OJ7A 2YBDA 4QRIA 4DJDC 3IDQA 4X8LA 1P5JA 2OHXA 4WVLA 2ZDGA 2V7VA 1OJLA 4MIKA 2O8CA 1U2GC 4Q9LA 2P2GA 2JAWA 2IUTA 1RHJA 4OQNA 4IF4A 4OGGA 3GCGA 4K8RB 1T8YA 4KQKA 4NFHA 4V0RA 3VR4D 3SSMA 1Z4KA 4GWLA 4EJSC 2Z95A 4KX5A 1M9NA 3ZU3A 5K0NA 4B47A 1Q95A 2QMUA 1ZK3A 2H0AA 4Q6WA 4LYJA 3DP7A 4IEFB 3DKPA 1JUDA 5BOVA 1I7LA 1Y34E 1HQYE 3DT8A 4DZRA 2IP1A 3SKVA 3HB4X 1ZUWA 3SKXA 4X66B 2YXBA 2AKAB 1CKEA 3V8BA 2ZE8A 2XNHA 1M5TA 1Q1GA 1U04A 1TC1A 2VP2A 3AJ9A 3EXFA 3OZEA 3ZUPA 2WIKA 3TNYA 1V16B 4XUDA 4C4YA 3ZDQA 1Y1KE 3ZS9A 2Z5FA 2C3MA 3G2QA 3ZD8A 1JU9A 1GG2A 4A3SA 1A9YA 3QUAA 4L08A 4BAZA 3FG9A 1AS0A 3ELBA 4L5IA 4ALLA 1M0EA 4RCYA 1T3GA 4PQRA 5ED0A 3ZXIA 1ABEA 1JJBA 5L95A 3VGJA 4QJ4A 4UEKA 1FDUA 2GASA 4HSEA 2XCSB 1NQXA 2I2FA 5JC8A 4M21A 3ZE8A 1T24A 2OLJA 2J9RA 1GR0A 5A3JA 2AW3A 3W1WA 3UQYS 4AY4A 3CRW1 3I9V1 2BKAA 3P2MA 4RPGA 3MXTA 4OQYA 5DGXA 1U2GA 2IZ7A 3FTQA 3JQEA 1J8FA 3D3WB 3FGPA 1EP2B 1YHZA 4UTZA 3HLYA 2X1HA 1XTSA 4MV4A 1F0PA 4BFTA 1ZMXA 3GLUA 5EKDA 4AF7A 1XYGA 1E6EA 1YVUA 1XKTA 1B6GA 4TLBA 4PINA 4JEHA 1N0WA 1E1QA 1MT0A 3GG9A 1LNSA 3GN1A 1M2JA 1ZN2A 3QKWA 2HD4A 4JJFA 1IN4A 3G02A 3OI7A 4HF7A 4FYYA 2R4TA 4EZBA 2VUTA 4QE3A 1YZFA 2FFJA 2KMLA 5AW2A 3BRWD 1E5TA 4YRPA 1E2NA 2EJTA 2PGIA 3T5BA 2C2GA 5JTUA 4UTRA 2CSXA 3LCUA 3IR7A 1VTKA 4O6VA 3ZEIA 4G6ZA 3UPTA 1H3FA 1QC5A 5ALOA 5C35A 4ESVA 1EFKA 3RLIA 3VI4B 4F71A 1QRRA 2A58A 4DJTA 1PZGA 4MRVA 3IRVA 2H31A 4PX2A 1Q1QA 3AGQA 4X1YA 3TQTA 3V00A 1JDPA 1SG0A 3O47A 1Z5VA 5KDOA 4NOJA 1KH3A 3E5HA 4BJHB 1KI6A 2XTAA 3F96A 1EX1A 7ABPA 1ECLA 1TYBE 1ML3A 4DDTA 2OSVA 2ZYSA 3G2OA 3I9NA 3ZR4B 5IYZF 2H4FA 3F74A 1OXVA 3OIGA 2V6MA 2WUEA 4BLWA 1CIVA 4TVOA 8GPBA 2PMBA 1A0OA 5K20A 2CJWB 1OWOA 1R6VA 2HQRA 1GG8A 4IKPA 4G84A 1HDIA 3G13A 5IKOA 1TVKB 3CCBA 3BRCA 4EMUA 1R5OA 1AB5A 4XYLA 2H1VA 2ZRJA 3JPYA 4IIHA 4MGKR 5C4GB 5IAKA 5SYMA 1X9GA 1PTJA 4M1QA 4OQEA 3Q7EA 1CYDA 5A4AA 1EZ1A 1K9VF 2Z5VA 4KP7A 2EEPA 4NCNA 1ZUNB 4ITRC 2YOGA 4F96A 4FSDA 2R6JA 1I6LA 2E7ZA 2FSVC 4R9NA 4YI5A 3GWGA 1KYWA 4OM7A 5DBIA 3TJZA 4JSYA 3PQ6A 4C43A 3RADC 5DTQA 4FFVA 5TY0A 3RFVA 1NWHA 3KXLA 1P5FA 4JVLA 1R00A 1UDCA 5BSKA 4KSBA 4NESA 3ND7A 3PGVA 5E8RA 2ASVA 3UVEA 1JEDA 3WBFA 4DTIA 3GPBA 2NO4A 2OCAA 3EA5A 3HSYA 4K7JA 4F4IA 2BR3A 3VDNB 4HEHA 3KTFA 4BX0A 4L0MA 4B4WA 4G4GA 1SBZA 3KR0A 3TL3A 2C96A 1ZUHA 2I7DA 4RD6A 3OTGA 1P4GA 2H16A 2IYUA 2XYVA 2D5IA 4R1OA 2DJ5A 3MTEA 3L6BA 4BNNA 3RVNA 4HS9A 3LYUA 3M2TA 5DYGA 1R9MA 5DVZA 5JS6A 1L5MA 3VC7A 1DKNA 1UUFA 5K3BA 4DSTA 4URXR 1GZ6A 1IBMB 3W5BA 1EB9A 2HA6A 4G4IA 4JC0A 4CL0A 3A4TA 4OQ4A 4CPDA 1HG1A 2CUNA 2HCJB 1YXMA 1PT9A 2ZT6A 1QANA 3GU3A 3IPYA 1STOA 3QFSA 4KQXA 2C7QA 3FHTA 2WJ3A 1BXKA 4R84A 1MCZA 1GQOA 4DLZA 1QX4A 3TUIC 1DE0A 3FRHA 2ZUCA 2YN2A 4P3XA 1GPYA 3AV0B 2FSVA 2OOSA 1E2KA 1EP3B 1Z4JA 4JB2A 2FG5A 2IHBA 3KKPA 1SBHA 2ZPTX 2HIHA 1RTKA 1IBRA 2ZTUA 3DLBA 5FQNA 2IPNA 5F1OA 4YXWD 4FGUA 1VL2A 3VDRA 1RQ7A 4IEIA 2ZYUX 5BR8B 1TYDE 2F3UA 1UDRA 3KQYA 4QUEA 4BEWA 5JFOA 3G9UA 4QYIB 1VE1A 2GZ2A 2DEUA 3LXXA 3U4QA 5EZ6B 3A8TA 4BAUA 5B1EA 1DQYA 1Z34A 3RVMA 9LDBA 3BFXA 3GNQA 4N47A 4JB3A 5IYZB 2JLBA 3FRIA 4KHPB 3SEZA 1N8KA 1G3RA 3WLQA 3QVWA 1CJKC 3C1AA 3FGZA 4BGEA 4YLEA 3E7PA 4D41A 5MFZA 4UCXA 3ME5A 4WBNF 2FMIA 4GUAA 5A4IS 4IICA 3A2MA 4P86A 1IPHA 4GOOD 3D9QX 4XXHA 4N18A 4Z1MA 2ZWMA 3PVZA 4BKPA 1P7YA 1ORTA 1UM9A 2MYUA 3GZNA 4F5DA 4GLJA 1RXIA 4W6ZA 5F64A 3R7AA 3EISA 5K0ZA 3A04A 2CDRA 3CZQA 4K05A 2RFLA 1RACA 3DL7A 1D4ZA 1O89A 4B7ZA 4ZJUA 1C7JA 4ZVTA 2AOUA 1CJUC 2JAXA 3ODGA 4B7UA 4XW2A 2A3RA 1VSQA 2P9EA 3W8DA 1H3NA 1XD8A 3V9AA 4GPTA 2JATA 1WSAA 3F46A 1XB2A 4C1BA 1CQIB 3ZE7A 1FY2A 3VOTA 4LJSA 1PL8A 1X42A 3K9WA 3QLEA 1CG6A 3GLHE 5EE3A 2FPXA 1KVQA 2F1HA 3CKKA 1NW4A 1RLMA 3PNOA 4HQ6A 4TTTS 3EYWA 4ATNA 1ZMTA 3CT4A 4U39A 1KPHA 4U2KA 4LCBA 1CULC 5BYKA 1C0IA 2FNAA 4F6RB 2PAFA 3BCRA 1KP2A 4YJKA 1DTEA 2ORIA 1CY8A 1V39A 3WLTA 1UP7A 4BAGA 4BFZA 4JDPA 3TTSA 1DAPA 1SCKA 5B2FA 1MC1A 2PUHA 4UW9A 2SCUB 3W5VA 2XVYA 1PFYA 3PL5A 1DC4A 4MYCA 4FFWA 1K89A 4GUDA 4WSOA 1LU9A 4YRRA 5B6IA 3SYMA 1RI5A 1E6KA 2RIRA 4LOJA 5L3QB 3ZE1B 4EBFA 2I99A 3CUSA 5KCMA 3DBIA 4LF5B 1TB4A 2VYFA 4F3CA 2X9QA 3C87A 4ESEA 1TM7E 3RT9A 1USVA 4ARAA 3A11A 5JAPA 5AI5A 4Z8XA 4RH1A 5A6VA 2Z3WA 1G3QA 5CTAA 1TA9A 1OFVA 2PV0A 4E7OA 5C0OE 4LVUA 3RTBA 3LKVA 1XVVA 3I2YX 2C2WA 3VI3B 4R31A 3J81k 3P9SA 4OHBA 3R8XA 2DFLA 2FPLA 1QKIA 1RHRA 4BJ5A 2I8CA 1T5OA 1G55A 3AF3A 2TRSB 3GQBB 1KO1A 3L8YA 1HEIA 4HGQA 4JA0A 2EBHX 2TMYA 5DBHX 3GEBA 1I94B 5FV4A 2DERA 1ID8A 3DPSA 4KHZA 3LUCA 5EQFA 4QYTA 1PVOA 1NXSA 1V1MA 3ZXUB 1VZ2A 5SZIA 3HU5A 2A7QA 1VE9A 2Q1YA 1I3LA 2KBEA 3BQNB 1U90A 3E7DA 3E9MA 3ICWA 3KTAB 3TUJC 5KNBD 1M1XB 2ZI5A 2IA5A 1LWNA 2P75A 1VOTA 4JB0A 1QHXA 4I1VA 3SS8A 1W5TA 4JQZA 1QK5A 1DRJA 3FYDA 3KVVA 1J6UA 2I80A 1BYIA 3R75A 3HR7A 2NO9A 1VMDA 4X95A 4K28A 1P39A 5CT8A 2OP0A 2QN3A 2O14A 4RSMA 2EHJA 3T5GA 3AIKA 4MRMA 4D9CA 4FEGA 3DLPX 1QFJA 2JCYA 3CW9A 3NTXA 2R6CA 5I7RA 1AZTA 1R16A 5IKMA 4YJGA 2AOTB 3Q3JB 3R40A 3TI9A 3WNZA 1J0DA 5KMGB 3BCUA 1MEJA 1KDOA 2IKSA 4BMXA 1MF7A 4NFYA 1MO5A 4WZBB 5ER6A 3L2OB 4NENA 4HWKA 2PUEA 2HDNB 3C7KA 4MS3A 1FC0A 3Q12A 3QW4B 3QNMA 1IK4A 5LR6A 2AEMA 3ZQJA 3ETLA 4QOJA 4K9SA 3EZ6A 3I32A 2QMQA 3PB3A 4LS3A 5DSZA 3D59A 3PYLA 2BFDB 4YH1A 5FX2A 2I4RA 3DV0A 3L0CA 2IQIA 3LX4A 1ADJA 1Z74A 2P2CA 1HE3A 2WYIA 1HDZA 3ZZNA 4YRNA 3GLFA 4MVJE 3F8WA 2WQZA 2VPYA 2XDYA 4IQ8A 1Z73A 4O4HB 3NWBA 4UXHA 5U4QA 4D99A 4KR9A 2O8CB 2WTXA 4B6QA 3CT6A 1UPXA 1T8RA 2WJYA 3U0BA 4UBJA 3VPCA 4BPRA 3FJ1A 2DTXA 3Q4GA 1AKUA 4EYSA 5AUQA 4ZZ1A 3WAGA 2MSLA 2X9LA 4QYXA 2HKIA 4DUYB 4I9GA 3DF7A 5KC9A 5CEJA 3G7SA 1T3TA 3LCRA 3NWPA 2L2QA 4N5NA 4YHBA 4OQQA 3DFZA 1BYUA 1HQKA 3KBBA 2P5UA 1EQUA 3HBJA 4KYTA 1FLDA 1USKA 2VQ3A 4JIGA 3FGNA 1JGTA 2L42A 4PIPA 4F6CA 2K87A 4TRJA 5I7WA 4TLLB 5KPDA 3KETA 3CX7A 1GAJA 1QZUA 1V4VA 2IEGA 1E2DA 2CDCA 2WIDA 4OOFA 3SBDA 3U9TA 1N2SA 3TVTA 3EXFB 2QUAA 3HUEA 3KFVA 2VSXA 4G2TA 5HIMA 1JZSA 1BJTA 3U5TA 2KPOA 1EFHA 3A06A 4NK5A 5D3KA 2RJ3A 3TDNA 1DWPA 3ROXA 2O8DB 5KPJA 3GJ8A 3O4HA 4LXGA 4RD0A 3IYLW 1YC2A 2ZRLA 3DZCA 3RODA 4CLRA 1E99A 3ZV4A 3OM0A 1ACLA 2QPOA 5DGDA 4WDQA 3L8ZA 3PR2B 4B6JA 2QD4A 2GHRA 2OHIA 3OCWA 3SR4A 1KYZA 1AHNA 1JLRA 3M4NA 2XYRA 2G67A 4NP6A 3RB8A 3T7JA 2QG4A 4B2YA 4R9UC 1ZNZA 1SHTX 4HH3C 3BJZA 4IJ6A 4B3FX 1Z29A 1DKUA 1Y5RA 3K1AA 1KRXA 3PQCA 3W2HA 4DQKA 3QFCA 3HK2A 2HRRA 1YKSA 1H65A 2JA1A 2O2SA 5IEJA 2IL1A 2X4IA 2XJ4A 4AJKA 4Y2XA 4HWSA 2AI3A 2W2LA 1MU0A 1RYFA 1IY1A 1Q11A 3SK0A 4DOMA 1VSUA 3FUTA 1Z6AA 1U2QA 2QTGA 2JIBA 4EJSB 5L7WA 2O8FA 2QMEA 3PRHA 3D8TA 3GF4A 4PM4A 2LBPA 4BYGA 4QBHA 2GM4A 2QM3A 4N40A 4F4HA 1P0CA 4QTUB 5JZSA 2PJUA 4PYJA 4GX1A 4DV1B 2M98A 4JBGA 2IPMA 3AOGA 1P8JA 2ZRAA 1BW9A 4RS3A 1TM1E 2QNRA 4R7GA 3W04A 3P9QA 3FNHA 4JL6A 1NVBA 1R6AA 2HN9A 3TLJA 1PYOA 1J8MF 1R9GA 4AX8A 3JAMA 2Q28A 1WXXA 3U3RA 4FT2A 1QC5B 1AQUA 4I4CA 4ZIRA 5DNVA 4NJMA 4WZ6A 4Y1RA 5FL7A 3DMYA 4X1YB 5ALTA 4B46A 1V3UA 3ZCVA 2QLFA 3MCZA 4A1FA 4YO7A 3UUFA 1CHDA 3BWDD 4B45A 3G2PA 1CR0A 1KI6B 3D4IA 3QYPA 4HEA1 2PSFA 2W71A 4ZEOA 5AM1A 4ICIA 1IL0A 4LDQA 4RLSA 5F1KA 2XRYA 1SXQA 1DEAA 2HZBA 4HGYA 2YJ4A 3ADOA 2JANA 4NU8X 4F3KA 2XZOA 1NAHA 1P9WA 2BOVA 5F1PA 3UV7A 4D8UA 4PFSA 4XX0A 3N2LA 2GD1O 5J4VA 3U6BA 3GEIA 2WNIA 3L6CA 2W90A 4DR4B 1NJFA 3AJEA 3RC1A 2DFVA 2A5DA 1WPQA 3M1LA 3HM2A 4Y1EA 5CK4A 2R3SA 1O7JA 1US8A 3GPLA 3Q6NA 1SXJD 1PZNA 2K5UA 2EZTA 2PRIA 1UKCA 3ED5A 4GU5A 4E5PA 1P9RA 2B8WA 2WF8A 4KIWA 3ROTA 4XWKA 5KTYA 5TMPA 4KLCA 1HO3A 1WP4A 1NRIA 2FR8C 1IN5A 4V0SA 4B3XA 2OXIA 3L93A 2DQSA 1K8YB 2G5TA 1Y8AA 3ZDFA 2HNKA 3FB4A 1YZGA 4QNNA 4E70A 4TT3D 1OB2A 3UMJA 1Q0PA 3NM5A 4D45A 1RLJA 1HI9A 5JMTA 1H3EA 4XRRA 3IULA 3FPFA 2OORA 1XRRA 5D6OA 2FH5B 2X41A 4UVDA 2HPZA 5J3JA 2GD0A 2QD1A 2IYFA 1SR8A 3OIWA 4EJMA 4XIYA 4JR0A 5LQUA 5KKNB 1BFUA 1WS6A 3EAFA 2LCQA 5A9SA 5BSEA 3EWNA 2XMRA 4AO7A 6REQA 1NC1A 1U0NA 3A2NA 1DFIA 1NXWA 3BH6A 1RADA 2NVOA 3ND9A 4ER5A 1TM5E 5EEGA 3QSYA 3WLEA 2JGJA 3GJ0A 4Q1FA 4WUTA 5GZ3A 1P0IA 4MUKA 1CTQA 4M9QA 1SU7A 1VGVA 5DRYA 5G3ZA 3V32A 4NBVA 4BO7A 1L6IA 4EM6A 2GTIA 3GL9A 2ARKA 3RNOA 5L40A 3GZJA 1BQEA 1LX7A 5L3ZA 2JGDA 3LUKA 5FWDA 1J07A 1I7SB 2NGRA 3TGLA 2YY5A 3OIYA 2QENA 4U7TB 3TD6A 1TA0A 5DM0A 1K86A 2CUTA 2VJBA 3HVUA 3WK5A 3P9RA 5HA5A 3S5UA 2C7PA 1G8FA 1JR4A 2TSYB 3C4VA 1P2FA 3Q0IA 4K9QA 4MUAA 5L4LA 1QX3A 2UYGA 2FR8A 3N0TA 1KEZA 1SY7A 3Q2KA 3QMWA 3BWVA 4ZAZA 1U7PA 4EQ6A 3QVGB 1E1RD 2O2XA 2BEUB 3UKOA 3MTAA 5AVKA 5K3AA 4D02A 2PTHA 1WCWA 1Q0SA 1Q7TA 3QP9A 2A3NA 4DIFA 1L1RA 3AHJA 2P5TB 4BWFB 1J1IA 1U1EA 4XUCA 2JNWA 3GR6A 4IPTA 1VHQA 2Q1TA 3ESCA 1A5AB 2Y0DA 1DG1G 1E2MA 1UBEA 2G3YA 1U8UA 3L4EA 5CX4A 3T3EA 2ZJ3A 2Y0CA 4JBNA 5ADUS 2AX4A 3I8OA 3DMFA 4WVFA 4CT5A 1W6UA 5J58A 1IHYA 4HXYA 1E2QA 5JLJA 3U4QB 3QFFA 1GN8A 3N7TA 4C07A 3CS3A 3L6OO 2VZ8A 5IJAA 1JEEA 4DGQA 1XEXA 1JKMA 1Z15A 3CONA 4EPYA 2GX6A 4EKDA 1H6CA 3C16C 5CH3A 1VKJA 3UY4A 3IUQA 2Z9DA 3WSWA 3RK4A 5B1HA 4EGQA 1KDRA 5SY9A 1X87A 1FB5A 3OMXA 1QGUA 1DZIA 2MSEB 1XBTA 2AX3A 4YAJA 3BZBA 4GOND 1NU6A 3QPDA 1YIAA 3GRFA 4HADA 5AT1A 4HTFA 4QECA 4JU9A 2A33A 1GTVA 4IUCS 3EVZA 1PO7A 1UM9B 1K6JA 2CHFA 5A7HA 3GZNB 3SHVA 4JLOA 4QBIA 5CG1A 4UDOA 1RJ9A 1CUSA 1RRCA 1WBDA 5AHXA 1XPRA 3EA4A 2QI9F 5F5LA 4INOA 1S1MA 4GIBA 3RK1A 1F3LA 1U0BB 2G9VA 2PR2A 2AOUB 3CUVA 4TXNA 5LQJA 1BVYF 5KYYA 2Y6VA 1DIOB 1F8FA 2FX3A 2DFNA 3CXRA 3FDIA 1MJGA 3A6ZA 3CRZA 3O73A 2PLRA 2XKJE 4R16A 3S1AB 4MW0A 2PKWA 4MPJA 3RU9A 4CM9D 5K0FA 4DCJA 1YZQA 3EARA 1NUQA 4RV9A 2VQ6A 2EERA 1GPDG 3IPCA 1B6TA 1TPZA 2PKQO 4I0WB 5TF4A 3UBMA 1C30A 1VYVA 4X6LA 2JJ2A 2WSYB 3H3JA 1Z8NA 2JJ1D 3ONFA 4G67A 4CLDA 3GEEA 5HQ3A 1XZHA 4S05A 1NX9A 3BE5A 5D6NA 5EE9A 1EDBA 3DR5A 4RW0A 3NJ4A 1KP3A 2OLEA 2OHVA 2HM7A 4RTOA 1VG1A 4KN5A 3GUHA 5HUHA 2Q4TA 2EJCA 5ICEA 1YUMA 2CVZA 4MW6A 3DTTA 2HI0A 3T34A 1HETA 3BSWA 3I01A 1CNEA 1NR1A 4ASUD 2X9GA 3LYLA 2X8AA 4J4HA 4HNHA 5A9RA 3J7AC 4C22A 1PAUA 5A2GA 4US2R 4IV8A 2FUCA 2FW7A 3EZXA 1FTWA 1Q12A 3K1TA 3MAJA 3QENA 1TRHA 4NBWA 1KZ9A 2O7SA 3IAAA 5DTRA 2IS6A 3L77A 1M2HA 1K0FA 2A9JA 2CNWA 2PTGA 4E2WA 3NZEA 2AZ4A 1VIDA 1M2VA 2HMWA 4NOLA 2CCKA 2O1WA 2Q3FA 4M0MA 4IXDA 1EK5A 1IULA 2EZ9A 1FUKA 5BVHA 3LQKA 4IDOA 2B8NA 1SVUA 1U9JA 1V37A 2CMGA 1UKAA 2OXFA 3B2QA 3E35A 3E3OA 3PE4A 3F67A 2JJ8A 4KVZA 4MUYA 2C9BA 4MGIR 1L5NA 3UK2A 4PQEA 3NIGB 1D6NA 2E21A 2OSBA 1Q44A 2QXYA 3CRMA 1LLFA 3IHTA 5C1OA 1G20A 1MTOA 1S4QA 4UBIA 1ID1A 1B0UA 4MZDA 5IUJC 3WKDA 1A9PA 2IQ5A 4DA6A 3KPUA 5CA0F 5I48A 2FZGA 1KMIY 1E64A 1V1MB 2DUJA 2GVNA 2V7XA 3KOOA 1NT4A 2FRXA 3GUVA 3D7RA 3OKAA 3V80A 2NV2B 5BWOA 2HT1A 3KK0A 1XTZA 5HX7A 2XHZA 4MEBA 2FK8A 1G16A 3PIRA 5K4GA 3KKZA 4H31A 4JDUA 1P3JA 2F00A 4URWR 5EPUA 1SVKA 4PC2A 1RIIA 2OXCA 3CB4A 2JLXA 3C5EA 3PJRA 3QPVA 3V8VA 1E58A 5HGXA 4G9BA 3GFFA 2MOKA 5C9ZA 1UODA 1SQGA 1VI5A 4DNXA 4YT4A 1JSXA 3RJ9A 4MRMB 3ZVNA 4ZVLA 5IXJA 2ZUVA 1YFZA 2B1RA 3IIMA 4MVJP 4CMIA 1JEYA 2EGUA 1GA4A 5H1YA 2SNIE 4ES6A 4FEYA 2WE7A 2GM9A 3OFSA 2I2CA 3M33A 2CEKA 4U02A 1P5HA 3IOEA 2QJOA 2Z2IA 3A9TA 1KO8A 3PXDA 4KYUA 4KRFA 1IY0A 4NENB 3G9XA 2DUUA 4GSYA 4MS3B 2Z9BA 2ODEA 2NU6B 4MKHA 4S24A 3BWEA 4M7RA 1XTRA 1DBQA 1YI1A 2VJDA 4PX3A 2Y3IA 4KH1A 1KSGA 3E7FA 3TLCA 2HJRA 3EOBI 3TQFA 4BP9A 3KLMX 1QYXA 3R41A 3J81A 3UCXA 1KBOA 3FSRA 2GLTA 5BT9A 3W4JA 1Q1EA 1TVCA 2CVHA 2H3EA 2HRDA 4KK3A 1W7AA 2LKDA 2BH2A 3QA9A 3BH0A 3S81A 4HHEA 4GZ5A 4A27A 1IEQA 4CTNA 4JOCA 3O1HB 2JBHA 2ZATA 2ZBRA 5BQ3A 3FXAA 3PDIA 2ZR8A 2A94A 4D0SA 1JHYA 1JQ5A 3WS7A 2R8OA 1Q77A 4S1OA 3ZWQA 4QPJC 1EFAA 1IM8A 3BMOA 2H1HA 1BGWA 1Y9EA 3NKFA 1RC1A 5EZSA 5LMZA 2IS1A 2OV2A 3DKIA 4JJAA 3K5PA 2O57A 4P2BA 2ZRFA 4ZQEA 1FVFA 2Q5CA 4XQ0A 4MEAA 1QBGA 2ZRHA 3DM9B 3HA3A 3QU4A 3LZCA 4L1KA 1OHHA 2VJCA 4P0TA 4AS3A 2ODPA 3M1YA 5BOSA 3FOAA 3D8UA 4FW9A 4RJJA 4ZJYA 3KJGA 3FBTA 4MUGA 4ZPXA 3RBZA 3TJMA 2FN4A 5DHRA 3RVLA 4A2CA 5J4KA 5FYDA 2OO5C 3AWDA 3BGIA 1PW5A 4FQ7A 4A15A 5KEIA 4L02A 1DTWB 3FF1A 3T9AA 1TZ2A 3P0HA 3WIDA 5JHGB 4PSAA 1KXJA 4OAOA 1Y4DE 2HYIC 5DBGA 5IM5A 5EIBC 2AG1A 3GK3A 3W6ZA 4CLRB 1KO7A 1IXYA 1N1EA 2P0YA 1SBQA 3MTIA 5JCZA 1ZN7A 1TC2A 3BTOA 2WFZA 3WK9A 1Z26A 3PXCX 3HZRA 4F06A 4POOA 4F2HA 2ZGVA 4UARA 5LPNA 1SPXA 2V6IA 4B3RB 5ABPA 4Q3OA 1IVNA 1XQWA 2XOKD 3GPCA 1Y7PA 4AWXA 3BZWA 2QMZA 2Y1GA 4UCQA 3UAOA 4YRKA 4YS6A 5CA0B 4UAGA 5ADVA 3K1AB 3L0IB 1XD2B 4IKEA 4OKSA 3L40A 3VKVA 4LJRA 2QRUA 2E85A 3G68A 3HWSA 1H05A 4JXKA 1I2ZA 3H75A 5IBQA 2F64A 1EGMB 3LM8A 5JW6A 1KL7A 5KWEA 4N7MA 1M34A 2JGEA 3OOHA 3ZX4A 3LBIA 4UHHA 4WMLA 5DNUA 1WW2A 3LP8A 2P6NA 2O8FB 1I4EB 3BA1A 2IV2X 4FOLA 4NBKA 1R9NA 5TIIA 4C0WA 4DIOA 3N7AA 2YFQA 1M1ZA 3H16A 4FW8A 1ISIA 5TGZA 1IZ7A 2D1YA 3VH2A 4BX3A 7GPBA 3RIHA 4K6OA 4ND8A 4EQZA 5TMEA 1OQAA 2XB8A 3FSGD 4GC9A 5F2EA 1H2FA 3TOZA 2Y93A 4MV9A 4O4LF 4KSCA 2OO5A 3RYIA 2I66A 2DKNA 3VTAA 3LTNC 3BB3A 1I30A 2RHJA 4FE3A 1EFUA 5K2OA 3S40A 4NJMB 2W4IA 2VT7A 5KQMA 4Y9RA 3HNPA 3R0VA 3HP1A 5AJZA 2HJHA 5A5EA 1HNXB 3D0RA 4Q21A 2PZ8A 5HTOA 3H0KA 3BK1A 5DFAA 3O92A 4DLKA 4FDVA 1YQDA 1Z4OA 3JZIA 4WZAB 5DXFA 5EINA 3SLKA 4IIGA 1IY8A 1A5BB 4Q9JA 2VUSA 3ZE9A 1P3DA 4Y0AA 3KT6A 1N5IA 2BFCB 3MOIA 1JDSA 2FWIA 4KN9S 4MOWA 5DI3A 3FR7A 4EHKA 2ZSKA 3KUXA 1X1EA 3CG0A 4QAJA 5IDXA 2Z6AA 3QVTA 1A9TA 4RWEA 3WLAA 2HW8A 2L19A 4XX0B 3DBLA 4JCCA 1MQ8B 1CS0A 4MWBA 4NU0A 5DBOA 1CFJA 4PC7A 3M2PA 4JKIA 2CLMB 1C3LA 1US8B 2PIDA 3OPVA 4H15A 3EPKA 5KX5A 4BNLA 2RHRA 2Y0EA 5KQRA 1CUUA 1WB6A 2V9ZA 5I8WA 2GK6A 1G6KA 3BJEA 1JLMA 3H9QA 3UT6A 3W1EA 2I33A 1K98A 1RHQA 3AF6A 1GU0A 4RTNA 4Q05A 3ZNPA 4D3XA 3EZ7A 4EHDA 1DC8A 3ZI0A 5CDGA 3OEWA 3TCXB 2R47A 4F45A 2D0OB 4E3WA 1FF9A 4P08A 3WFIA 2CFIA 5GVRA 4CLHA 4B31A 1I7QB 1AVTA 1HLFA 3A1NA 4LRQA 3R0JA 4E2ZA 4AWAA 3K0FA 4NX2A 4FUTA 3ND5A 3O38A 1ZJZA 4DLTA 4KAXA 1JSZA 4TKVA 1NUSA 4JMLA 6REQB 1KJ8A 4YMHA 1JRLA 2UVPA 5BUQA 5M7EA 1QTRA 1XZFA 1O96A 1U9IA 1RTTA 3LRXA 4IDAA 4LIPD 4ZVUA 4C7KA 4MLZA 4HLCA 1F2UA 1GY8A 1P74A 2CDNA 2PPVA 3H7IA 4NYMQ 4OUKX 3A6LA 2OVFA 2B30A 2IIPA 3GPIA 3OTHA 1YZVA 5FI3A 1PR2A 2FKNA 1CQWA 1AXEA 4LDRA 2P5SA 4P22A 3IH5A 3WWPA 2YZ7A 4G3XA 4JP5A 1PGJA 3KKEA 3VO2A 2FW0A 2M6RA 1NG9A 5AJWA 4MKZA 1TTPB 2HHHB 4JSTA 5CLQA 3QBJA 2I78A 2PK3A 2ZZMA 2XSZA 4CGZA 3VHQA 4MCHA 1MDFA 5KU1A 2ZPUA 4JQOA 3EF0A 4R1LA 1P44A 4RTPA 1O03A 3ZTWA 4TL7A 1YR2A 1TNDA 3LPAA 5C8VA 3SHWA 2F8SA 1G8GA 1NKVA 2Q3LA 3C0KA 4UC0A 2H1OA 3EXIA 5DHFA 1KJNA 3THRA 3DEHA 1AN0A 3L9XA 4O4LB 4JLAA 4YDHB 3J7TA 4Y2SA 2GO1A 4WBSA 3RTDA 1N0IA 1SKYE 4Y2GA 2VSNA 1PK9A 3DTVD 4QQNA 2VF7A 3CVOA 4U3JA 1KVTA 3TW6A 3NUZA 4O0MA 1IU9A 4MUFA 4F4UA 1Y8CA 4J0HA 3WK4A 2ZBUA 1X6VA 4H7IA 3L0SA 3VU0A 2VPZA 4F9FA 3WWEA 2CF5A 1XXHA 2IELA 4F60A 2IV7A 1IOWA 2CLOB 3FB1A 3C1OA 2CYCA 4LJ6A 4PNHA 5C1BA 1YTUA 3B1ZA 4WUVA 2BGWA 5AVYA 1F6DA 1USIA 5LUAA 1M54A 4KRXA 4QXOA 1R0BA 4IHJF 2Q6TA 4PIVA 4YAIA 2Q9AA 1I1OA 4ZD6A 1QOPB 2BRUC 2D5LA 4TYNA 3H6HA 4MW1A 2XA2A 4U2GA 5A9TA 3WO1A 1ORIA 1GRVA 5TEVA 4QPPA 4NZYA 1YD7A 1YB6A 5EIEA 1QGUB 4Z0PA 2GCEA 1M2FA 4CQMD 1PRYA 3SX0A 3V1YA 2IS2A 2A9FA 4IMIB 4AKGA 4OGWA 4JNKA 2GPAA 3COPA 2XMZA 2Q6OA 3M6LA 3F5QA 2BUBA 4BNHA 4YMVA 1BKYA 1I1NA 4Q1CA 5AH0A 5H4GA 4NDNE 2AUMA 1RJ9B 4HQ0A 5GGYA 4JUAA 1BD4A 1XZ8A 2P4SA 4RGYA 3RFXA 2ZWIA 4OX9B 3QVLA 4TMTA 4W5QA 1O57A 4WRRA 3V7YA 3T3HA 1I7NA 1MFZA 4B2LA 4O3MA 2ODQA 3NMUF 2XPCA 3CWZA 2JLWA 3AR8A 3C6MA 1S7GA 2JFBA 1E7QA 1L8QA 2GNPA 4RQTA 5KYYB 4CV0A 3P9ZA 1X8KA 4WN9A 2XUZA 1B76A 4KAJA 3FNBA 4RE6A 2QRVB 4YT2A 1RYDA 2EWMA 4AY2A 2RH4A 5J23A 3N2IA 3AEKA 2OV6A 4Z9AA 1LPOA 3S27A 1TQ8A 3PGJA 1C30B 1QE0A 1OTHA 4IWXA 2QIOA 1HTWA 2WF6A 3JQPA 4BO6A 2HO4A 1V0JA 2O9JA 1KI7A 3LECA 2W8ZA 2XCQA