1WFJA

C2 domain-containing protein from putative elicitor-responsive gene
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVALSFKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C2 domain-containing protein from putative elicitor-responsive gene
rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords putative elicitor-responsive gene
total genus 12
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfjA01
5CCJA 3HIZA 4HLEA 2ISDA 5H4ZA 4QJ3B 2FK9A 3APCA 2K4AA 3PFQA 4FHJA 2CHZA 5JHAA 4F93B 2Y3AA 1BDYA 4DNLA 1DJIA 4KITB 4FJYA 1DQVA 1RSYA 3DBSA 2WXQA 2WXNA 2WXKA 1DSYA 2B3RA 2KI6A 2LHAA 4WEEA 3B7YA 3PRZA 1E8YA 2CJSA 3ML9A 2WXMA 5EDSA 3TJPA 1DJZA 3M7FB 4NP9A 4NS0A 3NZUA 4WWNA 4NPJA 4Y1TA 3CSTA 4EZKA 1HE8A 4PS3A 2ENQA 3W56A 3L08A 3QR0A 4Y1SA 3ZVVA 1E7UA 4ANVA 1DJXA 4L1BA 4F1SA 4FULA 4ANUA 3F05A 4LCVA 3APFA 4J6IA 3R7RA 3CSFA 4LT7A 3RDJA 2N1TE 3R7QA 1E8ZA 3KWUA 4QJ5B 4XX5A 3MJWA 2QZQA 4ICWA 1E7VA 2CM5A 4JPSA 4BGDA 4MJJA 2WXHA 3QARA 3OAWA 4FJZA 3FBKA 1CJYA 2A5UA 2CHWA 3QR1A 3PS6A 2UZPA 2K3HA 3JZYA 3ZW3A 4DK5A 1TJXA 3TWYA 3T8MA 3L9BA 4QAMB 3F04A 4ICXA 2WXIA 3APDA 5G2NA 4FADA 4EZJA 1RH8A 3ENEA 3HHMA 2CHDA 5G55A 4ANWA 4QJ4B 2FJUB 3L16A 1E8XA 1V27A 2WXLA 1W15A 2QZ5A 2YOAA 3W57A 3GPEA 4GB9A 5CCHE 2ZKMX 2DMHA 3DPDA 3NSJA 2K45A 2WXPA 3IM1A 3L4CA 3QJZA 4OVVA 4HVBA 4TV3A 1E90A 2DMGA 3IBEA 3N5AA 2X38A 2Q0ZX 2NCEA 4AJWA 4G11A 4WWOA 4F91B 1DJYA 2D8KA 4AOFA 2Z0UA 4IQHA 4FA6A 1A25A 4FHKA 1BYNA 2ENPA 3FDWA 2BWQA 2CHXA 3PYCA 2WXRA 2K8MA 3F00A 1TJMA 3ML8A 4IHBA 2R83A 1DJWA 1BCIA 2WXGA 3ZIMA 3QK0A 2Q3XA 2V4LA 3F01A 1WFJA 4TS6A 4NPKA 1YRKA 1UOWA 1DJGA 4KZ0A 4XE0A 1WFMA 2ENJA 1E8WA 4WWPA 2CM6A 2WXOA 4KZCA 4PS7A 3SD5A 2JQZA 1QATA 3S2AA 2NSQA 3LJ3A 1GMIA 4GNKB 4PS8A 4TUUA 4EZLA 4URKA 2A4ZA 4V11A 3OHMB 5KJ7E 1K5WA 1UGKA 4OVUA 4WAFA 3L54A 4BFRA 3HN8A 5H4YA 1W16A 3KWTA 2EP6A 1DJHA 4FLHA 2NQ3A 2RD0A 3NZSA 4L23A 4F92B 4L1LA 2WXJA 2WXFA 4XZ4A 4LDCA 3L13A 1QASA 3P2BA 3PREA 4L2YA 3RPBA 4A55A 1UOVA 3QAQA 3TL5A 2YRBA 5JHBA 3L17A 5T8IA 1RLWA 4ANXA 5CCGE 2CJTA
chains in the Genus database with same CATH superfamily
2QELA 4MAUL 1WGVA 2JIXD 2YBRA 2DWXA 2Y5QA 1BWWA 1RVFH 4Y9EA 5HHME 1WBXA 4JR9L 1SJHA 5HGHB 2DQFB 2YKKA 4FQCH 1OE3A 2ZIDA 3MRFA 3W9EA 1KJMA 1SYVA 2PO6B 3WTUA 2CDFB 2R69H 4N0FB 2XNAA 1U9KA 2UWEB 3F85A 2X41A 4PYHA 15C8L 3RX7A 2IH8A 5MEQB 3JUYA 1GL4B 3L4UA 4G8FB 3U0TB 3DXAB 2C9RA 2XY1A 2CO1A 2CJUL 4XMKH 2PWFA 2VH5H 4EQ3A 5JHLL 1G7LA 4NRXA 5DUBA 2IBGA 4LCUB 4O2CB 3M1BA 4AIXA 1LVEA 5CLYA 5EU3B 2Q8BL 3LRHA 4WEBL 1KMGA 4WTWA 5EA0H 4EDXB 2G4EA 4KV5E 1TTRA 4LLMA 2HJKB 4XAKD 3KL0A 3ZL4L 5CR1A 1I8UA 1EVUA 1N59B 4Z7IA 1IZKA 2YKLL 4BM7A 3BDYL 4U1SB 4G7VL 3MCKB 3BI9X 3O3DA 4QHMA 4NZRL 4LFHG 4HGWA 1DBMH 1TZHB 2BVPB 2OTUA 3QWRD 1CLOH 3NIGF 5DJ8B 4M6OL 2WLLB 5A2AA 1GCFA 1ADQL 3WMSA 6CGTA 1L5GA 2E8ZA 5GS0H 4ZMWA 3KLHC 4AI7A 2CKBH 3HE7A 2IALA 4HWEL 3TCTA 5LXGL 2Z92B 1RLBA 4LQFL 4H0GA 4JM2B 1RFDL 3QDMA 1CVSC 4O2FB 4ZW7A 4FQHB 2Z1PA 4N2EA 2YA0A 3TASA 2Z35A 2XXCB 2VMEA 1S7TB 1JZ8A 2VN7A 3F83A 1S7UB 2FO1A 3KYOB 4WW2C 5D1ZA 3WXWL 3S36H 4J4PD 3O6KL 1QP1A 1IFHL 2QPSA 1DQMH 4N2FA 5E9NA 1AZRA 4AYDC 3ZE0F 1DBBL 3TTYA 3UEQA 3K6FA 5IT2H 4KTEH 2MKWA 2Q6WA 2IAMB 4UCFA 1RERA 1T83A 2BDNH 4QRBA 3SE6A 5HVHB 5E8PB 5J12B 3VQMA 3EYQD 3S35L 2VQ1B 1MFAH 1Z3GL 3PAZA 2D3LA 3JTSA 3UJTL 1LD9A 1QLRA 4PAZA 5GJTH 2J20A 4XVSH 5H37H 4MAYA 1ZLUK 2HPOA 5C0AE 3BDYH 1QQDA 4JQIL 4JPWH 4M5YH 4WFFE 3UAJA 4N2GA 4XN9A 3WN5C 1BV8A 4D9LH 4IIQC 1YNTA 4F7KA 3JVGC 2BNRA 3D18A 2H0EA 2KLRA 4KNUA 4I13B 5LNEA 2PYED 2WO4A 4MNGE 4F15C 4PJBF 3EF4A 4Q4IA 3L45A 2F15A 5F3FA 3C5ZB 3VD9A 4CKVX 4LPWA 3BZEA 1NIFA 5C3IA 2EO9A 2HB0A 1K2DB 1KXQA 5D1ZC 3AXIA 1Z2KA 1AI1L 5ALBL 4FCAA 3OG4B 5D5MB 4OCLC 5IOKA 5HPMA 5E03A 1QKZH 3VXRB 3O45B 4GXFA 3BUYB 2FWSA 2W07B 3B2PA 2ZE0A 3PXHA 4L29A 3V0FA 4KUCD 5H37A 1PSKL 4HUWB 3GGWA 1CQKA 3WLWD 2X6UA 4DP5X 5EOTA 4E9YA 4OGZA 2VLRA 5AD0B 3AXLA 4GUOA 2XPYA 2CK2A 2DWSA 2GSMB 4GW1B 1S9VA 4A63A 1ZTXL 1F42A 3GBNL 5JYLA 3K2IA 1TCMA 3KJ6H 4KJQC 4C56D 1ECYA 4BIKA 5GIRB 1JK9B 5MENA 2X89D 4EO5A 5GGSA 4RBPK 3H9HA 2BMKB 4GKOA 1QVOB 2YEZB 2NY6D 3ZE1F 3JTTB 3VSUA 3IT8D 3MRJA 5T5NF 4FFZH 1UGNA 5GS2D 4JRYE 3VWKB 1QEWB 4HD9A 1J88A 5IJVA 3OKEA 4PBDA 4OCNC 4K7PX 5GS0L 1FNHA 3LKOB 5KJRL 1INEL 1DR9A 4Z1PA 1TXKA 2YLKA 3P4OB 1RZJC 4Q9QL 3CSYB 3PGCA 3TPKA 3HN3A 5D7IF 1FNGB 3JXAA 4XC3H 2QV2A 1MQKH 1OCRB 2APBA 2BWQA 4EE2A 5KVEL 2VN3A 2BP5M 3W11C 1IBYA 4XTRC 4XMLH 1PJWA 2CMRL 2V4LA 5L2JB 1JPSH 2CUHA 1DJGA 1IQWH 4FNQA 4NUJB 4RFNC 5A16B 3LEVH 2EVGA 2YD1A 3O4LB 4PJHE 4BK5C 5ITFA 1UYWL 1HXMA 2OLDA 1CYGA 1YNKL 4ZW8A 3U4EA 4RFEA 4PRBA 1V05A 3DBXA 4P2QA 3BO8A 1X7QA 5DJXA 1MSPA 1OAUH 4BQ8A 2SEBB 4CMMA 3FH7A 3UCRA 1NMAH 1DUZB 3BOVA 5E95B 4ZFZB 3N85L 2BINA 4P05A 3EO9L 3O9WD 4ADGA 4DPCX 4NOBA 1HJBC 4KHTH 5JW3H 4NIKB 1P5UB 3LRSA 4BRJA 2EH7L 2VWEE 1BQLL 3OKOA 1U42A 3R4RA 3BRGC 1BVZA 4NKOB 1E5AA 3L5XH 4OGXH 1J1OL 2F53D 5E7FA 3FT2A 3VWJA 3LNIA 2GJ6E 2HRPH 3VD7A 1E42A 3BISA 3Q8AA 2L7UA 2W0FB 2W65B 3C5SB 1R0AL 2VZ3A 2VO5A 3IJHB 5DO8A 1WBYA 5ICUA 1XWVA 4GAGH 2ZWZA 4CKQA 1DQDH 1BVKB 2AJYH 3IJYA 3EGXB 1Y7VA 1TQSA 2I85A 1I9JL 2GAZA 3AZUA 3HI6H 3FO0L 5F8RC 1R3LB 1KBWA 1T4KB 4HK0B 1KTLA 1FL6A 3DJRA 5HI3C 4PJ5A 4A7QA 4PGEB 4UDTA 4LCVA 4AVKA 1FLRL 3HG1E 1F13A 2LAAA 3DV6B 1BZ9B 1RPQA 1I1YB 2EDTA 3GMPB 3KW8A 3ME0B 3TBSA 3ZE0B 5FYKL 5DD5H 3ATDA 4QHLB 2D9CA 1TTCA 2WBJD 4KK5C 5C3TA 5B7EA 3MROA 1JPEA 4AKPA 3VA6A 5ADPH 3GO1L 4JPKL 2R2BA 1Q0XH 5A3IC 4B7LA 3L3KB 1RXLA 1NEZB 4Z7NF 4N0CD 1UWYA 4N85A 4PJXE 1OD7A 5GS0D 5TE4L 2K9UA 4RMQA 2X2IA 3U2IA 4PMFA 4EIZC 2IFFH 3VXSA 3TFKC 1NDMA 4OSUH 4QD2E 2P26A 1KWGA 3BZFA 3VH8A 4WNSA 1ZHBA 1F4YL 3QXVA 3QC6X 5EEUA 3IXAB 2VLJE 3LQAC 4WCYH 5CLZA 3V6OE 4KO9A 3IGKA 4LNRA 1LK3L 2YD7A 3AY2A 1DN0B 2ZSWB 1BOYA 1T1YA 3IRCA 2P7TA 3U4EB 2GC7C 5E8DH 1GGBH 1QLFB 2HH0H 2FYYB 3RTQD 1JUFB 1JVLA 2WJ7A 4F8LA 4G1MB 2YEQA 3E9TA 4P57A 1JGUL 5I18H 4IBLT 1EAPA 5IFHL 1F3JA 1OV8A 1KN4H 4HPOL 3N41B 3P3RA 3NJLA 1BBJA 3ZK0A 1PKQA 4DKEL 1W0WB 2UZYA 3CC5B 4X9GA 1GY1A 1P1VA 1PEZA 2DYSB 4X4MA 1ZEAL 4Y19B 4NKOA 4LF3B 4TQEL 1MY7A 4NSKB 2VO8A 5D7LE 3U1SL 5MEPA 5FFGA 5FCSH 3TPUB 1N0LA 3PP3K 4FI8A 4X6FB 4Y0GA 4WI4A 4TVUA 4XVJH 5KBDA 1YEIH 3UYPA 1JZ6A 3EGDB 1UXWA 2OCCB 1E67A 3DX9B 4YUEH 2WQAA 3E3QE 4GG6E 3QWOA 1F4WL 4WTXA 4DO5A 3CPUA 1ESOA 2UWEF 1QO3B 3UZEA 3BPNC 1X44A 2NNRA 2M2DA 2V9QA 4MA8H 3JWOL 1NKRA 1EJ6A 2YAOA 4UV7L 2H6UA 2XFXB 3AY4C 4KUZH 1MUJA 2W60A 3OZKA 1PNDA 4ZG1A 5A3ID 5J1TC 1W2KT 3L7EA 5JPMC 1FF5A 1MWAH 1WFUA 1WPCA 1CURA 5BV7B 3TFBA 3MFFB 2X2UA 2F54A 3RKPA 2ZD0A 5BNXD 4MMYB 3Q7JA 4KTEL 1GPOH 1A9BA 4NC0B 4G82A 4HFWB 3WEXA 3KS0J 2ZX7A 5DJAA 2JXMA 1MPAL 3IMRA 1HE8A 3ZHLA 3NCCB 2UVFA 3OGOE 3SYCA 5LG6A 1T89C 4FG4A 4HU2A 1XTMA 4PJEB 1O6TA 3UXFA 4Z3TA 5JW4M 4UQIM 2Z64C 3I6LD 2LLNA 4H26A 5DA0B 3S3CB 5J89A 1Z9SB 2V33A 1JCVA 1GZHC 1BXVA 4MXWH 4Y2LA 5E6ID 1I7UB 2VISB 2E56A 3RVTD 2QZQA 5AFAA 4OT1H 4NKDB 4ONFH 5IR1B 3L1GA 3QULA 3BQVA 2YQGA 1XR9B 3KGTA 4H2CA 1PLGL 1JWUB 4BWUA 4HUCA 2A5UA 2VGLM 3QR1A 3TNNB 3ZU8A 1N10A 4UAOB 1TITA 5AW7B 3O9WC 1E2WA 5TDNA 4G8EA 3U79A 1U3HA 5C86A 2EYTA 3E0GA 1EO5A 2GTWA 5G55A 4GRMB 3Q2CA 4C47A 4OLEA 4ZS7L 2WVUA 3L3HB 2A9MH 5KSBF 2XX1A 5IM7A 1II4E 4ZUTB 4GP5B 4Z78B 4L1TA 1OSYA 1F4XL 2UUDK 3C60B 4Y2NA 1YO4A 4XNBA 4CDHA 2YD6A 3MA7A 3SPGA 1J05B 3BZ4B 3JUZA 2W95A 4NO0B 4U1NB 4NP4H 1UM6L 1U8OA 5DQJB 3O3BA 1HI6A 2YGQA 3UPRB 3B7TA 2KYIA 1OF2A 3PIQB 3BWUC 1MCBA 5DWUL 4K2UL 3L3DA 3KYKH 4MXQD 4IKKA 5F70A 2UWEE 2FWOB 5E99L 1OSPH 5DQ9A 3HKFA 5B38A 3KVQA 4QHUB 5B3JE 2WLLA 2FQFA 4PRPE 1XL6A 5IQOA 3REVA 4GSQA 4PS4H 4XNMA 3B2UD 2FBJL 1V7NH 2WXFA 5A40E 2EZ0C 4HETA 5I1KH 4HJ1A 2BRRL 4MMXB 4F7TA 4ORGB 2BP8B 5FHBH 2OMVA 3M86A 5I0XA 3ULVL 5I6PA 3HB3C 4V33A 1UB6A 3P4MB 3C5ZC 3BP4A 3T2OA 3EYFA 3WS3A 3L95A 4ES9A 1O75A 4MJ6A 4XB8A 3G6JE 3AFLA 2NY6C 1QSFB 3PGFH 2DM2A 3V10A 1G7JB 3F3HA 5KSAD 2OK0H 5ALBH 3PHOB 1U8PB 2WXNA 2YWZA 4Y19D 4K94L 4B97A 2K70A 3D05A 1NCOA 3EJJX 4DO4A 3P11H 2Y9RT 5TQ2L 5CEYA 4HJEA 3U46B 1XR9A 2HT2D 3VXPA 2XDHA 1RU9L 5KYYB 5DVLA 1U3ZA 3GMMA 3KXFD 4P3CL 3D4ZA 3D87B 3VGAC 4RWYL 1GSMA 1NQBA 4G8EB 1I7TB 5DD1H 5BS0B 1G9EA 4DKFH 1A65A 3X14A 3ABZA 3DYOA 3NEEA 1KLUA 4HCRA 2X4OB 2RR3A 1MVFA 4KI5F 4CMHC 5JOPE 2PN5A 3L3GB 2X7LB 3RILA 5J9PB 1MN4A 5IMMA 2FH6A 4DTGL 1CD0A 3QARA 5JW4N 1RJCA 2FX9L 4PRAB 1CGXA 4AVIA 4ELKA 4ZSOB 4AE0A 3WU1A 2HT2C 4D0BA 5ILTL 5JO5A 4XI5D 1IBZA 3U4BL 4Z8FL 4QRQB 3I3BA 5ISZE 2DYRB 3NQKA 3IFNH 2A4CA 2H32A 5CLXA 4FQ1L 1V3LA 5D1XE 3OKKB 5AKRA 4QJ4B 3U83A 4UQ3A 5DD6B 1VPOH 5DO2C 2YSSB 2VZVA 2WBJB 2ZWSA 4UNVA 3EFOA 3GLDA 1X4ZA 4UANA 4J5VA 1SMOA 4U2YA 2WCPA 1HJCA 1NPUA 3SN6N 3T71A 3PWUA 3Q1EA 5KYXB 2AQPA 5DZAA 4J23A 1QFPA 1D9KC 5INCB 3C8KB 3H42H 2XTJE 2CUMA 2BY1A 2E9BA 4FA6A 2OMUB 5ACZB 6TAAA 4LXFA 5JYMA 1MCFA 3VI4A 2MKLC 3DUUB 4QY8A 5EZIL 3WI9A 2QQKL 4YWGH 1J1PL 3P9MB 4M7KL 4F9PA 5T1KD 4UT7H 5F1OB 5HHMD 5DMKB 2H47C 3MRPA 2X42A 3V6ZA 2NNAA 1ZJBA 1P9MC 3ECBB 1TETH 4K3HA 5AAPA 4H88H 1QEWA 4URKA 2ZKYA 3AABA 1XIWC 3SDDB 1BWMA 4RAHA 3G9VA 1JGLL 2BIPA 5CJOL 4LP5A 4BFRA 2YQ2A 4QLWA 3FB7B 1JXJA 3SOTA 2MPAH 1D6VH 4HZLA 3U7WL 4AG4L 5C7XH 3X1BA 1MFBL 2UXVA 4YNYA 5D2LA 4EOWH 5SX5K 3WSQL 1BFSA 1X9UA 4OCMC 2AQSA 3UZQA 4KROD 2QSQA 1N6QL 3FFCE 2N1KA 1OB1B 1ZVHA 1AG0A 2JI3A 1INDL 1J8HB 2ISDA 4GW1A 4JO2L 3APCA 5KEZA 1YPZE 4PJ7E 4X6DB 3TO4D 5JHAA 2A4EA 4H8WL 2LU7A 1B0IA 3HZKA 2Y07L 5C7XL 2EDQA 1FIGH 4GAAA 4ZQKA 4U3CA 2WTRA 2VDPB 3CFIC 3M8OL 3Q8FA 2Y06L 4JANB 1OP3H 2JCCF 1W9XA 5E9DA 4CBPA 4NFCA 1JF6A 1R5VB 3QR2A 3OB0K 4MHHI 4AUUA 1N6QH 4KVNH 2AGJH 3GSRB 4JHUA 4PJIB 4NQXA 4YBQD 1NMBL 3LHAA 4JPVH 1T7XA 4PJ7F 1N8ZB 3W37A 3NJIA 4Y9FA 1I8AA 1FC2D 3J27A 3F05A 3FQXB 3ROOB 5AB0A 2Q5BA 2DDQH 3QG6A 3CFBB 5IHWA 2EXWC 2DJUA 5F96L 5SV4A 3V4VH 4PY8I 5C0ND 3QFDA 4B9JA 1CDYA 4KH2A 2BFVH 1ZA6A 4DZBB 5CJQH 1JGDB 4QO1A 4X6CE 2BP3A 1MHPH 1CFNA 2WQVA 1RQ5A 3CV5A 4HUVA 1CWVA 3TO4A 5L9DH 3US9A 2ZOTA 2Z92A 3H9YA 2VERA 3UTZA 5ETUB 4J8QA 4YGVB 1FP5A 4AVHA 4ADJA 4EDWL 5TDOA 3UO1L 3QWQB 3LNDA 1I8KB 3SYPA 4UTAL 3KPQA 1T89A 4Z8FH 2G5BB 4AJVA 4CA4A 2VMCA 1NLBL 5CCHE 1T0MB 2BVPA 4YOKA 1AD0B 1EJ8A 3S8FB 3ATFA 1U8LB 2WAQA 5F7LB 1CDCA 1VPOL 5FGCE 4GFXA 3N9GL 1THAA 5HHNA 3LS4H 4FTVA 5D1QA 5MI0B 1M6OB 1G6RB 1YMMA 5HI3D 1PZUB 1R34A 3MLWH 3AU1B 4N9GB 4UTAH 1IGTB 1XGUB 4NAQA 5ACMA 1JS4A 4JZOB 4J3UA 1QI5A 5CEXB 5DZLA 5C6WH 4LASL 4HUXA 1OGSA 12E8L 3G6JB 4X4XB 1T5KA 4XE5B 1NCJA 5TFSH 3F58L 2D73A 3BWAA 2TSBA 2C4FT 1VACB 3VWJD 4GG6A 1KFAL 4AIOA 4PLKD 3GSNB 1GOGA 3T09A 1NL0H 3HI1B 2YD4A 1M71B 5DD1L 3EGXA 2A83A 3HG4A 4BZ1L 3P0YL 4X7TB 3OHXB 4LLDA 3RKDD 1FE8H 1SN5A 2DWYA 1OQXA 2EYRB 5EOQH 3EYUH 3PHAA 1G7HA 4N90E 5AW1B 4O02L 2F19H 2YEVB 3FSZA 4AEIL 1G6RL 1DZ0A 1J0JA 2VXQA 5HHXL 5IMKB 5IJKC 1UWGH 5DVMA 4LRNH 2IAMD 4CNIA 5AQ0A 3SGDI 1BW8A 4PI2A 5HHOB 2A99A 2MIZA 4WEUD 5GJSL 1YEDA 4QRPB 2VCOA 4LSPL 1F45A 3IGAB 1SY6A 4NS0A 4V2BA 3EJQA 1BXUA 4BBWA 3W11D 4HDIB 2V7HA 1U33A 2XV6B 5I1DB 4AQAA 5IGXH 3KPTA 4JN1L 1BM7A 3V9CA 4ENZA 3GGWB 5KVGH 1HYSD 1XAKA 3P40A 3ULVD 4PJXA 2ZSWA 3RBGA 1OANA 2BVQB 3NSDA 1JPFB 2OP4H 2E3VA 5HI5C 2B8OT 4PJGB 1R3JB 1MAKA 3KPOA 3U25A 1KCLA 1RUPL 1TUPA 3L4TA 3QZWG 3OWEA 4D0CA 1BECA 4JLRB 4UOJA 1GY2A 25C8H 1UFUA 4O4YL 5DZOA 3DGCR 4HJ0D 1LXMA 1OARL 1YMMB 5EORL 3EO1B 5A43C 4ZX6A 5JHLA 2N3JA 1LO4L 3IGLA 4NENB 2CHDA 2G5UA 4KNQA 1AIFB 1QWHA 3HLAB 5D2NB 5G4MA 4RAVB 3UG4A 4MDJB 4X4XA 3VFNB 4OD3H 1H15B 2ZOOA 3GSOB 4G8IA 3CBKB 3WKMH 5H35B 4KX7A 4XN8A 4BINA 4OCSL 3BSZL 1TFHA 1FBIL 2DWEA 3OBAA 3EBIA 4FHKA 2GY5A 3VXOA 1WEJL 2VN6A 4P59L 4YO0A 5AOKA 2V5RA 3BUIA 3S37X 1LO4H 2V3FA 3UH8A 1ANUA 3W0WA 1FO0A 4QMEA 2VQUA 4Y5XB 2IJ0C 3GI9H 3QYNA 2E9JA 3BIBX 1XSIA 1XF2B 1JYVA 3CFUA 1YEJH 1C16B 4Y4FD 2K6YA 2QDWA 3NGBC 3CH1B 3MTXA 3BZDA 2D3VA 3QXAB 5IW1A 3RZCD 5LGHL 2JKJA 1HHHA 2X12A 4EQ2A 3G5XA 1VB9A 2W0FA 3C5SA 4XCYB 2ZWKA 3DMMA 5IBLD 1H3UA 1OTTD 4G8AC 3N40P 2APTA 4JN2A 4PJCA 5EU7C 2R23A 1UOVA 3OZ9H 2DPKA 2BIQA 1DUZA 4ZFZA 3FS9A 1FYHB 1UUSA 1QPPA 2NY7L 3V0EA 5EZJB 2I5YH 3EOYG 4J2QA 4IBWA 4Z23A 1W0VA 5DRZB 4B3VA 3G6AA 2A6JA 1TJIL 4HAFA 4MTMA 4AQ1A 4WGKA 1KGCD 1MFBH 5EG6C 4ZW3A 1W6LA 1RZKL 3CLFH 3VWJB 5I8EA 5FYJH 4I77L 4EXKA 3RJQB 4JFZH 2WCSA 2IALB 4JGMA 3BPLB 2Z0BA 3C12A 4FQLL 1KDIA 2BZ7A 3ARFD 5IKCB 4ZYKB 3SPIA 4IMLB 4WHDA 5JHMA 2AQTA 2ATAA 1LYQA 4NO5A 3WE1A 1I9RH 2BVTA 4U6XB 4YBLC 3TBWB 1BLIA 1TQBB 1UB6B 1NC4A 3MLUH 4Z7VB 5E2TL 5CBEA 2EH8H 1SMDA 3MRBA 4NENA 4GRLA 1CLZH 1M56B 2X89A 1IGJA 3IJ9A 4HIIA 3BO8B 4X7SL 2W92A 3QUZA 3SYQA 2JJVA 3VH8G 5GRZA 4TVPE 1N12A 2CXGA 3ULUE 2BZCA 5LUMA 1R5WB 1XZ0A 3D50A 4YDLC 1MDTA 4G6AC 3QQ3B 4PFEA 3ZW3A 4BKLA 2NDGA 3FT0A 1NWPA 3FTZA 4I1RA 4FQ1H 1O5DT 3MO1A 4R8WL 1ZV9A 3D52A 3RURA 2R0ZL 4B9ZA 1XF3A 5J6GA 5CP3H 3S34L 3KH4A 4LVEA 1GGIH 3DPDA 5F6HI 1IILE 1KCWA 3IXAA 1EJOH 35C8H 4JKNA 3MOBH 3IDGA 2OXGB 3PV7A 4RWHA 4OZGA 4PG9A 4OFKA 4PVBA 1JWMA 5FYKH 2QQNH 2E86A 3K72B 3W2DH 4UINL 5L2KE 3HE7C 1WZ1H 5F2FA 4X5XA 5IK3B 1UM6H 2LFGA 3EHBB 2X40A 1UOWA 1GH7A 4P0DA 4PJAB 3GDBA 1MAML 2XX0A 4PS7A 4U1MB 3AWEA 4Z7UE 4UOW0 1TPXB 3DHJA 2WP3T 5E08L 2NR6A 1H6UA 4KMTL 2O6CA 2G0KA 3FU9A 3AM8C 4EEEA 4IHOA 2RH0A 1ZSHA 1NAKH 3ZL2A 3WFCL 1EBAA 4HQQL 3EBGA 3CVIH 5I8EB 5TK4A 5ABZA 1J8HD 4YVNA 3V5DA 4OFDA 5BO1H 3ARXA 3TL5A 1WG3A 1N70A 3KNBA 1QUNB 32C2A 4M9OA 1DQDL 3FONB 4PJEA 3V7AE 1CS6A 4ONFL 1IJNA 1YY9D 3WFBL 4M1CD 2G3NA 1J0YA 3QJRB 1E4KA 4ZAKD 3LD8B 1J18A 1KB5A 5SWSE 3HUJB 1AZNA 3FUJA 3UCQA 2EILB 4NOFA 1AXIB 4U1HB 3MFFA 5EDSA 5F97E 4QXUH 3WJJC 5EU6B 1HINL 5FDWB 4K3DH 2JELL 3SBWC 3RGVB 3VFGL 3GS7A 5I1AB 1FNFA 3QNZA 3GIZL 4Z7VE 4XNUL 4Q2ZA 4XO9A 1IIIA 3L3IA 4ECNA 1W0YT 3MOAH 4IGBD 4ODUB 2WB1A 5CSZB 5AZ2L 4QRPD 1GJWA 4NQSB 5AL8A 4NP4L 5HHOD 5PAZA 2HT4D 1I4FB 3V8CA 1BG1A 4POZD 3T9WA 3TT3H 1UYWH 3FUFA 3L9RB 4D7BA 3MTRA 2GITB 5E7BA 3VE0A 3NT0A 3TP4A 3JV6B 1U8OB 2VB5A 1P6WA 5C0JB 5C3LD 4J1UA 4XVSL 3T6ZA 3I85A 4X98B 4GRWF 5JOFB 3QAZC 4Q97A 5IBUB 3SDDA 3V0GA 5CCJA 5IFAL 5ADOL 4HJTA 3C2SA 4GKSB 5HVWA 3ISYA 1NGXA 1WIOA 2O72A 4LAJH 1ZT7B 3KJ6L 3C9NA 2UYLB 2YOCA 3LXUX 5D7IE 5CZRA 2J2ZA 2Q76A 3ATBA 1J8HE 2YBGA 4QRFA 5K69A 2Q10A 5BOZG 1SZNA 4QRSB 4JDVB 4XO5A 1V10A 3GINA 3KXFB 5DQJA 2LABA 5EF2A 5INDA 2GAZB 4NPKA 3FYIB 2P44B 2IQ9H 2O5YL 3L4WA 3PL6D 4P5MB 3ZHKA 5E51A 4POYA 1DCLA 2DMCA 3B3IA 4Y5XC 2CIIB 2YZ1A 4MQXD 3V5KB 4NN6C 2AJVH 3U0PB 2FWOA 2PCFB 3I2CL 3K6SB 3D09A 2FX8L 3L5WB 4KTDH 1HILB 1UEMA 4UV4H 2ID5A 3CWGA 3GI8H 1NCBL 5ERWB 3MPCA 2AJ3B 1NICA 3ZMNA 5C0GB 5EC1A 2IFFL 2K7PA 4M6NH 4ZD3H 3B5GA 3SE8H 3L13A 1MW2A 3VFUA 2CE6A 3L3OA 1A2YB 3EYVA 5LGYA 2WCGA 5AWNL 5C09A 1BFTA 4ZPVA 4PP1D 3WXVH 3V6FB 1BXXA 2PPCA 2A9DA 2J56A 4NQEB 2R2HA 5CEXA 2ESVD 5FGSA 1UJ3B 2A0LC 3NFNB 5BO0D 5IV2A 2HKFL 2QTVA 3FU8A 1F90H 1XAUA 1AI1H 2YHGA 3DGDA 4W93A 5DHDA 5FYLH 4ZDHA 1BDYA 4NN5B 1A8JH 1GVIA 4DVBA 3VXTA 3X3GL 2XQYA 5HGHA 3SJVA 2FL5B 2VLJD 3L7FB 1NBCA 4S1SH 5IHBA 4MQTB 3UAAA 2I5YL 5J6HB 4NPJA 1RKRA 2I9LB 2QGDA 3KPNA 1J9SA 4JPIA 3K8KA 3PNRB 4FEIA 1UCTA 2Q86A 3Q2WA 2G9HB 4YXLH 4KJPD 3TIDB 1FNLA 2BRRH 4I9WE 4NQDE 5I6NA 1D5MB 3ZDZB 2BDNL 3TN0B 1A6TB 3R4DA 2FX8H 2N1TE 4RQQB 5C0IB 1F8TH 3D30A 2VIRA 1EAJA 3CQFA 4Y19A 4JO3H 4Y5YB 1YNKH 1G7QB 4OF7A 1VEOA 5D2NE 1HSBB 1FRGH 4R7VA 3SDYH 1EK3A 1JBJA 4ZFOL 1PZ5B 3BP7A 1HYRC 4JDVA 1A7OH 4M62H 5I74B 4CW1A 3CSPA 1XB6A 3P30H 3DYPA 3QQXA 5SWQA 3VXUD 5IJCC 2F54D 1FFOA 1U41A 5C0RL 2YOAA 1AG6A 4FRWA 2XFXA 1MJ7H 3MACL 4N6RB 1N64H 3NA9L 5EF0A 3TONA 4NHUB 1IGFL 2BWIA 4JFWA 3ZO9A 4AEHL 4Z7WB 3VG9B 4JDTL 3VRJB 4GOSA 4Y4FA 5CEYB 2P80A 3VQLA 3ARBD 1Z7JA 4WO4C 2CMRH 2XETA 4F3FB 4JFOB 1F3JB 2BW4A 4OF6A 4K5NA 5D1ZI 1EGJL 2XA8H 2FEDD 3UTTA 5EBLB 4J3OH 1LDSA 1KIUA 2BSRB 4ZXBC 1KLUB 1YCSA 4AJYV 2KKQA 2JQZA 2ROXA 4LF3A 4GSXA 3C87A 4FC3E 3WJJA 3K71B 3WIHL 1G1CA 5EMYA 1UXSB 2H3XC 1MCOH 2P8PA 4WAFA 5FM5O 1ODAA 4B9PA 2G3MA 4PBVC 5E1QA 1OTUD 4C57C 1HEZA 5FCUL 3HZ3A 5MP6H 2EINB 1KEML 1A1MA 5CEZD 2NTFB 1QASA 2APVA 1TMQA 1EMTH 4L3EA 1KC5H 3CLEH 3ZE2B 4KK6C 3BFQG 3PWJA 4ATWA 3FU3A 1EANA 5DQDL 1ZXQA 4K3DL 1UADC 3ULVE 1R75A 1GTNA 3SB3A 1NSNL 1OTSD 3FO1B 2J1KA 2G60L 4OZIB 3T3PF 5AOLA 1S5HB 3FT2B 2V5TA 3BD4A 4TVSa 4KRLB 3GTTA 5FO8B 4KK8D 1KY6A 1WYJA 4EUPG 1WSST 3H0TB 3QJQB 2KI6A 1AR1B 1J5OH 4FNLH 1KXQE 3P0VL 2APXA 2XC8A 3QIUC 5F6IC 5KANG 4FA8A 1A02N 1CFNB 2JTYA 2PPDA 1KJ2A 3CSTA 5E1IA 5I6XB 3S4SB 5IREA 2QGEA 4JRXA 3EG9A 4KOBA 3D2UB 4I2XE 4AH2B 4J3TA 4ODSL 4LCIH 4FQXB 3ARPA 1M2VB 1EZLA 3GHEL 1QACA 3WY3A 4M93B 3NG5A 4L18A 4B9KC 5FYJE 4MJJA 2XVGA 2A38A 1A6ZB 2GG1A 1EJOL 4K7PY 4U6YA 4XCFH 5CSBA 2FB4H 1DVFD 5SWZB 3ZDZF 3OZ9L 2VOTA 2VDPH 1NEZG 1NJ9A 3G5ZB 3HHSA 3N44B 4CJ0A 2P24B 4HCRL 1U36A 1WWAX 1X4YA 2X1WL 2P5EB 1DO6A 4X6DA 4HALA 1CFSA 3WDJA 1PX3A 3IFOA 4LCYB 3IVKA 4L9LB 1WD8A 3MOBL 3VFVA 2HH0L 4FFYH 5I5MA 4K23H 3SOBL 1KN2H 3WUWG 3LQZA 4KQ3L 2BOBB 2BO0A 4LAQL 1RZKC 3ZO0A 3VXSE 2V2TA 4G1MA 3ARED 1HEJC 3B2XA 3IXTA 3X11A 2QVKA 1TQUA 5HDWA 1QEXA 2F74B 1XEUA 2BNQA 3ES6B 5E70A 1K3ZA 4FMFA 4OF8A 1TKWB 5AAMC 1ZLWK 1CU4H 2ITDB 4A7GA 2RHEA 3N50A 4WW1A 1E8WA 2FRGP 4PLNC 5LG1A 4K3JL 5I28A 5B1CA 3DDFA 4L3CA 4NSKA 4QPEA 3RPIA 3S4SG 3HMXL 3KG5A 4O9HH 5DWPA 3TVMA 4XNMB 1UH4A 4CNIB 1FH5L 3AACA 2ZQKA 4IU3B 4JQVA 1UXWB 2H7WA 3H9HB 5F1KC 2VW6A 2Z7ZA 3CE1A 4PVMA 1DBAL 4RLDA 3HAEG 1EFXA 3ZSTA 3KD4A 1XBRA 1QPXA 3MRJB 1AAJA 5EDXA 1F18A 5DLML 1S7RA 3WO3B 4CBZA 1HOCB 3D25A 5ESQB 2OPCA 4Z7VA 2AJUL 1E4JA 1I1AC 1UENA 4LLUB 4ERSL 1TQCC 2DQHH 3IDNA 5EU6E 2HJLB 4WY7H 3OKKA 2OP4L 3HFML 2YD8A 1H5BB 1DLFL 1Q9LA 3NYKA 3WHXA 2EUZA 2WVSA 5HHNB 4M8QB 1KJ2L 1XGPB 2VKWA 3FN0L 2WO2B 4DPRA 5HHOA 1NCCL 3ELAT 5E2WH 1WIPA 3QW9A 3KCPB 4WK0B 1MW3A 2B39A 1UKQA 2GTZB 3JT0A 1A6ZA 5C08B 4FKKA 4MAUH 3CFQA 3BSGA 1CXHA 5K33A 4R2GD 4HS8H 2ZOUA 4K9EH 4OLYH 2V7NA 1P53A 1DDHA 5MEND 3GXMA 1MF2H 2WGNB 1N5YL 2VDMH 4H1LH 1FSKB 4QLRA 4YDKH 2X0VA 3MFGB 1NANI 3SPVA 5L0QC 5E9DD 2J4WH 2KBGA 2LTQB 4X42A 1I1YA 2QGBA 3BJ91 1DDTA 3FQUB 4BELD 3B34A 3WFBH 2PPFA 4NZDA 1JHKH 4RZCA 1XHHA 5IVNA 1B2WL 1C5DB 3ZMRA 1MI5B 3GS4A 1NBZB 5I8CB 4AGQA 4D3CH 4DN3H 4ENEC 2IIJA 1SY6L 3OMAB 4DP1X 1JXDA 3O6FB 3OKMA 3ZDXB 4AYSA 1QLEH 1NPNA 1UH2A 5BVPH 2H6PB 3OKOB 4XMLL 1QNIA 5DJ6A 1CCZA 4QHNA 1Z9LA 1LEGB 1KEGH 4IW4C 1D9KA 4FQIL 1ZHBB 2Z1KA 3V4PH 4J3WA 4BYHA 1XVSA 3GK8L 5CFHA 4NQSA 2V2XB 3Q6FA 4ODXA 1XSJA 5KBPA 1H15A 5BZWB 1ED3A 1MW1A 4AJWA 2LR4A 2ZJSL 3HUJF 5H35A 2QHLA 1DJSA 4OKDA 4XCEB 1MRDH 3BE1H 2FBRA 3ARDB 4MD4A 3DHUA 2R0KH 3MUGB 3TURA 4YFLF 1TOXA 3E6FA 3GZPA 2O6FA 2APFA 4ZMAT 4NQXB 5DMGD 1WAPA 4PJFF 4PJBE 3BKYL 4R0LC 2OI9B 3NUKA 3TV3H 4YE4H 4L37B 3ELQA 3ARUA 3MYZA 5EUOA 3LNHA 3QPKA 4NRYB 4DF9A 2OI9C 4I5BB 3NPSC 2B59A 2GBTA 3LSOB 4YH6A 3T08A 1AC6A 2PP9A 2GEQA 4YNYB 1WFTA 3QFDB 1JMZA 2W88A 4QYAA 5FO7B 3UZVB 2Z35B 2XKSA 4LSQL 4JO8A 1A0QL 2WQ8A 1GJUA 1FV1B 5EZLB 3WFEH 1OGTB 3QI9A 2P52A 1TVBA 4OR1A 1KSRA 3ZDYF 3V4UH 3QORD 3TJEL 4CN4A 1KTCA 1QHPA 4Z0XA 2K4AA 3G6DH 3MRBB 1UT1A 2X5PA 5HI5D 5EUKA 4Y4HD 3EJZD 4UM8A 2B77A 2H32H 1SM3L 4O2EA 3SCMD 5I26A 1F6AA 3TJEH 1XCXA 2DQCL 4L5FH 4HISA 3NJHA 3PNWB 5DJ0A 2FSEB 1FYTE 4XXDA 4EF3A 1LO3L 4KVCL 2A9NL 1TCRB 3L08A 1S3KH 5BS0A 4G9FD 1MFEL 4PHZA 4ANVA 4N28A 3Q5YA 4JM2D 4OLXL 4HXAL 3ZR6A 1GIGH 2VM3A 2X3CA 5HYJA 2IAMC 4FZEH 5ABDE 2I60L 3VVVA 1PZ3A 2X4NA 5DK0A 3WTWA 1SMAA 5E1GA 3KYKL 2WXHA 1USZA 4HC1L 3HPJA 4PJCB 2OJEB 3X3FH 1XGYH 4DGUA 1ORQA 3PS6A 4UM9A 3V9EA 5A2KH 3NESA 1I8KA 2Y7MA 1ZKAA 1HCFX 4U05A 4XP5L 4JBSA 3DETD 3I6SA 1BX2B 2YFOA 1RZPA 5T3ZH 1D7DA 1CD1B 3V5KA 4ZTPL 4H5SA 5I1GL 3K6SA 2DMHA 2IDQA 5AAWA 4IRSD 3F5WA 3GNMH 5CD3A 2GSIA 2CGRL 2CR3A 1KEGL 1ADQH 4FFYA 3GBML 3SQOH 1A21A 3UZEC 3BKCL 4L8SB 5ID0A 1NGQL 3Q2VA 2XPZA 4NUPA 4HWNA 4P4KD 1W8OA 4PJ6A 1NFDA 2FEDC 3HE6A 2EYSB 2GFBB 3EJZC 3FPXA 3NZHH 3PWPA 3TBYB 5C0BE 5TPWL 4F24A 4WGVB 2B14A 4XTRD 5CIPB 5AW2B 1BQRA 3SQOL 4X5XB 2F18A 5T5NG 4PJHB 2GSGB 2Y1ZA 1WHPA 2HVKA 4Y16C 3MGOA 4KZCA 3IMVA 5DHVB 2BFVL 3RE0A 5C0DA 1NAMB 2AXJA 2UZIL 3OLDA 1NC2A 3OXRB 2AQQA 3L2LA 3C8HA 4G8GA 3LH2L 4IIQB 4QYOB 3OXSB 1CZ8L 1UVQA 2A74A 3FRPG 1KXTB 2XWEA 1HIML 2FO4B 3IDIA 1ITBB 1WGOA 3DI2B 2X4UB 3QQDA 4HWZA 3U2JA 4AZ8B 1F3DH 3ARRA 1JNNH 2VXUL 3P2BA 4J8RA 4M8RA 4Z77A 5K59E 3SDAA 5JHDE 3RJDA 3QDJA 5F9OL 1UA3A 4BFBD 1Y18B 2FT7A 2NY6B 2AABH 4IYKA 3NFPA 2OX5A 2HLFC 2NQCA 3EYSL 3FTWA 3BEVA 4Q2ZB 2VDNL 3L95B 5H4ZA 3EFFB 3X1EA 3FH5A 5IBLC 4XMTA 5CSZA 2HTLC 5ICYB 2WTRB 4JANA 4GW4B 4B53A 3X1NA 1DQVA 4MDJA 3E80A 4OJEH 3RVXC 4RDQG 5E9DB 1FJ1A 1FGVL 3RZCC 1V8HA 1JN6B 4JO2H 5CXPA 4JR9H 2VDNH 3STBA 3UACA 1X4XA 4Q9BA 4BQBA 5E6IA 4TRPH 1LQSR 3J07A 3CJJA 4X99A 1LO3H 5EU6A 5I8KL 4NUQA 3FTSA 3BAKA 1T6VN 3VJ6A 1HKFA 2XLLA 4Y8DC 4MNQB 5D2LE 4A2EA 3Q6GL 3ZRCC 1FFOB 4TPRL 3WUWA 1ZWIB 5LGJB 3GXUB 1CZ8H 2DD8H 5TGBB 2FX7H 3NACH 1A7BA 1NKGA 4PLOB 4Y4KA 4MS8D 4KQ4L 2VDOB 1BVKA 4UOW1 1UH3A 3KL5A 3VFRA 3RVWC 5I71C 4YR6B 1IU1A 3QFJA 2HG5B 3GXIA 2VR8A 4PWIA 4A68A 2XYCA 5JW5B 3OAZK 1VIWA 3VTAA 3T77A 5I19H 1Q9OB 5H2BB 4F37K 4UYQA 3GRWL 4LOVA 3L48A 5TTRA 2NY1B 2VDKL 3K4AA 1QBBA 2YJLA 3IB4A 5SWZE 1QX1A 4KY1L 5KZCD 4MNHB 2YBRB 2GABA 4FFYL 4XXWC 2J12B 5BQDA 5DD6A 4ZX5A 2VXTH 1FLTX 2ZCLH 2FHCA 2VRAA 3QEUA 2GI0A 4NM8H 1NGYB 2X38A 3OR6B 1WT5A 4K3EL 4RIRB 5C0CE 2V9RA 4W4NA 5D1XA 1GW0A 4A7TA 1HILA 2ZYSA 1IBGL 1NLBH 2YXMA 2DKSA 1U8NB 1CB4A 1N8OE 3S5LB 1CL7H 2CDFA 3X1GA 2VDLH 4ZUUA 4DVRL 4F15B 1AP2B 1SHMA 1CICA 4N26A 3NCYP 3QS3A 4G7RB 1MJJA 4XH2A 5AYUH 2QQQA 3D1MC 4TULL 3CVBA 1FFQA 4XGZA 4NPYB 4Q6IB 2EC9U 3P9MA 4YHYB 4KZ0A 4OZ4B 4P2RA 5DHXB 4MDIA 4QT5A 2R2HB 4MA7H 2ZCLL 4MYPA 5LDSA 4IBSA 1VFOA 5KS9E 2BIOA 1EXHA 3MGAA 1U3NA 2VLKB 2YPKA 1SJVA 3FMGH 2NUTA 1MCPH 3MODH 2P5ED 3WTXA 4PV8B 2LLLA 5D7LA 4YDJB 1JHLH 3RX9A 1JZ7A 3CH8A 3VG9C 4J4PA 4LL4A 1WBZB 5IQ9A 5GRVL 4X7FC 3RUGF 3LYRA 4RNRA 4I0PC 4QI3A 2WYTA 1SJEB 1G9MC 2K0RA 1WFIA 3N1FC 3PWPD 4AUYA 1QRNE 1S9XB 1PG7L 4HLEA 3CPLA 2LOEA 1T03H 2WWMD 1ODUA 3NACL 5D2LF 2ATKA 1OAZL 5F7EL 3PPEA 4IKIA 1YUKB 4NDMA 1MCPL 4X6FA 4HJJH 5IOPA 1XTLA 3HCVB 1G0XA 1I9EA 3ZOAA 3O4LE 1U8QB 2PWEA 3M7FB 3CDYA 1OSPL 3GRGA 1PAMA 2I9TB 3T0DA 2O5ZL 4JJ5A 2FD6H 3K4ZA 7FABL 1B4TA 2PCYA 3NABL 3V8OA 4Z7QB 3LN4B 3O41B 3O6LH 4N20A 1WZAA 4XZUA 4K4KA 2AK4E 1E2ZA 4FTVD 1KPRB 2D0FA 4XBPB 3LNEA 3MLVH 4GRLB 3MBEA 1ZRUA 4XAKE 4RDBA 1DO5A 4PRPA 2QGCA 1KZYA 2DIAA 2JKIS 2J8UA 5FOBA 3K8MA 4QXTA 3R7QA 4XB7A 4OJFL 3BLKA 3HC4L 5E6ZA 2C9UA 1X5XA 5E2UL 4BZ2A 2Y7NA 3CC1A 3D9AL 1A1NB 5HHPB 4G7YL 3MRQB 2WP3O 4RRPM 3HUJE 5D71L 4R6UA 4YUEL 3T2NL 4PJ8D 1DBAH 2FUQA 1WIUA 4F2MA 2F5BH 1PZ5A 3QH3A 3H9SA 3O9WA 4WNQA 4UT6H 1HIMH 1TLMA 4LMQE 3SKJH 3VI4E 1QNZH 4IOIA 3VFWB 4I3RL 4ZFFA 2JB5H 4H88L 4MJIB 3SCMA 4IK7A 5IR1A 1AD0A 1HESA 2W91A 2BNRE 1WCBB 3K6DA 4RZCB 2J4WL 3HNTL 2QQLL 4P8QA 1DFBL 2XG4B 1AOZA 3N6YA 4MA1C 4XMPL 1FO0B 2BSED 5KWYC 1K72A 1M53A 4HKBB 1FN4B 2Q7NA 2G9HA 2A9AA 1U91A 3KE0A 4LLUA 5J57B 3WMPA 3GSNL 4GRMA 3SDYL 3ULSB 2EEAA 2E76C 4Z6AT 4IMKC 2WSKA 2VAAB 1CC3A 1NFIB 5E8DL 1XB3A 1EHLH 2A3TA 4LHUD 1QUPA 4IBQA 3D69A 4GMTL 3IFPA 2AEIT 4OFQA 4ZTPH 4R5TA 4LOEA 4WTZG 2CD0A 2H9GA 4MGXA 4P5TA 5I0YA 4N90D 2Y6SD 4S0SD 3W5NA 2E47A 3WIIH 3M07A 2Y7OA 5JXED 4TUKH 3DJ9A 4HBCL 4WU5A 4QRRA 2WWOA 1A4KB 3NSFA 5HJ3A 4ZMVA 3DO7A 3PWNA 4JHWL 1J86A 3IWUA 1GKOA 4F37F 3QDGA 4WUUE 4P2QD 1KPUA 3OZLA 3KW7A 3DOIA 3RVTC 3C5JA 4JRWA 1GIGL 3L1OL 1K4CB 5GZOD 2CJSA 4WWKC 1C08A 4WIQA 4X5LA 1F1AA 2R2EB 3SPCA 3TJPA 2DQHL 4KH9A 5I16B 3F7PC 4JY6A 5FYJU 3MRIB 4L0ZA 2IGLA 2X9ZA 2QJDA 1NC4D 2DM4A 1L7IL 5I75C 2X28A 5HY9A 1BZ7B 4GAGL 1NC4B 2VERN 4JFEE 3RUGA 1R4XA 3KXFA 2VZOA 2P24A 5ICXB 2R8SH 1KYFA 3MV9A 4FNPA 2HKAA 4ODXB 5F3BA 3NGBB 2Z4QB 2CO6B 2ZAHA 5EIIG 5ENWB 1BREA 3IFOB 4PJXB 4DKAA 1DSWA 3DX8A 4R4BB 2H0JA 2LV4A 5I0VA 3NIDE 3QC5X 4ODWA 1M71A 4AITA 3QI9C 1DQLH 3PU7A 2I27N 4N0FA 2ZX6A 3HNVL 4KMQA 4PRDB 4CDGC 5GS2H 1IM9D 4FFWC 4GBXB 4YXHL 4FXGC 2ICES 4ZO9A 5DYOB 1ET8A 2ADIA 1QW8A 1IKFH 3LS5L 4ZMNA 4ZX4A 4XR8C 3QUYB 1YY9C 2CKBL 5EEWA 1YPZA 4LDLB 3LPFA 4N8VG 2ZOLA 3MV8E 4PJEE 5FWQA 2VITA 5JUEL 2DEYX 2ZONA 1LK2A 2VLKE 1I31A 1NPJA 1AGCB 1XD1A 3LQZB 4QUOA 5BXFB 1OAKL 3JV4A 3T0EC 3KWXA 4GPVA 1T20A 1JTOA 4DFIA 5LQBH 2PMZA 2VDKH 1SXNA 2NX5A 2APSA 2HMIC 3IJYB 4OV5A 3IRPX 4PGDB 3HW7A 5AZUA 3VGAB 1G9ML 1BSIA 2Q3XA 4P5MA 3VYPA 2IDUA 4X80L 5IMOA 3GT6A 3QT2A 4XB3A 4MNGA 1EUTA 2A9NH 2JFCA 2X88A 3ZL1A 4DGYL 5DSCB 3QCVH 4FFVD 4GNKB 5J1AA 5A6LA 3JVFC 2E8YA 3U30B 3P11L 3TEZA 3IBOA 3TYFB 4HX1B 3W9DA 1CI3M 2VSCA 4APQC 3WTVA 1QI4A 3QIUA 1LE9B 3QXAA 2ARJQ 4MX7A 1J12A 1OW0A 2WZPD 4TXVB 1T22A 3HZMA 2GTZA 2XTSA 2XQBL 1IKNC 1AKJD 1SUHA 4H4NA 4UQBA 3K2MC 1CXEA 4YFLI 4IRSC 5DXWA 5GGTA 2IG2L 1Z9NA 3QHZL 4G72B 4KHTL 5JW3L 5D6DA 4NAMA 2J57A 1JWSA 1JHKL 5EZJA 1AOHA 2HTLD 3GDCA 5IG7B 3DRTA 4AYMC 4F93B 3B9KB 3RZCB 5HXMA 5CZVH 1BYPA 4HXBH 1SYSA 2FBJH 3DBSA 3SPVB 2A1WL 4Y1AD 1YMME 1KCVH 2VZ1A 3QHFH 4M56A 1Z0NA 5CN2A 4L8BA 5EHFA 3FQUA 5E4OA 4ODWB 1ORQB 3V79C 1KJVA 2HJFB 2IG2H 3QHZH 3KCPA 3IDJA 1TSHA 1J0KA 1O5PA 3II1A 3H6AA 4JNXA 2BSEA 3EOTH 1H19A 1GPOL 2DQ6A 1MG2C 1ZOXA 3LV3B 1NMAL 3QFJD 1C5BL 1HSAA 2NRDA 3QXWA 1XF2A 4UIKH 1PD6A 3HE7D 4XCCL 2ZKHH 4TNWF 1WS8A 4G5AA 4H8WC 3QJHA 4W9ZA 3U4KA 3QXUA 1XH1A 2GJ6B 3OC5A 1E7VA 2D0HA 3MRMB 4B9YA 8PAZA 2ZUVA 4N87A 3ZYOA 1MQ8A 1G9MH 5I17A 2F1AA 3UYPB 4AGPA 3ZDXE 4OUUB 5DMYA 1XDTT 3TVMC 4IKNA 2UUDH 1MIMH 3QQ4A 2CDGA 4DIXA 2AJSH 5KYUB 5FGBC 3SY0A 4TQPA 3JZ7A 2J1WA 4WUUA 2QZ5A 4JZJC 1NLDL 2BS8A 5E5LA 2YPLD 3Q13A 4I3SH 4BDVB 2H3NA 1F41A 1LDPL 3AAZA 3OQ3B 4IU2B 4MLIA 1BAGA 3QVAA 2WTPA 3NAAL 2YK1H 4U3HA 4FFZL 2JKWA 3BGMB 3MOQA 3KLLA 5GGSB 1T2XA 4NO2B 1A3RH 4HHAA 2R9HD 4P49A 4YZFF 3FO9A 2BNUA 3NAAH 3T6QC 2CKBA 1MRFH 4L3ED 5F1NB 4JO3L 2VWEC 1IQDA 2AJZB 4HC1H 4V11A 5KJ7E 1VENA 2P5WA 3RWJA 2AV7B 3KHQA 3VFTA 4A6YH 4ZW6A 5T1LA 1ZGLM 3BAEH 4P2OA 5J0BA 3IU4H 5CUSH 4F92B 1J10A 4FTDA 2CU9A 1SYVB 3C09C 3QNXB 4Z7QF 1WK0A 2NY1D 3TU6A 2W07A 1UT9A 4L29B 1WA0X 5C09B 4QWWC 3MNDA 8CGTA 1MFEH 1X5KA 3KXFE 3FRUB 2P8MB 1XF3B 2P47B 3NJJA 3U4AA 3FU7A 4PJFA 4YHLH 4X4KA 5E24E 3TT3L 1VFBA 4AW4A 4I85A 1IRAY 3ZKND 4UQDA 5EC2A 1I9IH 1JXKA 2X1QA 4E9TA 3RWDA 3OTTA 1OEZW 4LSTL 4E5XG 1ZT1B 3BN9D 1JDAA 2GJ6A 2HKFH 5L7XH 4TQEH 1LP9F 3ARDA 4MD4B 4P23B 1EV2E 1I9JH 4Y2DB 3G3LA 4JRXB 3VFPB 3VXUA 2EH7H 3L1FA 4MCZB 1EEUA 2IQ9L 2ENQA 4PJCF 2EIKB 4DP6X 3B7SA 4JQIH 1JJUA 3IJ8A 4HLZH 4UUJA 3EDDA 5IBTH 2X1XR 4LZKA 2WD0A 2X6BA 2Q3AA 1L6ZA 1FDLL 1AACA 4LQFH 1CD8A 1NIBA 4EN3C 1NFAA 2HUEA 1J9TA 3FUKA 3S48A 1RCYA 2VC2B 3DJZA 4OFYA 3UDWC 2EEFA 3GMQA 2R9HC 3GIVB 4XP1H 4QOKB 4WFHD 4UAHA 2XG5B 4WI0B 4PY7A 2ICWI 2YD0A 5DQDH 1OGTA 3QI9B 1HNFA 2DQDL 1TJXA 2BP0B 3MJ9H 3QCTH 4LRIA 3UBXB 3VE0B 5B3JF 1YJDL 3UYRH 2V6HA 3FUNA 2ZX8A 4N86A 5DJDA 1OAUL 2ZX5A 1ADWA 5F89B 3SDDC 1XIWB 3IE4A 1JYNA 3VGFA 4Y9GA 4HS3B 1X5AA 4IOFC 4KJYB 4UU9B 2ZICA 1YY8A 3OMIB 3INUH 5BRQA 4XBPA 3H7BB 4HCIA 2Z93B 1N6VA 4LBEB 4JDTH 2DYPA 1BZ9A 2Z7UA 3CXHK 3RWCA 3VMNA 2OMWA 1KBBA 1FA4A 5AW3B 1L0YA 2Q3ZA 2A77L 5KSVA 1T1XB 4KRMB 2OS7A 4HEME 1A1NA 4ZW5A 1MCIA 4HGKC 1KIQB 3DX7A 2NUPA 4KI1A 5E1AB 3T65A 1MQKL 3GJEA 5GGVH 2VKXA 1OK0A 5K1NA 5I5IA 4XN1A 1OGAD 3WKNA 3CZLA 4LRIC 2N0KA 3BAIA 1P84K 2JKNA 4JREC 5DT1L 5JORB 1D7FA 1UURA 1IGCL 4AGMA 2OSWA 2DWDA 4QRUB 3F12B 5AVYB 3TH4T 1R9FA 1KGYE 5TDPB 3MBXL 4X0NA 3MRGA 3L5JA 4JFXA 1JD9A 2QV4A 1YQ2A 1BEYL 1MHHA 2G60H 4AZ8A 4NZJA 1A66A 2VZTA 1YMMD 1BX2A 4HS8L 2DEXX 2FJGB 4PGCA 4ZTOH 1BF2A 3FN9A 4H5SB 2F54E 2XACC 4HLJA 1KC5L 4UDUA 1H5BA 2OTPA 3F5WB 4PIBA 2B3IA 4X5WA 4U6HA 4K5PA 3H85A 5EEXA 1LO2L 2NOYA 3UBXG 4LSTH 3MROB 2EAEA 1UWGL 1RK0A 3ARGC 1OAZH 2WPGA 4PJBB 3SDDD 3M6DA 1Q1JL 1O9ZA 4L8SA 4G5ZH 2MQGA 5GS1A 1O7SA 4Y4KB 3G08B 4AZUA 4IEFB 3B1TA 4YHIA 2F19L 5C6TL 4KKAD 3ABMB 5FPIA 3HE6D 2OMUA 3KPNB 1AZZC 5IHZB 3N1PC 4WJ5A 3TZVC 4JHAH 2VUOA 3CVIL 3LXAA 1U30A 2DH2A 3CQQA 4FQXA 1ICTA 3N91A 6FABL 3APFA 4NXSA 1IBHA 3SCMB 2YQ3A 3T8VA 3CSFA 5FFOA 3OKEB 4RGMC 2CNZA 2PO6A 5D7HA 5DGQA 2J1XA 3S96A 2DICA 3P69A 4G42B 4IGBA 5KG9A 5HDQL 2WINA 3EFDH 2CUIA 4Y5VA 5FM4A 1A2YA 3LZOA 5F9AC 1CDBA 2BNQE 1NCNA 4MRBA 1P7KA 1ORSA 3ULSA 1MNNA 1MELA 4MXVF 3ATAA 2FBOJ 3BYYA 5A2FA 2JJTC 5F7UA 2ITEA 2JQMA 4E41E 5JMOC 5HY9B 2BIHA 3BAEL 5AALA 3UAJD 2BXZA 2BXYA 3ZKNC 3D0AA 1E5CA 5JUEH 3GRWA 3BVNB 3OF6D 1EQWA 5DURB 2B1OA 2G9KA 1AQDA 1JN6A 1AR1C 4ZMZA 1IM3B 1EZVY 4L9LC 5FGRA 3EGSB 4FQXD 4WWOA 2DQUL 3CDZB 4KK9D 5DS8A 2G4GA 3QE5A 1U58B 5KSBB 5FKPA 4X6DF 1AO7A 1SLUA 3MO1B 5T3XE 3HBZA 2NXZC 1OF0A 5T1MA 4F7MA 3POHA 2FGWL 1OP5H 2QQLH 1JPTL 2B1HL 5ISZB 2V2WA 3E6HA 3LVTA 1BJ8A 1L7IH 2E7DA 3OAYH 5FEBA 3WKML 5A2LH 2LQRA 3ZIYA 1SXBA 4KZDL 4WFEE 4BK4A 2H8PB 1PNCA 1X9QA 4MS6A 4YDNA 3O8XB 4BFOA 5HTSA 2X9WA 4QDGA 3DVNA 1RZIA 1QSED 2EDBA 1HCVA 1N7ML 2M26A 4KRPD 4AK2A 5T1KA 4EI6B 1J05A 1CXKA 1S7TA 2HVBA 4U1NA 5EBMB 4DEWA 1SFDA 1BQKA 3NIGE 5JXEA 2ZPKL 1AE6L 4PV8A 5D7LB 2R29A 2CJ3A 1WP6A 3P9LB 5ANMB 3I9PA 2IO5A 5T3ZD 1YN6A 2WY3B 3HC4H 1T4KA 1MFUA 2IFGA 4I77H 3DUSA 5F6IB 3PP4H 4X0KA 2X9XA 1WICA 3NJGA 2ED9A 2HA1A 2ZXDA 4BUHA 2R69L 2VC2L 2VL5A 4EJ1C 1DJIA 4LHUA 1SLXA 3KYMA 3DMMC 3TBSB 5H8DA 5I75B 1MJUL 5L8LB 4NDMB 3S98A 3WKPA 2J8OA 5KBKA 2N4IA 2YD5A 3KH3A 3VGBA 3PDOB 1HKLH 4J3OC 2EXWD 2Q8AH 1M7UA 1NSNH 1DQKA 4OGQC 5AG8A 4K9EC 1D5IH 4I0CC 2IXQB 1SDDA 1CFVL 3EOBB 2GTWB 4R2GB 5DTFA 3D39D 4TOYL 2EYSA 3QRBA 5DMGC 3TXAA 3N85H 2VLLA 4JPQA 3DSNA 4FQJL 4HJSA 4E41A 3ARBB 3KVPA 3FT1A 4I1PA 3NTCL 1K6QL 5HI4C 3QUZD 1KB5B 4PB9H 3LEYH 3B9KA 5E9AA 4U1HA 5KUKA 3QWRA 3KPLB 4PV9A 1N26A 1EEZB 2NCMA 4NO0A 5CCKH 2LU4A 2X1OA 3ZTNL 1WD9A 1T1WA 4GQRA 1OWWA 5I1AA 2XWJA 2QVIA 4LSVL 3WJLA 3NRFA 3CVHH 2GB2A 4NX0A 3JQOB 4ISVA 4M7LL 1BZQK 3OG6B 5E94A 3RGBA 4GUQA 1EXUB 1EXGA 4AJ0A 4LPYA 1KFAH 2NY5C 4GUCA 5I6KA 4TUOB 4TL5A 4OCXL 2L0DA 2A6DA 3JYCA 4XP9L 4XT1C 5G5DB 5HHVL 1NCAH 4K3GA 1JNHA 3U1QA 1EHXA 2P5WD 3T2QA 3KJ4B 4OQ1A 4M4RB 3UBHA 4O51A 2YEZA 1CYXA 4LEBA 5DJXB 2JKSA 3IFNL 4GFTB 1BP3B 2R0ZH 2D7QA 3LIZL 3T2NH 5T1KB 4BJLA 3QEQD 2Y5TB 3DURB 1ZLDA 5D8JL 1UD6A 2J1YA 2XV3A 1BVLB 2XBDA 3AREB 1R47A 1QZ1A 5CN3A 3RAJL 2AANA 3PQYE 3UDWA 3PJNA 4J3OD 2C7UA 3EJCA 5B1BB 4YPGA 4BFIB 2C34A 3KL3A 1IFGA 3HS8A 1Y6NR 1JL8A 1U4FA 4R96A 3NP4A 1FNEB 4CC4C 1RJZB 4RMSA 4G3YL 3RWHB 5HYJE 2XTJD 3ZT6A 4I7ZC 3SQBA 2BVYA 4MJ5A 2ZUSA 1IAKA 2VNCA 4PM1A 4JE4B 3NCEB 3QG7H 4JM2C 1SGKA 2YUZA 4TQIA 2XQBH 4R7DA 4LCYA 1NIDA 4CC1A 2CHZA 1T7ZA 2AEPL 2FT8A 2WVVA 2WXQA 2EXYC 2IDFA 3RA7H 3RB7A 5L6YH 3MLUL 5E2TH 1KBVA 1K4CA 2WXMA 2NSMA 3ECWA 1NGPH 4PV9B 5KVDE 1HAWA 1Q94B 3EYVB 4QTHA 3QG7L 4PJ9D 5AVXB 5C0CD 5TFSL 4U2ZA 2C3GA 3WKYA 1B4JL 3TJHD 2LTQC 4YO0B 1TEYA 4YL4A 1FSKC 2BCKA 4WFED 4UQ3B 1BZ7A 4WFFD 1SHXA 3G9AB 3WIIL 3ESVF 4YSAA 3JYBA 1WQVT 4HK3J 4GQPH 4J28A 1FIGL 4YSOA 5AL0A 1O9VA 4YSQA 1MFAL 1AR1D 1IV8A 1Z3GH 2YPLA 3D08A 4NQVA 3UJTH 3RY6C 4M7ZC 2A6KB 5IHLB 3UC2A 2H9GB 1B2YA 2F2HA 3IJHA 2PR9A 2DW5A 3I2CH 3Q3GA 4L1DA 5ESVB 4WHTA 2GI7A 3BHBB 1Y0LB 1ZT1A 4OGAD 3W38A 2QHRH 3K6NA 5GHWL 3ZLQC 1MI5A 4OFVA 1X5GA 3ILQD 2JQAA 3A67H 2CA4A 3L9BA 2C4XA 2KHAA 3O45A 3Q8BA 4ZK8A 3PWNB 4OLZH 5CILH 5F0PB 4RBPH 1JXGA 3FSWA 1TQCB 2B2XL 2XWXA 3EDJA 4PJ9A 5C0CA 3VYOA 4XNYH 3RWEA 4D9RE 5HHVH 4U3XA 1YEJL 4PSRA 3B7RL 2YUWA 2GYSA 5DA4A 5KANI 5BZWA 3K1DA 2R4RH 5AVWB 3SJVE 2PWHA 4E9LA 3N44F 2QKSA 4MX7B 5FYLE 3MMEA 4YXKH 2Q7YB 2JIXA 3FOMA 1I1CA 1PZCA 2BZDA 1AZVA 2ESVA 4ONHA 4P59H 4ODTH 3H42L 4R3SA 1F56A 1OCZB 1P69B 1OARH 1IAKB 4V1DE 3QZPA 5DJZA 2BSTB 3ZN6A 2NSQA 3HZKB 1NCIA 3MZGB 2HVJB 3LXBA 3MAWA 3EAKA 4F58L 5J1AB 5JHDD 4XPHL 2L8AA 7PCYA 2NNCA 5CZKA 3VM5A 3P4OA 2ICCA 3VXUB 2NX5E 1OM3L 3GKWL 4HSAC 3LKPA 3LX9A 3IDYB 4IDJH 5E8OA 3NZ8A 3ALXA 1B90A 1SJEA 1C5BH 4LPCA 4ELME 1C9SA 4KK6D 4G7YH 1VHPA 1HKLL 1S5IH 2KQMA 1VESA 2KC0A 3IDYC 5DMJB 3QEQA 1BPLB 4WF7A 1TG8A 1IVTA 1YNLH 5CIPH 3AQYA 5AVQB 5IEKB 5J6GB 1WWCA 4G9DA 2X4RB 4OLVH 1VGKA 4DNLA 3DOHA 3O4LA 4UZUA 1LP9B 4HOZA 1E9QB 5HJGA 2DLTA 4QO1B 3M1CA 2RFXA 1T7WA 1INQB 3FBQA 3W9EB 1RJYA 2G0LA 1TTAA 3GM8A 1NFKA 5E0FA 5J11B 1G9NH 4N8CH 3OLIA 4P9HL 4PTTA 3FHQA 1ZANL 5C07B 2I7OA 1SHWA 1JZ4A 1P4BH 1ZLEA 4G6FB 2OFQA 3UROR 1N9PA 4G8FA 4GS7C 2Q2LA 4LKXA 1MFDL 5IMKA 2VLME 5K93A 1RZJH 2X4SB 2WKGA 2E7LA 5A2BA 2PYFB 3DO4A 3KBEA 3NEOA 4OUOA 5I6OA 1P5VB 2R2CA 4JY4A 3EFOB 3DX3A 1V3JA 3QYMA 1FAIH 5AVSB 5DMIH 4MZRA 4FLRA 4ZQTA 5GS1B 3QORC 4ZAKC 4P5TB 3T77B 4JO1H 3T4AA 3SKJL 4CMHB 1NEUA 5AW4B 4GQ9L 3AS1A 3MVSA 5CILL 1E5BA 1TYEB 2HKHL 3CFTA 3QI9D 4M9PA 3QEGH 4NUGL 2EDHA 1PLBA 1IGMH 1KN2L 2XWCA 5KYUA 4IKJA 1FZJA 1KDJA 2AV1A 4PCKA 2HVJA 4XNYL 4YE4L 2UY7B 4QHLA 3WNNA 1HHIB 4GP8B 1N2RA 1CIUA 3UIYA 1Y6KR 3RYMA 2EE3A 2G75A 5HGBB 3RL1A 4CVZA 4WNJA 5ID1B 2WQUA 3JT2A 1D5BB 4KFZC 1JZ5A 3A0OA 4M5TA 1KIRB 1ZTMA 1TMCB 1UXMA 5GGSY 1A7PH 5GRUL 2NY3B 3HZYB 4DP2X 3KYOA 3S37L 1WT5C 4JFPB 3BSHA 4L8DB 3MCLL 5IW6B 5FYJD 4P3DB 3CFDB 2YPLE 4LPTA 1SQMA 1P4LA 4HWBL 1XMWA 4DUVA 4MBRA 3LQAH 3QORA 5I1LA 4ABQA 4AEFA 1DTUA 5I17B 1CN4A 1JV2B 4LDCA 3DETC 3U9UB 4PRHB 3TA3A 4BFNA 2IPUK 2DWEB 2CUAA 4TPRH 5T3XH 3CLWA 1R5VA 2I24N 4MAYB 1YHPA 2X0WA 2V3EA 5KW9L 3CU7A 5IB5A 3JV5A 1RLWA 3QDJB 4ACPA 3MRRA 4OZHE 3VMOA 2Y24A 5DLLA 4UUJB 1DQQA 1LEKA 5J11C 4QHUA 2DJSA 5DRWA 2EE2A 2EEDA 1GAFL 4OBSA 3I74A 3REVB 3FCTA 3BGFB 4GW4A 4JKPH 4FNSA 4XPBH 3BKMH 4KQ0A 2NT1A 3OMNB 4JJ5B 4JMNA 3FB6B 3MNZA 3S5YA 4Z5RB 1T04A 4K9EL 2XG5A 4N1HB 4WI0A 1CGTA 1ZDQA 3AS2A 3EYSH 3LN4A 2YQBA 3IFLH 3O41A 3OJDA 4NRZA 5CIPA 4O5LH 4MASA 3W56A 1A7PL 4U1JA 5AKSA 4JZNA 5GRUH 1KENH 4MJ6B 4KK5D 4JL2A 3GMLA 1KYAA 4MNQA 2Y7QB 4KKBD 3WSQH 4FXGA 1AGBA 4Y4KD 3QRGH 2NTSP 4Q14A 2OSLB 7PAZA 2PF6A 1AGEB 4XBMA 4ZO8A 4N8VB 4NLAA 3ZZLA 3K4DA 4MCMA 5GS0C 1CE1L 1EGJA 3IDIB 4PBWD 3H2QA 4ZAKB 1QABA 1DUYA 1EEYB 1VRSA 2ADGA 3LKSA 3U0WL 1HQ4B 1CIDA 3QBTB 5EN3A 5KSVB 3VXMB 4MMZA 2MH4A 3P77A 1HQRB 3JTBA 3T0VA 2P49B 4D0DB 3CU1A 4PJFB 1LMKA 4MB3A 1UJ3C 1PX8A 2NY5L 1XIWA 3B9VA 1OKEA 4FXLA 4WHCA 4XAWH 1U95A 5CO1A 2WQWA 2A74C 5KAQG 1YY8B 1W8EA 4KHXL 4MNHA 2HAZA 1G9HA 2UZIH 2DMKA 3G5YA 3GK8H 3JBG7 4GI8A 1A9EB 1TETL 2WLNA 2Q0ZX 3T6XA 2ZT9C 3VXTB 3MBED 5CJBA 1L9PA 3O4LD 1CU4L 2NX5B 4NBYB 1OGAB 2GBVA 4WK2B 3FSOA 3HRZA 1U8NA 1GTFA 3V0VB 1RUQH 3PABA 8FABB 2R83A 3LDBB 4JPIB 2OYPA 3TGXA 3STLA 4M43L 2CM6A 2WXOA 4H40A 2O93L 2WSPA 2QSCH 4FNTA 4OZ4A 1FO0H 4P2RB 3KS0H 3ZDXF 2BX5A 4PGBB 3LEYL 4PW3A 1EIBA 3KWWB 3U6XA 4X5WB 1WRFA 5TF1L 2BHZA 3PWUB 1RJLB 3BP6B 4GG8A 4YE0A 5KYXA 1JK9A 1AXTL 1QA9A 2P5EE 3SKMA 3HS0C 4BUGA 5I1HH 1VCBC 5HYSB 3BRFA 3CN4A 4EBQL 1DBJH 4LFHD 4PJXF 3GXDA 4WKXA 4U3SA 4X2UA 1SDYA 2YARA 4DKFL 4A2DA 5IROC 3BQUA 4NQDA 1OSZB 4N2IA 5D7IA 1AKJB 1RZ7H 4HUNB 4Z0BL 3CD4A 4PJHF 3VWKA 5J13C 2OR7A 3N06B 2B4CL 3P2DA 2X6CA 3LPOA 2DLEA 2N7BA 1KPUB 1DVFC 1IEHA 5FA4B 4CUCA 1FL3A 1AGBB 1CK0L 3FQTB 5L6YL 4B60A 3OQRA 4P23C 3NSCA 3QRFM 2IDSA 1KGUA 2QPEB 3BVWA 3GD1C 3QJSB 3QQ3A 4WO4B 4BKLB 1ZJAA 5FUOH 1TIUA 2NUPB 3V4UL 3FUHA 2W5PA 2NY2B 2AAVA 4HS6B 2NY2D 4YHKH 2CLVB 3RDTC 4HUUA 5I30H 4GO6B 5DEFB 3VXRD 3ARYA 3QJHB 2EKSA 3U36B 4NN7C 2V37A 1R19A 1BFVL 3OX8A 5FK9B 4YX2L 4OGXL 3Q05A 2XZCL 3MLRL 1FG9C 3F12A 4I48A 1UXSA 4JQIA 3LTVA 5JPNB 3CX2A 3QFGA 5FYKE 2XKNA 4OD1L 3T2LA 2AQRA 4CC4A 3GHBL 3TBBA 3GBEA 1O7VA 1CFBA 2FGWH 3BKYH 2OZ4A 3BD3A 5IW3A 5MEOB 1IM9B 3B5HA 1S7XB 1DLHA 1R17A 5AYUL 1SHSA 2CDGB 3V6OC 4FADA 1B3JA 1OGPA 1T0PB 3WV0A 3MLWL 2Y6SC 3VXSB 4AC2A 2FJUB 3RWGA 3GEWB 3D4CA 3ORJA 1KGXA 4PRIE 3RWIB 2HWZH 4BK5A 1I1FA 2A9ML 1ID5I 1YAIA 5BJTA 3CZEA 5ETUA 3ZE2F 2JJSA 4UTAA 3GXTA 1JOIA 1U8IA 4Y2DA 3FB5A 1RUAL 2V3DA 3K91A 1NIAA 3ZIMA 2ITCB 3MBWB 3TV8A 4PJ5B 1EAPB 1O6VA 1CTOA 3D2UA 5CZXD 3LQMA 1MVUB 3ZTNH 4KQ4H 5FO9B 4L5FL 3ILEA 4GW5A 2CIKA 2PR4H 4LU5H 3HZVB 5C0RH 4FNLL 5B1AB 3KYMB 2OSYA 2F7OA 3P02A 1S3RA 3HZMB 5FO7A 3NOIA 2ZUQB 1RURL 3CDCA 4W9GC 4MAZA 4G43B 1BQLH 4CILA 3LB6D 3II2A 1JV5B 3MYJB 2ZCHL 4K0OA 4KRNA 4AYEC 3QIBC 3WFEL 4Z7WF 2QR0B 3BQUC 2V0AA 3RZCA 3F7YB 1U8HB 4WW2F 1KXHA 2A6KA 4HZAA 2Y6TE 1P84J 3DK0A 4ODHL 3AUWB 2O61A 2QKIA 1QI3A 1ZPLA 3T5WA 4AWJC 4H13C 3S8GB 4W9FC 3H1ZA 1P4UA 3PJLA 2ZCHH 3JWNE 4D0CB 1S78D 4R84A 5D2LB 4PY8J 4NKIL 4BUQA 2V2WB 2AJUH 3NQIA 5DJAB 2PPAA 4MJIE 3ES6A 1J0ZA 4HIXH 4E9WA 1DEDA 1E5ZA 4FABH 4N0YL 4GKNA 4PG2A 3BMVA 3RUGB 5BRZE 5EFIA 3MV7A 3Q01A 3V4PA 3G7TA 3REWA 3I6LE 4YHPB 3RDJA 2PR4L 3CXHJ 4XI5C 1DL7H 4OJYA 3PJSB 4Y1AB 1R33A 4MJID 3PP4L 4QRPA 4IRJA 1JPST 5J3HC 4C4UA 4R4BA 3LEVL 3UABA 4F58H 5F3HB 2YMOA 2IANA 3BGAA 2IC2A 3WNOA 3DUUA 4FQIH 3V4PL 4F8OA 3O6ML 1U2YA 4Z76B 1KACB 4HEMA 1ND0A 4UM9D 2IGFL 3DIVA 2W9LA 2JCCB 2O5XL 4QHKI 4I9WD 1AXSB 1G7PA 2ADIB 3A4DA 5C2UB 1JPFA 3CG8A 2YD9A 3D2TA 3LVEA 1U21A 3HI5L 2B9BA 1NDGA 4PHXA 1DBBH 3L3JB 1Z5LB 5FOJA 3RX8A 5CKAA 5ALCL 1E90A 2C7UB 1HS6A 4TUOA 3GBDA 5CCKL 2P46B 1JGVL 4DQOH 3MQIA 5I76A 4CVXA 4AKOA 4Y5YA 1SXZA 3FU0A 4G71B 5L88H 1UEYA 5CJ5A 1A7OL 3LZQA 3KGRA 3F00A 1I8IA 4XNZB 1LO5B 4UBDD 1T0OA 4DCQA 4DGIL 3QCTL 3K80A 4YXLL 3V4VB 4ZOEA 1NMCB 2Y5TA 3MCG1 3MYJA 5GGQH 5FV2A 1J9CT 3MXWL 2WZPA 3SDAC 5L2KD 4KY2A 4ELMA 2AK4D 2JJTA 3BH9B 1J0HA 3MRKA 2VQ1A 3FN0H 3V6BR 1DYZA 4TQHA 2X09A 5E23A 4DPBX 3O6FC 2IEPA 1YNTB 2H1LM 2ZKWA 2Z31B 4CAGA 1ZSDB 4OI8A 4OQTA 4YHLL 1T22B 4GBXD 1E50A 1JFHA 3L4VA 1NDMB 2IMNA 2MCG1 2H4EA 5AOMA 2LGNA 1O7DC 2X87A 4P5TD 2CNYA 4U6XA 5IM7B 5HYSG 1BD2D 3OR7A 3U7YL 5DJ6B 1DN0A 1T1YB 1R1CA 1T5XA 4OY9A 1R0AH 2B20A 3NIFF 1J5OL 1Q4NX 3FCSB 1VKXA 4N4YB 2P8PB 5GSRB 2D3JA 3MNWA 3ML9A 4NQEE 3BAXA 1E4HA 1GJIA 3L5XL 4OZGE 5E4AA 4NEHB 1HI6B 3HI6L 1Y0LA 4L8SC 5AAWC 3THMH 4QKXB 1S7VA 2Y2WA 4PJDA 3ZKSD 2P45B 3MLZL 3PWJB 3ZVVA 3ULVH 5J1SC 3CPLB 3LV3A 3GSQB 5TJWK 2YXFA 5B8CB 1SBBA 1SFHA 2AI0H 4K5MA 5FUCC 4NO0D 5T3XD 4PJCE 2HYMA 2P1YA 1OP3K 4N6RA 4A6YL 2GCYA 1B6DA 1FH2A 1N5AB 2YFNA 1C1EH 1GZPB 1DZBA 4Z7WA 3QIBD 2H6OA 3FK3A 4BGDA 3DVIA 3TO4B 2OKMA 3H3KA 3U7AA 1EO8H 2OMNA 4R97B 5AUMA 4BCXA 3TEUA 3E38A 3GYRA 3JTTA 1IQWL 3UTTB 3SE3C 5HHOE 2VDQH 5GRJH 1KIUB 2BSRA 3H3BC 4H1LA 1BEXA 3HC3L 4PP2B 3R19A 1CFTB 3D34A 3SD2A 3US0A 3HC0B 3AWGA 2PXYD 1E8XA 1V27A 3BVNA 3QUML 2GK0A 3IMBA 3HN5A 3RX5A 4KKZA 5ADPL 3LAFA 4JDEB 5D96B 2J73A 3BESR 1ZIAA 1LGVA 1HAUA 1AIZA 1R24B 4QTHB 1ES0B 4LEOB 3INOA 4PI0A 1U58A 5KSBA 1VF5C 2F5BL 3EUUA 5INCA 5C9JA 4KXZI 3HC3H 1R3HA 6FABH 5IVOA 2JKRM 4JRYA 4PREB 4R83A 3BGMA 3JSSA 3G6JA 4TN9A 1QSEA 3KNBB 3HVNA 3ZDWA 1E6JH 4BSVA 1TJGH 4K5OA 3O2WH 2EE9A 3WNLA 4OD2A 2XN1A 1FPTL 2Q8BH 4EZLA 4HJ0C 2OAAA 2JSFA 4ZDHB 1KBKA 4P46D 3VFVB 1SVBA 1W16A 4F20A 1DJHA 2XWDA 3FULA 4M8VA 3LZFH 1OAQH 4L23A 2YIHA 3FB8B 3ZHNA 4IKLA 4D0BB 4JFUA 2YMTA 5TDNB 1FAKT 3CSGA 1M1XA 2OZ4H 3CCHA 5D7LD 3SKNA 4DJMA 3PDDA 3MZTA 4N8PA 3LKQB 5D7JA 4ZMXA 2Q86B 5D2NC 3K5RA 2ZXEB 1M2VA 4JVWA 2JKLA 3NRQA 3QPXL 4XN2A 3D69B 4HSCX 5K9OB 3ULAB 3G5VA 5D4HA 3TN0A 4PCYA 3ZRFC 1EEYA 2ADGB 2A7BA 3C6SA 3LKSB 2O6PA 4IS6A 2VIRB 4Y16D 2RFXB 4UV7H 4QXWA 1PSKH 3ARGB 3BEWA 4NCDA 2XZQL 4ZZKA 1IMHC 4O51B 1P7BA 4QRRB 4A1RA 4OBRA 3JWDL 2HRHA 4P4KB 2R23B 3V7MA 3DSNB 1AE6H 4E41B 4HU8A 1WCQA 5LVEA 1U95B 2YO3A 3B5TA 2VDRL 3ME0A 5FLUA 4Y2OB 4UINH 4JY5H 5EO9B 3QHTC 1L9RA 2A77H 4FF9A 1JZGA 4H0HB 3S35H 4M1GL 1VZHA 5LBSH 3RB5A 1DCEA 1Q90A 4S0HA 3T0AA 3UBGA 2MHAB 5M7QA 4E5XA 1MJ7L 1XGPA 1KXTA 4FLQA 2CR6A 4XN4A 5F7HA 1CJYA 4DFHA 5E4EB 4LPVA 4JVPA 4Y5XA 5EBWA 4S2SB 4UNIA 5D5ME 5GS1C 5IFHH 1X5LA 2BOLA 2EE6A 1FI8C 2FEEL 3VVWA 4FEMA 2AXGB 3D06A 5I1JL 1ECZA 4O00A 2WXLA 3BEVB 3TT1H 1I4FA 3CN2A 3ZKMD 1YDPB 3ARFC 3VXQA 1DQLL 4E0RA 3U36A 1H3PH 3TLRA 1IL1A 2MCMA 2QFRA 1LK3H 1PKOA 2GJRA 3L5WA 4RVBA 4YHML 3RNQA 1ZMYA 4IQHA 5FKPB 3N04A 2V5SA 1RMFH 3IDXL 4B41A 1DFBH 2YSTA 1OPGH 3DC0A 2EUXA 3MRLA 3U1PA 5JMRA 3MRNB 2XQYG 1DLHB 5LDUA 4N5EC 1Q0YL 3MLTB 1AHKA 5CJQL 4CSZA 1Q72L 1F00I 1ZWIA 1K5WA 1T7YA 2X1PA 4XP4H 3C9NB 1RJZA 1KV3A 1L3NA 1TZIB 2CRZA 1T4WA 5J13B 1M3IA 1MIML 1NKOA 3N41F 3CVHB 4ZXBB 5FW7A 3QORB 5E8NA 3VUAA 5FR3A 1YEEH 1CQYA 2WLZA 4X4ME 4XCEA 3BW9B 2AGJL 3LMJL 1VERA 3WTYA 4LP4A 1ZS8A 5F88A 3RTQA 5IF0A 4N2AA 1AS7A 3H54A 1YSOA 1J8RA 2J55A 4UT9L 2J88L 3QNYB 1JZIA 2Y06H 4S1QH 3T8XA 3T2PA 4DAGH 5A2CA 3V4LA 3N3EA 1L3WA 5EO9A 4B9CA 4IOSA 1GYVA 3MR9A 2E7BA 3MLVL 3TWCL 1CBVH 2G75B 4FE9A 2AS5M 5ACZA 4OM0H 3D8MA 1HHKB 3CHXA 3GIZH 3AUVA 3ZUNC 1WV7T 4NNXB 4LKCA 2D4DA 2NY4B 1JHTB 5FFLA 1OHZA 1P4IH 4JFSA 4KGJA 4L9DA 2QSTA 1PQZB 1HWWA 1MJJB 4JFPA 4GSDH 5I1DA 3D4YA 4LBAA 2DJMA 1E27B 2CRMA 1PL3A 4K07A 1G7IB 1FBIH 3S8WA 4J2XA 1HVXA 5I1LB 4KMTH 1X5ZA 4ZS6C 4U0RC 1JDCA 1JWUA 2F53E 3W81A 1QSEE 3LRLA 4I3GA 4MZ2A 1BZOA 2BFGA 4JFXB 2CK0L 1U3HD 1R6VA 5DFTA 2HN7B 4PWGA 2D7TL 2VAJA 5IB4B 1XGTA 1VFUA 1ZIBA 4NZ8A 2P8LA 1ACYH 4AXWB 4FI6A 4HZ1A 1TCRA 4RNRB 3VI3F 2Y2TA 3HNTH 3VO0A 3WLWC 4MJ2A 5D71H 1I3GH 1XB8A 3BKJL 3QCUH 3WLBA 2VDOL 3O8XD 4P46C 4KPHH 2GT9A 2JCWA 4NN5C 4OZFH 5DR5H 4DOHB 2G2RA 2ODIA 2W1NA 4I3RH 4ZS6D 1CTNA 5ICZB 2AKRB