1WFDA

Solution structure of mouse mit domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
GSSGSSGQDSDSTAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMDRAENIKKYLDQEKEDGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of mouse MIT domain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein 1500032H18
total genus 30
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wfdA00
3ZT5A 4CN1A 3EABA 5LB7B 2WY2A 1WR0A 4U3CA 2RPAA 2XZEA 4WZXA 4U31A 4U33A 4ZEYA 4U2ZA 2A9UA 3ZSTA 4U7YA 2CPTA 4U2YA 4A5XA 4CN4A 5CGMA 2LRKA 2V6YB 2W2UA 1YXRA 2LRLA 2DL1A 4P1NA 2V6YA 3K1SA 2MPKA 2JQKA 4CN6A 1WCRA 4IT4A 2JQ9A 3ZSSA 2WWVA 3ZT7A 2V6XA 2K3WA 2JQHA 4NIQA 4U7IA 3ZT6A 5CJ5A 2CRBA 5FVKA 1WFDA 5FVLA
chains in the Genus database with same CATH superfamily
3E0ZA 3UU5A 3ETVA 2XQ5A 2EHOD 5AQJB 4DIDB 2CWYA 1WR0A 2NP9A 2WAUA 4PFOA 3JC6C 4QKNA 4U3CA 4UVAB 1D0XA 4YFSA 3RC3A 4LF5T 4BJNA 4I4TE 5JDLA 3ZYLA 1W09A 3TLUA 4ISTA 3ZEFB 4AKLA 3A7MA 4PJLA 1D1AA 5LHHB 3C4WA 4IGUA 4TX5A 5HEUA 2WU5A 2JIWA 2WP9A 3OYXA 4EYUA 1IBLT 2AXDS 2IAKA 4G63A 5FXZA 3D0TA 3DJBA 3TLWA 4EZ4A 3N9NA 5CA1E 3RI5A 3ZCJA 4HFDA 5JH7E 3K1SA 5L3BB 1LVFA 2WWUA 3B13A 3CIRA 3LFMA 3HKCE 4KUMB 5DQWA 5AQRB 5LJMA 1J5ET 1T98A 2V6XA 3VR8A 4ZI7E 4DBRA 5FNVE 1ZV4X 2VVSA 3AE8A 4O2BE 5LOVE 4JV5T 4WW0A 3ZCIA 4X1YE 4EAHA 3AE6A 3EI0A 1UUSA 4ILUA 2D2SA 2LOSA 4UVBB 2P9BA 3ZLIA 5ABHA 2BVMA 4AQYT 5HEOA 2GK9A 2VKDA 2BKOA 2RPAA 3LSVA 3QOFA 3PU8A 4U31A 3N2OA 5LGNB 4U33A 2CXFA 2DWGA 3O4XE 3LG7A 3I9YA 2CXLA 4CXWA 3KBUA 2WB5A 2MYSA 5LG3A 3PURA 2WQYA 3KINB 3PUYF 3OYZA 4H9PC 4O4LE 4CN4A 2W2UA 2WBLA 3KFWX 3HI2A 4LMJA 4B3MT 1QLBA 2PTFA 2UUAT 3R6NA 2XY8B 5JR9B 2XM1A 4H63H 4JI8T 2H3RA 5JDMA 3MACA 2CE7A 3WAJA 1MIVA 4DR2T 5TAOA 2DLRA 4X1IE 5ABGA 3L8RA 3UFGA 3ZT6A 4TWDA 2VWAA 4B3ST 1ZEEA 5J0ZA 2NTXA 3DP7A 1UCUA 3RPUA 3ZPOA 4CN1A 2IC6A 2J62A 4UEMA 4DV5T 3RH3A 1NWMX 3L39A 4OYJA 3NRYA 3RKOA 3SS1A 4H63V 2ACXA 4NXNT 4X65T 3PTRB 4HGAA 5JVDE 1X79A 2VL8A 1E7PA 5HXEA 1LKXA 1I6ZA 4IDOA 5CFBA 5JDGA 2YK0A 1XMQT 1WYCA 3F2EA 3KVAA 3PU3A 4QHOA 4A5XA 2W61A 4I55E 4ADZA 4LF8T 3K3NA 5FY0A 3FHNA 3M3ZB 3JAFA 4ILCA 2X0YA 5HCJA 4DNDA 2LHNA 2EHOA 3AA6B 2I6HA 2AE9A 2YU2A 3BK9A 3BQLA 3PUAA 4H9RC 3W15B 2IIUA 1XMOT 2WMNA 1HNZT 1U5PA 2BS3A 3AEAA 1QSDA 3TLSA 2LOPA 4HFEA 4PNIA 2KT9A 1I94T 2UUCT 2X51A 4YXDA 4O4IE 4JI6T 2XAJB 5FVLA 2NWBA 4NUVA 1KNRA 1S35A 2JRKA 2YN6A 3AE4A 2NW9A 2H88A 3A8YC 3ZJ2A 2WMOA 4AKRB 4HFCA 4CI1B 1DU2A 2LM2A 3CX6B 4QH1A 4ZI2D 2XQ3A 4TV9E 4YJ2E 3LK3B 3QB5A 4H9SE 3V5UA 4MFRA 4UV8B 4XZCA 4U7YA 3QUJA 2PBIA 5AQGB 4M1PA 5DQVA 3K3QC 3UTKA 3E08A 2X9XA 4OHFA 3QC9A 3F31A 2YDQA 2WDQA 4AISA 1OEDA 4OFZA 3ZYMA 4JEUB 3PE0A 4JLEA 3PJAA 4ILAA 3Q5EA 5FMNA 3UU6A 5C3JA 3C51A 3ZT7A 4YT0A 4ZI3C 1UGOA 3CX7B 2ES0A 5IUXA 1ZOYA 5AQFB 4GKJT 2C5IT 2BKPA 3N9PA 1Y64B 2V5DA 4WYVA 1NENA 4Z90A 5L3FB 1CUNA 3AE3A 2CEAA 4J2CA 2BS4A 2ZM2A 4TNVA 4YSZA 5AQHB 4HFHA 3ZJ1A 4LF7T 5FY7A 3S4UA 4DR7T 3AEEA 3H3MA 1KNZA 3ZMVB 1BR0A 2WSSV 3IA3A 2XJ7A 5JRCA 2CXDA 3AE9A 2E8IA 2H7OA 3KV4A 3KVBA 5LJNA 1HR0T 1V9DA 3LBXA 4QXCB 4EB6E 2WDRA 1MMAA 5AQNB 3SFEA 1SE7A 2WM9A 4O4JE 2XAQB 3FZLB 1HG5A 2LEHA 4JI4T 3JADA 1NAFA 1N36T 2N1GA 3AAEB 5AQKB 4KHPT 3VKGA 1HX1B 2E2AA 2DL1A 2J4GA 2XQ7A 3N9LA 3TLTA 5KMGP 3NBXX 4JYAT 2IMLA 4JI3T 4IL9A 4ZXLA 1E1HB 3GMIA 3LDQB 1KEYA 4DV1T 4X1KE 2Y48B 5AQUB 2IDOB 4WBOA 2LE8A 4HFIA 5LGUB 4UVCB 2E9XB 3ANWA 5HXSA 5F3JA 4AIUA 4CI2B 1IJ5A 3OTOT 4DV2T 2CHNA 2V7MA 2YOEA 4IE4A 4YLHA 3R84B 3NZQA 2W67A 2XASB 3P4WA 3UU8A 2BG9E 5HWXA 5DABA 2D0UA 3OPCA 3FXDB 3LBXB 4I50E 5AQSB 2XQAA 1OEDE 1XZYA 3PUGA 2DI4A 5CB4E 2V6YB 2LRKA 2PG8A 5J2UE 1YXRA 4LMKA 4AQGA 2L3LA 3CPZA 3LK2B 5IYZE 2KLQA 3N2GE 3AE2A 4TV8E 3HKDE 1HG2A 3AEBA 4IE7A 3AE7A 5KDMC 5AQOB 4ZZBA 2A72A 4ZOLE 4JI5T 4IL4A 3PUXF 2LSJA 5H6QB 2WU2A 3ZSSA 2IC9A 2VKOA 1HTJF 2H89A 3PUZF 4IE0A 3JC6D 2MOZA 1U4QA 4ISSA 4LF4T 4GKKT 1WFDA 2YKSA 4GIWA 3AEFA 2HPLA 2K48A 2VK9A 4X62T 1NEKA 4KX6A 4PW8A 4C90A 4TNWA 2ODVA 2Z6EA 3ZMUB 5KXJA 2KSRA 4HEAA 2Q9QD 2VKJA 2V7LA 5LBMA 3QNUA 3EVYA 1EZ3A 4PJMA 1AJ3A 3AAAB 1Z0PA 2KWIB 4P0AA 2BDEA 4DV6T 2LJLA 2VQET 4HWIB 1G8XA 2RA1A 1FMVA 3AXJA 3AA0B 4DV4T 2XQ8A 4DVDA 4DR1T 2L9QA 1BR2A 2QYWA 4QWNB 2QRXA 5FXXA 1OEDB 4F8HA 2DNXA 1M7KA 2X67A 2XAFB 1WLXA 2XHEB 2OV9A 3C98B 5JDFA 4PJNA 2X68A 3AEDA 4FI5A 3ZKRA 4EXTA 1UX5A 2UXCT 5HXRA 2JQ9A 4ASKA 5M4YA 4BJMA 3AE5A 2ZLYA 5LNKA 1WYBA 2JPFA 4U74A 5L4EA 2M6BA 2BKNA 3CK6A 2XPKA 3O9XA 5LMUT 4AI6A 2A2FX 2LT3A 3CWZB 2E5VA 5JDQA 2QVAA 4MALA 2KMFA 5EK4A 4WZXA 4QH5A 2PJQA 4DV0T 2I59A 2XQ4A 2CLYC 1W0AA 3CVRA 5H6RB 5IWAT 5BMVE 3O1HA 1ZP0A 4PAGA 3B5MA 2JJ9A 2X9HA 4OX9T 4P0BA 1D0YA 2MBGA 4ZHQE 1OWAA 5FL0A 1FIOA 3NVOA 2EHOB 2ZM8A 4ZS2A 2NW7A 1ZHCA 2J47A 1Z8UA 3JAEA 3RLFF 3RIFA 2W62A 2YEVC 5LGTB 2WZIA 1KF6A 2K3WA 2JQHA 4IE5A 4NIQA 5ABFB 3P4PA 5JDNA 1E2AA 2ODUA 3OJAA 4I0UA 1QUUA 5F5WA 2D0TA 2XZEA 4TN7B 4HWFA 2BG9A 2ZMAA 4ZI3D 2CMRA 2V8SV 4GK0E 4ZEYA 2I0MA 4DUYT 2CM0A 4YTMA 2CCQA 3C64A 5L3CB 3VRBA 4H9NC 4PJJA 4B3TT 3MXZA 1D1BA 2FJBA 4AQFC 5JR9C 2YU1A 5E0OA 4HN9A 5JDHA 3ONJA 1N34T 1X9BA 3AEGA 4UR9A 5IHYA 3AVSA 4KMCA 4V1Av 3KV5A 4CN6A 4DR6T 3FZKB 3RIUC 3LK42 2E9XD 2Q9QA 1GQEA 5LG4A 1VCTA 2MAWA 3N5LA 3NWIA 3RF1A 4K0KT 3ETUA 5AQMB 4ANJA 4LF9T 4EV6A 3BQKA 3GN5A 4MHCA 4DBQA 2K5BB 5AQQB 2HN2A 3ZN0B 4EGWA 2PFVA 3BQIA 2V7KA 4DR5T 3OKQA 2C5JA 2CLYB 3FZMB 4YHJA 2LSIA 4YTNA 5LMNT 3EABA 5L2LA 3GWHA 4YY3T 4DV7T 2YDSA 3V5SA 2RP4A 5DJQC 4YJ3E 5EK3A 1IBMT 4JI0T 4HFBA 2KINB 3E22E 4L9IA 2FJEA 2XSBA 1J1JA 2XUEA 5EK2A 3UU4A 2FUPA 4U2ZA 1KFYA 3Q5WA 5GONE 3NKZA 3N9MA 5J1GA 3RQWA 3UUMA 2BBHA 5HYAA 1R8IA 5J2TE 1KK7A 5LHIB 3VRAA 3U78A 2VASA 4EZHA 2JMKA 3EHZA 4A56A 3A5XA 1WRDA 5AQVB 3TLVA 3UT5E 3CKDA 4EOZB 1UK5A 1W0BA 3CQCB 3HL6A 3I0OA 2V1DB 1T72A 3MK7C 4UIGA 5AQLB 4YSYA 1MNDA 3LJCA 3P50A 4K0UA 5JTGA 3KV6A 2W00A 2FBWA 2ZM6T 2OLTA 4MBQA 4MLKA 4U7IA 5HEGA 4OK0A 3U3IA 2CRBA 3CQXC 2IHR1 4U72A 3T1YT 3WI3A 4H9QC 1JNZA 4JI2T 4OYKA 3NZPA 5BR8T 5HEJA 3FBLA 5LB7B 3RRCA 3PUQA 2L8KA 3EDVA 4GK5E 4DMVA 3K3OA 3WAKA 4IDNA 1ZKEA 3RYHE 3OBVE 3QB5K 1FMWA 1HCIA 1MIWA 1BR4A 3L3PA 2KWHA 3C4ZA 2HPJA 3M65A 3ONLC 4JEHB 1M62A 3ABVA 4KP3C 4LFAT 2A9UA 3EUHA 1YW0A 4HE8A 1HX8A 4A98A 2IUBA 2NR4A 5L3GB 3EAMA 3VHLA 4LFCT 3C50A 1HFAA 2VL0A 2WCAA 1FJGT 4QH4A 4FJOA 4NXMT 2V7JA 4A97A 1MNEA 1UX4A 1KNPA 2W0GA 1MMDA 2BBJA 5HWYA 3HR0A 2QA7A 2V6YA 3PV0F 4E7ZA 2JQKA 5L3DB 5LP6E 4Q25A 4AXPA 4ERRA 4IDPA 4X66T 4IREA 2VB6A 4PK5A 4YSXA 2NTYA 5AFUL 3PUWF 3MKDA 2LSYA 2DWKA 4E7SA 2XQ9A 3GN5B 2V26A 2XTLA 3F57A 2LKGA 3IF8B 3RGLA 2FJAA 2VVNA 4X20E 1J5WA 2HH7A 2VKHA 3ZC1A 2B1EA 2J1DG 4DR3T 3UUNA 4LF6T 3HKBE 5FYMA 3FXEB 3ESLA 3RRWA 3AB3B 4O4HE 2LHRA 2G0UA 2CPTA 2HN1A 3KV9A 4JI1T 4IE6A 4KBMB 2X0LB 2BG9B 1YQ4A 3FBZA 4JBWF 2X9WA 3ZC0A 4GYSA 2X9YA 4AKGA 4HKAA 5F8PA 2XQ6A 4HTEA 4EEDA 1N32T 1WR6A 4JUYA 5JR9A 4AQFA 4X5TA 4CXYA 3T1HT 4UF0A 1MMGA 4XAXB 5LBQB 4YHHT 1IBKT 3KDSE 4QXBB 3UFEA 4IIJE 2JQQA 2WDVA 5FP3A 3I9WA 2N9DA 3ONXA 3PDYA 1W9RA 2KNDA 3AA7B 3Q9DA 4HWCA 3RIUA 2C5KT 1HNXT 4KI0F 3VKHA 5ABEA 2M6IA 3H37A 2CA5A 2KZ7B 3P4QA 3RYFE 4CI3B 5C2TA 2UXDT 5HAXA 4JI7T 3NRXA 3AE1A 3PUVF 4G2AA 3P4SA 3B57A 4DR4T 4DMWA 2BVLA 1G73A 2M67A 2NW8A 2W63A 2X66A 5FKYA 5FXWA 2IW5B 5A1LA 2N2NA 1HF8A 3AECA 2MTQA 4Z91A 3J9X1 3IBPA 5HEHA 5L3EB 2D5UA 3Q2MA 3ZSTA 5FL1A 3H3AA 3I1AA 5AQIB 3MZKB 4X64T 3RC8A 3RYCE 1VCSA 4DO0A 4AKIA 2CHOA 5AQPB 1IZNB 3OVUA 2LSGA 2LRLA 1XNRT 3CX8B 5ADXL 1XDPA 3FB2A 2CWOA 1B7TA 2V7IA 3CMLA 3TKLB 4YTPA 1HNWT 3AXJB 3UUXB 3O1JA 3X1DA 2YINA 1T8BA 4CQIA 2K9AA 1S94A 1SHZC 3N9QA 4TZ4C 5FVKA 4WNKA 3C4XA 5L4HA 1MIYA 2WY2A 4GOUA 2E9XC 5HXCA 4ZZCA 2WZHA 5FXVA 4QX8B 5LCYA 1HS7A 5ETWA 4TWHA 2LSKA 3RYIE 1VRBA 4UELA 4CZZB 3J7Yq 4UXNB 2ACZA 2XM2A 2V5CA 2Q9QC 5CGMA 2LLYA 4COFA 2VURA 1SA0E 2QGSA 2EHOC 2A3DA 3O1IA 2CBJA 2H7VC 3EDUA 4HWDA 3UULA 3UQ4A 3FZFB 3SRZA 4BA9A 5EZYE 4DV3T 1LRZA 2SPCA 4O2AE 5KX5E 4IT4A 3AA1B 4EYYR 1YKHB 3P4RA 2UXXB 2WWVA 4AKHA 1CHUA 2JMHA 2LM9A 2XSAA 2Q9QB 4CXXA 5CJ5A 2LKHA 4L0RA 5JQGE 4B6XA 2WS3A 3PJAJ 5LYJE 5C8YE 3FZHB 4H9OC 3HKEE 4TUYE 2YDRA 3Q5XA 5L47A 2UUBT 1FEWA 2Y6XA 2W4XA 4NPPA 4UV9B 2E9XA 1VOMA 3ANWB 3MA9A 4QXHB 2OA5A 2XAHB 4GYRA 5LXTE 2F4VT 3AVRA 2UXNB 4IDZA 3UQ7A 3HA4A 1UURA 2Y8DA 2XAGB 3UUBA 4F6RC 5CA0E 2BZBA 4HFVA 4NUUA 3RIAA 4DUZT 1OEDC 2KXPB 1MMNA 3L09A 2UXBT 3RQUA 3ZMZB 1XDOA 4LFBT 4N78D 2BG9C 3AAIA 3Q5DA 4L5GA 4P1NA 2DHRA 2MPKA 4LMLA 4PK4A 1L0VA 3ZYKA 3RX6A 1N33T 5HXHA 4QX7B 1T7SA 1SUMB 1IJ6A 2FJDA 3SWHA 4IDQA 5JRCB 1YD8G 1YKEB 2R6GF 2X0HA 3I0QA 3P8CD 4KHZF 4O8SA 4P09A 5HCMA 5ABFA 2W66A 1YQ3A 3ZMTB 2VQFT 3ZT5A 4Z8XA 3UU3A 5JREA 3VR9A 3N2KE 1D0ZA 5LHGB 4ZS3A 1O3XA 5LA6E 3RHWA 1IAPA 4ZI2C 3VU7H 3RKGA 2K24A 4B3RT 4I43B 2ZM0A 4ILBA 3G06A 5AQTB 5FY1A 4WBNE 2HHHT 4XBFB 1LVKA 1D1CA 2BS2A 2CBIA 2DCFA 2D9DA 3IHRA 4IHJE 4U2YA 3DTOA 3ZMSB 2XQYA 4TWFA 4UF0B 4HWHA 2UU9T 2B76A 1Y01A 1XWMA 1BR1A 1XNQT 3P7IA 4PFPA 3SOLA 2C0SA 3MJXA 3ZN1B 4EEBA 2NOXA 4EIWA 3QK6A 3KBTA 3SFDA 1US7B 1WCRA 3GA8A 3T8OA 3K8PC 4BAYB 3PUSA 4C91A 3JCFA 4PK6A 1OXZA 3CQGB 1JNRA 3IEEA 2E5LT 1H7CA 3N9OA
chains in the Genus database with same CATH topology
3ZT5A 4CN1A 3EABA 5LB7B 2WY2A 1WR0A 4U3CA 2RPAA 2XZEA 4WZXA 4U31A 4U33A 4ZEYA 4U2ZA 2A9UA 3ZSTA 4U7YA 2CPTA 4U2YA 4A5XA 4CN4A 5CGMA 2LRKA 2V6YB 2W2UA 1YXRA 2LRLA 2DL1A 4P1NA 2V6YA 3K1SA 2MPKA 2JQKA 4CN6A 1WCRA 4IT4A 2JQ9A 3ZSSA 2WWVA 3ZT7A 2V6XA 2K3WA 2JQHA 4NIQA 4U7IA 3ZT6A 5CJ5A 2CRBA 5FVKA 1WFDA 5FVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT5 A;  4CN1 A;  3EAB A;  5LB7 B;  2WY2 A;  1WR0 A;  4U3C A;  2RPA A;  2XZE A;  4WZX A;  4U31 A;  4U33 A;  4ZEY A;  4U2Z A;  2A9U A;  3ZST A;  4U7Y A;  2CPT A;  4U2Y A;  4A5X A;  4CN4 A;  5CGM A;  2LRK A;  2V6Y B;  2W2U A;  1YXR A;  2LRL A;  2DL1 A;  4P1N A;  2V6Y A;  3K1S A;  2MPK A;  2JQK A;  4CN6 A;  1WCR A;  4IT4 A;  2JQ9 A;  3ZSS A;  2WWV A;  3ZT7 A;  2V6X A;  2K3W A;  2JQH A;  4NIQ A;  4U7I A;  3ZT6 A;  5CJ5 A;  2CRB A;  5FVK A;  1WFD A;  5FVL A; 
#chains in the Genus database with same CATH topology
 3E0Z A;  3UU5 A;  3ETV A;  2XQ5 A;  2EHO D;  5AQJ B;  4DID B;  2CWY A;  1WR0 A;  2NP9 A;  2WAU A;  4PFO A;  3JC6 C;  4QKN A;  4U3C A;  4UVA B;  1D0X A;  4YFS A;  3RC3 A;  4LF5 T;  4BJN A;  4I4T E;  5JDL A;  3ZYL A;  1W09 A;  3TLU A;  4IST A;  3ZEF B;  4AKL A;  3A7M A;  4PJL A;  1D1A A;  5LHH B;  3C4W A;  4IGU A;  4TX5 A;  5HEU A;  2WU5 A;  2JIW A;  2WP9 A;  3OYX A;  4EYU A;  1IBL T;  2AXD S;  2IAK A;  4G63 A;  5FXZ A;  3D0T A;  3DJB A;  3TLW A;  4EZ4 A;  3N9N A;  5CA1 E;  3RI5 A;  3ZCJ A;  4HFD A;  5JH7 E;  3K1S A;  5L3B B;  1LVF A;  2WWU A;  3B13 A;  3CIR A;  3LFM A;  3HKC E;  4KUM B;  5DQW A;  5AQR B;  5LJM A;  1J5E T;  1T98 A;  2V6X A;  3VR8 A;  4ZI7 E;  4DBR A;  5FNV E;  1ZV4 X;  2VVS A;  3AE8 A;  4O2B E;  5LOV E;  4JV5 T;  4WW0 A;  3ZCI A;  4X1Y E;  4EAH A;  3AE6 A;  3EI0 A;  1UUS A;  4ILU A;  2D2S A;  2LOS A;  4UVB B;  2P9B A;  3ZLI A;  5ABH A;  2BVM A;  4AQY T;  5HEO A;  2GK9 A;  2VKD A;  2BKO A;  2RPA A;  3LSV A;  3QOF A;  3PU8 A;  4U31 A;  3N2O A;  5LGN B;  4U33 A;  2CXF A;  2DWG A;  3O4X E;  3LG7 A;  3I9Y A;  2CXL A;  4CXW A;  3KBU A;  2WB5 A;  2MYS A;  5LG3 A;  3PUR A;  2WQY A;  3KIN B;  3PUY F;  3OYZ A;  4H9P C;  4O4L E;  4CN4 A;  2W2U A;  2WBL A;  3KFW X;  3HI2 A;  4LMJ A;  4B3M T;  1QLB A;  2PTF A;  2UUA T;  3R6N A;  2XY8 B;  5JR9 B;  2XM1 A;  4H63 H;  4JI8 T;  2H3R A;  5JDM A;  3MAC A;  2CE7 A;  3WAJ A;  1MIV A;  4DR2 T;  5TAO A;  2DLR A;  4X1I E;  5ABG A;  3L8R A;  3UFG A;  3ZT6 A;  4TWD A;  2VWA A;  4B3S T;  1ZEE A;  5J0Z A;  2NTX A;  3DP7 A;  1UCU A;  3RPU A;  3ZPO A;  4CN1 A;  2IC6 A;  2J62 A;  4UEM A;  4DV5 T;  3RH3 A;  1NWM X;  3L39 A;  4OYJ A;  3NRY A;  3RKO A;  3SS1 A;  4H63 V;  2ACX A;  4NXN T;  4X65 T;  3PTR B;  4HGA A;  5JVD E;  1X79 A;  2VL8 A;  1E7P A;  5HXE A;  1LKX A;  1I6Z A;  4IDO A;  5CFB A;  5JDG A;  2YK0 A;  1XMQ T;  1WYC A;  3F2E A;  3KVA A;  3PU3 A;  4QHO A;  4A5X A;  2W61 A;  4I55 E;  4ADZ A;  4LF8 T;  3K3N A;  5FY0 A;  3FHN A;  3M3Z B;  3JAF A;  4ILC A;  2X0Y A;  5HCJ A;  4DND A;  2LHN A;  2EHO A;  3AA6 B;  2I6H A;  2AE9 A;  2YU2 A;  3BK9 A;  3BQL A;  3PUA A;  4H9R C;  3W15 B;  2IIU A;  1XMO T;  2WMN A;  1HNZ T;  1U5P A;  2BS3 A;  3AEA A;  1QSD A;  3TLS A;  2LOP A;  4HFE A;  4PNI A;  2KT9 A;  1I94 T;  2UUC T;  2X51 A;  4YXD A;  4O4I E;  4JI6 T;  2XAJ B;  5FVL A;  2NWB A;  4NUV A;  1KNR A;  1S35 A;  2JRK A;  2YN6 A;  3AE4 A;  2NW9 A;  2H88 A;  3A8Y C;  3ZJ2 A;  2WMO A;  4AKR B;  4HFC A;  4CI1 B;  1DU2 A;  2LM2 A;  3CX6 B;  4QH1 A;  4ZI2 D;  2XQ3 A;  4TV9 E;  4YJ2 E;  3LK3 B;  3QB5 A;  4H9S E;  3V5U A;  4MFR A;  4UV8 B;  4XZC A;  4U7Y A;  3QUJ A;  2PBI A;  5AQG B;  4M1P A;  5DQV A;  3K3Q C;  3UTK A;  3E08 A;  2X9X A;  4OHF A;  3QC9 A;  3F31 A;  2YDQ A;  2WDQ A;  4AIS A;  1OED A;  4OFZ A;  3ZYM A;  4JEU B;  3PE0 A;  4JLE A;  3PJA A;  4ILA A;  3Q5E A;  5FMN A;  3UU6 A;  5C3J A;  3C51 A;  3ZT7 A;  4YT0 A;  4ZI3 C;  1UGO A;  3CX7 B;  2ES0 A;  5IUX A;  1ZOY A;  5AQF B;  4GKJ T;  2C5I T;  2BKP A;  3N9P A;  1Y64 B;  2V5D A;  4WYV A;  1NEN A;  4Z90 A;  5L3F B;  1CUN A;  3AE3 A;  2CEA A;  4J2C A;  2BS4 A;  2ZM2 A;  4TNV A;  4YSZ A;  5AQH B;  4HFH A;  3ZJ1 A;  4LF7 T;  5FY7 A;  3S4U A;  4DR7 T;  3AEE A;  3H3M A;  1KNZ A;  3ZMV B;  1BR0 A;  2WSS V;  3IA3 A;  2XJ7 A;  5JRC A;  2CXD A;  3AE9 A;  2E8I A;  2H7O A;  3KV4 A;  3KVB A;  5LJN A;  1HR0 T;  1V9D A;  3LBX A;  4QXC B;  4EB6 E;  2WDR A;  1MMA A;  5AQN B;  3SFE A;  1SE7 A;  2WM9 A;  4O4J E;  2XAQ B;  3FZL B;  1HG5 A;  2LEH A;  4JI4 T;  3JAD A;  1NAF A;  1N36 T;  2N1G A;  3AAE B;  5AQK B;  4KHP T;  3VKG A;  1HX1 B;  2E2A A;  2DL1 A;  2J4G A;  2XQ7 A;  3N9L A;  3TLT A;  5KMG P;  3NBX X;  4JYA T;  2IML A;  4JI3 T;  4IL9 A;  4ZXL A;  1E1H B;  3GMI A;  3LDQ B;  1KEY A;  4DV1 T;  4X1K E;  2Y48 B;  5AQU B;  2IDO B;  4WBO A;  2LE8 A;  4HFI A;  5LGU B;  4UVC B;  2E9X B;  3ANW A;  5HXS A;  5F3J A;  4AIU A;  4CI2 B;  1IJ5 A;  3OTO T;  4DV2 T;  2CHN A;  2V7M A;  2YOE A;  4IE4 A;  4YLH A;  3R84 B;  3NZQ A;  2W67 A;  2XAS B;  3P4W A;  3UU8 A;  2BG9 E;  5HWX A;  5DAB A;  2D0U A;  3OPC A;  3FXD B;  3LBX B;  4I50 E;  5AQS B;  2XQA A;  1OED E;  1XZY A;  3PUG A;  2DI4 A;  5CB4 E;  2V6Y B;  2LRK A;  2PG8 A;  5J2U E;  1YXR A;  4LMK A;  4AQG A;  2L3L A;  3CPZ A;  3LK2 B;  5IYZ E;  2KLQ A;  3N2G E;  3AE2 A;  4TV8 E;  3HKD E;  1HG2 A;  3AEB A;  4IE7 A;  3AE7 A;  5KDM C;  5AQO B;  4ZZB A;  2A72 A;  4ZOL E;  4JI5 T;  4IL4 A;  3PUX F;  2LSJ A;  5H6Q B;  2WU2 A;  3ZSS A;  2IC9 A;  2VKO A;  1HTJ F;  2H89 A;  3PUZ F;  4IE0 A;  3JC6 D;  2MOZ A;  1U4Q A;  4ISS A;  4LF4 T;  4GKK T;  1WFD A;  2YKS A;  4GIW A;  3AEF A;  2HPL A;  2K48 A;  2VK9 A;  4X62 T;  1NEK A;  4KX6 A;  4PW8 A;  4C90 A;  4TNW A;  2ODV A;  2Z6E A;  3ZMU B;  5KXJ A;  2KSR A;  4HEA A;  2Q9Q D;  2VKJ A;  2V7L A;  5LBM A;  3QNU A;  3EVY A;  1EZ3 A;  4PJM A;  1AJ3 A;  3AAA B;  1Z0P A;  2KWI B;  4P0A A;  2BDE A;  4DV6 T;  2LJL A;  2VQE T;  4HWI B;  1G8X A;  2RA1 A;  1FMV A;  3AXJ A;  3AA0 B;  4DV4 T;  2XQ8 A;  4DVD A;  4DR1 T;  2L9Q A;  1BR2 A;  2QYW A;  4QWN B;  2QRX A;  5FXX A;  1OED B;  4F8H A;  2DNX A;  1M7K A;  2X67 A;  2XAF B;  1WLX A;  2XHE B;  2OV9 A;  3C98 B;  5JDF A;  4PJN A;  2X68 A;  3AED A;  4FI5 A;  3ZKR A;  4EXT A;  1UX5 A;  2UXC T;  5HXR A;  2JQ9 A;  4ASK A;  5M4Y A;  4BJM A;  3AE5 A;  2ZLY A;  5LNK A;  1WYB A;  2JPF A;  4U74 A;  5L4E A;  2M6B A;  2BKN A;  3CK6 A;  2XPK A;  3O9X A;  5LMU T;  4AI6 A;  2A2F X;  2LT3 A;  3CWZ B;  2E5V A;  5JDQ A;  2QVA A;  4MAL A;  2KMF A;  5EK4 A;  4WZX A;  4QH5 A;  2PJQ A;  4DV0 T;  2I59 A;  2XQ4 A;  2CLY C;  1W0A A;  3CVR A;  5H6R B;  5IWA T;  5BMV E;  3O1H A;  1ZP0 A;  4PAG A;  3B5M A;  2JJ9 A;  2X9H A;  4OX9 T;  4P0B A;  1D0Y A;  2MBG A;  4ZHQ E;  1OWA A;  5FL0 A;  1FIO A;  3NVO A;  2EHO B;  2ZM8 A;  4ZS2 A;  2NW7 A;  1ZHC A;  2J47 A;  1Z8U A;  3JAE A;  3RLF F;  3RIF A;  2W62 A;  2YEV C;  5LGT B;  2WZI A;  1KF6 A;  2K3W A;  2JQH A;  4IE5 A;  4NIQ A;  5ABF B;  3P4P A;  5JDN A;  1E2A A;  2ODU A;  3OJA A;  4I0U A;  1QUU A;  5F5W A;  2D0T A;  2XZE A;  4TN7 B;  4HWF A;  2BG9 A;  2ZMA A;  4ZI3 D;  2CMR A;  2V8S V;  4GK0 E;  4ZEY A;  2I0M A;  4DUY T;  2CM0 A;  4YTM A;  2CCQ A;  3C64 A;  5L3C B;  3VRB A;  4H9N C;  4PJJ A;  4B3T T;  3MXZ A;  1D1B A;  2FJB A;  4AQF C;  5JR9 C;  2YU1 A;  5E0O A;  4HN9 A;  5JDH A;  3ONJ A;  1N34 T;  1X9B A;  3AEG A;  4UR9 A;  5IHY A;  3AVS A;  4KMC A;  4V1A v;  3KV5 A;  4CN6 A;  4DR6 T;  3FZK B;  3RIU C;  3LK4 2;  2E9X D;  2Q9Q A;  1GQE A;  5LG4 A;  1VCT A;  2MAW A;  3N5L A;  3NWI A;  3RF1 A;  4K0K T;  3ETU A;  5AQM B;  4ANJ A;  4LF9 T;  4EV6 A;  3BQK A;  3GN5 A;  4MHC A;  4DBQ A;  2K5B B;  5AQQ B;  2HN2 A;  3ZN0 B;  4EGW A;  2PFV A;  3BQI A;  2V7K A;  4DR5 T;  3OKQ A;  2C5J A;  2CLY B;  3FZM B;  4YHJ A;  2LSI A;  4YTN A;  5LMN T;  3EAB A;  5L2L A;  3GWH A;  4YY3 T;  4DV7 T;  2YDS A;  3V5S A;  2RP4 A;  5DJQ C;  4YJ3 E;  5EK3 A;  1IBM T;  4JI0 T;  4HFB A;  2KIN B;  3E22 E;  4L9I A;  2FJE A;  2XSB A;  1J1J A;  2XUE A;  5EK2 A;  3UU4 A;  2FUP A;  4U2Z A;  1KFY A;  3Q5W A;  5GON E;  3NKZ A;  3N9M A;  5J1G A;  3RQW A;  3UUM A;  2BBH A;  5HYA A;  1R8I A;  5J2T E;  1KK7 A;  5LHI B;  3VRA A;  3U78 A;  2VAS A;  4EZH A;  2JMK A;  3EHZ A;  4A56 A;  3A5X A;  1WRD A;  5AQV B;  3TLV A;  3UT5 E;  3CKD A;  4EOZ B;  1UK5 A;  1W0B A;  3CQC B;  3HL6 A;  3I0O A;  2V1D B;  1T72 A;  3MK7 C;  4UIG A;  5AQL B;  4YSY A;  1MND A;  3LJC A;  3P50 A;  4K0U A;  5JTG A;  3KV6 A;  2W00 A;  2FBW A;  2ZM6 T;  2OLT A;  4MBQ A;  4MLK A;  4U7I A;  5HEG A;  4OK0 A;  3U3I A;  2CRB A;  3CQX C;  2IHR 1;  4U72 A;  3T1Y T;  3WI3 A;  4H9Q C;  1JNZ A;  4JI2 T;  4OYK A;  3NZP A;  5BR8 T;  5HEJ A;  3FBL A;  5LB7 B;  3RRC A;  3PUQ A;  2L8K A;  3EDV A;  4GK5 E;  4DMV A;  3K3O A;  3WAK A;  4IDN A;  1ZKE A;  3RYH E;  3OBV E;  3QB5 K;  1FMW A;  1HCI A;  1MIW A;  1BR4 A;  3L3P A;  2KWH A;  3C4Z A;  2HPJ A;  3M65 A;  3ONL C;  4JEH B;  1M62 A;  3ABV A;  4KP3 C;  4LFA T;  2A9U A;  3EUH A;  1YW0 A;  4HE8 A;  1HX8 A;  4A98 A;  2IUB A;  2NR4 A;  5L3G B;  3EAM A;  3VHL A;  4LFC T;  3C50 A;  1HFA A;  2VL0 A;  2WCA A;  1FJG T;  4QH4 A;  4FJO A;  4NXM T;  2V7J A;  4A97 A;  1MNE A;  1UX4 A;  1KNP A;  2W0G A;  1MMD A;  2BBJ A;  5HWY A;  3HR0 A;  2QA7 A;  2V6Y A;  3PV0 F;  4E7Z A;  2JQK A;  5L3D B;  5LP6 E;  4Q25 A;  4AXP A;  4ERR A;  4IDP A;  4X66 T;  4IRE A;  2VB6 A;  4PK5 A;  4YSX A;  2NTY A;  5AFU L;  3PUW F;  3MKD A;  2LSY A;  2DWK A;  4E7S A;  2XQ9 A;  3GN5 B;  2V26 A;  2XTL A;  3F57 A;  2LKG A;  3IF8 B;  3RGL A;  2FJA A;  2VVN A;  4X20 E;  1J5W A;  2HH7 A;  2VKH A;  3ZC1 A;  2B1E A;  2J1D G;  4DR3 T;  3UUN A;  4LF6 T;  3HKB E;  5FYM A;  3FXE B;  3ESL A;  3RRW A;  3AB3 B;  4O4H E;  2LHR A;  2G0U A;  2CPT A;  2HN1 A;  3KV9 A;  4JI1 T;  4IE6 A;  4KBM B;  2X0L B;  2BG9 B;  1YQ4 A;  3FBZ A;  4JBW F;  2X9W A;  3ZC0 A;  4GYS A;  2X9Y A;  4AKG A;  4HKA A;  5F8P A;  2XQ6 A;  4HTE A;  4EED A;  1N32 T;  1WR6 A;  4JUY A;  5JR9 A;  4AQF A;  4X5T A;  4CXY A;  3T1H T;  4UF0 A;  1MMG A;  4XAX B;  5LBQ B;  4YHH T;  1IBK T;  3KDS E;  4QXB B;  3UFE A;  4IIJ E;  2JQQ A;  2WDV A;  5FP3 A;  3I9W A;  2N9D A;  3ONX A;  3PDY A;  1W9R A;  2KND A;  3AA7 B;  3Q9D A;  4HWC A;  3RIU A;  2C5K T;  1HNX T;  4KI0 F;  3VKH A;  5ABE A;  2M6I A;  3H37 A;  2CA5 A;  2KZ7 B;  3P4Q A;  3RYF E;  4CI3 B;  5C2T A;  2UXD T;  5HAX A;  4JI7 T;  3NRX A;  3AE1 A;  3PUV F;  4G2A A;  3P4S A;  3B57 A;  4DR4 T;  4DMW A;  2BVL A;  1G73 A;  2M67 A;  2NW8 A;  2W63 A;  2X66 A;  5FKY A;  5FXW A;  2IW5 B;  5A1L A;  2N2N A;  1HF8 A;  3AEC A;  2MTQ A;  4Z91 A;  3J9X 1;  3IBP A;  5HEH A;  5L3E B;  2D5U A;  3Q2M A;  3ZST A;  5FL1 A;  3H3A A;  3I1A A;  5AQI B;  3MZK B;  4X64 T;  3RC8 A;  3RYC E;  1VCS A;  4DO0 A;  4AKI A;  2CHO A;  5AQP B;  1IZN B;  3OVU A;  2LSG A;  2LRL A;  1XNR T;  3CX8 B;  5ADX L;  1XDP A;  3FB2 A;  2CWO A;  1B7T A;  2V7I A;  3CML A;  3TKL B;  4YTP A;  1HNW T;  3AXJ B;  3UUX B;  3O1J A;  3X1D A;  2YIN A;  1T8B A;  4CQI A;  2K9A A;  1S94 A;  1SHZ C;  3N9Q A;  4TZ4 C;  5FVK A;  4WNK A;  3C4X A;  5L4H A;  1MIY A;  2WY2 A;  4GOU A;  2E9X C;  5HXC A;  4ZZC A;  2WZH A;  5FXV A;  4QX8 B;  5LCY A;  1HS7 A;  5ETW A;  4TWH A;  2LSK A;  3RYI E;  1VRB A;  4UEL A;  4CZZ B;  3J7Y q;  4UXN B;  2ACZ A;  2XM2 A;  2V5C A;  2Q9Q C;  5CGM A;  2LLY A;  4COF A;  2VUR A;  1SA0 E;  2QGS A;  2EHO C;  2A3D A;  3O1I A;  2CBJ A;  2H7V C;  3EDU A;  4HWD A;  3UUL A;  3UQ4 A;  3FZF B;  3SRZ A;  4BA9 A;  5EZY E;  4DV3 T;  1LRZ A;  2SPC A;  4O2A E;  5KX5 E;  4IT4 A;  3AA1 B;  4EYY R;  1YKH B;  3P4R A;  2UXX B;  2WWV A;  4AKH A;  1CHU A;  2JMH A;  2LM9 A;  2XSA A;  2Q9Q B;  4CXX A;  5CJ5 A;  2LKH A;  4L0R A;  5JQG E;  4B6X A;  2WS3 A;  3PJA J;  5LYJ E;  5C8Y E;  3FZH B;  4H9O C;  3HKE E;  4TUY E;  2YDR A;  3Q5X A;  5L47 A;  2UUB T;  1FEW A;  2Y6X A;  2W4X A;  4NPP A;  4UV9 B;  2E9X A;  1VOM A;  3ANW B;  3MA9 A;  4QXH B;  2OA5 A;  2XAH B;  4GYR A;  5LXT E;  2F4V T;  3AVR A;  2UXN B;  4IDZ A;  3UQ7 A;  3HA4 A;  1UUR A;  2Y8D A;  2XAG B;  3UUB A;  4F6R C;  5CA0 E;  2BZB A;  4HFV A;  4NUU A;  3RIA A;  4DUZ T;  1OED C;  2KXP B;  1MMN A;  3L09 A;  2UXB T;  3RQU A;  3ZMZ B;  1XDO A;  4LFB T;  4N78 D;  2BG9 C;  3AAI A;  3Q5D A;  4L5G A;  4P1N A;  2DHR A;  2MPK A;  4LML A;  4PK4 A;  1L0V A;  3ZYK A;  3RX6 A;  1N33 T;  5HXH A;  4QX7 B;  1T7S A;  1SUM B;  1IJ6 A;  2FJD A;  3SWH A;  4IDQ A;  5JRC B;  1YD8 G;  1YKE B;  2R6G F;  2X0H A;  3I0Q A;  3P8C D;  4KHZ F;  4O8S A;  4P09 A;  5HCM A;  5ABF A;  2W66 A;  1YQ3 A;  3ZMT B;  2VQF T;  3ZT5 A;  4Z8X A;  3UU3 A;  5JRE A;  3VR9 A;  3N2K E;  1D0Z A;  5LHG B;  4ZS3 A;  1O3X A;  5LA6 E;  3RHW A;  1IAP A;  4ZI2 C;  3VU7 H;  3RKG A;  2K24 A;  4B3R T;  4I43 B;  2ZM0 A;  4ILB A;  3G06 A;  5AQT B;  5FY1 A;  4WBN E;  2HHH T;  4XBF B;  1LVK A;  1D1C A;  2BS2 A;  2CBI A;  2DCF A;  2D9D A;  3IHR A;  4IHJ E;  4U2Y A;  3DTO A;  3ZMS B;  2XQY A;  4TWF A;  4UF0 B;  4HWH A;  2UU9 T;  2B76 A;  1Y01 A;  1XWM A;  1BR1 A;  1XNQ T;  3P7I A;  4PFP A;  3SOL A;  2C0S A;  3MJX A;  3ZN1 B;  4EEB A;  2NOX A;  4EIW A;  3QK6 A;  3KBT A;  3SFD A;  1US7 B;  1WCR A;  3GA8 A;  3T8O A;  3K8P C;  4BAY B;  3PUS A;  4C91 A;  3JCF A;  4PK6 A;  1OXZ A;  3CQG B;  1JNR A;  3IEE A;  2E5L T;  1H7C A;  3N9O A; 
#chains in the Genus database with same CATH homology
 3ZT5 A;  4CN1 A;  3EAB A;  5LB7 B;  2WY2 A;  1WR0 A;  4U3C A;  2RPA A;  2XZE A;  4WZX A;  4U31 A;  4U33 A;  4ZEY A;  4U2Z A;  2A9U A;  3ZST A;  4U7Y A;  2CPT A;  4U2Y A;  4A5X A;  4CN4 A;  5CGM A;  2LRK A;  2V6Y B;  2W2U A;  1YXR A;  2LRL A;  2DL1 A;  4P1N A;  2V6Y A;  3K1S A;  2MPK A;  2JQK A;  4CN6 A;  1WCR A;  4IT4 A;  2JQ9 A;  3ZSS A;  2WWV A;  3ZT7 A;  2V6X A;  2K3W A;  2JQH A;  4NIQ A;  4U7I A;  3ZT6 A;  5CJ5 A;  2CRB A;  5FVK A;  1WFD A;  5FVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...