1WFDA

Solution structure of mouse mit domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
GSSGSSGQDSDSTAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDRAENIKKYLDQEKEDGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein 1500032H18
publication title Solution structure of mouse MIT domain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 30
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wfdA00
3EABA 1YXRA 4WZXA 2V6XA 3ZT5A 3ZSSA 3ZSTA 4CN6A 2JQ9A 3ZT7A 3ZT6A 5CJ5A 2W2UA 1WR0A 2LRKA 5LB7B 2CRBA 2DL1A 4U2YA 2XZEA 2A9UA 4CN4A 2RPAA 4U33A 2MPKA 2JQKA 4U31A 4A5XA 5FVKA 4P1NA 4CN1A 2K3WA 3K1SA 2WY2A 2WWVA 5CGMA 2CPTA 4NIQA 4U7IA 5FVLA 1WFDA 4U3CA 4U7YA 2JQHA 2V6YA 2V6YB 2LRLA 4IT4A 1WCRA 4ZEYA 4U2ZA
chains in the Genus database with same CATH superfamily
2ZM8A 4NUVA 1XZYA 3ZMUB 3Q5DA 4ASKA 4DUZT 3VR9A 2BZBA 4CQIA 2IMLA 5F8PA 3NKZA 4A97A 3NWIA 4IDPA 5HEOA 2L9QA 2XUEA 4KUMB 2CMRA 2RP4A 2DNXA 1WCRA 3IA3A 1MMAA 4ZI2C 2ES0A 5TAOA 3EVYA 5J2UE 3C4ZA 5FL0A 4JI1T 4WNKA 2XZEA 3U78A 3HR0A 1MMNA 3O1JA 2CPTA 4LMJA 2V26A 3L3PA 3PUWF 2WMOA 3BK9A 5C8YE 2P9BA 3AE1A 2D0TA 1KEYA 3Q5WA 4H63V 3S4UA 2JQ9A 3W15B 5DJQC 3DP7A 2E8IA 5LB7B 5L4EA 1KNZA 3H37A 3QB5A 4QH5A 4LF7T 1QLBA 5C3JA 3CX6B 3LFMA 3SFEA 3HKDE 3UFGA 4OX9T 3O9XA 2E9XD 3ONLC 3WAJA 2VVNA 5CB4E 2VQET 3KBTA 1H7CA 5LG3A 4GKKT 3HA4A 3JCFA 1CHUA 2M6BA 2W63A 2YEVC 2IAKA 4ZXLA 4DR6T 1CUNA 2NW7A 5AQRB 2NW9A 3ZPOA 3M3ZB 2PTFA 1BR0A 4V1Av 3PV0F 3B5MA 2A9UA 1VCSA 1NEKA 4LF6T 4OYJA 3TLVA 1W9RA 4CXXA 4U7YA 2KT9A 4TX5A 4C91A 2YU2A 1WRDA 2GK9A 3CK6A 4HGAA 3MACA 4DV5T 5JTGA 5CGMA 2XM1A 5FY0A 1HTJF 4U74A 5CA1E 3JAFA 3LK42 3PJAA 4AQYT 4LMLA 3SRZA 1IJ5A 4BJNA 2F4VT 2X51A 5KXJA 1LKXA 4DBRA 4TV8E 3T1YT 3N5LA 4O8SA 5JDQA 4FI5A 2HN2A 3AE2A 3KV5A 3PUAA 3C51A 2CLYC 4JI8T 4ILCA 2PBIA 5C2TA 2MPKA 2XQ6A 3WI3A 2VB6A 5FY7A 5L3BB 5LG4A 5KX5E 3LG7A 4DR5T 3ZT7A 2BS4A 2PJQA 5BMVE 4YTMA 4IDQA 4LF5T 2YOEA 1UX5A 1HFAA 3LSVA 3VHLA 2WB5A 1V9DA 4IDOA 1U5PA 3N9OA 2C5KT 2UXBT 1T8BA 2XAJB 4UV9B 4EZHA 4X64T 3PURA 3AVRA 3HKBE 3AA7B 1HG5A 4IDZA 3C98B 4WBOA 2V7KA 5AQTB 4O2BE 4ISSA 4YHJA 1HS7A 1WYBA 5JDNA 4KP3C 3KV9A 2Q9QC 3D0TA 3A5XA 5JQGE 2IIUA 1SHZC 3QUJA 5FP3A 2WZIA 3EHZA 1HX8A 1OEDE 4TV9E 5AQGB 1VCTA 2Y48B 3PUQA 4GK5E 1D1CA 1XWMA 4DBQA 1ZHCA 5LXTE 2L8KA 4IT4A 2CWOA 4DR1T 3PUSA 1KK7A 3UUNA 4ZZBA 2D9DA 2XHEB 2LM9A 3UT5E 2BBHA 2X0HA 5ABHA 4CI1B 5LGUB 1UURA 4KMCA 3FHNA 2KZ7B 3N2OA 2ZM6T 4P1NA 4DIDB 2V7JA 4GYSA 2MBGA 3UU4A 2KXPB 2XM2A 4DVDA 3AA6B 3EABA 2LOPA 3O1IA 2E9XB 2NR4A 3GMIA 2XPKA 4TWDA 1IJ6A 3AE4A 4UVAB 2ZMAA 3AEAA 3VKHA 2V6YB 2KLQA 4YSXA 4BAYB 4QH1A 3PU3A 3SFDA 3ZT6A 2BBJA 4HFBA 2JIWA 2Z6EA 4LF4T 4QX7B 2V8SV 2LHRA 1Z8UA 2ZM2A 4IDNA 1T7SA 3IF8B 3ZSSA 1XMOT 1KF6A 4HFEA 3ZMTB 2DHRA 5JDHA 4IREA 4BA9A 2NWBA 4UIGA 5IWAT 4CN1A 1X79A 4E7SA 1D0XA 3UU6A 2D5UA 2JPFA 2M67A 5AQMB 4DNDA 2I6HA 2X9HA 2W66A 4EB6E 1IAPA 5AQOB 5FKYA 4QHOA 5LYJE 4ZHQE 4DO0A 1D0ZA 4AKRB 4QXBB 2UUCT 4H63H 4LF8T 4HKAA 1ZKEA 1KNPA 3OYXA 1N33T 3CQXC 2QA7A 1DU2A 3H3AA 3MA9A 4H9NC 3GN5A 2R6GF 2MTQA 2V5CA 1MNEA 2CXLA 4HTEA 3KV6A 2XQ5A 1W09A 3EI0A 2LRKA 2LSYA 2QGSA 2YDQA 2CHNA 2BG9A 3AA0B 3E22E 2K24A 2WDRA 2WWVA 4NUUA 4ILAA 1NWMX 3BQKA 4Q25A 5HEGA 3AE7A 3MK7C 1YXRA 3K3OA 3ONXA 3RLFF 3AEGA 1IZNB 3AAEB 5J2TE 4EEBA 5ABFB 5DABA 3OJAA 3SOLA 3R6NA 4IL4A 3RIAA 4XZCA 3OKQA 2FUPA 2MYSA 3PUXF 1L0VA 3FZLB 3P4RA 1OEDB 1N32T 1OWAA 2X0LB 4DR3T 1E2AA 1J1JA 4DUYT 3DTOA 1HNZT 1XNRT 2N1GA 2ZM0A 3CX7B 1Z0PA 3CKDA 5CA0E 5ADXL 4EXTA 4FJOA 4TZ4C 3ZSTA 1S94A 2LE8A 3OYZA 4HWIB 4HEAA 5L3CB 5HCMA 1HCIA 4DV6T 5HEJA 1XDOA 4PK5A 3ZYLA 2KINB 3FBLA 1HNXT 4JI2T 4IE0A 3HKEE 4B3RT 2J62A 5LBMA 3B13A 3UTKA 3SWHA 3FZHB 3P7IA 3OBVE 3N9LA 2H7VC 3ONJA 1T72A 4P09A 3TLWA 2UUAT 5AQQB 5GONE 1MIYA 2XAQB 2FJBA 4PK4A 2UXCT 1YW0A 2X9XA 2CLYB 2B1EA 4EYUA 2RPAA 2WSSV 4HFIA 2E2AA 3A7MA 5FVKA 4MBQA 2VKJA 4UXNB 2HH7A 3AXJB 2BKNA 3N2GE 2H89A 2Y8DA 3ZYKA 3ZYMA 2W4XA 4JUYA 4ZS3A 3AE8A 1QSDA 4TNWA 2JMKA 2LJLA 2L3LA 3AA1B 3B57A 2K48A 4DV2T 4JEHB 5LOVE 5A1LA 3Q5XA 2QYWA 3MXZA 3UU5A 3V5SA 4HFVA 2ODUA 4L0RA 3BQLA 4ISTA 2Q9QB 5FNVE 1UK5A 4IE5A 2BKPA 3CPZA 2MAWA 3LBXA 2V6XA 3LK2B 4LF9T 2WCAA 1GQEA 4GYRA 4X1YE 5FL1A 2LM2A 3AVSA 1AJ3A 1WFDA 4HFDA 2K5BB 4ERRA 2J1DG 1ZOYA 3X1DA 1SUMB 2DI4A 3AEEA 4B3TT 2CBIA 2A2FX 2IW5B 4GK0E 3G06A 4Z8XA 4O4JE 2WWUA 5LHIB 2CHOA 4PNIA 4OFZA 3RIUA 4JI7T 5AQIB 2J47A 3AAIA 3RHWA 3E08A 1HF8A 4COFA 2BG9C 4NPPA 3TKLB 3AECA 2K3WA 1NAFA 5L3EB 3ABVA 5FXZA 3C4XA 3KDSE 3UUBA 4KI0F 4DV0T 4AIUA 5HXCA 4WBNE 1BR2A 1M7KA 3ZN1B 2EHOA 4U33A 5LHHB 2HPJA 2FJAA 4I50E 2DCFA 2VWAA 4AKHA 4WYVA 3PUGA 4M1PA 3A8YC 2WP9A 2PFVA 4QKNA 2ACZA 3JADA 5JR9A 4NXMT 4CN4A 1VOMA 2YN6A 2XY8B 2CM0A 2I59A 3EAMA 3RC3A 4GIWA 5CFBA 4DV7T 4J2CA 3CMLA 3N9MA 2CBJA 3R84B 3C4WA 2AXDS 4KBMB 5JH7E 4LFAT 4UF0A 3RQUA 1YD8G 3UFEA 5EK4A 3CIRA 3PE0A 5EK2A 4OYKA 2LRLA 3RKOA 4TUYE 2YU1A 3I0QA 2DWGA 2JMHA 3ZT5A 2WMNA 3UUXB 2CWYA 2WQYA 4YXDA 1WLXA 1O3XA 4ZI3D 4Z91A 1X9BA 2K9AA 1R8IA 3ZEFB 3AB3B 5LBQB 4QX8B 5AQHB 2PG8A 5LMNT 5H6QB 5FY1A 2N2NA 1KNRA 3ETUA 1MMGA 3I1AA 3AE3A 3JAEA 4PJMA 1FIOA 3GA8A 4U31A 1IBMT 4C90A 4QXHB 2XSAA 1KFYA 2I0MA 4H9RC 4AKGA 1IBLT 2J4GA 3J9X1 4CXYA 4JEUB 2FBWA 1QUUA 2W0GA 5J0ZA 2BG9E 2B76A 2UXNB 2LSGA 3JC6C 2XQ3A 3UU3A 4EV6A 2DLRA 1ZP0A 2CXFA 1N36T 4EIWA 4EEDA 3U3IA 4B6XA 4JBWF 4YJ3E 3LDQB 4O4LE 5AQFB 2BS2A 3GWHA 1ZEEA 4I55E 1BR4A 1NENA 3ZKRA 4YTPA 3K8PC 3UQ4A 1FEWA 1MIVA 1EZ3A 3PJAJ 4Z90A 5ETWA 4HWCA 4O4HE 4XBFB 3CQGB 1D1AA 2FJEA 2NW8A 2M6IA 2V7MA 5L47A 3MKDA 1E7PA 1OXZA 4X65T 3IHRA 3OPCA 4HFCA 1I6ZA 4MALA 4NIQA 2ACXA 3QK6A 1HX1B 2JQHA 4YHHT 4L9IA 3RIUC 3CWZB 2E5LT 5ABGA 3ETVA 4I0UA 5AQUB 1VRBA 5HYAA 4E7ZA 5JDGA 3BQIA 5IHYA 3UUMA 3WAKA 1LVFA 1UGOA 5LCYA 2XQ4A 2C5IT 3PDYA 2XQ9A 4PJNA 2EHOC 2W00A 2H7OA 3PUZF 1G8XA 2X0YA 3ANWA 3FBZA 5DQWA 5JRCA 3JC6D 3FZKB 4ILBA 5FVLA 1HNWT 1SA0E 5LJNA 3AE5A 3C50A 4P0BA 3I9YA 2V7IA 3NBXX 5JREA 2BDEA 3ZN0B 4JI4T 2DL1A 2C5JA 5JR9C 4X1KE 3K3NA 2WU2A 3RQWA 3KFWX 2UXXB 3ZLIA 2C0SA 2D2SA 2X9YA 5L3DB 3FZMB 4ZOLE 2YDRA 4U2ZA 3ZCIA 3P4PA 4CZZB 2CEAA 4LFBT 2LEHA 2V1DB 4QH4A 2VVSA 2X67A 4UV8B 3C64A 2NOXA 2X68A 3NRYA 4IE6A 1XMQT 2CE7A 5AFUL 3SS1A 4AXPA 4HFHA 4U7IA 1I94T 2LSKA 3V5UA 3GN5B 1S35A 4TWFA 1JNRA 3F57A 2HPLA 3RF1A 4G2AA 4AQFA 2WZHA 2AE9A 4CXWA 4EGWA 1YQ4A 4DMVA 2VKOA 2LHNA 2BG9B 1US7B 4EZ4A 2CCQA 4PJJA 2VKDA 5IYZE 5DQVA 4AI6A 1WYCA 1N34T 2BVLA 5CJ5A 1J5WA 1WR0A 1LVKA 2WBLA 4BJMA 5LNKA 2UXDT 2WDQA 4L5GA 3P50A 4GKJT 5L4HA 2H3RA 2OLTA 2IUBA 3FB2A 3PUYF 4XAXB 1IBKT 1YKHB 2FJDA 3RYHE 4QWNB 3CX8B 5HXEA 2N9DA 5LHGB 2EHOD 4HN9A 1U4QA 3N9PA 5HWXA 2IDOB 4GOUA 4ZEYA 3RKGA 5AQJB 2WU5A 4CN6A 3RPUA 4F6RC 2XAGB 2W2UA 4DV3T 3DJBA 2CA5A 4HWHA 3PU8A 3ESLA 4PFPA 4LFCT 2LKHA 5JDLA 4KX6A 5HXHA 1YKEB 4MHCA 4ILUA 4U2YA 4UELA 3J7Yq 4IL9A 4A98A 3FXDB 4H9PC 3PUVF 4B3MT 2IC6A 4H9SE 2W62A 3I9WA 5F5WA 3QC9A 2ZLYA 4MFRA 4YSZA 2D0UA 3F31A 3L39A 4G63A 5HXRA 5FMNA 5HEUA 4WZXA 2CRBA 4ZI3C 2A72A 4X66T 3HI2A 3EDUA 4DMWA 2W67A 2HHHT 2YINA 2H88A 3AEFA 1OEDC 2V7LA 2NP9A 2YKSA 4UVBB 4O2AE 4JI3T 4AISA 2IHR1 1FMVA 2KWIB 4NXNT 3K1SA 1ZV4X 2LKGA 3RYCE 2VQFT 4JV5T 4MLKA 3RIFA 4TWHA 3LBXB 4P0AA 1UUSA 4X1IE 3T1HT 4ANJA 3N9QA 3NZPA 2XTLA 3ZJ2A 3TLTA 2VURA 1T98A 5AQSB 5F3JA 3VR8A 1WR6A 3RRWA 2XJ7A 4ZI2D 1LRZA 2VL0A 2UU9T 3LK3B 2QRXA 3NZQA 3VRAA 4I43B 3RC8A 3AE6A 4ZI7E 5J1GA 4U72A 3LJCA 2BKOA 3ZMSB 3ZJ1A 2XSBA 5E0OA 2LOSA 2VASA 4OK0A 3O4XE 4UEMA 3ZCJA 4KHPT 4AQFC 1G73A 4AKLA 3RRCA 5KDMC 1W0BA 2JJ9A 3P4QA 3AAAB 1BR1A 2JQQA 5L3GB 2ODVA 2XQ7A 5HWYA 5KMGP 4YT0A 4JI6T 5FYMA 2NTXA 4HWDA 4X5TA 3TLUA 2KWHA 5BR8T 2EHOB 3MZKB 3FXEB 3N2KE 3OTOT 4K0KT 3UU8A 2LLYA 3VKGA 5H6RB 2E9XA 2MOZA 3P4SA 3O1HA 3HL6A 3NVOA 4PJLA 1YQ3A 3RGLA 5JR9B 3IEEA 2JQKA 5M4YA 3N9NA 2W61A 2UUBT 4DR7T 3KBUA 2V6YA 4IE7A 2OV9A 4QXCB 1J5ET 4UR9A 4DR2T 1UCUA 1D1BA 4K0UA 4YY3T 4DV4T 3HKCE 4UF0B 5LGTB 2WAUA 3MJXA 3ZC0A 2XQAA 2KMFA 5IUXA 5AQNB 4CI2B 1XNQT 4H9QC 5HCJA 1MIWA 5EK3A 2LSJA 2G0UA 1XDPA 3F2EA 2WY2A 3QB5K 4ADZA 2X66A 2XAFB 5LGNB 1M62A 3AE9A 3QOFA 4A56A 4ZS2A 3I0OA 4UVCB 3P4WA 3ZMVB 4U3CA 3EUHA 4F8HA 2XQYA 3RX6A 2VKHA 4B3ST 5ABEA 3RH3A 2KSRA 2XQ8A 5LMUT 1FMWA 4YFSA 2VK9A 1SE7A 3RYIE 3K3QC 3AEDA 5AQKB 5AQVB 2NTYA 5AQLB 5FXVA 5ABFA 2Q9QD 1HG2A 5AQPB 4X62T 4X20E 1JNZA 2HN1A 3RI5A 4H9OC 2WM9A 1Y01A 4IE4A 4TNVA 4YSYA 4OHFA 4EYYR 3AEBA 2QVAA 1OEDA 3L09A 5FXWA 5LJMA 1Y64B 1MNDA 4IIJE 3VRBA 3TLSA 2BS3A 3P8CD 2WS3A 3FZFB 2KNDA 1E1HB 3H3MA 5FXXA 3VU7H 4HWFA 1UX4A 3T8OA 4IGUA 5L2LA 2BVMA 2WDVA 2VL8A 5JVDE 5L3FB 3OVUA 4WW0A 2JRKA 2E5VA 3CQCB 2CXDA 4ZZCA 1HR0T 3EDVA 2LSIA 2SPCA 1W0AA 4YLHA 2Y6XA 4JLEA 4A5XA 4PAGA 4KHZF 2X9WA 5HXSA 4JI0T 4YJ2E 4JYAT 4AQGA 2YDSA 3PTRB 3KINB 4EOZB 5EZYE 3ZC1A 5JDMA 4N78D 2RA1A 3QNUA 3ANWB 4I4TE 4O4IE 3UULA 3AXJA 5JRCB 5LP6E 4DR4T 4PW8A 2XAHB 3ZMZB 2DWKA 1MMDA 5JDFA 2E9XC 5HEHA 1FJGT 4JI5T 1B7TA 3UQ7A 2XASB 3IBPA 2IC9A 3CVRA 3Q9DA 4DV1T 3E0ZA 2A3DA 3Q2MA 4CI3B 5LA6E 4IHJE 3Q5EA 3KVAA 4PFOA 1D0YA 5HAXA 3KVBA 3RYFE 4AKIA 4EAHA 4HE8A 2Q9QA 3NRXA 4LMKA 2LT3A 4PK6A 4TN7B 3M65A 3L8RA 3KV4A 2OA5A 2YK0A 4YTNA 2V5DA
chains in the Genus database with same CATH topology
3EABA 1YXRA 4WZXA 2V6XA 3ZT5A 3ZSSA 3ZSTA 4CN6A 2JQ9A 3ZT7A 3ZT6A 5CJ5A 2W2UA 1WR0A 2LRKA 5LB7B 2CRBA 2DL1A 4U2YA 2XZEA 2A9UA 4CN4A 2RPAA 4U33A 2MPKA 2JQKA 4U31A 4A5XA 5FVKA 4P1NA 4CN1A 2K3WA 3K1SA 2WY2A 2WWVA 5CGMA 2CPTA 4NIQA 4U7IA 5FVLA 1WFDA 4U3CA 4U7YA 2JQHA 2V6YA 2V6YB 2LRLA 4IT4A 1WCRA 4ZEYA 4U2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAB A;  1YXR A;  4WZX A;  2V6X A;  3ZT5 A;  3ZSS A;  3ZST A;  4CN6 A;  2JQ9 A;  3ZT7 A;  3ZT6 A;  5CJ5 A;  2W2U A;  1WR0 A;  2LRK A;  5LB7 B;  2CRB A;  2DL1 A;  4U2Y A;  2XZE A;  2A9U A;  4CN4 A;  2RPA A;  4U33 A;  2MPK A;  2JQK A;  4U31 A;  4A5X A;  5FVK A;  4P1N A;  4CN1 A;  2K3W A;  3K1S A;  2WY2 A;  2WWV A;  5CGM A;  2CPT A;  4NIQ A;  4U7I A;  5FVL A;  1WFD A;  4U3C A;  4U7Y A;  2JQH A;  2V6Y A;  2V6Y B;  2LRL A;  4IT4 A;  1WCR A;  4ZEY A;  4U2Z A; 
#chains in the Genus database with same CATH topology
 2ZM8 A;  4NUV A;  1XZY A;  3ZMU B;  3Q5D A;  4ASK A;  4DUZ T;  3VR9 A;  2BZB A;  4CQI A;  2IML A;  5F8P A;  3NKZ A;  4A97 A;  3NWI A;  4IDP A;  5HEO A;  2L9Q A;  2XUE A;  4KUM B;  2CMR A;  2RP4 A;  2DNX A;  1WCR A;  3IA3 A;  1MMA A;  4ZI2 C;  2ES0 A;  5TAO A;  3EVY A;  5J2U E;  3C4Z A;  5FL0 A;  4JI1 T;  4WNK A;  2XZE A;  3U78 A;  3HR0 A;  1MMN A;  3O1J A;  2CPT A;  4LMJ A;  2V26 A;  3L3P A;  3PUW F;  2WMO A;  3BK9 A;  5C8Y E;  2P9B A;  3AE1 A;  2D0T A;  1KEY A;  3Q5W A;  4H63 V;  3S4U A;  2JQ9 A;  3W15 B;  5DJQ C;  3DP7 A;  2E8I A;  5LB7 B;  5L4E A;  1KNZ A;  3H37 A;  3QB5 A;  4QH5 A;  4LF7 T;  1QLB A;  5C3J A;  3CX6 B;  3LFM A;  3SFE A;  3HKD E;  3UFG A;  4OX9 T;  3O9X A;  2E9X D;  3ONL C;  3WAJ A;  2VVN A;  5CB4 E;  2VQE T;  3KBT A;  1H7C A;  5LG3 A;  4GKK T;  3HA4 A;  3JCF A;  1CHU A;  2M6B A;  2W63 A;  2YEV C;  2IAK A;  4ZXL A;  4DR6 T;  1CUN A;  2NW7 A;  5AQR B;  2NW9 A;  3ZPO A;  3M3Z B;  2PTF A;  1BR0 A;  4V1A v;  3PV0 F;  3B5M A;  2A9U A;  1VCS A;  1NEK A;  4LF6 T;  4OYJ A;  3TLV A;  1W9R A;  4CXX A;  4U7Y A;  2KT9 A;  4TX5 A;  4C91 A;  2YU2 A;  1WRD A;  2GK9 A;  3CK6 A;  4HGA A;  3MAC A;  4DV5 T;  5JTG A;  5CGM A;  2XM1 A;  5FY0 A;  1HTJ F;  4U74 A;  5CA1 E;  3JAF A;  3LK4 2;  3PJA A;  4AQY T;  4LML A;  3SRZ A;  1IJ5 A;  4BJN A;  2F4V T;  2X51 A;  5KXJ A;  1LKX A;  4DBR A;  4TV8 E;  3T1Y T;  3N5L A;  4O8S A;  5JDQ A;  4FI5 A;  2HN2 A;  3AE2 A;  3KV5 A;  3PUA A;  3C51 A;  2CLY C;  4JI8 T;  4ILC A;  2PBI A;  5C2T A;  2MPK A;  2XQ6 A;  3WI3 A;  2VB6 A;  5FY7 A;  5L3B B;  5LG4 A;  5KX5 E;  3LG7 A;  4DR5 T;  3ZT7 A;  2BS4 A;  2PJQ A;  5BMV E;  4YTM A;  4IDQ A;  4LF5 T;  2YOE A;  1UX5 A;  1HFA A;  3LSV A;  3VHL A;  2WB5 A;  1V9D A;  4IDO A;  1U5P A;  3N9O A;  2C5K T;  2UXB T;  1T8B A;  2XAJ B;  4UV9 B;  4EZH A;  4X64 T;  3PUR A;  3AVR A;  3HKB E;  3AA7 B;  1HG5 A;  4IDZ A;  3C98 B;  4WBO A;  2V7K A;  5AQT B;  4O2B E;  4ISS A;  4YHJ A;  1HS7 A;  1WYB A;  5JDN A;  4KP3 C;  3KV9 A;  2Q9Q C;  3D0T A;  3A5X A;  5JQG E;  2IIU A;  1SHZ C;  3QUJ A;  5FP3 A;  2WZI A;  3EHZ A;  1HX8 A;  1OED E;  4TV9 E;  5AQG B;  1VCT A;  2Y48 B;  3PUQ A;  4GK5 E;  1D1C A;  1XWM A;  4DBQ A;  1ZHC A;  5LXT E;  2L8K A;  4IT4 A;  2CWO A;  4DR1 T;  3PUS A;  1KK7 A;  3UUN A;  4ZZB A;  2D9D A;  2XHE B;  2LM9 A;  3UT5 E;  2BBH A;  2X0H A;  5ABH A;  4CI1 B;  5LGU B;  1UUR A;  4KMC A;  3FHN A;  2KZ7 B;  3N2O A;  2ZM6 T;  4P1N A;  4DID B;  2V7J A;  4GYS A;  2MBG A;  3UU4 A;  2KXP B;  2XM2 A;  4DVD A;  3AA6 B;  3EAB A;  2LOP A;  3O1I A;  2E9X B;  2NR4 A;  3GMI A;  2XPK A;  4TWD A;  1IJ6 A;  3AE4 A;  4UVA B;  2ZMA A;  3AEA A;  3VKH A;  2V6Y B;  2KLQ A;  4YSX A;  4BAY B;  4QH1 A;  3PU3 A;  3SFD A;  3ZT6 A;  2BBJ A;  4HFB A;  2JIW A;  2Z6E A;  4LF4 T;  4QX7 B;  2V8S V;  2LHR A;  1Z8U A;  2ZM2 A;  4IDN A;  1T7S A;  3IF8 B;  3ZSS A;  1XMO T;  1KF6 A;  4HFE A;  3ZMT B;  2DHR A;  5JDH A;  4IRE A;  4BA9 A;  2NWB A;  4UIG A;  5IWA T;  4CN1 A;  1X79 A;  4E7S A;  1D0X A;  3UU6 A;  2D5U A;  2JPF A;  2M67 A;  5AQM B;  4DND A;  2I6H A;  2X9H A;  2W66 A;  4EB6 E;  1IAP A;  5AQO B;  5FKY A;  4QHO A;  5LYJ E;  4ZHQ E;  4DO0 A;  1D0Z A;  4AKR B;  4QXB B;  2UUC T;  4H63 H;  4LF8 T;  4HKA A;  1ZKE A;  1KNP A;  3OYX A;  1N33 T;  3CQX C;  2QA7 A;  1DU2 A;  3H3A A;  3MA9 A;  4H9N C;  3GN5 A;  2R6G F;  2MTQ A;  2V5C A;  1MNE A;  2CXL A;  4HTE A;  3KV6 A;  2XQ5 A;  1W09 A;  3EI0 A;  2LRK A;  2LSY A;  2QGS A;  2YDQ A;  2CHN A;  2BG9 A;  3AA0 B;  3E22 E;  2K24 A;  2WDR A;  2WWV A;  4NUU A;  4ILA A;  1NWM X;  3BQK A;  4Q25 A;  5HEG A;  3AE7 A;  3MK7 C;  1YXR A;  3K3O A;  3ONX A;  3RLF F;  3AEG A;  1IZN B;  3AAE B;  5J2T E;  4EEB A;  5ABF B;  5DAB A;  3OJA A;  3SOL A;  3R6N A;  4IL4 A;  3RIA A;  4XZC A;  3OKQ A;  2FUP A;  2MYS A;  3PUX F;  1L0V A;  3FZL B;  3P4R A;  1OED B;  1N32 T;  1OWA A;  2X0L B;  4DR3 T;  1E2A A;  1J1J A;  4DUY T;  3DTO A;  1HNZ T;  1XNR T;  2N1G A;  2ZM0 A;  3CX7 B;  1Z0P A;  3CKD A;  5CA0 E;  5ADX L;  4EXT A;  4FJO A;  4TZ4 C;  3ZST A;  1S94 A;  2LE8 A;  3OYZ A;  4HWI B;  4HEA A;  5L3C B;  5HCM A;  1HCI A;  4DV6 T;  5HEJ A;  1XDO A;  4PK5 A;  3ZYL A;  2KIN B;  3FBL A;  1HNX T;  4JI2 T;  4IE0 A;  3HKE E;  4B3R T;  2J62 A;  5LBM A;  3B13 A;  3UTK A;  3SWH A;  3FZH B;  3P7I A;  3OBV E;  3N9L A;  2H7V C;  3ONJ A;  1T72 A;  4P09 A;  3TLW A;  2UUA T;  5AQQ B;  5GON E;  1MIY A;  2XAQ B;  2FJB A;  4PK4 A;  2UXC T;  1YW0 A;  2X9X A;  2CLY B;  2B1E A;  4EYU A;  2RPA A;  2WSS V;  4HFI A;  2E2A A;  3A7M A;  5FVK A;  4MBQ A;  2VKJ A;  4UXN B;  2HH7 A;  3AXJ B;  2BKN A;  3N2G E;  2H89 A;  2Y8D A;  3ZYK A;  3ZYM A;  2W4X A;  4JUY A;  4ZS3 A;  3AE8 A;  1QSD A;  4TNW A;  2JMK A;  2LJL A;  2L3L A;  3AA1 B;  3B57 A;  2K48 A;  4DV2 T;  4JEH B;  5LOV E;  5A1L A;  3Q5X A;  2QYW A;  3MXZ A;  3UU5 A;  3V5S A;  4HFV A;  2ODU A;  4L0R A;  3BQL A;  4IST A;  2Q9Q B;  5FNV E;  1UK5 A;  4IE5 A;  2BKP A;  3CPZ A;  2MAW A;  3LBX A;  2V6X A;  3LK2 B;  4LF9 T;  2WCA A;  1GQE A;  4GYR A;  4X1Y E;  5FL1 A;  2LM2 A;  3AVS A;  1AJ3 A;  1WFD A;  4HFD A;  2K5B B;  4ERR A;  2J1D G;  1ZOY A;  3X1D A;  1SUM B;  2DI4 A;  3AEE A;  4B3T T;  2CBI A;  2A2F X;  2IW5 B;  4GK0 E;  3G06 A;  4Z8X A;  4O4J E;  2WWU A;  5LHI B;  2CHO A;  4PNI A;  4OFZ A;  3RIU A;  4JI7 T;  5AQI B;  2J47 A;  3AAI A;  3RHW A;  3E08 A;  1HF8 A;  4COF A;  2BG9 C;  4NPP A;  3TKL B;  3AEC A;  2K3W A;  1NAF A;  5L3E B;  3ABV A;  5FXZ A;  3C4X A;  3KDS E;  3UUB A;  4KI0 F;  4DV0 T;  4AIU A;  5HXC A;  4WBN E;  1BR2 A;  1M7K A;  3ZN1 B;  2EHO A;  4U33 A;  5LHH B;  2HPJ A;  2FJA A;  4I50 E;  2DCF A;  2VWA A;  4AKH A;  4WYV A;  3PUG A;  4M1P A;  3A8Y C;  2WP9 A;  2PFV A;  4QKN A;  2ACZ A;  3JAD A;  5JR9 A;  4NXM T;  4CN4 A;  1VOM A;  2YN6 A;  2XY8 B;  2CM0 A;  2I59 A;  3EAM A;  3RC3 A;  4GIW A;  5CFB A;  4DV7 T;  4J2C A;  3CML A;  3N9M A;  2CBJ A;  3R84 B;  3C4W A;  2AXD S;  4KBM B;  5JH7 E;  4LFA T;  4UF0 A;  3RQU A;  1YD8 G;  3UFE A;  5EK4 A;  3CIR A;  3PE0 A;  5EK2 A;  4OYK A;  2LRL A;  3RKO A;  4TUY E;  2YU1 A;  3I0Q A;  2DWG A;  2JMH A;  3ZT5 A;  2WMN A;  3UUX B;  2CWY A;  2WQY A;  4YXD A;  1WLX A;  1O3X A;  4ZI3 D;  4Z91 A;  1X9B A;  2K9A A;  1R8I A;  3ZEF B;  3AB3 B;  5LBQ B;  4QX8 B;  5AQH B;  2PG8 A;  5LMN T;  5H6Q B;  5FY1 A;  2N2N A;  1KNR A;  3ETU A;  1MMG A;  3I1A A;  3AE3 A;  3JAE A;  4PJM A;  1FIO A;  3GA8 A;  4U31 A;  1IBM T;  4C90 A;  4QXH B;  2XSA A;  1KFY A;  2I0M A;  4H9R C;  4AKG A;  1IBL T;  2J4G A;  3J9X 1;  4CXY A;  4JEU B;  2FBW A;  1QUU A;  2W0G A;  5J0Z A;  2BG9 E;  2B76 A;  2UXN B;  2LSG A;  3JC6 C;  2XQ3 A;  3UU3 A;  4EV6 A;  2DLR A;  1ZP0 A;  2CXF A;  1N36 T;  4EIW A;  4EED A;  3U3I A;  4B6X A;  4JBW F;  4YJ3 E;  3LDQ B;  4O4L E;  5AQF B;  2BS2 A;  3GWH A;  1ZEE A;  4I55 E;  1BR4 A;  1NEN A;  3ZKR A;  4YTP A;  3K8P C;  3UQ4 A;  1FEW A;  1MIV A;  1EZ3 A;  3PJA J;  4Z90 A;  5ETW A;  4HWC A;  4O4H E;  4XBF B;  3CQG B;  1D1A A;  2FJE A;  2NW8 A;  2M6I A;  2V7M A;  5L47 A;  3MKD A;  1E7P A;  1OXZ A;  4X65 T;  3IHR A;  3OPC A;  4HFC A;  1I6Z A;  4MAL A;  4NIQ A;  2ACX A;  3QK6 A;  1HX1 B;  2JQH A;  4YHH T;  4L9I A;  3RIU C;  3CWZ B;  2E5L T;  5ABG A;  3ETV A;  4I0U A;  5AQU B;  1VRB A;  5HYA A;  4E7Z A;  5JDG A;  3BQI A;  5IHY A;  3UUM A;  3WAK A;  1LVF A;  1UGO A;  5LCY A;  2XQ4 A;  2C5I T;  3PDY A;  2XQ9 A;  4PJN A;  2EHO C;  2W00 A;  2H7O A;  3PUZ F;  1G8X A;  2X0Y A;  3ANW A;  3FBZ A;  5DQW A;  5JRC A;  3JC6 D;  3FZK B;  4ILB A;  5FVL A;  1HNW T;  1SA0 E;  5LJN A;  3AE5 A;  3C50 A;  4P0B A;  3I9Y A;  2V7I A;  3NBX X;  5JRE A;  2BDE A;  3ZN0 B;  4JI4 T;  2DL1 A;  2C5J A;  5JR9 C;  4X1K E;  3K3N A;  2WU2 A;  3RQW A;  3KFW X;  2UXX B;  3ZLI A;  2C0S A;  2D2S A;  2X9Y A;  5L3D B;  3FZM B;  4ZOL E;  2YDR A;  4U2Z A;  3ZCI A;  3P4P A;  4CZZ B;  2CEA A;  4LFB T;  2LEH A;  2V1D B;  4QH4 A;  2VVS A;  2X67 A;  4UV8 B;  3C64 A;  2NOX A;  2X68 A;  3NRY A;  4IE6 A;  1XMQ T;  2CE7 A;  5AFU L;  3SS1 A;  4AXP A;  4HFH A;  4U7I A;  1I94 T;  2LSK A;  3V5U A;  3GN5 B;  1S35 A;  4TWF A;  1JNR A;  3F57 A;  2HPL A;  3RF1 A;  4G2A A;  4AQF A;  2WZH A;  2AE9 A;  4CXW A;  4EGW A;  1YQ4 A;  4DMV A;  2VKO A;  2LHN A;  2BG9 B;  1US7 B;  4EZ4 A;  2CCQ A;  4PJJ A;  2VKD A;  5IYZ E;  5DQV A;  4AI6 A;  1WYC A;  1N34 T;  2BVL A;  5CJ5 A;  1J5W A;  1WR0 A;  1LVK A;  2WBL A;  4BJM A;  5LNK A;  2UXD T;  2WDQ A;  4L5G A;  3P50 A;  4GKJ T;  5L4H A;  2H3R A;  2OLT A;  2IUB A;  3FB2 A;  3PUY F;  4XAX B;  1IBK T;  1YKH B;  2FJD A;  3RYH E;  4QWN B;  3CX8 B;  5HXE A;  2N9D A;  5LHG B;  2EHO D;  4HN9 A;  1U4Q A;  3N9P A;  5HWX A;  2IDO B;  4GOU A;  4ZEY A;  3RKG A;  5AQJ B;  2WU5 A;  4CN6 A;  3RPU A;  4F6R C;  2XAG B;  2W2U A;  4DV3 T;  3DJB A;  2CA5 A;  4HWH A;  3PU8 A;  3ESL A;  4PFP A;  4LFC T;  2LKH A;  5JDL A;  4KX6 A;  5HXH A;  1YKE B;  4MHC A;  4ILU A;  4U2Y A;  4UEL A;  3J7Y q;  4IL9 A;  4A98 A;  3FXD B;  4H9P C;  3PUV F;  4B3M T;  2IC6 A;  4H9S E;  2W62 A;  3I9W A;  5F5W A;  3QC9 A;  2ZLY A;  4MFR A;  4YSZ A;  2D0U A;  3F31 A;  3L39 A;  4G63 A;  5HXR A;  5FMN A;  5HEU A;  4WZX A;  2CRB A;  4ZI3 C;  2A72 A;  4X66 T;  3HI2 A;  3EDU A;  4DMW A;  2W67 A;  2HHH T;  2YIN A;  2H88 A;  3AEF A;  1OED C;  2V7L A;  2NP9 A;  2YKS A;  4UVB B;  4O2A E;  4JI3 T;  4AIS A;  2IHR 1;  1FMV A;  2KWI B;  4NXN T;  3K1S A;  1ZV4 X;  2LKG A;  3RYC E;  2VQF T;  4JV5 T;  4MLK A;  3RIF A;  4TWH A;  3LBX B;  4P0A A;  1UUS A;  4X1I E;  3T1H T;  4ANJ A;  3N9Q A;  3NZP A;  2XTL A;  3ZJ2 A;  3TLT A;  2VUR A;  1T98 A;  5AQS B;  5F3J A;  3VR8 A;  1WR6 A;  3RRW A;  2XJ7 A;  4ZI2 D;  1LRZ A;  2VL0 A;  2UU9 T;  3LK3 B;  2QRX A;  3NZQ A;  3VRA A;  4I43 B;  3RC8 A;  3AE6 A;  4ZI7 E;  5J1G A;  4U72 A;  3LJC A;  2BKO A;  3ZMS B;  3ZJ1 A;  2XSB A;  5E0O A;  2LOS A;  2VAS A;  4OK0 A;  3O4X E;  4UEM A;  3ZCJ A;  4KHP T;  4AQF C;  1G73 A;  4AKL A;  3RRC A;  5KDM C;  1W0B A;  2JJ9 A;  3P4Q A;  3AAA B;  1BR1 A;  2JQQ A;  5L3G B;  2ODV A;  2XQ7 A;  5HWY A;  5KMG P;  4YT0 A;  4JI6 T;  5FYM A;  2NTX A;  4HWD A;  4X5T A;  3TLU A;  2KWH A;  5BR8 T;  2EHO B;  3MZK B;  3FXE B;  3N2K E;  3OTO T;  4K0K T;  3UU8 A;  2LLY A;  3VKG A;  5H6R B;  2E9X A;  2MOZ A;  3P4S A;  3O1H A;  3HL6 A;  3NVO A;  4PJL A;  1YQ3 A;  3RGL A;  5JR9 B;  3IEE A;  2JQK A;  5M4Y A;  3N9N A;  2W61 A;  2UUB T;  4DR7 T;  3KBU A;  2V6Y A;  4IE7 A;  2OV9 A;  4QXC B;  1J5E T;  4UR9 A;  4DR2 T;  1UCU A;  1D1B A;  4K0U A;  4YY3 T;  4DV4 T;  3HKC E;  4UF0 B;  5LGT B;  2WAU A;  3MJX A;  3ZC0 A;  2XQA A;  2KMF A;  5IUX A;  5AQN B;  4CI2 B;  1XNQ T;  4H9Q C;  5HCJ A;  1MIW A;  5EK3 A;  2LSJ A;  2G0U A;  1XDP A;  3F2E A;  2WY2 A;  3QB5 K;  4ADZ A;  2X66 A;  2XAF B;  5LGN B;  1M62 A;  3AE9 A;  3QOF A;  4A56 A;  4ZS2 A;  3I0O A;  4UVC B;  3P4W A;  3ZMV B;  4U3C A;  3EUH A;  4F8H A;  2XQY A;  3RX6 A;  2VKH A;  4B3S T;  5ABE A;  3RH3 A;  2KSR A;  2XQ8 A;  5LMU T;  1FMW A;  4YFS A;  2VK9 A;  1SE7 A;  3RYI E;  3K3Q C;  3AED A;  5AQK B;  5AQV B;  2NTY A;  5AQL B;  5FXV A;  5ABF A;  2Q9Q D;  1HG2 A;  5AQP B;  4X62 T;  4X20 E;  1JNZ A;  2HN1 A;  3RI5 A;  4H9O C;  2WM9 A;  1Y01 A;  4IE4 A;  4TNV A;  4YSY A;  4OHF A;  4EYY R;  3AEB A;  2QVA A;  1OED A;  3L09 A;  5FXW A;  5LJM A;  1Y64 B;  1MND A;  4IIJ E;  3VRB A;  3TLS A;  2BS3 A;  3P8C D;  2WS3 A;  3FZF B;  2KND A;  1E1H B;  3H3M A;  5FXX A;  3VU7 H;  4HWF A;  1UX4 A;  3T8O A;  4IGU A;  5L2L A;  2BVM A;  2WDV A;  2VL8 A;  5JVD E;  5L3F B;  3OVU A;  4WW0 A;  2JRK A;  2E5V A;  3CQC B;  2CXD A;  4ZZC A;  1HR0 T;  3EDV A;  2LSI A;  2SPC A;  1W0A A;  4YLH A;  2Y6X A;  4JLE A;  4A5X A;  4PAG A;  4KHZ F;  2X9W A;  5HXS A;  4JI0 T;  4YJ2 E;  4JYA T;  4AQG A;  2YDS A;  3PTR B;  3KIN B;  4EOZ B;  5EZY E;  3ZC1 A;  5JDM A;  4N78 D;  2RA1 A;  3QNU A;  3ANW B;  4I4T E;  4O4I E;  3UUL A;  3AXJ A;  5JRC B;  5LP6 E;  4DR4 T;  4PW8 A;  2XAH B;  3ZMZ B;  2DWK A;  1MMD A;  5JDF A;  2E9X C;  5HEH A;  1FJG T;  4JI5 T;  1B7T A;  3UQ7 A;  2XAS B;  3IBP A;  2IC9 A;  3CVR A;  3Q9D A;  4DV1 T;  3E0Z A;  2A3D A;  3Q2M A;  4CI3 B;  5LA6 E;  4IHJ E;  3Q5E A;  3KVA A;  4PFO A;  1D0Y A;  5HAX A;  3KVB A;  3RYF E;  4AKI A;  4EAH A;  4HE8 A;  2Q9Q A;  3NRX A;  4LMK A;  2LT3 A;  4PK6 A;  4TN7 B;  3M65 A;  3L8R A;  3KV4 A;  2OA5 A;  2YK0 A;  4YTN A;  2V5D A; 
#chains in the Genus database with same CATH homology
 3EAB A;  1YXR A;  4WZX A;  2V6X A;  3ZT5 A;  3ZSS A;  3ZST A;  4CN6 A;  2JQ9 A;  3ZT7 A;  3ZT6 A;  5CJ5 A;  2W2U A;  1WR0 A;  2LRK A;  5LB7 B;  2CRB A;  2DL1 A;  4U2Y A;  2XZE A;  2A9U A;  4CN4 A;  2RPA A;  4U33 A;  2MPK A;  2JQK A;  4U31 A;  4A5X A;  5FVK A;  4P1N A;  4CN1 A;  2K3W A;  3K1S A;  2WY2 A;  2WWV A;  5CGM A;  2CPT A;  4NIQ A;  4U7I A;  5FVL A;  1WFD A;  4U3C A;  4U7Y A;  2JQH A;  2V6Y A;  2V6Y B;  2LRL A;  4IT4 A;  1WCR A;  4ZEY A;  4U2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...