1WF6A

The third brca1 c-terminus (brct) domain of similar to s.pombe rad4+/cut5+ product
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
132
structure length
132
Chain Sequence
GSSGSSGSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVVGAKWLLECFSKGYMLSEEPYIHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Similar to S.pombe -rad4+/cut5+product (A40727)
publication title The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product
rcsb
source organism Homo sapiens
total genus 17
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1wf6A01
3AL2A 3K0HA 1JNXX 3UEOA 2JW5A 2K6GA 3UENA 3T7JA 3SQDA 2XNHA 4Y2GA 2INGX 2EP8A 3I0MA 3EF0A 3PXAA 1GZHB 3T1NA 3PD7A 4OFBA 2WT8A 3COJA 4ID3A 3II6X 3PXBA 3QVGA 3JVEA 3PXEA 1WF6A 3U3ZA 3KTFA 1T29A 1OQAA 5ECGC 4Y18A 3L41A 3K05A 4BMCA 3AL3A 3PC6A 4XPZA 3L40A 3T7IA 2VXCA 3PXCX 4JLUA 1N5OX 2COUA 3T7KA 2E2WA 3K16A 4BMDA 4U4AA 2L42A 3FA2A 2VXBA 3EF1A 2ADOA 1CDZA 3HUEA 3SHVA 2LE0A 1L7BA 1T15A 1IN1A 2EBUA 2M2IA 4IFIA 3L46A 3PC8C 1T2VA 1Y98A 1IMOA 3SZMA 4IGKA 2COKA 3HUFA 3SHTA 2HTFA 4BU1A 2D8MA 3K15A 1KZYC 2DUNA 3K0KA 1Z56C 2XNKA 2R1ZA 2COEA 3I0NA 2ETXA 3PA6A 1L0BA 4BU0A 3PXDA 2K7FA 3OLCX 2EBWA 4XQ0A 1T2UA 3QVGB 4N40A 2NTEA 2AZMA 3PC7A 3PC8A
chains in the Genus database with same CATH superfamily
1AS0A 2IXTA 2IZ5A 3ZY5A 4YP9A 1MR3F 4R8VA 1N6PA 4ME6A 4JT9A 1FVXA 2JIBA 2CNBA 3JCZA 3QY0A 4TVBA 1NMXA 4PO3X 4ZA2A 4DJTA 4JBHA 4NI5A 2A6PA 4RZ2A 1I14A 6REQB 1PTJC 1CF9A 3GJXC 3P7MA 4QHYA 3BD6A 4BPBA 3IEVA 2CLKB 6Q21A 2BKLA 3HNPA 2H6EA 2JBHA 4J16A 4BYGA 5I7FA 3NDJA 2VBGA 2ZBUA 2XKJE 3DOHA 2BBSA 4I6GA 3NKVA 5KOJA 1O97D 2ZVJA 2C96A 5D3ZA 5HF6A 1SXGA 4C0KA 1XD9A 4PO8A 1JVNA 1Z73A 2QT1A 2R66A 3ABSB 2Q50A 3VFDA 3KQTA 4CIXA 4X8LA 3L7MA 3KZNA 5DSTA 5KNLA 2ZWOA 1TZMA 1R66A 3O5AA 2DULA 4G1EB 4NOMA 5FPTA 3U7RA 2WZDA 3RV3A 3DV2A 2WPNA 1NULA 3AHIA 1ULSA 1WUKS 5BNZA 1NKVA 2YV4A 1J99A 4FS3A 1H4TA 2X23A 1A8PA 2REBA 5EUBA 2AN3A 4X0EA 5FHRA 3WSVA 2C4KA 2WB2A 1PW5A 2JC3A 3O8QA 4HEA6 4WINA 1CUDA 3KP1A 2O2JA 4ZQEA 1AUXA 1FFXA 2Q28A 3NUGA 4DV4B 1K5PA 5ENDA 2A1UB 5TJ9A 4PO1A 1OLXB 3K8QA 4ZYLA 1RC1A 2BMFA 2I3DA 1WTCA 4XLTA 1GRNA 5K0ZA 4YWJA 1P2BA 1PO7A 4HTFA 1GAEO 1RYNA 2YRFA 1AG9A 1ODKA 4KW7A 4QOSA 4TMKA 3AR2A 3HNRA 1T3ZA 4ROSA 5TVGA 3SX2A 1GPWB 4G67A 3G8DA 3RM3A 3BIJA 3Q8XB 4B4VA 1E79D 1NW6A 2OHHA 1TEZA 2RC6A 4A0QA 4DBLC 1WW2A 1XFDA 1E98A 4IX9A 3QK7A 4RANA 4ALKA 4I2NA 3Q85A 1FTNA 2RGRA 1R0YA 1U2GC 4EG5A 3FHOA 3FNEA 4IDFA 4CUJA 2XJ9A 4KQ2A 3QKRA 4P0PB 1I2MA 3C5VA 5DN6D 4DUYB 3DDUA 3QFRA 1PJ8A 1S96A 4Q1DA 4D4KA 4DIEA 2LIPA 1LSUA 3H42B 4L78A 1KO5A 1RI5A 1T1RA 2QY9A 4QWWA 5LLSA 3ZJ5A 4B8WA 4EMUA 5KYWB 1PS0A 2PUFA 3NM6B 5C18A 5ALGA 1B7GO 1XSEA 3OBBA 2YRXA 3AR7A 4OLHA 3G9XA 3SM3A 1T4CA 1ESMA 1ZX1A 1K7SN 2PKXA 5DWVA 5FCDA 3M4NA 2FUNB 1KIMA 2ETVA 5WRFA 5JJ5A 1VIAA 4ITVA 1RAGA 3BIWA 4X20B 3A3PA 3OQNA 1V9CA 2PLAA 3AP1A 4P4LA 1L7OA 5AJXA 1WXGA 5JNVA 1P7VA 3CNNA 2C7RA 2POQX 1HE4A 1IG0A 3A9VA 3IUPA 3NBUA 4OGWA 5B3JA 5ARBA 4N6GA 5KKNB 1ZN9A 5EAIA 1PZGA 4F84A 2F1JA 5GVSA 4TSKA 1RKUA 2C5LA 4MCHA 3PEYA 5DTRA 4DMMA 5A71A 3HWRA 1LV7A 1JB1A 4HDKB 1JLRA 3UJHA 3WFZA 3I73A 3ZBPA 2JL1A 3UT0A 5AW5A 1D4AA 4CG3A 3NG1A 4PC3A 5KSPA 4CWAA 3U4HA 3KL4A 3DAFA 4YT8A 3QX8A 1PHRA 4CQLB 2E5LB 1EWRA 2BBOA 1Q7EA 3VSEA 2QUHA 3W5CA 3THXA 2VHUA 3F0TA 1JSZA 3V4RA 5J4YA 3VJRA 1UFVA 1T43A 1TF5A 1H0HA 3DLIA 4LDPA 5M7EA 1RAIA 3C74A 1MENA 5IKOA 5CNJA 3RUAA 5IPFA 3ID6C 3ZC3A 5KX5B 4AP6A 2OG1A 3TDNA 1NIPA 4TLCA 1ATIA 1QBGA 1OGYA 3LT0A 3C14C 5CA0F 1R5NA 1EMDA 2P79A 4JYBA 1TVMA 2BT4A 4PVCA 4H7FA 2XWQA 2KE5A 3LT1A 2F3PA 4LZAA 5CB6A 5G0TA 2F90A 4NOKA 4WRRA 3PUKA 1ZD4A 5JSZA 1X6VA 2H06A 1VJ5A 4ZT7A 4DGQA 4C7VA 3RO7A 5D3QA 1DBWA 1ISFA 1D2EA 1PZMA 3A04A 1N9ZA 1VSUA 3DKPA 1B1CA 1C7ZA 4YPFA 4B8ZA 2BBWA 1NW8A 2QTZA 3GZ4A 4M1OA 1H94A 3GEMA 4OV6B 4XGQA 3EVZA 1YRBA 4NPHA 4H6PA 2QZ4A 1SIBE 1WPQA 2WMDA 5FFFA 1GAJA 1AZWA 1W9HA 4PN3A 5F3WB 1NMQA 4TVOA 2CXUA 2W6ZA 5DYYA 1H6CA 3DEZA 4U2FA 1KI3A 1T9CA 4IMPA 3EXEA 2P4EA 1TUEA 2ZB2A 3P94A 4OIFA 2D0IA 5BN4B 5JMPA 5KB3A 4TM7A 1D1QA 1WPXA 2PKWA 4Z7QB 5E1BA 3X2FA 2ZWVA 4XXHA 5JPCA 4LVCA 1K2WA 1PX0A 5JHGB 4X3PA 1DXOA 4IMJB 1TYZA 3G9TA 4IO1A 1XROA 1A9ZA 1X8LA 4AKSA 2YYZA 2Y0DA 4N5HX 4CMIB 3AM1A 1JI3A 2GDZA 4HYTA 3TQCA 4W5OA 2BSAA 2H2AA 5DSXA 3UBMA 2ZIXA 1ISMA 5DVZA 2H1HA 1Y3DE 3N3BC 2MSNA 5AW4A 3KETA 3EZXA 3FCEA 3C7KA 5K7SA 4EUHA 4UFPA 4XD2A 2YMPA 2GF9A 2GQ0A 1ZPDA 1FQKA 3QF4A 5JD6A 2WT4A 1V9LA 2W6QA 2X40A 3IP8A 2OFWA 3WFJA 4C6TB 4PFKA 2QLTA 3GZNA 1NFFA 2CFCA 1F8XA 1Y1SA 2B4KA 3AF2A 4RXUA 4JI8B 1IYZA 3CGGA 3AYXB 1PCXA 2RI6A 4X92A 4EKNB 1RXUA 1VBFA 3EFHA 3IVAA 1RWMA 5LN1A 3PNKA 1MLDA 4RY0A 4OQFA 5KOJB 1QK5A 4KR9A 3WL6A 4LV6A 1CU1A 4LRSB 4E32A 4C4ZA 4ECEA 2HJWA 4DNPA 4P33A 2I55A 4NCIA 1N0VC 2Y1GA 4V2UA 3R76A 5CH5A 3SYRA 2RE8A 1RMTA 3DZJA 4Y2QA 5AVRA 1IBMB 4HDQB 2MMCA 2O2GA 3REGA 4IGEA 2WWGA 2JD0A 1IPHA 2YHUA 3O4HA 3B13B 4YAIA 3I9NA 2QUZA 4A0SA 3RU2A 4EI2A 1E1QA 3FE2A 2PH1A 1M2OA 4KR0A 1V8BA 3DOIA 2ORIA 2XQFA 4BB0A 2KB0A 3DE1X 1JRLA 3HDTA 4MHTA 4HLNA 4O0MA 3ORFA 4N9WA 3S7ZA 1UK8A 3DL4A 1ZJ6A 4KDRA 4J7AA 1O89A 3ZCVA 4OPMA 3O8QB 3PNBA 2R86A 2UZ1A 3M89A 5D1HA 2X4LA 4TLMB 2K6GA 5DTMA 3WMEA 1EH5A 1I3CA 3MT0A 4JLOA 1NVDA 3GL9A 4MRNA 3BXOA 2DBZA 5GTDA 3THYA 2FN4A 1ZJZA 3PXAA 1G21A 2X0DA 3W8NA 3MUOA 3EVAA 4PFSA 4Q3KA 1M34A 1A5BB 3BXXA 2IZZA 1ZMTA 1JVBA 2NO6A 1R4ZA 3H7IA 2Y2VA 2B2XA 1QGOA 3PPWA 2XD9A 4FYJA 2G0AA 1NBOA 4QKQA 3VHRA 1VJDA 3G2MA 2EF0A 4C5BA 4D9FA 4EJFA 2XX3A 2JVJA 4R51A 2Q5FA 4MP6A 3QKRB 3IHWA 3W5VA 1LLQA 3IOEA 2IWHA 3HCRA 1T5SA 3P45A 4QTZA 1M6HA 2IYZA 3JASA 4B3BA 1Z5NA 4QFBA 4DA7A 4FPXA 3AUJB 4W6ZA 4ZRDA 1L4KA 1QAOA 1R0XA 3KZXA 4QODA 3WKCA 4YV1A 2ECKA 3K05A 4Q4CA 2Z4TA 1CJUC 1E32A 3D3NA 4A6XA 2OYCA 1KWKA 1T4CB 3G1WA 3WRVA 1EE9A 1A9TA 4U39A 4E2FA 3L18A 4GYKA 4QOIA 5ENVA 1NJ8A 2GT1A 4TV8A 1M8FA 3CEHA 3ZS8A 4KXFB 3QLTA 1NBIA 2FR1A 1VIYA 3HLTA 3RAJA 4YJGA 3V8BA 3ZCPA 1MW9X 4EARA 1RKQA 4WE3A 4GBGA 1DINA 3FI0A 3KUUA 3U4AA 5CFRA 2C78A 3RROA 2ONYA 4Z9AA 2CSUA 1QOQB 1SA0A 4Q3CA 3SP1A 4CYMA 3VPXA 1SD5A 3VQTA 1V16B 1YL7A 2A1TR 2PX4A 2QRNA 5LP6C 5KWVA 5JALA 1BROA 2XMRA 3AUSA 3IAXA 4J75A 4OQXA 3I8OA 4I1OA 4AJLA 3SAJA 1KL7A 4X8HA 2Y66A 5EL0A 4BZPA 1KJQA 2CL6X 1FNNA 5AKHA 4IQ8A 4AJJA 3HJHA 4BJ1A 3THXB 2VN8A 1FS4A 1F2UA 2AWOA 1R00A 1H8EA 1TB4A 1Y63A 3GJQA 3IDQA 3KKLA 3Q8WA 1N9GA 4GMDA 4UE2A 2VDRB 1W6RA 3N2GA 2WDPA 4MRRA 5LMCA 4C4RA 2AOUA 3DKIA 2R1ZA 1Y8ZA 4LYYA 1SKAA 2BFCA 2JLYA 3AUAA 1MV5A 4RHCA 1O6FA 1AHNA 3INNA 1SXQA 1NIJA 3DGFC 1KI4A 2A86A 3VYSB 4UBKA 1NBMA 3B5IA 2R47A 3BULA 1MIHA 3N28A 1JG1A 5JSZB 1IOVA 4JK3A 3HLYA 3ZVNA 6AT1A 3P2OA 4PC7A 1N4AA 2V4ZA 1T5LA 2QJRA 3BJMA 3IOMA 4ZO8A 1T8PA 1X74A 2QLLA 4MGYR 1KZ6A 1IULA 1Z8DA 2VNAA 4OOFA 1W96A 5CLJA 1PJAA 3IAS1 3EXHA 5J47A 3IBTA 1Z88A 2NNLD 3EQZA 4CMGA 1QMGA 1P60A 1W2HA 3Q6MA 1M6WA 1ZZGA 4M0MA 4KLAA 5DBHX 4BQOA 1U0HC 3EQ9A 4OVKA 1KAEA 2DKOA 1PQUA 1QIJA 2ZT6A 3IT0A 1U99A 1HDOA 4JJZA 2HNKA 3BWEA 4MAAA 1GTZA 3OM1A 5ELLA 5ERGB 3EXEB 4MHOA 5FEUA 1SXPA 1UMBA 1ZKDA 3PNQA 2V1UA 2HW8A 1LX6A 4XVQA 5JASA 2J6HA 4R2LA 4LHSA 1OA0A 4DUZB 3IUBA 5DGHA 3P9ZA 2FWNA 2PGAA 2H65A 2H8KA 4CLXA 4CT5A 3K0BA 4PYRA 4CQNA 2HUPA 5HTKA 4ACBA 4IDOA 3QXHA 1N2EA 3LS2A 2I7TA 5DLQC 2DWQA 2BKAA 3T3DA 4IINA 2OAEA 3F6YA 4MR9A 5DTIA 1X7GA 4GP6A 2FRVA 3CSSA 1C9JA 5BYBA 3JWJA 2ZIXB 3MTGA 5G0SA 4F3YA 5E2AA 2HK7A 2FE4A 5H0IA 3A0RB 2IP2A 2JIZA 1X87A 2WKWA 1F3OA 4FWBA 6PFKA 1X2EA 5KTSA 1DKPA 2X1MA 1P2SA 3QF4B 2J6IA 1LPNA 2V7QA 2WHEA 4RE5A 3FTFA 3Q8LA 1LX7A 1U90A 1C1XA 5JSYA 3VDQA 3WBKA 3FJ1A 4UTZA 2NSYA 3AOEA 4TTIA 4BC1A 5EJAA 1IY1A 1AKUA 4RM2A 3CSUA 1F9AA 2V7EA 3GZNB 1WVIA 4IXDA 4UBJA 4DV3B 2XF2A 2GUWA 3K9CA 2XWPA 1T6YA 3OU7A 3QG1A 4H18A 2DTDA 5I4BA 1HFWA 3LI2A 3QPAA 4TTTS 1B0PA 2VEDA 1ULZA 1RXIA 3PJRA 1MRSA 4Z0HO 4ZCQA 3S2EA 3AJEA 3DZDA 4N5IX 3GGSA 1Y0BA 2RKWA 3C8DA 4LYGA 4MWBA 4UMDA 4AG6A 1V1MA 4UMEA 4K6MA 2QRPA 5TNXA 4WVFA 2H4ZA 3MJSA 2JFBA 3FA2A 1RE0A 4FR0A 2A9FA 6LDHA 1G20A 3N05A 4ARSA 2A0FA 3HBNA 3DOJA 1SUPA 2PAAA 2QORA 4JKYA 4K6CA 4V2IA 4AJEA 2O23A 3D3EA 4QGSA 2W4QA 1ADBA 5BMVF 2GFIA 5A5FA 3SHWA 1USUA 1PZHA 2A4KA 1YFJA 1T6XA 1IBRA 2Y93A 2CXRA 3IUQA 4MVYA 1RJDA 1U0TA 2X8AA 1U2DA 3A2LA 4L95C 4QULA 4ZVSA 3ZLTA 1KI8A 1A72A 1G3QA 3MWJA 1RM0A 3F67A 1U4SA 5A1TA 4CG0A 5JATA 3OZXA 4HNQA 4U2GA 3E7WA 5FRDA 5AW2A 1HQYE 3TRKA 2PX6A 4LF4B 3B1KA 3NM4A 2YW9A 1KZYC 1ZXXA 3SBDA 1VJRA 4OI1A 1VJ1A 3THYB 2OBXA 1G21B 1FS6A 1RYHA 3H4TA 3T3MB 4C4AA 3ANNA 3MUFA 1B15A 1EK2A 1AKQA 1M34B 3CF0A 4QHTA 3ZJUA 1KYZA 5ALMA 1QGED 2PMBA 3RS5A 5AUPB 4WKBA 2FMUA 3GG9A 3IFSA 5FFNA 3KL2A 1K4MA 2X41A 1KO7A 1S8NA 2DSNA 3EVCA 3I0ZA 3PHIA 4OXRA 2C8JA 1NV8A 4TKMA 3GY0A 2DQ4A 4PSVA 1QVRA 3B1VA 3D7MA 1WOYA 3M2PA 4MXDA 1P31A 3JASB 5JOQA 1FNDA 2W7TA 2X58A 4JBGA 4ONEA 3F98A 3AG5A 4PLVA 4WADA 1UBTS 1HYBA 3GV0A 4MVWA 3H05A 3NWJA 4Y9DA 1VYHA 3P9PA 5IK2D 4A1FA 3O1IC 1LW6E 2HPHA 4YAUA 1XHFA 5KNBA 1UMKA 1D2CA 1ZCFA 1ODCA 3F7OA 3FAKA 4HQNA 1RZ3A 1JA9A 4JU9A 3ZCTA 2XUFA 4BUCA 4BO8A 1P0CA 1U6IA 3KB1A 4TV8B 4NICA 2HEGA 2O7RA 1H0RA 3H2HA 3L0OA 3LUFA 3EWAA 3GJ3A 4MPPA 4OH7A 1WXWA 4YJGB 4Z86A 1ZMBA 5KNDA 4JWKA 3OAAA 3MWKA 4QDJA 4OLFA 3D5TA 5ETJA 3SE7A 3TIXB 1GZ3A 1Y89A 2I67A 3DMYA 1U9ZA 2PUJA 5ECDA 4CL2A 1XZIA 3UZUA 3D4IA 2J9GA 3RRYA 2XLBA 4DMCA 1N77A 1HURA 1L7RA 1P2FA 1PWYE 1SA0B 3GJ7A 3U3DA 2O48X 3E7DA 2VH1A 4TZKA 4MUYA 5FUMA 4B8YA 2IQIA 3AOEC 2NVOA 5D2CA 2YWJA 1KR5A 3JVEA 4O2AA 3Q5EA 3ZE0B 2J0QA 2JVKA 1K5DA 2OECA 4EPVA 3SX0A 4OAPA 1E1NA 1CBUA 1CEYA 3PTLA 1NVMB 5LJIA 4AMYA 4TN5A 2XEXA 3DXFA 5FLYA 1JQBA 1PWEA 1C5KA 1F2UB 3MRSA 4ER5A 2FSSA 4HNVA 3T7DA 7YASA 1N9GB 1MEJA 1SHTX 2R25B 3S6JA 1QSGA 1EQ2A 3BTOA 4MEBA 3N2GB 4RW0A 4Y6GB 3WDKA 4E33A 4EQ6A 2HWWA 5HIAA 2AD5A 2AOUB 4RXMA 4AKHA 4LJAA 4CM7A 3BIXA 4MGZR 2IITA 3PXCX 4LBVA 3TI7A 2BFCB 5CLQA 3RAPR 3B9BA 2H4FA 4I50F 4UVHA 4MPJA 2JLRA 1HDZA 3ISTA 1J2UA 5IUKC 4AF8A 2GXAA 1ZW6A 2OM2A 3A2KA 3IR6A 2A92A 2PD3A 1I7SB 2DT5A 2ZI3A 3CBQA 4FDVA 4GMKA 2XGMA 3IUJA 4L4UA 1PEDA 1E94E 1M1XB 3QVSA 1QPGA 2ADOA 5CT5A 1XP8A 5IUJC 2I3BA 2L18A 1NQWA 1U2DC 1LY1A 1TO2E 2PGIA 4FEGA 1AKTA 4LAFA 4YEDA 2EBUA 1SVNA 3EXHB 4HX5A 1F6DA 3KT8A 4FLMA 2O8CA 1U6JA 1ZZEA 5T4EA 4PXSA 1U8ZA 1FP7A 2FZ4A 2JFUA 1XLVA 1QUEA 3BB1A 2QTRA 5FTLA 4A9AA 3ZZNA 1O6GA 1JDTA 2QTVA 4RVHA 5SY4A 4BFTA 3SSAA 2R96A 1UMBB 3W06A 3HUFA 1VBNA 2RAFA 1R8JA 1C2YA 4KMSA 5EKXA 2I1QA 3FGZA 5I4IA 6YASA 1GKKA 5JTTA 2BSQA 1B2RA 1J07A 3TDKA 3O1LA 3V7YA 1FMJA 2YH2A 2XXAB 3OPYA 1Z56C 1CB0A 1NKTA 2OCIA 3C3PA 2QN1A 4RMHA 1W4LA 3EDCA 4QM6A 2WFMA 3ITDA 4JU8A 4UAUA 5DHRA 5C8YF 5KSZA 4BEJA 4MR9B 4GMGA 3U4MA 4J29A 3RSZA 4TSFD 4GLFA 3JXEA 3Q41A 2IOQA 4BZZA 4P4SA 4XWYA 4EFDA 1PGNA 4ENVA 3ZXUB 3RVSA 2P6OA 4DWWA 4V3BA 3NETA 2JCBA 4TYQA 2IV2X 5K4HA 3EIXA 2PZJA 2CHFA 4E88A 3FYUC 4K40A 4PYLA 3H5RA 2O2ZA 1C1XB 1ABEA 3OHMA 4AS2A 1DJOA 4D43A 4YDSA 4RDIA 1VMDA 1IXKA 1MAHA 3PUJA 5MN6A 2QT0A 2OLJA 2ZK7A 2Q1YA 1NVFA 1RQLA 1EP3B 1SRQA 3FNBA 3P97A 4ZICA 2JIMA 1F17A 2NUAA 3L8DA 2OLEA 1QFSA 4IIXA 3UIEA 2DETA 1B6SA 2BJHA 4TQGA 2OC4A 1SY7A 2PIAA 4IIYA 4QJ3A 3KPWA 3VNRA 3AY7A 4JB3A 3OOYA 3SJUA 2ZCUA 3GRKA 4HFRA 1G20B 4BGDA 2JJYA 2FRDA 3QY9A 3LG2A 4E5MA 1VOTA 3LBNA 2WTAA 2VHXA 3QEOA 1DIGA 2V7XA 2G4LA 3EXFA 1NAIA 2DPYA 4UU7A 4CODB 4L85A 2ODTX 5C1IA 1O95A 4R8RA 3RVQA 3QI7A 2PYDA 4DQUA 1HKHA 2I91A 1MU0A 5JC8A 2XYVA 2VDQB 2WU0A 1GDDA 3IPAA 4MMYB 1XTQA 1ZH2A 2YWGA 4P36A 2DH6A 1O94D 1PVDA 3A1VA 3LXUX 1OXSC 1XEFA 5IDYA 3V8VA 2VUTA 4PAWA 4E51A 2Q3HA 2OXEA 2RAUA 1M2GA 1JKFA 3IV9A 4GI5A 1CEQA 2QX4A 4LSWA 5FF9A 1P81A 4EYKA 2J5BA 4YP6A 2E4VA 4YV0A 1Y9EA 5LYJF 4KYUA 3FGOA 5BQ5A 4LF6B 2JA1A 2AHOA 2WNSA 3O3CA 1KMCA 1ZNYA 2ACEA 4JLAA 2IYPA 2Y4NA 3UH1A 5I8PA 1WBJB 3FWKA 4H77A 1PLJA 3N87A 1ZGBA 4RYLA 1WW8A 4C2TA 2GILA 5EJFA 3I83A 4EI8A 4Q48A 1KOGA 3OZVA 1SUCA 4NENB 1PQ4A 3WQBA 4JX8A 3SN6A 1BQEA 3NYRA 5K0EA 2ORED 4H3SA 2J48A 1MAVA 4WBXC 1F8FA 2VJKA 3WZMA 2BJWA 2PG3A 4Y1GA 4RZXA 4GLLA 4NWIA 1Z38A 1SC6A 5BT9A 3O4IA 1G7SA 2FB9A 3E8SA 1YRAA 3ICCA 4FDUA 4MUAA 4OATA 5TGZA 1ILEA 1CHDA 3CO0S 1JB9A 2O8VA 1BD3A 2XNDD 2AZDA 1SPXA 1TZCA 5REQB 4G5RA 5DM1A 1SWWA 1E9CA 3KT6A 1T3LA 2C92A 1DDGA 3C3XA 1X7YA 4HGOA 4BFWA 4ER3A 3VDXA 3ESAA 1OYVA 1C3OA 3C16C 2CBZA 3FWHA 4PHFA 4IDQA 3P2EA 1XTBA 1I33A 5DCWA 4LOAA 3OZWA 1BU8A 3OWOA 5IZ4A 3DF9A 3TZBA 2ZROA 3SBEA 3OIYA 3VPDA 1TC2A 1KA9H 1PNQA 4Y8VA 2PWYA 2P0AA 1NNSA 4IIGA 1Y6ZA 4KBGA 1TKRA 2A5LA 3EY9A 2FPPA 3HU5A 2AUMA 2ZS7A 3AERA 1Z6YA 4XM0A 1DIOB 3SJZA 5CDSA 4GC5A 1PR5A 2RH5A 1E3IA 3D7NA 4O2AB 3TJZA 5I7HA 2GS9A 4K1LA 1GNSA 4LDRA 2NO4A 2GB4A 4YV2A 3D6MA 3WYBA 3UMYA 4JI4B 4IDAA 2X3FA 2NUBA 4NE7A 2A4MA 1Y3AA 1RD4A 3KFXA 3UAVA 5AVZA 4H7KA 2ZUTA 2HJRA 3F47A 3DMFA 1P9RA 3VTFA 4ZTUB 1NQUA 1ZQ1A 5CYFA 4EQ6B 5LMNB 3GK3A 1NXQA 4GPIB 4RLFA 3O82A 3ZE9A 2PZEA 4DUGD 1EGMB 2EAUA 1PD0A 2AF4C 3ND7A 5F5NA 2YWXA 4HT3B 1Y5IA 3DMPA 5LXTF 4LDNA 3K94A 3I0MA 1UJ2A 1DBQA 2YY5A 3FSGA 4QYMA 3FOCA 4YJDA 2XNJA 1E5TA 4U6QA 4CL0A 5BXQC 1DCTA 1W5BA 1ZMRA 3FBWA 1GADO 4MKGA 4U7TB 4EZEA 1O95C 3U7EB 1QH1A 3NR2A 3M3DA 4CTJA 1GTSA 3Q7QA 4OXKA 2HHJA 2H8GA 1JECA 1PT9A 3QLUA 2O6HA 3H1GA 1YR2A 4G0QA 2O8CB 5F1KA 4B7UA 4KDFA 4S0XA 5FTNA 4Z99A 4ZZ1A 1ZIXA 3QOXA 1J39A 3CF2A 4GR9A 2P2ZA 5AVUA 4IY1A 5CD9A 2QTVB 1ML3A 4GAEA 1ZK4A 1Z62A 4INOA 1G8FA 1N8NA 4H1UA 1LPOA 2MMGA 2PDAA 2E4ZA 3IMKA 1JYEA 2YJZA 3JQAD 3VSBA 1B8NA 1FU8A 3NLLA 5D8DA 3VVMA 2QQGA 2CKDA 1DOZA 2VYND 3OPYB 1O8CA 2VDMB 3AL3A 3KLMX 3MW8A 4ZT6A 1J5XA 5EJ8A 2PUGA 1G21E 1TK2A 3ECCA 1MOZA 2VPPA 2VQSA 4M37A 4CG1A 5KJ1A 3G7UA 3S28A 1M34E 4I6EA 2Y0BA 1SHJA 2WF5A 4PLFA 1TD1A 3LYUA 4MTLA 2OV2A 3K4PA 3GU3A 1ABFA 2RGNC 4BMDA 5FDFA 5AK6A 1E58A 2NWQA 1UBMS 2C0QA 3LIPA 3UOWA 3WLIA 2DH5A 1HYEA 4IH1A 2Z2YA 1O4VA 2HCFA 2QMEA 1JBKA 3F97A 1Z7EA 4YRGA 5KCZA 1QPBA 1NLYA 1V4BA 1NPTO 2R00C 3ETNA 1CVRA 4X6YA 2ISSD 2P69A 3NT2A 3V6MA 1CZRA 2BHTA 4TT3A 3ZHQA 3LDGA 4LPKA 3ESQA 1M7HA 4DSAA 3PC8C 5KTMA 1E60A 2CVFA 1IOWA 2IPNA 3GBVA 4RHUA 4HLDA 3L79A 4CV2A 1SMKA 5HZHA 5BUZA 2JI4A 3KQPA 1UDWA 3ELUA 2HJVA 2RH9B 3BFVA 3VGPA 4NCAA 2AB0A 2JGEA 1EAYA 4Q3OA 2GNPA 4LGCA 4M0KA 4N54A 5KTOA 5EHIA 4LXIA 3RRXA 1KI6A 1E4YA 3VMMA 1A5AB 4JSTA 3UM9A 2C4NA 1KOJA 2CCJA 2LTAA 3D6UA 1FP6A 2YCLA 4FOTA 4R0VA 5TJHA 3ICQB 2O0MA 5GJWC 3TSOA 4EMSA 1Z35A 2IYXA 2Q49A 4COOA 3FSJX 2GBPA 2IQ5A 2Q1UA 4A2PA 3BDIA 3EXFB 4AKTA 1T4MA 2CFRA 1AK9A 3RSOA 3RVBA 2HU8A 4WJKB 1DKRA 4TL6A 2JI8A 1WXEA 3AU9A 4P98A 3NTXA 2QP4A 2PWPA 1OASA 3KJZA 1I4OA 4YQYA 4HS4A 4P82A 1X8JA 4RDHA 2V7WA 1BMFD 1Z0SA 2BAGA 2ZIEA 3GP5A 2Q5QA 3IQEA 4IG4A 4NMLA 4YACA 5L45A 5EHGA 3VR3D 4FGWA 4JIGA 3SHFA 3GXBA 1W49A 1A50B 4J76A 1T9AA 3LUDA 1OVMA 4C05A 1QVWA 4ZOQI 2O2XA 2O5VA 2QAJA 2RHJA 5D6NA 2L0XA 1KO4A 3OT1A 3OX2A 5DP2A 4CM8A 3PHBE 4UNRA 1RYBA 4QAJA 1WWKA 2X8LA 3DKKA 1W5AA 4MUMA 4BP3A 4EG8A 5K45A 2G3YA 3NEAA 4YJHA 2POCA 3CURA 3WNQA 5K8VA 3AVXA 1QYCA 1C9EA 4X60A 3ZBUA 1R6VA 2QTNA 4I46A 4US0R 2A9KA 3VHXA 2WTUA 5ALYA 1ZH8A 2YVUA 3ZY6A 3V80A 1WB9A 1DBRA 1YAJA 3R5XA 4MUFA 4NBNA 3WGHA 3IVGA 1JKXA 4CKCA 5CA1F 3WAGA 4TYNA 3WADA 1E4VA 5EGSA 3EFEA 1HDEA 5G4KA 2NP7A 5BWNA 2Q3FA 3AM3A 3SEAA 4IV8A 2Y76A 1FVOA 5ALTA 2D7DA 3D4LA 1D4OA 3W4JA 3MJVA 2QXYA 4I4CA 4JJKA 4AJNA 2W37A 4HAWA 2X0JA 1HQDA 3FBGA 2Q1SA 4EHIA 3PKIA 5AH0A 1K89A 1L5MA 2BKXA 1E0AA 3ANXA 4LQCA 5LZ9A 1J2EA 3OIWA 3SD7A 4ZDJA 5JCOC 2V4MA 3VPHA 4FFSA 3HJTA 1E61A 2V8BA 4QUAA 3KJGA 1J1ZA 3KPJA 4KYVA 3HL4A 5E1OA 5FOWA 4L75A 3CB2A 5K0JA 4KPEC 2AA3A 3N8NA 3K30A 3PUHA 1S3SA 2FPPB 4P08A 2EKLA 3AERB 1S4QA 2I7DA 2A59A 1JAZA 3U9LA 4R1NA 2ID8A 5F5XA 1FLDA 2GCPA 3QE9Y 3I34X 2OZLA 1GSOA 3FDZA 3O92A 4L07A 3HP4A 4LHZA 3ZE7A 4BRSA 4FHCA 5KVVA 2Q9UA 4MA4A 3OZDA 5AM1A 3CH7A 3ABZA 4QQNA 3ZPXA 2BHNA 4JOQA 1NLUA 5LJLA 1K2VN 3KG2A 1JWAB 1G1MA 3E3LA 1YD7A 3O8RA 5AW0A 4P1ZA 5HP4A 3FWZA 2W2TA 5LWQA 3S2IA 2AW5A 3ZDDA 3RR2A 4G24A 3OFKA 4J8PA 3W3AA 4B7XA 4KAAA 3K8OE 4J4BA 4RKQA 5GOZA 5HPYB 3FKJA 2KX7A 1Z3CA 1XEWX 4HAYA 4KP7A 4RIGA 1JX6A 1OI2A 2VVTA 3GMIA 3ONVA 4BVKA 5CGZA 1YB4A 1DQRA 1V4VA 4TXHA 5C7YA 1P62B 3FPSA 5DV9A 5IJ0A 4PTZA 4CF3A 2IUUA 3J81A 1UL1X 4YMSA 2A67A 3L49A 3IBCA 2YMQA 1QH1B 1G7TA 2G70A 2UVPA 1R6DA 4I5EA 1KQ3A 1OXKB 3A1NA 3NBMA 2VJBA 2C58A 1BWRA 2HMAA 3RQSA 4O02B 1XZEA 1GA1A 1JA1A 2YNMD 3PHJA 4BNHA 3VX4A 2LDBA 2JLSA 3M2TA 3QX9A 5GP1A 4NAHA 1HG1A 3PHHA 1KJ9A 3SYKA 3LGAA 3T8YA 3HVKA 3ASUA 1SCUB 4IWYA 3TJMA 3VM6A 2R8ZA 1HL3A 3GJ8A 3SXPA 3CPEA 4ATNA 1D9XA 1E3LA 3H6KA 2QRGA 3EAQA 3OEHA 3R3HA 3WGUA 4CM4A 4D6YA 2AQHA 1GV1A 5JMTA 3ZR4B 3M5PA 5IHXA 3KQQA 4LBWA 3SJ7A 3BE4A 3EDMA 1Y7TA 5KHAA 4A73A 2TRSB 2I6GA 3Q7IA 3TK1A 2HSEA 1INLA 1CY0A 4LYAA 1F4VA 4F1WA 1CDEA 2GPAA 4AJ2A 2C7GA 3RC2A 2ZTSA 2B2NA 2JZOA 4N01A 5HRAA 4WUTA 5JS7A 2QVZX 5K05A 4HZUA 2FFBA 2QWXA 1G16A 2ZAOA 3NORA 3EJ6A 4HB0A 4NU5A 2TECE 3C8UA 1Q50A 4H7EA 5KOHA 3ZWWA 1E7RA 1Q1QA 2YZ7A 4JEUA 1KDRA 2VFAA 1CX9B 1EFPA 2HMSA 1JW9B 3ZDEA 4RD3A 2GZHA 3YASA 1QRUA 3I9OA 1BXKA 2MYPA 2GZ3A 4BECA 3ESDA 3K72B 3AV3A 4YK7A 3BVPA 2JAQA 4MJ7A 3L6CA 1N0IA 1OF1A 4BVEA 2UYCA 1Q57A 2BKUA 2OYSA 2VAMA 1T9BA 2MT9A 3KLPX 3ZHCA 4E30A 2XRMA 4AY2A 3PKJA 4KXXA 1G5HA 3HKBA 4XWGA 4BEBA 4JLSA 5CIWA 3SG0A 2WINI 3O47A 3B38A 2FPGA 4HHEA 5L51A 3ASYA 1L5GB 3KD2A 1KI6B 2EYQA 1Z74A 1R1DA 2B9EA 3JQRA 4KWTA 5CM2Z 3THRA 5BV8A 4X24A 2DPHA 5AKLA 4RPIA 5AESA 5F7JA 5AI0A 4ML3A 2PSJA 2I0FA 4HDAA 4UQPA 3VUEA 3E18A 2C2BA 4L57A 2E82A 1P1IA 4L27A 2QIOA 2OOKA 3RHFA 2DLNA 1RRMA 3LP8A 2C95A 1FNCA 4YXWD 1DKLA 5K0NA 4R1TA 3CN7A 2GEVA 5HKKD 5AJVB 2AJBA 2C4UA 1J8DA 1UJMA 3FRJA 5T3YA 4RVFA 1R3DA 1THMA 1EXWA 2OV8A 2V8OA 4EO7A 3AEYA 1RYZA 3MLBA 3T9CA 4F4JA 5AVTA 3AY0A 3PYMA 5DB4A 2W2NA 4MYCA 2PMCA 5ECWA 4IICA 3PUXA 1WVMA 4ZK2A 1L1EA 2FFJA 3BKXA 4W99A 3ZY2A 1CIVA 1N2CE 1BDIA 2YJ6A 3Q7SA 2YN4A 3GEPA 5BR1A 4MEJA 3SVLA 1FFWA 5AJUA 4CM8B 2IHTA 4W1SA 2D8MA 3JWEA 4M9UA 3KE8A 4CLDA 2CK3A 2ZWIA 2DLDA 4RK5A 4YJHB 4DDKA 3IR7A 4UASA 2QD2A 4DSUA 2QTHA 3BILA 1XJ5A 2Q3EA 3CZ4A 2OXTA 1U3TA 3VHXB 4BZQA 1FTYA 3BGDA 3I6QA 1C9MA 1SH7A 2CDRA 2P30A 3F96A 4CKCB 3OIGA 3WQQA 1ZUIA 4OSOA 2EYUA 2W8ZA 4YGYA 2BEUB 4X9XA 3ZKWA 3NS7A 4Z9BA 5KX5F 4GPEA 1DFHA 3QTLA 5BORA 1YMVA 4G25A 2ZRPA 4FXOA 4MVJP 3ED1A 2GLUA 3AXTA 1YU9A 2PWAA 3LAWA 4N40A 5BUQA 5JECA 5LIRA 3QFHA 4F97A 3ZWPA 3QE4A 3OZBA 4FFNA 3DHEA 1FXWA 3O4GA 1W5SA 4G5GA 5JYEA 4LZLA 5JJLA 3OLYA 3CEAA 2ZQ5A 3F5SA 2ZOSA 1LBSA 1P7YA 3LQ4A 3D5EA 2CZGA 5EC8A 2EC5A 5E6RA 4DA0A 5EFZA 1IZYA 2AMJA 2JCGA 4GMHA 3QPWA 3CZRA 1CC1S 3UMSA 4BJ5A 3F8WA 5ALNA 1N7IA 2XXBA 2G7MC 2WI8A 5BMOA 3PQEA 1N3YA 3G88A 1HDIA 4F2HA 2XVYA 1JZSA 3DM9B 3ZWCA 3G79A 4RMIA 2Z95A 2O54A 2HZBA 4MDYA 2FN7A 2HA3A 3PD7A 4NKRA 5IVIA 1WXXA 2F3TA 2G0TA 1Z2NX 2OZLB 2RARA 1C8LA 4NDAA 1YOVA 2OV1A 1KP3A 3JU3A 2BEVA 3BREA 3CLHA 4BJ6A 1NG1A 1CP2A 5BXYA 1P2DA 2HLDA 1H2BA 2WEKA 3C5EA 3E22A 1Q91A 3NH9A 4KUGA 2G67A 2TMKA 4HCJA 2WILA 1WV0A 3RIGA 2AYZA 3ZIDA 4R01A 2A58A 1XDWA 1H2HA 1UAYA 2A1IA 2W93A 3FVVA 2G5CA 5HF5A 3RFXA 4YMUA 3U44A 3WLMA 5JTUA 5H70A 2G77B 1XL1A 2N1MA 2IOFA 7MDHA 3U4QA 3HO8A 2O2HA 2J6BA 1X38A 4HQKA 1JU9A 4OJTA 1FSZA 2AKYA 2ZZNA 2VTDA 3LPMA 3T7IA 7REQA 3G9ZA 1JZTA 2XADA 5IJ0B 1KGDA 4FDMA 2XUHA 3LQ2A 1Z5VA 2Z8YM 3OCVA 1YCGA 3S4YA 3LECA 3LPNA 3PNVA 1PBTA 1KKLA 2UVPB 4RK1A 3M4YA 2W6CX 2EKBA 2YWHA 3OTQA 4L50A 5D7NA 1QIDA 1W87A 3L4BA 4UVEA 1GYQA 1XLTC 2QMQA 2QRMA 2O3SA 3JD2A 4L4YA 3H5VA 4TWAA 3T35A 4HXYA 4CIDA 1DP4A 5IWAB 3UWDA 3ZH9B 2YKGA 2ZGVA 1E2MA 2J3LA 4S24A 1KAMA 3GDWA 4GLBA 4JJ6A 1ZD1A 1WO8A 2XA1A 4OHRA 5EPEA 2W58A 3S2SA 3SC2A 3WSWA 1RI4A 3K9BA 2AC4A 4JYPA 3RRFA 4IKOA 5ECYA 4YCAA 3BFPA 3DPSA 2D4HA 4CM4B 1LDEA 4OMCA 5KTTA 4FOPA 3PJFA 1YI1A 4IGKA 3LDUA 4URHA 3VNSA 4Q9IA 3G9UA 1XLWA 3NIDB 3S5UA 1UAAA 2ZWMA 2R0QC 3DMNA 1P4HA 3SEQA 1C1YA 2P2GA 1OFIA 3AJAA 1VRCA 1C3XA 1WDTA 5F1OA 1K92A 3SNHA 4ZAYA 4HI0E 4K9RA 1EWVA 1CR6A 1RIIA 2HGSA 2C29D 3CRQA 4MCIA 3SOPA 2WVGA 2UXDB 4U7DA 4RYDA 4HZUB 3W6UA 3E5HA 2OE2A 3GLFA 2X4IA 3GH1A 5KOHB 1U3UA 1L5SA 1VXOA 1P8JA 1V45E 1MW8X 2AQ8A 3RW9A 2Z4SA 1FOEB 4JP8A 2WF8A 3MHPA 3ZUPA 1XRNA 2HSWA 3DE2X 3CWZA 4ZGGA 1PYGA 3AT1A 3FUXA 1AE1A 1ESEA 4RNCA 1WLYA 3EMKA 3HJUA 3KLBA 2GZ2A 4G0ZA 2AG0A 5LQRA 1O6CA 1GFSA 3DDSA 1V9SA 3UICA 3U9SA 4HAVA 3OC6A 3IL2A 1FJHA 2FPGB 2VT3A 3H2KA 4FIZA 4RIFA 4AW9A 5HIKA 5EIHA 2LWIA 3RFUA 4XQCA 1O08A 2ZSEA 3H9QA 4RTKA 2ILVA 4Q1EA 1OYWA 4D4MA 3I37X 5EJ9A 1DKMA 1H3NA 2AOTA 2O4UX 4L8VA 1O2DA 3B1YA 3ZGXA 3L93A 3ZGZA 3PUWA 3FPHA 2X0RA 3MELA 3TTXA 5CVCA 3RBAA 1UMDA 3QBJA 1FDUA 5A05A 2VUHB 1OJLA 2QG4A 2ZI6A 1SCAA 2DTEA 4G5XA 3ZEIA 3TAHA 2P77A 3GFGA 1QP4A 4MYRA 4F2WA 1CW2B 2BW0A 2PHZA 4I9NA 4KZKA 3OF3A 2GWHA 2F1HA 5JH7A 2QRZA 3BWYA 2CB0A 4X85A 5IJZA 3H2GA 2VHTA 4PRKA 2HNAA 1FZQA 1QLJA 3ZHTA 3LQFA 4D9MA 3DE4X 3C4JA 3D8HA 4Z4QA 1DOAA 1TTQB 2EW1A 1YB1A 4ZC1A 2OCLA 3C3JA 4HS9A 4WKGA 3P0JA 4WGGA 1G2PA 5LCXA 5BRJA 2GAIA 4XEHA 4V0LA 1FP1D 3IYLW 4JLWA 4TS4A 4EHJA 1M6NA 2X0IA 4PS1A 3PZRA 3H9GA 1P39A 2YWDA 1J1IA 2C4HA 5KWSA 1FYFA 1GTG1 3FWNA 4PPGA 1G64A 2C57A 1XYYA 1RJ9B 1JQDA 2J5KA 2VQ6A 4HN9A 3VC1A 4PS0A 1EFDN 1M66A 3E61A 2A7QA 3HSKA 1JF8A 2OO5A 2NYUA 3ZKWB 5HKBA 3O3NB 4KFSA 4J1QA 4OUDB 2NSJA 2QUJA 2A5DA 1YR8A 1FS5A 2ZJ7A 2OYRA 4B44A 3SX4A 4DMFA 1JDVA 3G8YA 4AQYB 3JARA 2Q8NA 4FGZA 3AWDA 3UT5A 4YWHA 4AURA 3GAFA 2I2FA 1GO2A 2X8JA 2H2IA 1XBTA 2P35A 4TKLA 4UMFA 1SEVA 1P7PA 4BAZA 2XWBF 1RXWA 1DT5A 1I4LD 5IC4A 5SY6A 3G89A 2PL5A 4MV9A 4I3FA 5E6RB 3OZRA 4GGPA 1L5NA 4FXPA 3CPSA 1YBFA 3EGXA 3FSRA 2D7CA 1GWNA 4DE5A 2XCRB 4HNUA 5BP7A 3C3BA 1E2EA 2QP3A 3MCZA 4LTNA 4B0OA 1EWTA 1S7GA 5BQ3A 3ER9A 1ZC3A 1QRDA 3TOZA 1P0QA 2FMFA 4CV1A 4JI5B 1ADYA 1ISPA 5B3AA 2GJ9A 3HB9A 3UUFA 5HF9A 4D3XA 1YOVB 4Z0NA 2BEVB 3MA0A 4D26A 3AFNA 4PCVA 4X8OA 4FR5A 3VA7A 5EUMA 1VHLA 3E22B 4RPGA 2GN4A 5JLAA 3AR9A 5GY7A 3OVMA 5I7EA 1C0IA 1YGPA 4KYTA 2NN3C 2ZB4A 1FRZA 2DFPA 3AHDA 1BKYA 3U44B 2O2DA 5L3QA 1AGRA 3BMXA 3FX2A 3KHUA 4BNUA 4N3BA 3RFCA 3VSAA 1QO9A 2XV1A 5LM3A 1YKFA 3AZOA 3U4QB 4QE3A 4S1OA 3RNLA 4F4IA 4GKJB 3RUEA 5DXAA 3STTA 1NBEA 4MLPA 4F0JA 4K9KA 5B2FA 1IPFA 3IJPA 7REQB 1M7BA 1EG2A 2OBMA 3BZBA 3CXRA 4C7OA 4HQOA 1JFFA 3ETCA 3O3MB 3B6IA 4UUOA 3EXG1 4FCCA 4D9HA 4AQ7A 4C6HA 3MOSA 1V47A 5HRCA 4ZT2A 5I7AA 1YAHA 3EF0A 3LKBA 1BCRB 4GBED 3VYUB 3BHIA 4EKDA 2XMGA 4FW9A 1NJSA 2Q41A 4JLNA 1YS7A 4EJSA 2KBEA 3E05A 3FYCA 4MP8A 1DEKA 1PJBA 3CHYA 3FCXA 4KFUA 3G2HA 3QE3A 3B9QA 4XE5A 3WVNA 3H5OA 2GYWA 1DMRA 1F51E 4NH4A 4HNTA 2W22A 4XVUA 3KSAC 1XXHA 3MCVA 3SC2B 3FAZA 4FHEA 3TIFA 3TTVA 1JR3A 2CXOA 2YV3A 4L5YA 3TTYA 4HDMA 4JLPA 2WFLA 3TB4A 1FUYB 2ZPTX 3X1YA 1X1EA 3L9WA 2XUGA 1MBZA 1ND6A 2HSZA 4X7PA 2QE6A 4EPRA 5B7QA 1JALA 1MC8A 4GF5A 3BH7A 4LWZA 1E96A 4QRDA 4QXQA 4UQOA 1B93A 1TJYA 4DW8A 4FE4A 4RA9A 1L5HA 3GUHA 2AIRA 5L40A 1YC2A 3SBOA 4U7WA 3BH6A 3TLEA 4EG4A 5CBKA 1JP7A 1OTHA 1NW5A 5HK8A 2HQOA 3HJBA 2A0UA 3JRXA 3LP5A 3CUSA 3Q7RA 3L4EA 4OK3A 1J7KA 3C5WP 3NGXA 1G5IA 2IUYA 4D4HA 4YO8A 2AG1A 3OJXA 3FMFA 3GLFB 4BMOB 1N5OX 4M60A 4RFVA 4GVXA 1A76A 3VZDA 2D0OB 1XK6A 4AZWA 2JKZA 4FT4A 4BQFA 1BX0A 1OFUX 4GGOA 4QM7A 4DXAA 2PQMA 2RCNA 1S3GA 4LXHA 4Z1OA 2HT6A 4OBXA 1CZUA 5J40A 3T1HB 1ZP6A 2RHHA 3DZHA 1D09A 2G76A 2D06A 2XDQA 3LVFO 4K9MA 2BELA 4BNJA 1CNFA 1QF9A 4I19A 2VHZA 5JC1A 5A0VA 2YDYA 2Z2IA 3QWAA 4P81A 5K6AA 3TCNA 4AI6A 1BIFA 3LX8A 4FHZA 4BUJA 5FWYA 3H1AA 4OHVA 4FKBA 3PQ8A 5DNYB 1P73A 1WHSA 2VBFA 4HDCA 4E1BA 1YZHA 4DMUB 2OB2A 1VCNA 4Q39A 2QK4A 4MW7A 5GPBA 3VTAA 4ZCTA 5MGNA 4RA6A 4ZTZB 2E4XA 1K88A 2RGCA 4CBVA 3NIGB 4OYHA 3J81k 4JGBA 2GUGA 1SOVA 1JPVA 8ADHA 2JJ2A 2ZIAA 5I7WA 1GNPA 4DJFC 2AOTB 4DL9A 4JP1A 4URWR 1WDLA 3KYCA 3WYFA 2F3QA 2ZUCA 4PV7A 5FO1A 3NFRA 2PJDA 3TR5A 3RUIA 5DISB 3I1YA 4NJEA 2PS0A 4NCBA 1FJGB 1UMDB 1AKRA 1NXTA 1ITZA 4TV8F 1A5SB 2ZZKA 4MB0A 2LIVA 3EOBI 1FDOA 2EQ5A 1KYWA 4OY3A 5AQEA 4F3KA 1Q74A 3HTXA 4I5GA 1C7JA 2NAFA 1WXFA 2AE1A 1JIJA 3DO8A 4AX4A 4OHYA 1NR7A 4BN4A 2IELA 5JH7B 1NQ5A 2XUKA 1WF3A 1GT91 1I5OA 1FF9A 1N5MA 2AUNA 3A6JA 3BIOA 3LA8A 2FJ0A 3OJOA 5KYTA 3A4VA 3U48A 5KNBH 3R23A 4NULA 2ATXA 5GOTA 1D2NA 1KZ9A 1NI4A 4R9SA 4TWRA 2IH2A 1YDGA 5GONA 3C1TA 1YHZA 7AT1A 3G85A 1WDWB 4I5IA 2P3SA 2J4FA 4P32A 5DTJA 4RULA 4RKWA 4TLBA 3L0ZA 5KNDH 3X1MA 1GU1A 2CBXA 1ZVKA 3ZCXA 1UKCA 3ZD7A 2C04A 4AZ3A 4XOIA 5C5IA 2MSCB 3B12A 3WJ2A 2Q4EA 3A3YA 1PVOA 1OGIA 1T1SA 2EQAA 3AY6A 3CU5A 3DUFA 4KXMA 1R64A 1MX1A 3TLMA 4EJSC 5FX2A 1FX0A 4R7ZA 3UUWA 1EXMA 4G6ZA 2GPJA 3ITKA 5JSUA 2BGRA 4N5NA 2OORA 2O5RA 3TLZA 5IKPA 1G6OA 1VE1A 3RV4A 2K4MA 3GEDA 3UFXB 3ZK7A 1N7JA 4QYWA 2B5OA 4ZEXA 2XKAA 3OU6A 4DABA 1W7AA 2QJFA 1YZYA 1L4GA 1Z6ZA 3LY5A 2Q3LA 4DF3A 2Q6VA 4XWOA 2YVQA 1EDOA 4JLBA 2B0CA 3JARB 1GPBA 3EK2A 3ETGA 5DDIP 3UT5B 1U28C 4HFNA 3NBXX 5CW1A 5IXSA 2DB3A 2X8JB 4FZJA 3IAM6 1U04A 2ORWA 2O4CA 3OY7A 1IPEA 4DCGA 1C8VB 2UZ3A 3O84A 4XZ3A 3CJQA 5DXJA 3RTAA 4EQZA 3WRYA 4LQ4A 3RS8A 4CCSA 4GZ3A 4G1UC 3KHKA 1ZSVA 2WTEA 1NXSA 3NVDA 4IHQA 2XJ4A 4LJ5A 3O4JA 3TOCA 3EGXB 2GHRA 4S04A 2G9ZA 3KFLA 4ZI7A 1CF4A 3GUVA 2V9ZA 4PQEA 4TQUS 2H17A 3ILHA 4NK5A 5H3LA 4UXHA 3BF8A 3LWDA 3N0TA 4FDAA 5JNUA 1ZMOA 1TTPB 1DV1A 1JQLB 3C7DB 3CIOA 3WIDA 4DG5A 4OLBA 3RH0A 2NSHA 5LR6A 3KQOA 3QYAA 5DGXA 1NVWQ 5CB4A 1E8NA 3H2SA 4M1ZA 4IXWA 2PVPA 4UBIA 2FR8C 4F4CA 2LP4Y 2P90A 3FUCA 3PVSA 4XFKA 4ZYXA 4EY7A 3A6PC 2RSLA 3L4SO 1Q15A 3Q3EA 1X7HA 2FGJA 4NY1A 2PBLA 3DE3X 3KB6A 5B12A 1U9CA 2HADA 4FUQA 4A26A 1L7BA 2H4JA 3WQHA 5L3QB 4FEAA 3EVNA 1N2XA 1YIAA 3KQMA 1JEDA 1AC5A 1P9LA 3VJMA 1JG3A 4BBZA 4DA8A 4N47A 2Q4OA 1GUAA 1U65A 1IVNA 2K7ZA 3BWVA 5T57A 3AF1A 1OYOA 3L8HA 5T67A 1HLPA 2Z04A 4GOMD 4XSGA 4DSZA 4Z4HA 1KEUA 3K9GA 3OT4A 4MH0R 5TS3A 1SBHA 1A27A 1BFDA 1YB2A 1V5WA 1TK9A 3R3YA 4I14A 3T3OA 4C7OB 4IDGA 1HORA 2E4YA 4CT0A 4OHKA 4ZARA 3IV7A 1PS8A 3CMCO 3E03A 3HYSA 2W8BA 1T8RA 1LBHA 1YQTA 3K0KA 2QR2A 4IO0A 4LK2A 1B6GA 2W4IA 3GLKA 4M0LA 4OFWA 3UB3A 1ETUA 4HEHA 1CUYA 4EJSB 2ABWA 2E6KA 4E22A 1G7CA 1PSWA 4OTZA 3EBLA 1EP2B 4QWMA 1VPEA 3WGOA 1D7OA 4IYRA 3WGLA 3C39A 2BR5A 2H18A 5ALDA 2C9ZA 5IUNC 1XXHB 1X0VA 1ODIA 1FFDA 1Q19A 2C3PA 1W85B 2R2GA 2X5XA 3MS7A 4ON9A 5TSDA 3RSFA 4HDMB 2ZDHA 5TV2A 3R8XA 1RVDA 1VL8A 3L0IB 4TUYA 1GL6A 2JLCA 3NAGA 4CV3A 1T4DA 4YMTA 3KOOA 1N9KA 3E58A 1T5OA 4HX2A 2HFJA 3GPLA 1GZ7A 1NONA 4ODIA 1IK4A 1EUYA 1L5HB 3QX3A 1HBJA 5CNIA 3WNBA 3C0KA 4BQRA 1PFGA 2XBLA 3BSYA 3EG9A 2HK6A 4R4JA 1QOPB 5EQDA 4EGSA 1E2UA 2X19A 4E5KA 1PE0A 4GWGA 3BK1A 1FJ2A 4POAA 1VI5A 4EHKA 1JXQA 4FI3C 4ISBA 3N07A 1XX6A 5JFGA 5AVVA 4EGQA 5IC6A 2CNDA 1IZ8A 1ZK1A 3HO6A 2HL6A 5EERA 4Q4DA 3ELBA 4K26A 1NRWA 4MI3A 3E8MA 4H0NA 5K03A 3IIEA 4U2DA 3FYHA 1PJRA 1LNSA 3GLUA 3LC1O 2BFOA 4MGIR 2W70A 4JROA 1KP2A 4G4SO 3CH5A 3JRWA 3ZLUA 3GHYA 4BZWA 2CMGA 1P1FA 4LDAA 2XDQB 4UCFA 4J0HA 4D1YA 3GRPA 4Q05A 4B74A 5LQUA 2P6UA 4EZBA 4W5RA 3NOVA 2XTZA 4ID3A 1DS6A 4BBAA 2OD9A 4TRNA 3GLQA 3B20A 5FWYB 3RUFA 4XR9A 3UKOA 1JTVA 5BVHA 1OKKD 1YCDA 3Q9LA 4PXYA 1NJ1A 4MIYA 3JPWA 1WHSB 4K3UA 1KS9A 1LTKA 2PLFA 4YUAA 2AEJA 5FWXA 4EHFA 1Q44A 4RA6B 1DT3A 4LC1A 2ZT7A 4YI5A 5TQVA 5IJ9A 1S0UA 2BLLA 1V1RA 2FGKA 4BNLA 1R0SA 1JQEA 2QLJA 3PWZA 1ZH0A 3BTSA 4DYHA 3KYCB 4C89A 4R69A 1N0UA 1UQUA 1XMIA 2DAPA 2IHJA 3HZHA 3LLMA 5I47A 3EZGA 3AB7A 1SB9A 4NJEB 3NEJA 3W0LB 1Y34E 5FUVA 1AGYA 4GOXA 4Q93A 4RTSA 4J90A 1QORA 5HQJA 4UARA 4HVAA 3CRW1 5EMJA 5FD8A 4FCTA 4J6FA 3K0SA 1T9ZA 2VT6A 3F7NA 3M7IA 4JP2A 5AUOB 1EUZA 5JXHA 4BGEA 1WKBA 2JK0A 1XNHA 1C30B 2QL5A 1XVTA 1EJ6A 3UJ6A 4MDFA 3R5SA 1KO1A 1E62A 4UJ5A 3MBKA 1NI4B 1BCSA 5HIJA 3UBTA 1FEZA 4KQ1A 5GONB 4CJXA 2J87A 1RBQA 4FQ7A 3E1GA 2D1RA 4IWXA 1L7XA 2HHCA 1T5DX 3N8IA 4O2AF 3PNMA 3DW1X 3SYLA 3BXFA 5F2KA 1AQJA 4AZ3B 4AY6A 1YHYA 4PSCA 3IUEA 5JR3A 4HUTA 4LZJA 5JROA 2WJWA 2DBVO 3DUFB 3GUZA 3MT9A 3P2JA 1E1QD 1MABA 1RWXA 2DJIA 1FX0B 1Q14A 5JDIC 2VNHA 2Z3ZA 2HJSA 4KYIB 3O7MA 5K2MA 4EA9A 4PHTA 1AO0A 2COEA 1XDBA 3N2YA 1QO7A 2OWDA 2AFVA 2G8LA 4H1HA 5L4NA 2FXVA 1SRRA 2H7XA 3CFYA 3DCYA 4HDOB 2SBTA 4ASUA 4CL8A 5BWBA 1SU6A 2GK4A 5ALKA 1MA3A 3L1JA 1YUMA 1UEJA 1NVEA 3ML1A 4TSRA 1M67A 3TQTA 1E7YA 2H4XA 2DLCX 3F5FA 3U0VA 3W90A 4AJPA 5EJ2A 4IW3B 3AF5A 4XQ0A 4QDKA 2EZUA 4B2YA 4D4IA 2ZAGA 1LDNA 3GWZA 3R7NA 1DO2A 1G6HA 3ZVLA 2JA2A 3A1DA 1W35A 4QBFA 3PLRA 4RWEA 3SVZA 3TLXA 1Y3FE 4AWAA 1NUAA 2X3UA 3DZIA 1ODLA 1RWBA 4ZI7B 2XUQA 1HE5A 4CN8A 1QX4A 4BQSA 1CD5A 3NHBA 4MWEA 1XVVA 4KLNA 2R8XA 2IS2A 3PL5A 3C2QA 1WUJS 1ZDMA 1MO5A 2ZQZA 3D9QX 3HEMA 3IULA 5DYWA 2CV0A 1WUTA 5EEHA 1XV5A 5JZMA 1Z15A 4MQLA 5LP1A 4CTNA 3GLFE 3WNDA 4H4EA 4JUFA 5CB4B 4EO9A 1MG0A 2PVSA 3CSDA 1EG7A 3QKSA 3DZGA 1S2MA 3I9KA 3OIDA 5DF1A 3HBAA 4HLCA 3BWXA 3UK0A 4IQGA 2AG8A 4Z9XA 2H9IA 4ZC8A 2DHDA 1WIWA 4L6CA 2QM8A 3GEEA 4X1KA 4YNBA 2FEXA 3NHAA 1MEOA 3ZHBA 2H9YA 3KVOA 3VZSA 1Y6GA 1RYDA 3TD9A 4AP9A 1DRWA 4ILEA 4JB0A 3V6LA 2GERA 4DEXA 4ESEA 2BUCA 4M7RA 4UBOA 4CLOA 4Y2TA 4UNQA 1C4XA 3EQ7A 4MA0A 1PFWA 2D5BA 1E1MA 3SCZA 3WLFA 2ZR8A 4YCJA 3WXBA 4D45A 4MV6A 5E1DA 4XWKA 2PZKA 1P1KA 5AKJA 2HMVA 3IELA 2EATA 4Q7LA 4QFMA 1F5NA 4L8LA 4KRFA 1Y7IA 1RWPA 1SU8A 1F4LA 2W8BB 1QX3A 1WCIB 2B21A 3ZHXA 4RM3A 4KXVA 2M1XA 1JAHA 1U81A 2NADA 1YULA 3TL3A 4IL5A 4NBUA 3WNZA 3DHNA 3M4ZA 1BAPA 3NYWA 3OM9A 1A8SA 1R9GA 1R88A 4LJYA 5BT8A 3OIFA 2PUVA 2ZYTX 5KQPA 1KEPA 2W6JA 5KTRA 2NZJA 4YJKA 1H8ED 1QF6A 1DC5A 4DDVA 2YCBA 1TYDE 5E1MA 4A23A 3GPIA 4AJKA 1N3BA 1SWVA 4QOHA 3U7FB 1D8TA 1E8DA 3AW9A 2EW8A 4TUYB 4JNKA 2OHIA 4QNMA 3TUIC 4HGZA 3ZDZB 4F21A 1NW4A 1ESZA 9MHTA 4E14A 1NBMD 4MWTA 2PY6A 5C34B 2JLXA 1RWKA 3QVTA 3LBIA 1Z18A 3ORQA 4Q47A 4ZO7A 2ODNA 3G2IA 3EG9B 3QW4B 1PGJA 1PV1A 2ICAA 4XEUA 3O7WA 1RWOA 5CEFA 5HGXA 3M83A 4E07A 2FQYA 5B3KA 2F3RA 1NAHA 4D0GA 2EEPA 4RACA 4C5CA 4RVSA 2HSDA 4MICA 4Q9HA 5EFOA 1AZTA 1VLLA 3ZDFA 3FI9A 1YA6A 4EENA 4DV0B 4XW2A 4XI9A 2EJVA 1UJNA 3R7AA 4EHHA 2QRQA 4BN5A 3TPCA 1Q77A 3FRHA 1ADCA 1V43A 1FUEA 4JEMA 4YRAA 4QO7A 3E15A 3EZFA 3QLJA 5CNMA 4WOBA 5E8RA 2VSXA 3UVEA 4AFNA 3TL6A 4AS3A 1NOJA 3V1YA 5AM2A 3I58A 1CR2A 4PG4A 1OGJA 3HJAA 4M99A 1QMPA 5BVHB 1VLVA 3AWIA 3DE5X 2GF2A 5ALOA 4AO6A 5EKDA 1I2CA 3RRMA 1WQ3A 4UUMA 1B43A 5FWXB 1F8YA 2ST1A 3MCAA 3P2IA 3QPCA 3T5BA 2XT9A 3D43A 4DLAA 4HXGA 3JVDA 5IARA 3FYSA 1Z3IX 2KYRA 3ZHZA 1W36B 1ZS9A 1TA0A 3FWYA 3T4XA 5IJ9B 4O1MA 1V1RB 1YT5A 5J58A 1V8FA 1MOQA 4BLQA 4LBZA 2I2XB 4OFZA 3WRWA 4BKPA 5B4VA 4WK0B 1NYRA 3BMCA 3CEMA 3EMBA 4BV2A 3F6EX 2V7QD 5CDHA 3E81A 1SHUX 3CX3A 4DLWA 2R6DA 4HY3A 3DULA 1N6LA 3F4LA 1JHMA 4JVNA 4XLZA 4AVYA 2HOQA 2IX3A 1BWPA 3IERA 2WT8A 4J9UE 1GNTA 4C0XA 1B3BA 1TIPA 3PITA 1JU4A 5AOAA 4I1IA 2F1IA 1L8XA 4LRQA 1YOBA 4JJAA 1U7ZA 3HL0A 4WOCA 2Y3IA 4Y6OA 1BCSB 4EB6A 3N2NA 3X1WA 5HWSA 4F8JA 1SIUA 3DMRA 3U3ZA 1GG8A 4DR7B 4B7ZA 5LDDC 5C31A 5EXTA 1S8AA 4R6WA 1M6VA 2W6MA 4D0LB 1LZKA 5ICEA 1Y8CA 2ZRDA 4JZKA 4GE3A 4J2TA 4F5YA 5HZGA 1GIAA 1K9VF 1Z5OA 2DR3A 3DAYA 3AUFA 3RGWS 3GW8A 3ZWVA 1VHQA 1V3VA 5FUWA 3EAFA 1FDVA 2XQVA 5FR1A 5GVRA 1T91A 2O8NA 2IHZA 1E1RA 2ZVQX 1H3FA 2O5EA 4JLKA 1PFKA 2FDRA 2D1TA 5IH7A 1K6XA 4Q18A 1W6UA 2FLKA 2XRZA 2Y68A 4EB3A 3O21A 4YUYA 2VWPA 1X9GA 1QS0A 1XXHE 1T2FA 2D6FA 4WXYB 1JR3E 1JSLA 1XRQA 2BEWA 3QU9A 5EZYA 1UM9B 3T5AA 3ONDA 1Z13A 1EGVB 2JRLA 2Q5CA 4JYCA 4R1LA 3FWPA 3HUEA 4WXHA 2VF2A 3O8DA 3PFHA 5DP1A 4DR5B 4ADSG 1E2DA 3I64A 1WSBA 3JV7A 3OUUA 4LXYA 4CLHA 2FMTA 3M1LA 1XTKA 2LD4A 4ZREA 3W3AH 3GGPA 1WB6A 5AHKA 1KYQA 1SCDA 1Y98A 4LJ7A 1E5QA 2SHKA 3AEUA 4W9NC 1DAMA 2J7KA 2R68A 3F8TA 2R6GA 2Q0SA 3OQHA 3OQIA 1EXNA 2WUWE 4I4NA 3WYGA 1PS9A 1Z6TA 1E3SA 1NHWA 1W47A 4RF4A 2R7KA 1I1HA 1Y7LA 1FXSA 5COBA 3B1XA 4YO7A 3WGGA 3KR2A 2CZQA 1JHRA 2JEZA 4MRPA 3ZE2B 4KQ6A 3QKSB 1XVIA 3R5JA 1MO2A 5BW4A 3UN1A 2P7IA 2VSYA 5FWAA 1FVFA 4C08A 1IHOA 4JC8A 1YB6A 4EL5A 5KNBD 1Q0SA 2ODEA 2WVHA 3DW3X 1KI7A 3I2JA 5AHOA 4D4LA 5JZBA 2I1VB 3GRAA 2BGWA 1PU2A 1ZIYA 2DGDA 4X1KB 5IDXA 4E15A 1OUMA 2Z6AA 4M6WA 2R1TA 3P8ZA 5KNDD 1M5TA 3OAAD 5ALHA 2ZSAA 4WLUA 3ANMA 4MITA 1ZOIA 1T2UA 3GROA 4CLOB 1YF3A 3IHKA 4BVHA 3EPJA 1Z45A 4UATA 3TW6A 1YRWA 2NTEA 3IV6A 3LHSA 3ZU4A 2QI9F 3U3JA 3KPUA 1N2IA 2AZMA 3DVRX 1A7AA 4AWBA 2RI1A 3AKZA 3GGGA 5TEWA 5DGIA 4BTVA 4LECA 3S8EA 2DKFA 3V1NA 2Q2WA 4BMXA 5NLLA 1JA0A 3QYJA 4XM2A 2Q5EA 4R2JA 4BE4A 5AVWA 1O1YA 3L6BA 4QU0A 1DAHA 3OOWA 5U9CA 2GEBA 1A9XA 1O97C 1KEWA 3Q8KA 5B2ZA 1Z28A 5E2IA 5KAPA 4LYDA 4X1YA 1E5LA 4JQYA 2HMYB 4WZZA 5EXSA 2ZSKA 3QXGA 2FPSA 4UNNA 1E2PA 2DM6A 3UHPA 3UW3A 4BGUA 4EP1A 2V4UA 1IN4A 3TE6A 4IIBA 1HDRA 4DQDA 1A69A 1HQKA 3I76A 1RLOA 4KG7A 4O3MA 2GDJA 2GK7A 3QM1A 4O2RA 3JATB 1FLNA 1QGAA 5AKIA 3D8BA 1RW4A 5AK3A 2BJVA 4DSNA 3KTOA 1V6CA 4BDSA 3CISA 2RMKA 2FE1A 3HCFA 4QEKA 5ALFA 5HDBB 2K2WA 3QYFA 1M6YA 3CWCA 4D8TA 1ISIA 5DGCA 1IHDA 2XE6A 1MJNA 3MXOA 4IF4A 3SZUA 3EUFA 4K8RB 1ECGA 4K6HA 1E6EA 1EVEA 5I48A 5ELMA 4I1SA 4IOKA 2RHLA 3QUBA 1C8BA 1SOAA 4BB5A 2BIFA 1J70A 2YYSA 1V2GA 5D86A 4Y3UA 4H6XA 4EPXA 1I1OA 4JVLA 3D7KA 1USWA 2RBGA 3EJWA 1QYDA 5FTMA 4P22A 3HZOA 4MCJA 3TEMA 3RTEA 4A8JA 4ZV4A 1MB9A 5EINA 3GLRA 2B1JA 3MSXA 5LDHA 2COUA 2DYKA 3QIVA 4OP3A 4CQJA 5KCMA 3R9WA 4R31A 2GNAA 4J91A 5ILQA 1ZWKA 5PNTA 1YL5A 1G8AA 2QW8A 1I13A 2XYQA 1PIWA 2B8WA 3D59A 4U7GA 2XCQA 3TSAA 3U39A 1A9SA 1N1GA 1Q7TA 2I78A 2F6RA 3VXKA 2X4DA 2GVDC 4RGVA 4R8LA 1YFKA 5H3CA 3TNYA 3L6EA 4WOPA 5ESXA 3UMVA 1N3LA 4D9NA 3ZU3A 1WNFA 2G25A 4TS3A 2DHCA 3U37A 5AKGA 3MLEA 3V4PB 4M8NE 1V5EA 4Y2PA 4QG3A 2FUCA 1WOMA 3OEEA 3OE5A 3LPAA 4HMQA 4ED9A 4PNHA 4C43A 4GRDA 3N70A 1ORRA 1ZVMA 1JIQA 4UPEA 4MVCA 5T3UA 3M6IA 3FUVA 4BASA 2JAWA 5AVYA 1HDYA 1PV2A 3VR1A 4W63A 5EIEA 4UOEA 4RTOA 3K9HA 4GDMA 1YZQA 2ZJ3A 4OYYA 3LBFA 1PSDA 2Q9AA 1E1YA 1VLZA 1GNQA 1UJBA 1ZU5A 3OJLA 3DLTA 3PNSA 1IEQA 4P7FA 1I24A 4M1MA 5DYNA 3MGAA 3RDPA 4M8SA 2AEMA 1X1TA 4YBRA 3A4TA 5HVNA 4YRZA 4Z1MD 4D74A 4DR4B 4MVJG 1UWLA 4WV3A 1XPOA 1OI3A 1DL5A 4GI7A 3IGFA 1P1RA 4QPDA 3QEAZ 1NR5A 1YBAA 2C9CA 2PWBA 4EB6B 5G02A 4DMLA 2QS9A 1R15A 3C3WA 3ZVRA 1USIA 2VRCA 1BX3A 4JL8A 1OFHA 3GFFA 3S2ZA 3PGJA 1I36A 2YS6A 3A9TA 4NS1A 3HO1A 3I9FA 1M6VB 1Y9ZA 1CZNA 3FHCB 1J24A 3B51X 4FHFA 3PRKE 3CX6A 3ZE1B 3INYA 5GWXA 2G4VA 5TDHA 2P2DA 4DLLA 5D01A 2I3AA 4H6WA 4EJ6A 1NVGA 2J8ZA 4WL0A 2WIBA 2PXXA 1FP2A 3GBPA 4KRXA 2ZPUA 3QPBA 1O95D 2PJZA 3AHCA 4MV5A 5JZSA 1JNXX 1NF9A 2GWRA 2NPFA 3WLRA 1TKAA 2DR0A 2AVDA 2Y1FA 3T5PA 4B4UA 2Q5HA 3VOTA 4I0WB 1NNEA 3R7FA 2NU6A 1YQXA 2ASVA 4TMWA 3WB1A 4G86A 4WCVA 1CUCA 2HQRA 1BRTA 1PDWA 3FDXA 2IIVA 1QS0B 1PD1A 3HY6A 4X1OA 4P4TA 1QGYA 3ACBA 5F2EA 4ZV7A 2D00A 2VJOA 4MQEA 3FCYA 2JI6A 5EZYB 4FW8A 3OZEA 5TQ2B 1XZHA 4RESA 3M3PA 1SG6A 4C1NA 3EGDA 4CKWA 3AO0B 3ICPA 2QZPA 2EERA 1SBQA 5H82A 5J5AA 4IJUA 3HFRA 2G80A 4IDCA 3SIWA 1IJKA 1F20A 1TVKA 1MNAA 2BEJA 3IQZA 3JD4A 3HU3A 3N7TA 5EGNA 4BCBA 2I4RA 2W5UA 3AEUB 1LD3A 2HCBA 1XCJA 1D0VA 4ZU6X 3VNQA 1M1ZA 2BFEA 4B1FA 4ZYWA 1GL7A 4MQ5A 4NBSA 2VSQA 1E7SA 4A8JC 1KJJA 2AFHE 1IWBB 5JPDA 1X7DA 2LCIA 4CF6A 4QJBA 2BYTA 1EHIA 3DKRA 3T4PA 2ZTMA 3KYIB 3GNLA 4PONA 4BVAA 1CQPA 1TU0A 1FYDA 2WABA 3G6KA 4C88A 1DUVG 1PL7A 3M6LA 3EYWA 3GPBA 4YMGA 2GCIA 4AS1A 2PX0A 3D0KA 4ZOAA 3IPLA 1T5IA 2G1KA 5IANA 3WISA 2QG9A 4B35A 3ZDXB 2DBYA 3ITEA 4M6WB 5C1DA 2R1TB 4EBBA 1KQOA 3A3OA 5A06A 3HU1A 3SWWA 3UNXA 1K4YA 4K2HA 4A92A 3OJCA 4PG6A 1SKUA 1U2QA 3AI1A 3GGDA 4JBYA 3L8FA 3TPFA 3RJ9A 3R3XA 3WIBA 3GFOA 2ERXA 2I03A 1Z25A 3KHSA 4ZAXA 3ONFA 5HKLA 2NVBA 2CLSA 4FCVA 2H0AA 4JQOA 3N6XA 2BF7A 5MGBA 4DB2A 1FMTA 1P74A 3JQ9A 2B5WA 2HU2A 3NDRA 1QFMA 3RT7A 3U1VA 1RM5A 4Q37A 3GC6A 3VTZA 1IMOA 1EGAA 5JAMA 1SBIA 2VPZA 4HAUA 4XB6B 4BQNA 2LV8A 2ZP1A 2FNAA 3T94A 4K6OA 4KIFA 3RNOA 3VBEA 3RBXA 3MWGA 1YFLA 2G28A 2AKAB 2B6NA 1A9XB 2XY4A 1PNRA 4RZIA 4B4KA 2EGUA 1U3VA 3HN7A 2O3RA 3MNFA 1LI4A 1WV1A 2A33A 2HYDA 4JEHA 4X1YB 3RAGA 3WIOA 4ZEVA 4UHDA 1G66A 1HNWB 3CUYA 3H6HA 4HUQA 3N0RA 5H8WA 1LDGA 2QTLA 4IX1A 2PYZA 1T1JA 1C1DA 3G3EA 4JJIA 2VHYA 5KAMA 1SBNE 3C7CB 4PPNA 3T12A 1ZEJA 2WJ3A 3OPMA 4YCCA 3IEIA 5CJ2A 1U4OA 1TGVA 1SN7A 2PVCA 1GTJ1 3VKHA 2IOHA 1KJNA 4I1VA 4PVDA 1E1KA 3FSGD 2NLOA 3QHAA 1AD2A 5A4FS 1R8QA 2GM5A 2P9QA 4UU0A 4KSCA 4RIEA 3IAEA 4NE2A 3KVYA 3CNEA 3AXSA 2GESA 4B32A 2H1RA 3AHJA 2DBQA 2WE8A 4ZVTA 3W2HA 4D4GA 2R6FA 4YPOA 4HGRA 1CRWG 1U63A 4LXXA 2QA5A 2RJNA 3OKCA 4ARAA 1Y4AE 2GZMA 3DBRA 2HCTA 2I4OA 1UP7A 1CS4C 1QKIA 4ZEWA 2X0FA 1DUSA 2UXCB 4RZHA 1EX1A 2CV2A 1T8SA 3CONA 4RHFA 5IBRA 1QRRA 2DQZA 1R74A 3EBOA 3N8DA 4FKZA 2B4AA 2J30A 2FRXA 3U2QA 2XCSB 3L0YA 1WCWA 4MRMA 1EVQA 3JQ7A 3KJFA 2C77A 8ABPA 1OU4A 3DLHA 4ETNA 1CK4A 4GPD1 5CFOA 1FPMA 2ZBVA 2YV5A 1JMYA 1U8CB 1JQKA 1LZLA 1SB8A 3PZBA 1OPRA 5EZQA 1YB7A 2GYVA 3GJZA 4URXR 1ZK2A 2NUPB 5CCXA 1LBIA 1MJGA 2HPVA 3DJFA 5AOBA 1GQ2A 4BFXA 5JAZA 2CYBA 3IILA 2BHLA 1Q0HA 5CB8A 3HYTA 1VIMA 1GUZA 1ZJ5A 4BKOA 4GUDA 1FMCA 4CIWA 1LXCA 1C3EA 5B7PA 2P41A 4PWYA 5DEOA 4QTYA 4REQA 1LNZA 4NCXA 4TKVA 1ONPA 2H07A 3QUTA 4UHEA 4BGIA 3HYNA 1NG9A 1GGNA 2CXNA 2QNRA 3CKMA 1N6RA 4Q6BA 1NPYA 1I5RA 2VPXA 4XH9B 4PLHA 4QJIA 4CFSA 4RTNA 1IEWA 2G9QA 2VKQA 4MS1A 3N8HA 3N7UA 1QG4A 1W5FA 4Z5XA 2EFGA 3K20A 5C9ZA 2IXDA 4NOJA 4AJ1A 5AICA 4DN6A 1W1WA 2JFWA 1HXHA 2PUTA 4NCKA 1T0JB 2NSDA 3IAAA 2PZFA 3NHPA 4F4UA 5IFKA 2BWJA 4YJ2A 4DCNA 1JFTA 3JYLA 3PDJA 3OSZA 1Y1KE 3KPVA 2XVAA 3MJ4A 4W5JA 1MC4A 3CW8X 3IKVA 3TOSA 5IYZB 4TWIA 2D2XA 2IRWA 3R0JA 2OHJA 1C4OA 2FKAA 4G9BA 4H15A 3QW2A 2ZAYA 4IIFA 3IPRA 1SU4A 1F4PA 5K8JB 4EGJA 3I01A 1N5JA 1C4KA 2A5JA 3WKAA 4J49A 2ALJA 4W6QA 4Q7JB 2ZIZA 3H6GA 3IR5A 2BUBA 2XAAA 5J59A 1TUIA 2ASEA 5ER6A 1Q0TA 1I3LA 2I4LA 1GQSA 1CB7A 2NU6B 1IEVA 1E7WA 4UZEA 4Z3OA 3IUYA 3GUUA 4LRUA 2XMQA 2WTMA 1TRHA 5EP3A 2CVPA 3H8SA 3RIXA 3RYFB 1C7RA 1ZBQA 2IY9A 2OUIA 3LJKA 2H1LA 3Q1LA 1R0KA 2OHGA 3QBDA 4IFTA 4MGHA 1NU6A 2A9RA 2IYVA 3KUKA 5TY0A 3ZKAA 4B84A 5H9WA 5HZKA 1LSSA 3ZNOA 2EJWA 1NQXA 3EGDB 4CKWB 4HXEB 4ERNA 4ZAWA 1PLKA 1L7DA 1XMJA 4D92A 4QT0A 4BJHB 2WYOA 1FIUA 5BQPA 1NUUA 4AAYA 1TVKB 5D84A 3A14A 3TOXA 3CPHA 1H05A 1U2ZA 1PK8A 2VJPA 1I0ZA 1LW7A 2BFEB 2C5GA 1LC3A 1QV6A 4WH0A 4LQDA 5KNCA 2HRCA 5C53B 5KHLB 4ARZA 4BLUA 2QVYX 1VCHA 1P72A 2NZ2A 1VHDA 4FQ8A 4L8YA 1YDMA 4MV0A 4YP1A 4CVNA 3BWBA 5K6TA 1XNRB 2I22A 4FEYA 3UUGA 3ZG6A 4YLYA 1V35A 1QHSA 1QYVA 2WUEA 3CNHA 3DDNA 4MYUA 1Z2CA 4KMRA 4D8YA 2D7JA 1QCDA 2MJLA 5KQMA 4AF7A 3E2IA 1JLHA 1VKRA 4MMZB 5HA5A 4G09A 4N5LA 1TNDA 3KSRA 4X7MA 1GAQA 2Q21A 4YAEA 3CVYA 1I3MA 2LNDA 2EGGA 3BRSA 1VKOA 3QX7A 2F7SA 4FT2A 5LBTA 1NVXQ 4QSMA 1GZ5A 3A9RA 1XNGA 5BR7A 1JJIA 2W6NA 2R5WA 4XDGA 5IT9A 4GZ6A 3F8SA 2B20A 4DSTA 2D59A 3EVBA 1KMMA 2UZ0A 2D4AA 1ENPA 1MAAA 1CWUA 4GPAA 4QU9A 4RK7A 1C7QA 1FQWA 3QBEA 4C4PA 1XD8A 3I4CA 4NNJA 5YASA 4FFVA 4LVUA 4X91A 2WM2A 2ZJBA 3AUYA 2J9YB 3WK8A 2AD1A 1CUJA 3BZUA 3FOEC 4XYMA 2ZTHA 1JHOA 1QZUA 4QPPA 4F93B 1T0PA 3FVWA 3C6BA 3QTTA 1Z75A 2AF3C 1BTOA 3GLIA 3GCXA 1KERA 1E5DA 1L7MA 3BEOA 4HUQB 3TJRA 3ZNQA 4AC9A 1FTWA 2HJHA 2C2GA 4KKVA 3E3MA 3P9SA 3BS4A 4EX7A 4TLEA 5DHQA 3E9RA 4L0CA 3L07A 5HKOA 4QGBA 2B99A 4JI0B 1CUXA 2ET6A 4NX2A 1ZG3A 1KOLA 2IYNA 2LVBA 5JXIA 1GSAA 3NU1A 3PQ4A 4PSUA 1Z4PX 2Y4OA 4DAEA 1O9BA 2Y9PB 4Y1RA 5CYOA 4RVUA 1GQQA 5AUNB 5C4IA 2FWBA 3A4NA 3GIWA 3ENKA 1YRLA 4MKRA 4HB2A 5KJCA 1Z37A 1H1TA 1U1IA 3PGMA 1EDZA 2XE7A 2P5UA 3S1AA 1ZSNA 4LF9B 2ERCA 3TR0A 3RF7A 4X71A 4DQXA 3HB1A 4JA0A 1L4UA 5E4FA 5F2NA 1VC2A 3COYA 4ZVKA 3ESXA 4HLUC 3DBRB 3PFIA 3W8RA 1OLSA 5JH7F 3MCTA 4QA9A 4R1UA 3SZGA 4DCUA 4ENRA 2P65A 1T24A 4P53A 2BGIA 4U00A 3HJNA 4WDQA 3AF6A 1A7KA 1O3YA 1JDUA 3OCWA 1GL9B 1CUEA 3K15A 4UKDA 3EARA 5I9LA 3HR7A 1ICEA 1P4JA 1SHZA 4GI1A 2CBGA 4F7WA 4I1YA 4A0RA 4MRMB 5IHPA 1BH6A 3OEHD 4UEKA 5CPFA 5F73A 1ZCAA 1VSTA 3JQ7B 4OP1A 2I29A 1EDEA 4P3YA 4RZQA 4UM8B 3S29A 2BTQA 2Z6QA 3AK4A 3P52A 1PFUA 4MNTA 5J2TA 3CF6R 5IEBA 5KO2A 2IUFA 2FZKA 3HR8A 1LC0A 3I6MA 4Y9SA 1SO8A 4IMRA 2ZRHA 1XDSA 3PFCA 3COSA 2P9ZA 2V7GA 2EBWA 4WVLA 1ECBA 1H2YA 1QUFA 4X54A 1AF4A 3IB3A 5B53A 4Q1CA 5B4TA 2DWUA 1H66A 5FPYA 2FEMA 1NVKA 2ESRA 1DWOA 4R98A 2YFQA 1U8AA 4KAXA 4RPJA 2ZYUX 3ZXIA 1CERA 2X9QA 3DXZA 1Z5WA 3HYLA 3UG6A 4EY6A 2YR0A 5CXQA 2Z9DA 4I1PA 1PZFA 1OLOA 1S3IA 4REQB 4KB5A 1NP3A 2HIGA 4TKVB 4I55A 3KCQA 5JD3A 3UHFA 4BO5A 1SR8A 4IHAA 2HSJA 4ZO9A 5HUJA 4D41A 4PYMA 4PLWA 1MOPA 3TFWA 3B1FA 1D2HA 1VRWA 2C3YA 3DLCA 4MS1B 1NVBA 1Z12A 2JFVA 3NHYA 4LCJA 1PJ3A 4Z9FA 5EE0A 4EABA 5TE9A 4RF3A 4C7KA 1BEUB 2D1FA 2WSIA 1Y9DA 1CCWA 4M76B 1HT3A 1GZHB 3MVEA 1N75A 3IIKA 2FK8A 3G5LA 3QPDA 3BRCA 4ZO6A 3MOGA 5ITWA 2O5CA 1Y9AA 3EDRA 4YFVA 4YJ2B 3DR5A 4TT8A 3ZWAA 4JOBA 4OH1A 1ZNXA 1HDXA 1M0TA 5IXYA 1GPAA 2C8VA 4QO8A 3HWSA 3UXYA 1L4LA 2B98A 3ROKA 3F46A 2IIQA 1V95A 1A9OA 1T8UA 5CAEB 2Z2ZA 4ZGBA 1KU6A 2Q6OA 2MHCA 3VI4B 3GEIA 1DIRA 2ZT5A 2QRKA 4MQUA 3AVPA 5IAKA 2DTXA 1J8MF 4PFQA 2GAAA 4TZTA 1ISGA 3R3WA 8GPBA 1EGHA 4HXFB 4B81A 3EISA 1YSCA 3MWDA 1ZHHA 5JJKA 4PEVA 1ZA2A 5EJGA 1FNBA 1T10A 1K6MA 1JPJA 2QVCA 2O2EA 1VHWA 2O7SA 1GD1O 1KORA 2CD7A 2OQRA 2B0JA 3QWIA 1HFEL 3I3OA 4ND2A 1PL6A 3UO8B 4AJHA 3B6EA 1THGA 3NT4A 1UPTA 2CK3D 4YRSA 3ZZ0A 3DNFA 3IHTA 3AVVA 3F49S 2V7BA 2B4TO 2E1RA 1OLUA 2NTYC 3A25A 3MGBA 1B6RA 4L9WA 3A6FA 3TH5A 3VJKA 4BWVA 5CLLA