1WFJA

C2 domain-containing protein from putative elicitor-responsive gene
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
136
structure length
136
Chain Sequence
b'GSSGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVALSFKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative elicitor-responsive gene
publication title C2 domain-containing protein from putative elicitor-responsive gene
rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 12
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfjA01
4FHKA 2UZPA 3IM1A 4FLHA 4QAMB 2WXLA 4EZLA 4OVUA 2QZ5A 2B3RA 3QR1A 3KWTA 1E8XA 1E8ZA 3CSFA 5CCHE 3R7RA 5JHBA 3F04A 5KJ7E 3TL5A 3PREA 4IHBA 4KITB 2WXNA 4WWOA 2KI6A 2WXIA 4WAFA 1YRKA 4TV3A 3LJ3A 2WXOA 4FULA 1BYNA 2Z0UA 5T8IA 1E8WA 2YRBA 5EDSA 4Y1TA 4URKA 2NSQA 3PRZA 3IBEA 3NSJA 4FADA 2N1TE 4L2YA 4PS7A 4F92B 4ANVA 3NZUA 1UGKA 1E8YA 4NS0A 3L4CA 4WEEA 3F05A 4OVVA 2CHXA 3TJPA 3PYCA 1E7VA 2JQZA 2Q0ZX 3RDJA 3T8MA 1DSYA 3FDWA 2WXQA 4JPSA 4LT7A 4IQHA 2WXKA 4G11A 5G55A 3MJWA 1QASA 4MJJA 3ML9A 1DJWA 2K45A 4F93B 2ENQA 2ZKMX 3GPEA 2ENJA 2Y3AA 1HE8A 4FJYA 2DMHA 4ANXA 2CM5A 3DBSA 1BCIA 2YOAA 4KZCA 1BDYA 3TWYA 1DJXA 4FA6A 4J6IA 1UOWA 3L16A 2R83A 1DJHA 2QZQA 3SD5A 4NPJA 4L23A 4BFRA 1E7UA 2K3HA 2FJUB 2NQ3A 3QJZA 2NCEA 3L17A 4LDCA 3QAQA 3W57A 3QARA 4WWNA 2WXGA 2DMGA 2LHAA 3FBKA 4ANUA 2A4ZA 3APDA 1W16A 1WFMA 4L1BA 3APCA 1DJYA 4EZJA 2CJSA 2K4AA 5CCGE 4GB9A 4ICWA 1RH8A 4PS3A 4FJZA 4LCVA 3JZYA 4DK5A 3CSTA 4GNKB 3L54A 3HIZA 3F00A 2RD0A 1QATA 1DQVA 2WXFA 3B7YA 4ANWA 5JHAA 3HHMA 3P2BA 3APFA 4NPKA 4XX5A 4Y1SA 3DPDA 2ENPA 1RSYA 3HN8A 1UOVA 2CJTA 3OAWA 4XZ4A 4HLEA 2CHZA 3QR0A 3M7FB 4TS6A 4QJ5B 4ICXA 2A5UA 4QJ3B 3R7QA 1CJYA 4NP9A 5H4ZA 4V11A 4F1SA 4L1LA 2BWQA 4KZ0A 3S2AA 2Q3XA 1K5WA 4FHJA 3ZIMA 2EP6A 2CHWA 3L08A 3W56A 3ENEA 4EZKA 4F91B 3F01A 1GMIA 4PS8A 2WXPA 3PS6A 4TUUA 1WFJA 1DJZA 3L9BA 1TJMA 2WXHA 4WWPA 3KWUA 3ZVVA 1DJGA 2CHDA 3ZW3A 4HVBA 2D8KA 4XE0A 5CCJA 2X38A 4DNLA 1TJXA 4AJWA 3OHMB 4AOFA 1V27A 4BGDA 3RPBA 1DJIA 3L13A 4A55A 2CM6A 3N5AA 5G2NA 1E90A 1W15A 2WXJA 4QJ4B 2V4LA 5H4YA 1RLWA 2WXMA 2K8MA 3ML8A 3QK0A 2ISDA 3PFQA 1A25A 2FK9A 2WXRA 3NZSA
chains in the Genus database with same CATH superfamily
1X7SA 5KW9H 4JRXB 2Q1EA 2O6PA 2BC4A 2LFEA 1TO4A 3V0AC 4Z7NE 3ZUNC 5JHLH 4ZMLA 2WXIA 3ARVA 2ADYA 2AV1A 4F37K 2YUVA 4N0FA 2HKAA 4PWKA 1NIDA 3RNKB 2EYTB 4ZS6C 3VD5A 4XP1L 1OHZA 4EPSA 1TTRA 3AREB 1PIGA 1EIBA 5DQDL 5T1LB 5IJBC 3BJLA 4TQPA 4KK6D 4Y16B 2AJVH 5TH2B 2VXSH 5DJZB 4DK6A 2Y5TA 4NM8L 4RETB 5MEQB 4XNUL 2XN2A 4KHTH 3AMLA 3RTQB 3FCTA 4J3TA 1KFAL 5I1DB 2NQCA 4G8EB 4DH2A 4WHTA 1XL4A 1CICD 1KIQA 2UZIH 5GZND 1UB5B 3ZYIA 2FB4H 3NZHH 3K2UH 5B22A 1U3JA 3V0VA 1PZCA 3ULUH 2VLKE 4GI6A 2FTAA 2NY5C 4WHDA 4ONGL 1ZANH 3CJJA 1IO4C 1I8MA 2HN7A 1WF5A 2GSIA 4OGQC 1OM3L 5J89A 5J1TC 3L3JB 5FFGA 1OCZB 4YVNA 3RIFF 1JXKA 4IMLB 1WAAA 1WIPA 2XA8H 2F61A 4OFYD 3L3GA 3L3OA 5I30L 2ZG2A 4E9VA 3PV6A 3BDYL 1J12A 4OD3L 4PUBL 5HDLA 1P7QA 5TGBB 3EO1B 2IDFA 3SKJL 2RCSH 1PU0A 5FK9B 1QFWI 1D5XB 1IEBB 2WTOA 3JYCA 3OR6A 4FFWD 3CSTA 4CUCA 1HXYA 1UH3A 4TL4A 1L9OA 1LO4L 4CN6A 4HIJB 1I8LA 3UAJD 3C8HA 1DBBL 1RV6X 1KV3A 3RKDC 3RU8L 2IANE 3WIIH 3FF8A 1G7IA 3QR0A 5DWUL 4JZJB 1KT2B 4FXLA 5ACZA 4HG4J 4XCNA 4TSAL 3GIVB 1TZGH 2Y23A 1DN2A 5I6NA 3EO9H 3Q06A 2XWBB 5HHOA 1R3KB 2CLVA 3UTSB 4PJ5A 5DYOA 3FZUC 4NX0A 3AACA 4CGUB 1F4AA 3ME0A 5LWYL 2MOVA 3FYEB 5DLLA 3FQ2A 1FGVL 1OCWH 2P5WA 2UX7A 2AW2A 4M6AA 4R9HA 4CKVX 3OKNA 5DQ9B 4JBSA 4EI5B 3QUYC 1QFWH 4CVZB 3ULVE 2YKLH 2VR4A 3J8F7 2AJZB 1CYXA 3RGBA 1E4WH 2XV0A 1E2VA 1KSRA 3LS5H 3U0TA 3NCYS 4WIQA 1T5WB 4XMKH 5GGSB 1CFTB 1EFQA 3FTUA 1KYOJ 3DGGB 5BW7A 2Z9TA 5EIIA 2UWEB 1A3RH 4M4RA 5FCUL 5IQ9B 1VESA 1IIIA 2OYMA 2X9XA 4P2OA 4RZCB 2OJ1A 3S37L 3O4OB 3F04A 2ICCA 5EOCL 3UADA 2NR6A 4TVUA 4KZDH 3LEYL 1UADC 2J5LB 4JDZB 3OF6A 5IB3A 1OT1A 1DEEA 3BUPA 5AAMA 3HPJB 4ZT1A 4N2IA 4FERA 5I0VA 2ZSWB 3HC3L 3CSBA 1NDMB 1U92B 2WBXA 2NX5B 1FDLL 2GSGB 2MQGA 3ARXA 3GBDA 3IMVA 4XCYB 2VIRB 3L3IB 3ZL4H 3U2JA 2HRPH 3EUDA 4KKAD 4GQ9L 3SE3A 3K1DA 1U8NA 4U6TA 3WBDA 2CHXA 1GSMA 3LDBB 3LPWA 3SGJC 1GC1L 3AU1A 2MOGA 4R4ND 4C54A 2FJFB 2AQ3A 1NGXB 3KPPA 2ZD0A 3WLWC 4G9DA 4A2HA 2PO6D 3S5LG 5HVHC 5I0XA 1P84K 2Y24A 3GSRA 1FVEA 5F89B 3W0WD 3PL6B 1XGQB 3KZ8A 1H5BB 3RDTB 3LVTA 3MOQA 4N2KA 5G5DB 4AC4A 2MHAB 2Y36L 5J7CC 3AB0C 4DEWA 5IR1B 4Y9EA 4K7PX 3JWOC 4XMVA 2H45A 3TWYA 2OS7A 2Y6SC 3ZT6A 5IHUL 3QNYA 2ZKXA 4CVXA 2ZXCA 4FN0A 3W3BA 3C2AH 3TTSA 3BLPX 3O2VL 2NZ9C 1G6VK 2XN1A 3PGCB 4O02H 1X6LA 3TFKC 5JIDA 3B7UX 1I1AB 1OM9A 3LCYA 1KCVL 2FLBT 3QG7H 1SM3H 3EGDA 3LIZH 3N50A 1EZVX 4ZDHA 2DD8L 2EEFA 4WI0B 2K78A 3QEUA 5EPMB 2NY5H 5GS0D 5ITBL 3OX8A 3LEVL 3MAWA 4JFZL 5E2TL 1TCRB 3V9FA 2X09A 2E7BA 3AQZA 1M3JA 3GSNL 3DV4B 5KSUB 4M8QB 2F54D 4PJ9B 1MW3A 1THCA 3WIHA 3MGAA 2BH0A 1I85A 3VX1A 4ZMWA 2Q10A 4PVLA 4A37A 1A47A 4W9IC 3SDDD 5C1MB 4JCMA 5F7NC 3P3TA 5JZ7D 3RL2B 3E3QC 4M7KH 1CXHA 3I6KB 4GKNB 5JTWA 1NEZA 2WXHA 1OP5H 4ZMZA 4YO0A 3GD1C 2VZUA 5EEZA 1T89A 1MVUA 3GSVA 4E9XA 1NDTA 1NCAL 1DBJL 4WJKB 3OPZL 2YPLE 4FG0A 3IYLW 4QXGH 2M26A 3I9IA 1E4KC 4PRAA 4TVSa 2VAAA 4HC1A 4AWJC 1QSZA 1QRKA 2AK4B 2OP4L 2IQAA 3B34A 2IMNA 3MRHB 4KV5E 1FLRL 1J5OH 2XXGA 5JHDD 3CVDA 1ROCA 2ZUUA 4FNRA 4OF0A 2Q6WA 4D0CA 4M5TA 1EO8L 1QZ1A 4QHLA 1BM3L 4MNQA 1GXEA 4PRPB 4MMZC 4FFTA 1A1OA 2HTKC 1ZSDA 2K0RA 3NSJA 1AIZA 1K4DB 5T1KD 2BW4A 3IKKA 5L8JB 2GG1A 2IG2L 3D2UD 5E9AA 3O0RH 4HIEA 3P4NB 4K94L 4OM1H 4Y2DD 3RNKA 3ZDYB 4ZI8A 1T1ZB 2EYTA 5BXFA 1BQHB 4XE5B 3AREA 1J9SA 3B8YA 1SXBA 1NFAA 4LVHC 4Y16A 3Q6FA 3UYRL 5TH2A 2PTTB 2XX1A 3KVQA 3P2TA 2WLNA 5IHZA 2J3SA 4LOEA 5MEQA 5JXED 4FQLL 4Z7VF 1KXVC 4JO3H 3AWEA 1F4HA 4XPBL 1G5AA 4W70A 5I1DA 1VSCA 3BPCB 5AKRA 4G8EA 3UAAA 3BPLB 2IPUG 4I9WE 5D4HA 4BFFA 4U1SB 5FYKH 3GC3A 1NMCC 2D4DA 3ARUA 4K3GA 3P9WB 1J1PL 2P8PA 1IM9A 3FFDB 1S78C 1TVHB 1L6PA 2WBJC 4RSVA 1FL5B 1SHSA 3CVCA 1DQQB 4NENA 3TOPA 1AD0B 2ARWA 1KN2H 3L3JA 2UVEA 4EZJA 5F9JB 2QHRL 4MS6A 1KLGB 1D5ZA 3BZ4A 4IMLA 4FJZA 3BQUC 5HHVH 2BOBA 5DJ0B 1JL8A 3QJXA 1CGSL 3GRWA 5TPWL 1ZLDA 4LSRL 5TGBA 1JGIA 4DF9A 5ICXB 2VC2L 4WCYL 2GB2A 5FK9A 1D5XA 1IEBA 4KFZC 2ZUWA 1XIWC 1NC2B 3T6VA 1IFHL 3B6SB 5T3XH 2DQJL 3WUWA 1VB9A 2FBJH 3HNVL 4J3OF 4XNQB 5L4MA 4PLKD 4JZJA 1KT2A 1U2HA 3O2DH 4P4KB 5CILH 3WE1A 4MCYB 1Q0XH 3GIVA 4R0LB 5L2JB 4KX8A 3V4PH 3DOIA 1R3KA 5B4MD 4GP4B 3UTSA 4Y1AE 1CURA 1JN6B 1U6AL 6CGTA 2C1PA 3ML8A 4PB9H 2HVKA 5I74C 2IAMC 4Q14A 4WKZB 4EI5A 3WHE0 1LJMA 2QZ5A 1WITA 2HAZA 4UB0H 2HVJA 4BELD 4XXCA 3UH8A 4CMHC 2AJZA 5DEZA 3L95B 3ZRSA 1TTFA 2UX6A 1X9LA 3TYFB 4XO3A 2NCMA 1EGJA 4KKNA 2H0EA 5GGSA 4ZMQA 1XSIA 1RUQH 3DGGA 1GGBL 5IQ9A 2UWEA 5GRYA 4JVUA 4AGQA 1RPKA 3GI9H 4AIEA 4WW2C 4R8WL 3A5VA 3FAXA 4PP1D 1FNSL 4JFEE 1A4JA 5DC0A 3DO4A 4JDZA 1P4BH 4F7CA 3DO7B 3FB7A 5EA0L 3HPJA 3ZSTA 4GG6A 2H4EA 3S8FB 1IGFH 1TJHH 4HXAH 2JELH 2ZSWA 1KXQE 3DUUB 4POZC 4ZO9A 2B59A 5F7FA 2DEXX 1I3GH 2NX5A 2GSGA 2SEBB 3N85H 4JPIB 4XCYA 4XVJL 2VIRA 3TEXA 4Z7WB 3ARDA 3L3IA 5IESH 2WLHA 1IBDA 4MNHB 1XBRA 4HEPG 4WFED 2ZYIA 2Q7YB 1FO0B 5EWIL 1AI1L 2FJFA 1SFHA 1NGXA 4AYSA 4R4FH 1E50A 2H6UA 3RVUC 3VSTA 1GGUA 4JM2A 2V2TB 4HK3N 5F89A 2FECI 1DBML 2FE0A 4XHJC 1A7NH 1R3JB 3QWNA 4ZUWB 2NY1C 3MCLL 1XGQA 5IY5B 2BSRA 4BQCA 2RTTA 3KYOB 2CR0A 3TCXA 2WUCL 5G5DA 1B0RB 4GAGL 4JPWL 5I1EH 4MAYC 4NKMB 3ZE2E 5IR1A 3SDXE 1ODUA 3GPSA 3LHPH 4DGUA 2R69H 4TPRL 1JPSH 1PX4A 4L4TB 1T5KA 1VDGA 3B7YA 3PGCA 4Y19A 3TTYA 1PZAA 4GP8B 5GZOA 4D0DA 1SDDB 2XYBA 2R23B 2W80C 1QG3A 1VF5C 4G1EB 4WI0A 1CU4H 5DXWA 5LO7A 4C56E 5BRQA 4W4OA 1J0YA 2XXFA 4CSTA 1YEJL 3OZ9H 2VLLA 3QDGA 3ZIMA 1E4XL 4E9WA 4F24A 1TCRA 1A3QA 1B90A 3AT0A 3I75A 5H94B 4HT1L 5DD5H 1HH6B 4KX7A 2Q8AH 4M8QA 2NY6D 4PJ9A 1AHMA 5DYFA 1JF1B 2O6EA 2X38A 4Y2NA 4ZMYA 3WTXA 3INUH 5AW5B 4QT5B 3V6ZB 1XT5A 3SD2A 2EH7H 1WT5C 4LEBA 5EOQH 4ATTA 2CBPA 5D7JB 2DLTA 5H4YA 1MUJB 1HSAB 2JI1A 3I6KA 4GKNA 3O0LA 5JR1H 4FHKA 1KBBA 2UZYB 1Q72H 1YQVL 1PD0A 3WO4C 5K1NA 4YDNA 4MHHI 2XY1A 1QI3A 4IOFC 5DRZB 5K59F 1R0AL 2J44A 3HNTH 2KI6A 4PG9B 1NLDL 2WXOA 4N0UB 3P3UA 4GW5B 4JQVC 2FD6H 3O9WD 3C6LC 2AK4A 2WK2A 2BVPB 3IPFA 3MRHA 1LP9B 4CVWA 3HG0A 5D2NA 4G8GD 4ORZC 4GW4B 3I6LE 3LPPA 4F37F 1J8RA 1B2YA 5C09D 3MLRL 4N90D 2UYLB 1HE7A 4QKXB 2WZ5A 3PCYA 4PJFE 4YZWA 4DGIL 4DKAA 4PRPA 4P8QA 4S1SL 3F58L 3Q6GL 1J11A 3IJEA 1F3DJ 1QRNB 4UYPA 1K4DA 3NCFB 1Z9MA 2PWEA 3IETB 4GMSH 1WGVA 3BW9A 4TQ8A 4AVKA 2G4EA 4ZUUB 2BWIA 4KUZL 1BVLB 3RAJL 2PP7A 3P4NA 4NXSA 4OCWH 2B14A 4OJYA 3K8MA 1FO0H 2C7FA 1BQHA 2YAQA 1HQ4B 2DJ4A 4H7VA 4OGXL 4GG8A 2W92A 3RZCB 3MYJB 1RZ7L 1F6AB 3TP4A 3VFSB 3CDZB 1TEGA 1J10A 4N24A 2EH8H 4R7LA 1MH5B 3UTQB 3QIBC 3U1SL 1WICA 4PREB 1JGDB 2FATL 3B7TA 4TM9A 5G4NA 4MQXD 1YCSA 4U1SA 4YE4L 3U4KA 4NO2B 4UV7L 1V7MH 4FQIL 5D1XC 4V1DB 4NCDA 2WD0A 3KPTA 5IZ7A 2QR0A 3FFDA 3PGFH 5FYKU 4KMLB 1TVHA 1H3PL 3HC0B 5FYJL 3CFKB 5JHAA 1DEDA 2APVA 3BFQG 1WYJA 2AJSH 4YAQB 5J13B 1AD0A 2KLTA 2DQTH 4W9LC 1QTSA 4QJ5B 4ICXA 3MJ9H 5F9JA 1KLGA 4L1TA 5KVMC 4KTEL 5CJQL 3MO1B 2A77H 2GC4C 4OZGF 3OJVC 5DJ0A 1CB4A 1OALA 1XGPB 3HE6D 4J3XA 2X6UA 3O4LA 1MW1A 4G7YH 5FM5O 5BO1L 4AZ8B 5CBAB 3FYIB 1BFSA 4WWPA 3QIWB 3SHSA 5KS9B 3LNDA 3GXUB 4LSQL 3QCUH 3FQXA 4R3SA 4RFNC 1MAML 3HBQA 2VO8A 3VWJC 1EDHA 2WXJA 4HCIA 2VMCA 3FOMB 1L0XA 4ODSH 4XNQA 4A04A 1TQBB 2DY2A 1FIGL 1FZKB 1N3NB 4P4KA 3G6JB 4MCYA 4R0LA 5L2JA 3WXWL 6PCYA 4OY9A 5E1GA 3PUCA 2ZF9A 1JN6A 1AVAA 3UPRB 5J5EA 2BHZA 4GRWB 4K3EL 3S35L 4F9LA 2E7DA 1N70A 2W9EL 5IMMA 4YLQT 2OXHB 1W72A 2CXKA 2J25A 3WFBH 1UJ3B 5C0FA 3KLDA 3CFQA 4CILA 4ZQKB 3TYFA 3BEWB 3TF4A 2O5XL 1AGDA 4JFOB 4PD4J 3GT6A 4HF5L 1TYJA 4OSUH 5DD0H 3MOBL 3H3BC 4CN1A 3RILA 5T3ZE 1MCPL 5D8JL 1YLBB 3MOAH 4I3SH 3VFWB 4O58L 2X1PA 1WP6A 5EOCJ 3D18B 3L1GA 1N64H 1QFHA 1N19A 1K2DB 3FUDA 4JO2H 1KLFB 3DUUA 2YGNA 3EYVA 4LSVL 4XPTH 4H8QA 4JPIA 4NNPH 2RQ8A 1IQWH 1MCWM 3LMJH 4UQ2B 2CG9X 4Z7WA 2GITB 4YBHA 4PCYA 4MNHA 1IJNA 2Q7YA 3T6WA 1Z3RA 2MCG1 3OKLA 1GYWA 4QMEA 3CFJB 5H2BB 1BVKA 2G2NA 3FBKA 4YFLI 4XWOC 1GCYA 2HKFL 2PW2B 5FLVA 4HDIA 3JWDC 2B7DT 4OBRA 2YD7A 7PAZA 4ZUWA 4NQTA 4QRTB 4NI6A 4L18A 4GJTB 3EUUA 4IHOB 5DD6B 3H9SD 5DUPH 1PSKL 1B0RA 5A2LH 1TZAA 4LCUB 4NKIL 5EUOF 4AIXA 5B3JF 4NKMA 1S7WB 2MCAA 2CJTA 4HK0B 1ZRUA 4MD5B 3TO4D 4FABH 4Z77A 3GXIA 3QE5A 3HLKA 1INDH 3SBQA 1RZKC 3D5OF 4Y5XB 5I1AB 1BD2B 4P3CL 4L4TA 3RY5A 2A1WL 4BWTA 5IGXH 3BWUC 3BIBX 1SDDA 1ETA1 5GS2H 2CE6A 2Q8BH 2R23A 3FU5A 3SE4A 3LTVA 1U3HD 3QUMH 4G1EA 4DP1X 1S9VB 3TA3D 4Q4EA 5B8CC 15C8L 4ZD3H 5AB0A 4YSCA 4PBVC 4WUUE 3ZO0A 4JRYE 5GGTH 4NQCE 4PJHB 5JOPD 2CUAA 3QK0A 1BVOA 1HH6A 1A25A 1QEXA 3T0EA 1I9IL 2UZPA 5ICZB 4L0YA 1K3ZA 4PJDF 1JF1A 3LKSB 4XAKD 1JHTB 2ZONA 1OAYH 2HP4A 4XBGA 4GSQA 1EZLA 3N1PC 4QT5A 5E4AA 3V6ZA 3A3YB 3D08A 2XKSA 3WAJA 5DJ2B 2H0PA 2VUOA 2BFVL 2Y06H 3CH1A 5K9QI 4YFDB 3LQZB 3QPXH 4MKMA 5ESVB 4AEIH 1X7QA 4DW2H 1S46A 5DRZA 1I7RB 1AGEB 4X7FC 3SO3B 5C97A 2XT1B 4PG9A 2BZDA 4OGYH 1S7VB 4I48B 5AOZA 1TQVA 4I3RL 4N0UA 1E6OL 4ZAKC 4Z7QF 1F3JA 1QLRA 4M3JA 2BVPA 5E51A 4PYHA 4F7MB 1HNGA 4LT7A 2W65B 3MJ8A 1LP9A 4DGYL 3EO0A 2BY1A 4JO4L 4GW4A 4IIQA 3ZKMD 2OFQA 3N0AA 4LCCB 4JFYA 4DKFL 1UXSB 2DI8A 4MRCA 1QRNA 4UTAH 4X80L 5DRWB 4IBWA 3MXVL 4Y0GA 4WWKD 1X5LA 3UP1A 3KH3A 2XTJC 3R1GL 1FHNA 1O5PA 1KENL 1I3VA 3BYTA 2WN3A 3ULSB 2WSKA 1WGOA 2ZE0A 3PWVA 5DUBA 5TK4A 1RPUA 3QIUD 2IFFH 1NUFA 2EDEA 4WV1C 4ABQA 5I8OH 3MYJA 2ICEB 3C5ZD 2PR4L 1NFIA 5DMIH 5B7FA 1T21B 2Z1PA 2DMBA 1MH5A 4JDTL 1I9RL 2PMZA 4FQXC 1B6DA 1JGDA 4NC0B 4PREA 1SQ2N 2D7TL 1PAMA 3GBLA 4A6YL 1MVFA 2E56A 5J11B 2I85A 2VDQB 5KSAD 2V8MA 4JFFB 4TOYH 2XI9A 1TOXA 2BZCA 1Y07A 4QRRD 1KCUH 4R26H 2R2HB 1JTTA 3JWDH 3HC0A 1IC7H 2YN3A 3HG1D 3E9UA 4K71B 1MEXL 3OAZK 2XU9A 4YHLH 2MTAA 3BHBB 4ZK8A 4OCRH 3HMXA 2Z7YA 4JO1L 5CR1A 5DU7A 2ZYHA 3KYNB 1NCDL 1I7TB 4P46B 4PWGA 4P5MB 3WV0A 1RZKH 3L13A 4HV8B 3CUPB 3S2CA 1XGPA 2QVMA 3HI5H 3IF1A 1ZS8B 4JFDB 4EOWL 1YEEH 1LEIA 3HMWH 3LX9A 3QO0B 4AZ8A 2BS71 4UM9D 2AEPH 4Y4HD 4N0RA 2Z7ZA 3D1MC 4XVUD 5CCHE 4QRPA 4KITB 5JPNB 5E08H 3EDJA 3FOMA 3QHFH 2H8PB 4O9HL 3V52H 1FZKA 1N3NA 1UM5H 1NAMH 2X9YA 3G6JA 2B0SL 3HVDA 5KVEH 4URKA 1PEZA 1RLBA 3BOVA 2IPKB 1NCCH 2X4QB 3CIAA 4U2ZA 2DYPD 3P1VA 1N68A 3HE7B 4PRIB 4ZX3A 1QEWB 4IJTA 3UPRA 1VPOH 2FR4B 5HI3D 2BP5M 3L5XH 3WXVH 3MUZ1 2RGSA 4B27A 3QEGL 4GG6F 4ONFH 5AVZB 1KCRH 2JNZA 1V7NH 3O6MH 3TPUB 4RMVA 2OXHA 2H47C 2YWYA 1HXKA 1UJ3A 2EIEA 4NZUH 1WZMA 3W9DA 2J6EA 4UAOC 5D7SL 4ZQKA 3BEWA 4MS8C 5FUCC 1GHFL 2XWJA 5FKPB 5C0RL 4IOIB 1OF0A 5CIPB 2AEQH 2DQHL 4G9FD 4MD0B 4XC1H 1A5FL 4JM2F 4UT9H 1COBA 3SZKC 3A21A 3VI3F 3O3AA 4MA8H 2YSSB 3VFWA 5I15L 1YDPB 3PG2A 1XGTB 4X50A 2ITDA 5EO1B 3VE0B 1M7IB 2Y7QA 1J5DA 2DKUA 1K2DA 4NBZB 4YHKH 1XF5A 2C9QA 2UZXB 1CLYL 3FUKA 3P77B 4O4YL 5A2CA 1KLFA 4BFGA 3RPIB 5GGVH 3W0WE 3PDOB 1S9XB 5DLMH 4LBAA 4KOBA 4MJID 2GTWB 2O5NA 4IRJC 2GITA 5C0IB 3LV3A 5FYJD 5CZXD 1RH8A 4JE4B 1MWAL 3VRLE 4LPYA 3BAEH 5HI4D 3CFJA 2BSSB 5H2BA 4E5XG 4ZSOB 2X0WA 3E1F1 5EZJB 4AYDC 1FFPB 2VDQH 1SFDA 2DJUA 5JIIA 2A5UA 2VMEA 4QRTA 2H26B 3F6LA 3H1ZA 2F7IA 3Q8CA 5DD6A 1A8ZA 1NWPA 5FUZL 5K9JL 2DQFB 1MDTA 1XMWA 1BLNB 2YBRB 4LCUA 3CU7A 1KPVA 4NWUH 3T0AA 4OFIA 4MD5A 3HZ3A 2BIOA 3WIHL 5I1AA 3U36A 1BD2A 4AIOA 1L9TA 1UA6H 2QVTA 5ACMA 3P0YL 3FSAA 1JGVL 1U58A 3WYRA 1A6ZA 1RUAH 4Z0BH 2OI9B 1KYAA 1PNCA 4OQTA 4TQEH 2F54E 4N2OA 3ZU8A 2NDFA 3BX7C 2GABA 5D7HA 5PCYA 4CDGC 4PP2B 1S9VA 1JF6A 3VA2C 3HNSL 1N12A 3D9AH 5HY9B 2J5WA 3MCKB 4X6DF 5A7BA 4HC1L 1X5XA 4BK8A 4WO4A 4UBDD 4TLSA 5GXBB 2C9SA 5HGDB 4M7LT 5ICZA 2P9RA 3LKSA 4RCAA 5I0DA 1JHTA 4MNGB 4JGUA 3WELA 2NTSP 2F8OA 2N1TE 2XVGA 5TF1H 1WAPA 5T33H 1KJMB 3HN5A 3WJJA 4BQ6A 1Z3GH 3PE9A 5DJ2A 3KG5A 4Y4FB 3R0MA 1R5WB 3MBWB 3LQZA 5ESVA 3K2IA 5JHDE 1M7UA 3RDJA 4LGRB 2EC9T 5HYEA 2F7RA 2OMUB 2Y3NA 4AQEA 2GBTA 3IKCB 4G6FB 1I7RA 5DK0B 1AO7A 1L7TH 1WEJL 4U1GC 4I48A 3QFJB 4NJAH 3MRFB 3WKYA 5I75B 2GEQA 3RUGF 1CYGA 1U8PB 2ATKB 4LVNC 4DN3H 2IBZY 5CIPH 5F7DA 4DQOL 1PIFA 4F7MA 1KGJA 4HSAC 2W65A 5EFIB 2CALA 3FMGH 5DFTA 5HJ3B 2A9MH 1NCIA 2CGZA 4YC2B 1JD9A 2F7QA 4NJ9H 4F15B 1LO5B 9CGTA 1GYUA 3WTWA 2WQWA 4HGKC 2FH6A 5D2LF 1OT2A 3V10A 1JERA 5CBEB 4TL5A 5DQJB 1SY6H 4N2GA 1UXSA 3GK8H 3C8DA 2KZBA 2QQLL 2ZPKH 3HB3C 1AD9B 3L1EA 5CCKH 1LO3L 3QJTB 4B9ZA 1BSIA 1OP4A 1N5YL 2PYEB 3B9KA 2MKLC 2E7LA 3AQXA 2NY0B 2HJKB 3DJSA 3AWFA 1S7SB 3ZRCC 3KPRD 3BESR 2ED7A 4BSVB 2ICEA 3F5WB 2X10A 3JZ7A 3QRLA 2ZOOA 1A7QL 3ILEA 4KRPC 3KW7A 2FEDD 2YPKB 4ZFZB 3D39D 2JB6B 1L3WA 1WZAA 4K55A 1A4KB 1D6VH 2XV3A 3DVGB 5DRNA 1BF2A 2FJHB 5J1AB 4X8GA 2EO9A 2R2HA 4EUPG 3MYZA 3RWCB 5I6LA 3DX8B 3T3PB 1MFDL 3ECQA 4J4PD 5BPPA 1U30A 3OHXB 3POHA 4QTFA 1KXHA 2JIXA 3BHBA 3OZKA 1MCJA 4AGMA 2V5SA 3GI8L 4XVTL 2VL4A 5LN8A 1ETB1 2YUWA 3T77A 5TE4H 3KYNA 2BRQA 4P46A 4P5MA 2C3GA 2CBMA 2PP9A 3CUPA 4JFDA 4OFKA 1ZS8A 3POCA 1HCFX 3O41B 3GBEA 4KJWD 4TV3A 5E2VH 3LJ3A 5KOMC 3RWJB 4F2FA 4PW3A 1I3UA 2CO2A 1OGAB 1FG9C 3QO0A 2JKSA 2X28A 4ETQB 4UV4L 4JMNA 4H0IA 1KMGA 3ZE0B 4JJ5B 1VACB 1B4JH 4FNTA 3ZTJH 1TT6A 5DZPA 1QKZH 2PPAA 5JPNA 5GS1A 3LN5B 3M46A 4PU2A 2H8PA 2YS4A 4HBCH 1K4CB 4JLRB 1IGJB 1P1ZB 2HTLD 1BLIA 5EBWA 4HMCA 2LV4A 4S10A 3FDWA 2IPKA 4RBPH 3CZFB 2X4QA 3JTTA 4EIBA 1BJ1J 2B4CC 4QF1A 1D7CA 1RZJL 2YWZA 5G55A 3HE7A 4PRIA 1QASA 2FR4A 3CLFL 3TCLB 3KWVA 1PY0A 4DO5A 5KZCD 3U4EB 3BLKA 4RMSA 2J7LA 3PHOB 1MHHA 2C4FT 1OAKH 1XF2B 1Y0LA 4KY1H 3DMMC 2EZ0D 3QPQD 5KYNA 12E8H 5GJTH 3JUYA 1TTUA 4ELMF 2QZQA 1N6QH 5FKPA 2EEBA 1RK0B 2I60L 2YD8A 2VDOL 5IW1B 1YYCA 3UCRA 1KBGH 4WFEE 4KHXH 2ZT9C 3DRQB 2YSSA 3DX2A 5IJVB 4YHYB 1YDPA 3PABB 4O00A 3VWKC 3ILDA 1P7QD 5EO1A 1M7IA 1WD8A 3DSNB 3GB7A 2X05A 2CBQA 2WXFA 1TITA 2B1AL 2UZXA 3P77A 1T2XA 3RPIA 3PDOA 4AQOA 1S9XA 2YBGA 2C26A 1UYWH 3AVEA 5B38G 2MPVA 2ZXBA 1GS7A 4XWGH 4BSWB 3MLYH 5C0IA 2VLKB 3QWOB 5IBUG 3OSKA 5GGRY 4NLHA 1HYSD 5DR5L 4BSJA 4MB3A 1H8LA 4GKZB 1DP0A 2BSSA 1JYNA 1KZYA 2OR8A 5HHOD 1FSKC 2R0ZH 3ZDZE 4ZSOA 3W11D 1EXUA 5EZJA 2ZX6A 1FFPA 4W1TA 4PJ5D 2KKQA 1YO4A 4PRHA 3ABMB 1B4TA 1H3WM 2CGRL 4XN8A 4U0RB 1O6VA 2P5WD 1FYTA 1RMFL 1IKOP 2IDTA 2DQFA 2VN5A 3D07A 4LLYB 2YBRA 4KZEH 3GBML 1N5AB 4FXGB 4W9JC 2EE3A 3IB4A 3TVMC 5IQNA 4DQAA 5GS3A 1QR1B 1WBZA 2IDCA 4NZJA 3X3GH 1KDJA 2XSKA 1E8XA 2IANB 1JE6A 5JDJA 4IEFB 4PY7B 3QAZC 4UNIA 1WUZA 2PTUA 4P3DB 2QELA 1TETL 1QLEB 3G6DH 1NIBA 4P2OD 3IDIA 1BW8A 1DVFC 1HIML 3RKPA 3UAEA 3OC8A 5DEGB 2F7OA 4LSSL 4C4BA 2NR6D 2JCCE 4PP2A 3QR2A 1JYWA 3CDYA 4IRSD 4EDWH 3IBEA 3P02A 3OF6D 3Q1SL 5HY9A 3GXFA 1VFUA 1DHKA 1GMEA 2OPCA 2SODB 3MCKA 3ZKXB 3WKMH 5HYSG 3H6JA 3PHSA 2ARJB 5HGDA 3ZPDA 4DEPB 1MAJA 3ZZQA 4R2GC 2IPTL 3WD5L 4RGOH 2P8MB 4MNGA 4Y4KC 1HKLL 2QQNL 4LKXB 1UM4L 5D70H 1KJMA 4K5PA 3MJ6A 1IAKB 1R5WA 1G0DA 3NFNB 5EBLB 1JFQL 1GY2A 4W9HC 4FEMA 3EOAB 4EI0A 3FONB 2JWYA 4Y9CA 3GTTA 4G8GE 2OMUA 3CPLB 3T0VA 5DK0A 3OJDA 5C09E 4N90E 2A99A 4JKMA 3QFJA 3SE6A 3MRFA 1U8PA 2ATKA 4BZ1L 2E9IA 1ERNA 4OGZA 1PQZA 4JDVA 4FNUA 2BFGA 4WQOA 5EFIA 1EVTC 3GYRA 3M1BB 5DD1L 5L8LB 1LO5A 4FI7A 2OA9A 5E95B 1H6FA 3GGWB 1AKJB 1EEYB 2XV6B 2YQ3A 1ECZA 2EKJA 5DQJA 3SCMA 2A6IA 1LWRA 2R0WH 1PVHA 2VW6A 3NOIA 4G72B 4FYTA 4HZLB 1AQMA 1BOGA 2GKIA 3STZB 3G9VA 5SWZA 3EJSA 2DQCL 4ZPVB 1JHKH 5BUAA 1AD9A 1G1YA 4PR5B 1JJUA 1UD3A 5IJKA 4L3EB 5C0AB 2HJKA 4W9KC 4YHMH 2BSEA 3W82A 3UL4A 1FN4B 4X0KB 1Q90A 4HALA 3SYPA 2Q2EB 4HU8A 4BSVA 2VSCA 3BP4B 2WY3B 3F5WA 2CRMA 4PJCB 3ZW3A 3TPKA 3PWNA 5AW3B 2UXTA 4PRDB 3EDKA 4XE0A 1ITBB 3OMNB 3FUNA 1YEIL 5D7KD 3IFNL 3FU7B 2YPKA 2YD9A 4ZFZA 5L9DH 2JB6A 4FXKC 5BV7H 1E90A 4KOCA 3DVGA 3ARSA 1LD9B 1TIUA 2HZHA 2FJHA 3CD4A 3F7YB 2BVQB 4U49A 5J1AA 5FWQA 1T6VN 5M7QA 1NICA 1IAIM 1ACYH 3RWCA 3DX0A 4X98A 5ALBH 5IW6A 5F72S 3GMMB 2WXNA 3A6CH 4LBEB 4Z8FH 2CRZA 2HH0H 5F7BA 2YHGA 5CM1A 4X5XA 4OGAC 2X2JA 1D9KB 1Q8MA 2OKMA 4TNVK 4C83B 1AACA 2D7MA 4DN4H 5CN2A 3VGGA 5ADOH 3BKCL 3UJIH 1I3RA 4KK5C 5DHDA 5T1MB 1AP2B 4HUVB 2FEJA 4MDRA 1BFVL 1YMMB 5D1ZC 43C9A 1BQKA 4JRXD 5E8PA 2K70A 4K9JA 1O9ZA 3O41A 3UJJH 1UWFA 2P8LB 3RWJA 3TZVA 4KI1A 5DEFB 5CAYB 1G1KA 1OGAA 1NINA 2OSLA 3ULVH 3QS3A 2DWDA 3G08B 5T1DH 1W72L 3IFLL 5D9SB 4F57H 3WNOA 4JJ5A 1VACA 1S9YB 1QA9A 3FCSA 4NZFA 4NZTL 3ARED 5EHFA 1P6AB 2H1PH 5DO2C 3LN5A 4Y16D 3VI4F 3TM6A 5IMLB 1KYFA 1K4CA 2CO4A 4JLRA 2QVKA 1P1ZA 5DJXB 1FH2A 4JFUA 4BK5A 4K3DH 2ZXAA 4EKXA 3MLSL 1Q9KB 2EE6A 3UTPD 2LW3A 1RP8A 1ICTA 3DK0A 3FF7A 1USQA 4FFZH 3ABKB 1JUFA 1KB5H 4H2AA 1IAIL 1XR9B 4L23A 2A73B 1OHQA 2KUTA 1DQLL 1NIEA 2TRHA 5IVXB 1RHFA 3X3FL 1IM9D 3V5KA 5LBVA 2ID5A 2HUEA 3JV6B 3CQQA 5ID1B 1U8CB 4NOFA 3KM2A 4GBXB 3S7GA 3NJJA 3QUYB 4Z7UF 4OI9A 3UP6A 4MXQC 4X4ME 1PZUB 3F00A 4TN9A 1BFTA 3CXDH 3QFDA 1RK0A 2IADA 1QI4A 3BGFB 3KDMA 1KN4H 3L81A 3FQWB 2XQYG 1BX2B 1YNTA 3VXRB 4Z7OE 2YA0A 1OZTG 4PS4H 5JHLA 1CQYA 4JG1H 2R2BB 4GLRI 4G82A 5JORA 3WMQA 5IQMA 4X7SL 3H8NA 4XPGL 1IL1A 2D9CA 1YQ2A 3Q48A 4WU5B 1P84J 4PJGB 2WP3T 2LU3A 4P59H 1TJMA 4NUMA 3QWOA 2V37A 2WBWB 3HLAB 3TF7C 2HYMA 3WS3B 4GKZA 1E3XA 3QCVH 4F1ZA 1RXLA 1L7IH 2QTVA 2GJ6B 3GHEL 5HGBB 5LVEA 5JQHC 1HHHB 3X1FA 1RZ8A 4Z0XB 1RIUL 3UTSD 1MJ7L 1KCSL 4KH2A 3UOAB 1JK8B 3K1KC 4HKJB 4M7JL 1OTTC 4PJ8C 3ZYOA 1AR2A 4AYBA 2VLRA 3S3SA 1UEYA 3OQRA 4LLYA 5KJ7E 3PREA 1N5AA 4GLRH 4PGJA 4EI5D 3AITA 4DSYA 5AQ0A 1XGUB 3MNVB 3FHAA 4KVCL 5H37G 2WTRB 5JOPE 4PVBA 3MZGB 1CZ8L 4H8VA 3VFGH 4X2UA 3L2NA 4XODA 5ESAB 4AL8L 1UGKA 4XAKE 1XDTT 4L1DA 1RUKH 1QSEB 4QWWD 1I8UA 2ADFL 5DRXB 1FZOA 1YNLH 2BERA 5L6YH 3RFZA 3OLIA 3V6OE 4IQHA 4XMTA 2Y4SA 5DSCB 2NY2C 3N9GH 4F8TA 5JW5B 3NACH 2CJUH 3ESNA 4ZZKA 1OD9A 2NX5D 3ARDD 5INDB 2R8SL 4O5LH 5SX5H 3VFTB 4NYLB 3FT0A 5AKSA 2EC9U 4KU1A 2WOYA 1CD1B 1SDAB 1BQLH 2YO3A 3CC5B 3KL0A 4HS6B 4Q52A 4I0PA 2Q86B 2QPSA 1NKOA 1PFCA 1IRAY 4LKXA 5I16B 1OV8A 5EN2A 1JP5A 4X9GA 5TTRA 4JM2D 1C7SA 3D8MA 3NFNA 4W9DC 5EBLA 4LAQL 1TQTA 3NFSL 1F90L 3EOAA 3L17A 2HRLA 1SPDA 3FONA 4JM0A 3MV9B 1C5BL 1U8KA 2N0KA 3CMOH 3CPLA 3QC5X 2DWTA 4XCCL 3T0XA 3V4VB 3C5JB 4LPVA 1RUMH 4JR9H 3Q3GB 3F12A 4ZUSA 2P24A 4M5YH 4Q56A 4LCVA 4MJ5B 3ALPA 1DL7H 1MN4A 3WJLA 1MCDA 1UB6B 2VDNB 3BVWA 3GQFA 4J6RL 3TN0C 3UTTA 5CLZA 1R47A 1U3NA 4BUHA 1TYRA 1XH3B 3M1BA 4Y19D 4FGMA 2ITEA 1MCNA 1OAZL 5GZOD 1G7MA 3GGWA 3HHSB 1OCCB 4U6YA 4WTXA 1AKJA 1EEYA 3O6LL 4D3CL 3WENA 3EYSH 3ZYJA 3D0VB 5AW6B 4HZLA 3STZA 3QRFM 3UEQA 1R3HA 1YEKH 3QDGD 4ZPVA 5CLYA 2BHYA 1F4WL 1ZXKA 3GMLB 4PR5A 4WY7H 4L3EA 2GUOB 4M02A 5C0AA 1L9RA 3WDJA 4GO6B 3SDXB 5HDWA 4L9DA 2B5IC 4IKJA 2ZWZA 1FN4A 1YEHH 4NQVB 4PJ9D 2DBJA 4QRRE 1M71B 3HMXL 5D4IA 3BP4A 3J7HA 4PJCA 3BUBA 4ZMPA 3D33A 4HEMA 3HG1E 4LVHB 1FH5L 4JZNB 4JCLA 4PRDA 4DP6X 2N4IA 2R0KL 4UMGA 2WSDA 2RHEA 5F3HA 5B21A 3IDUA 1EZUA 1ZVHA 1YNKH 4HIIB 1HNFA 3F7QA 4KPHH 3U30C 3T9WA 25C8L 1LD9A 3F7YA 2VM9A 3QZBA 3GM8A 5C0JB 4BCXA 1YUKB 3WI9A 3FL7A 4HHAB 1GKEA 4NN6C 5F0JB 3CSYB 2BINA 4U6XA 1NMCB 5KYWA 3LKRB 4JKPL 2FEEI 1PG7H 2ADIA 2AK4D 3OJMB 4LBEA 2JJTA 4B9CA 1A0QH 1CLOL 5J06A 3GXMA 2WBJB 4M7ZC 4C83A 2LQRA 3UBFA 3KGSA 1E2WA 3GMOA 1MCCA 4HUVA 3DSFH 4M6NL 4OIIH 5GJSL 2QMJA 3DHMA 5IW3A 1SF5A 1YMMA 2WC7A 4GSRA 4N0CD 4PRPD 3RP1A 1X4ZA 2VL5A 4OD2B 1OP5K 5EF1A 1ND0B 3QJRB 3PXHA 3G08A 5AWNH 5TDOB 4N8VG 3TBVB 1S9YA 2J6EL 1ZTXL 1ZDQA 4WI3A 3S96B 1A1NB 3VMNA 3QZNA 4P2QA 4YFEA 4IBLT 1ADQH 2CO6B 1NDGB 5FW7A 1XIWB 3M17B 4W9FC 3TV8A 2J8UE 3L7FB 4H8PA 4LQ1A 4LDLB 1PX3A 2EIDA 4WWNA 3WS6C 1RCYA 5I1GL 2GIXA 2C4FU 3R19A 4LB8A 4EDXA 4MVBC 1AXSA 1Q9KA 3M6DA 3L6FA 5B1BB 1DE4B 1A8JH 4B97A 2HWZL 1JGLL 4PJFB 1CK0L 1JPTH 3MRKB 3PAZA 3I9PA 1NCOA 1CE6B 2ZOTA 3T4YB 4G9FE 4HWBA 1OKEA 4N4YB 5D5MA 2A73A 5IVXA 1VZHA 3PIQA 2ALAA 4HWEH 2EXWC 4NZRH 4JQIH 1FVDB 3WFDL 2W60A 1WO2A 1W8EA 2E27L 2W9LA 1U8CA 3TH2T 4RAUA 1H6EA 1YUHB 4MDJB 5LQBH 3QUYA 4JRFA 2NNAB 2XPZA 3I2CL 4P06A 4Y5YC 1RQ5A 3U9UB 4FA8A 1OAXL 3T2PA 4MJIE 3QZMA 1BJ8A 4DO4A 1I7ZB 5FYJE 4XTRD 1FFNB 1BX2A 3VXRA 4F8LA 2XZQH 2QPEB 1F4XL 3O11B 4PTUB 4U1JA 2GY7B 2CIKB 1FPTH 5INCB 3LQAC 4OD1H 5GRZA 3O4LD 4IBSA 2R2BA 2BDNL 2AJUH 4IBTA 3E0GA 2DIEA 3WEBA 2H32B 4ALAC 1GH7A 3BVDB 5FM5M 1CFMA 3SGKC 4J2XA 2IEPA 4WU5A 1X5ZA 4PJGA 4AK2A 3GUFA 1GYVA 2CR6A 4HOMA 2F5AL 4W9GC 2BHFA 3GEWB 1DDTA 4HIQA 4OQTL 3K71B 3H2PA 4J3OG 4NCC1 4P4KD 5DS8B 1QSVA 3WS3A 1EUUA 5LAPA 2EECA 4HZAA 2G0KA 5D7IE 3WSQL 2QFRA 1PY9A 2GJ6A 3QORC 5HGBA 1XCWA 1HHHA 4N5EC 2KERA 4Z0XA 2FT6A 2FYYB 4CU8A 1JK8A 4HKJA 4NDMB 3QPKA 4OM0H 4OLWH 2D4FA 4KI5F 3TJEH 2Y2YA 4I87A 2NLJB 3CBKB 1T03L 4JFXB 1HHIB 1XGUA 1JHLL 2WTRA 2HJLB 1CFVH 4ADJA 3VDAA 2C3VB 1KTLA 5ESAA 3GXDA 1KC5L 4APXB 3EAKA 1KEGH 1EEZB 4UYQA 3ATAA 1J86A 1L0PA 1QSEA 3CFEB 1J9RA 3CFCL 4JQXC 3RPKA 1N67A 1UENA 3WEMA 1ILUA 1XB3A 4JO8A 5J9PB 4PJAB 4XCFL 5DUMH 4X8JB 3U46A 1CGTA 3ILPB 3DJ9A 4IDLA 2RQEA 5DSCA 5JW5A 2OMTB 4UZGA 2AK1L 4UT7L 1X5GA 3AC0A 5INDA 4GI8A 1MCLA 4ESKA 1I53A 2WO4A 3JTBA 4NYLA 3UZQA 1S7QB 3VFTA 1CD1A 1NCUA 2Q86A 3N06B 2EDWA 4HS6A 1AZUA 1JV5B 2BZ7A 1TVDA 3IRCA 3FB5B 5A2KH 3S5YA 1XGYL 1BG9A 3L9RB 3BP7B 4QHNB 2ZUQC 1BF8A 2HMID 3PDDA 4GNKB 4J8RB 2YAPA 3G5YB 2CPUA 1BVNP 2OJEB 3ZK0A 2YQ2A 2G30A 2P4AB 3HHMA 3MKKA 1ORSB 3MV9A 1UKTA 3V4VA 3RX7A 1QWHA 4NQXA 3HKZA 4HLEA 1NCWH 5DJ6B 1DSFH 3C5JA 4JFQB 5CR8A 4GI9A 1UWYA 1JYXA 3WO4B 3CQPA 3K46A 1J5IA 4GO9A 1DQML 1RL1A 2I07B 1LDPH 1NIFA 1UB6A 2G2RA 3K6SB 5HI5C 2WYHA 5D93C 2X70B 3U82B 4ZNEA 3FQUB 4L4TD 5A2AA 3F83A 5DD3H 1E4KA 1JZHA 1XH3A 3MRPB 4XO4A 1SJHB 1DJZA 3C6LB 4E9RA 2VR5A 2D8KA 2OR9L 3HHSA 3KPRE 4FG2A 1CI5A 3BIAX 3S4SB 3VGAB 3D0VA 4K9EL 4PRBB 3UPAA 1PYWB 3EBAA 1NJ9B 3LNEA 5FO8A 4MA1B 4MMZA 3IBOA 4XH2B 3D39E 2GUOA 3NAAL 4RNRB 1QHQA 4H8WL 3S97C 2VKWA 3T0ED 4NQVA 3TL5A 1XF4B 4MCZB 1MCBA 4ZOCA 1UZ6E 5E6UB 3V0DA 2NY7H 2P5EB 2WLZA 5FW6A 4EN3C 1MFBH 4JZNA 1YYMH 5F6HJ 1MJ8H 2IDUA 1TVBB 1KXVA 2OULB 5SWSA 4HIIA 2I24N 5BZZA 4FKHA 4TNVF 4HGWB 4P5TC 4JRYB 5IFHL 4PG2C 1MZZA 3HZKA 4HHAA 1MG2C 3CSYA 2WXKA 3FBQA 4I5BB 3LKRA 4Q6IC 1A22B 1QTPA 4LSPH 2VLMD 3JT0A 3IE9A 4NXKA 4M6MH 5HJBA 2IWEA 2WBJA 5EF0A 4MDIB 1QP1A 3LXBA 1MCHA 4XB8A 3RWEB 2VH5H 4JHAH 4ANXA 1EA9C 1QBLH 3HZMB 3BUDA 1ZLVH 3BRDA 1PBYA 2VRKA 1HZKA 5B39B 3BQUA 1WD9A 3MA9H 4DP5X 1QRND 2NY3C 3GHBH 4PWHA 1ZDSA 3GJEB 1ND0A 3GSQB 5CINH 1JZ5A 4HIXH 1FBIL 4R97B 2EVJA 3TBVA 3NCMA 5LJYH 1MCEA 3CZJA 4OLXH 3S96A 1A1NA 1V3KA 2CO6A 1NDGA 1K9TA 1OARH 2NXZD 1XIWA 3M17A 4QRSB 2CBTA 3L7FA 4DVRH 1IEHA 1CICC 4AMXA 4PJEB 1T4WA 3SDCC 1ET7A 3H42H 3MUY1 5T3ZH 5GZNC 1X9QA 3C87A 1YNTF 3L4UA 1UOVA 4RAHA 4F2MB 1H3GA 2FYVA 1QQDA 3MRKA 2Y1YA 1G1OA 3T4YA 3T8VA 1CE6A 1CJYA 4U1MB 5KVGL 1WAAE 4RFEB 5AVUB 5AVVB 2FSEB 4L8DA 3RVTD 3TC9A 5CJOL 2LTQC 4K7PH 3P4MA 1TQSA 3HFMH 5I8KL 1RZQA 3ZL1A 4MDJA 1YUHA 1E28A 4IGBC 5TE7L 1A21A 2X0VA 3RX8A 3BD5A 3WEXA 5FA3B 3U9UA 1J1OH 4P2YA 1HILA 2R4RH 3S98A 1RHHB 1FGNH 1CXEA 3RRQA 5FOBB 1DZ0A 1I7ZA 4ZPTB 1FFNA 2WLLB 1LK2B 4YHPB 4FFWC 5IT2H 3OZLA 2CIKA 1Z9OA 3MMEB 4XP9H 3L3KA 2EIBA 4LQFH 1A14H 5HHOE 4M93C 4BGLA 4WW2A 3ULUF 3UAJC 3U9PL 4DKEH 4F80A 4PJ5E 4FFYH 4OU3A 2H32A 4IHBA 3LVEA 3KGTA 3LKNA 1BXVA 3EJYD 3S36L 4QRPD 2CCWA 4LARL 2OV0A 2P5WE 2ZKWA 3V0HA 2B08A 4LRIC 2G9KA 5KEZA 2X1QA 2K6WA 5IJCC 3HRZC 3PRZA 1NMBH 4UQ3A 3IWUA 3EW3B 3K71A 4TMPA 5DS8A 2VSMB 1NBYB 5EIIG 1MF2L 4XNXH 2ZKHH 4NEHB 5FEBA 2FYYA 2OX5A 4FQJL 1HAUA 4M43L 5ABDE 4NDMA 4KK9D 2XPYA 4MJ4A 2UY6A 1FL3B 2HFGH 2OLDA 5C7XH 4OJFH 2AXWA 2Z31B 3G5ZA 4X6CF 3BFOA 3W2DH 1NFDB 1F6FB 4JFXA 4WNQA 4FZ8H 2M83A 3HUJF 4R90H 1AZBA 1OW0C 1Z5LA 5F44A 2LVEA 1XHHA 3GBNL 5FM8A 2HJLA 5KTEH 3WNNA 3BD4A 1NGZA 2C3VA 2CM5A 3Q5YA 3GO1L 5C6TL 4XMPL 3CSPA 4FLRA 1EEZA 2JLLA 4FKEA 3RJDA 3FRUB 3O8XC 1HOCB 3Q2CA 2XZAL 3CFEA 2XKUA 4V33A 4NKOB 1F18A 5B3NA 3ILPA 3E9TA 3HW7A 4AXWB 4H1LA 1JNNH 2OMTA 2UXFA 3AXLB 4HJUA 5B8CB 1F58L 2EACA 1CN4A 2E6PA 1CS6A 3NQKA 8PAZA 3MBXH 2QDVA 4LDOB 4WJG3 4OB5H 1S3RA 1S7QA 4R7DB 4QEGA 1G9NL 3DYPA 1JV5A 2XRAL 2MNJB 3FB5A 2CNYA 3NDYE 3L9RA 2FVNA 4BKTC 1Z9SB 3BP7A 1RVFL 3WFCL 1X5KA 2Z91B 3EJUA 4J8RA 3O3BB 2L4OA 4F8NA 3LXAA 1WT5A 3B43A 2XWTB 2GFBB 2VUKA 3G5YA 2RIKA 2MTPA 2AI0L 4U1LB 2Z8SA 5JLZB 2XZCH 3GSXB 4NM4H 2PO6B 3F01A 1E6JL 1GMIA 1KGXA 3MV8A 5DJ6A 5IHWA 3J2PA 5CWSB 1NGPL 1P9MA 5EEWA 4DP9X 1A3LH 2DI9A 2I07A 5CKGA 4UTBL 4PJXF 5LBSH 4YL4A 2KYIA 3K6SA 5E6IB 1IGTB 2GPZA 1BD2D 2X70A 1D5RA 1UM6H 1HTYA 5GRJH 3MRPA 4JQVA 4ZAKB 4CC4C 1SJHA 3A4EA 3TEUA 8CGTA 1IC5H 3C6LA 4ZMXA 2G5RA 3GIZL 5GS0C 3E2HB 5HHXH 1KUMA 3QR1A 4N3TA 2W0LA 3S4SA 3ZMEA 4UILL 1NEZG 1PYWA 5IG7B 3ISYA 4E5XB 3PAUA 1EEQA 3IRZA 2X0UA 4X5LA 5D7KE 5BRZA 4XH2A 3EXLA 3Q01A 2OYKA 1NEPA 5JW3H 3OD3A 4RNRA 5EZOH 3SDDC 3R4RA 3H9ZA 1MI5A 2VDPL 2W59A 4WO4D 3QQDB 2APBA 1AH1A 1YEGH 3MUGB 1SMAA 2HG0A 1GGIH 2BO0A 1XF4A 4MCZA 1LE9B 2NTFB 4FMVA 2P5EA 3HHRB 3BWZA 4UT6H 3MLZH 1AXTH 5HJGA 3QEHB 4HSQA 3IVKB 2G3XA 1I8KB 1GZHC 4WV1B 3UO8B 1X5MA 5F88B 1OE3A 3RWHB 1TVBA 4EVNA 3FC8A 2CLRB 2QFPA 2JKLA 2XWEA 3QQ9C 1QFUL 4FFVC 1C16B 2V2XB 3QIBA 2F5BL 3WNLA 1AQDB 4FQXB 2ZUSA 4JG5A 4HGWA 1AO7D 5EC2A 5I6XC 2H3NB 5DT1H 1MJUH 2VDLB 4JRXE 3G9AB 5GISH 1J0KA 5D1XA 4OTXL 4P9HL 5E00B 3CCHA 4I5BA 2RFXB 2XV2A 1DLFH 1OTSC 4A6YA 2FWOA 4MDIA 3MLXL 2AJYH 4I1RA 4UDTB 5SX4I 4HZ1A 2AP2A 4Z7QE 2LHAA 1SXSA 3OBAA 1SJMA 3HZMA 3JWNG 4KX9A 3WIAA 4N68A 3K4DA 5GGTA 2JH2A 4N9GB 4NLAA 3O6KH 5B39A 3ESMA 1RK1B 3JWNE 1EHLH 5D5MF 3UG3A 1F2XK 1NCGA 4OCNC 1D5IH 3GJEA 2DQDH 3PWUA 3UTPE 1LO0L 3V0FA 1C5CL 3B9KD 1TQCC 4GAFB 3E8UL 2X2UA 3EGSB 1U8LA 1KYUA 5GGQH 3VQ2C 2VNCA 5B7EA 3VUAA 3EIFA 3WTYA 2QQKH 1U2CA 4G43B 1N10A 4PJEA 4Q74A 4Y2DB 1FCCA 1A2YB 1XL6A 2GCYB 1CLZH 1SJEA 3ARTA 5JHLL 5SX4H 4F2MA 4KO9A 4XCEB 1L0YA 4KMTH 4HWZB 5I1CH 1CFSA 4FMFA 3L7EB 4U1MA 4DUXA 5EEUA 5AKVA 5ADPL 4RFEA 1GOGA 3MACH 5CJ8A 1WLHA 3RPBA 4ZOAA 5HHMB 3V5DB 5AFAA 3TT3H 2CLZB 2ZG3A 2GC7C 3EJRA 4ZFGL 5C2UB 5C9JB 2IWGA 2ISDA 4APQC 2G2PA 5C8JA 2WCSA 4LEXH 2JIXD 2ITFA 5FA3A 4GQQA 5JIHA 4Q9QH 5IQLA 3WUWG 1D7BA 1RHHA 3IK2A 3APMA 3KNBB 3KEDA 4L9LC 4Q8BA 1WK0A 5FOBA 3ULAB 2VOTA 3CHQA 2WLLA 1A6UH 4P46D 4P2RB 4U33A 3QZLA 3BUYB 4MBOA 4YHPA 4PEEA 3NZHL 4JFDD 4WNSA 3ULUL 3MMEA 5CNHA 3H3KA 5AVSB 2YSTA 2BXZA 2FCBA 5GS0H 3UTSE 3DK2A 2C1OB 2WUBH 2QSVA 4PJBA 5LB1A 2C9XA 5I82A 3CX2A 3ZSSA 1KBKA 4Q9BA 6PAZA 1XCXA 5BQDA 5B4MC 4EUPB 1YSOA 4IRJB 3X14A 2IOOA 3CHOA 4FNPA 4BZ2A 1A9BA 1NBYA 3W39B 5IWLC 1Y18B 4UWQB 2X4RA 5EEYA 5TD4A 3HE7D 1MRDH 4PRID 5I18L 2UWEE 2R29H 1ECYA 3DBSA 4UQDA 2RBLA 2VXQA 2Z31A 5ALCL 1JPEA 2CMRH 1XCQA 5IUSA 4ADIA 1KTCA 2TRYA 4RMBA 2DIBA 2FSDA 4Q9RL 2O72A 1PJ9A 5EORL 4GG6E 3E38A 4KKCC 5C3IA 3UTZA 1YEFL 1UH2A 2NX5E 4ODTH 3IRPX 3AT9A 2CJSA 4UUJB 3X12B 1HCVA 2YEQA 3FRUA 1E43A 1HOCA 2AQPA 2ED9A 2VQ1A 3GSWA 3BP6B 2XVKA 1QFWL 4EBQH 3IS1X 1WUNT 4QDGA 3ZUCA 2YKLL 2X1WL 2CAKA 1ZLSH 4OQ1A 2CQVA 5DJAB 3D09A 2WZ6A 5FR3A 4AXWA 4XMKL 2DEWX 2YARA 4X5WB 5B8CA 1J8KA 4ZMTA 1IJ9A 3KLKA 3C8KA 4U7SA 4HP5A 5KJ4A 2ZP8A 4KZDL 3LKPB 1ZT1A 2ZICA 3F7VB 4HGMA 4R7DA 4YDVB 5BS0B 4XBMA 2NPLX 3PS6A 1UOLA 4Y2LA 4WTZA 1UC6A 1Z9SA 3OAYH 1RZPA 3O3BA 4PRHD 4QOKA 3QWQB 2XWTA 2GFBA 4Y19E 1XD0A 3LKQB 4UOW0 1B0GB 4U1LA 5JLZA 3ZL4L 3DRTB 3UJTH 1FYTD 2JTYA 3B9AA 1TJIH 3FOLA 4M1DH 5CWSA 1RUPH 2WIMA 1UXLA 4ZS7H 4U05A 2D7OA 2W0PA 3KWTA 4BFKA 3QDGE 1S4IA 1ASOA 4WU7B 5TFSH 5I1HH 4M8UA 5E6IA 4YBLC 1SBBA 4EI6B 2QGCA 1PLBA 1RZGA 3APNA 4ZAKA 3IGKA 5B38B 5CD5D 1E8WA 2MJWA 2N1KA 4BFJA 5IBUB 4PVNA 3PHAA 3VQ1C 1HQRB 1BBJA 2FL5A 5TDNB 3VXSB 1JRHL 5IIEB 4P23C 5IG7A 4E5XA 3JBG7 3ABLB 3T4AC 4JFVA 1P5UC 2EINB 4JHWH 4MLSA 4NNYA 4O02L 3HB3B 2OL3H 3T3MB 1URIA 1SM3L 3MUGA 4G5AA 4K4KA 3SQRA 2IMMA 3QUXC 3TH4T 3AROA 2GJZA 2NY5L 1KPRB 3NIFB 5A3IC 3QEHA 1VAHA 5KYUA 3IVKA 3B2UD 1I8KA 4WV1A 4FQ2H 2AK4E 3MNMA 5DJYB 1WBXB 2NY6B 5EC1B 1T66D 2XDHA 3BGMB 2WGNB 4QHUB 1TUPA 4Z7AA 5D2NE 2JCCB 1C16A 1IGML 2V2XA 5DZ9A 2I7SA 4G6FD 1A6TB 2A6DA 4FQXA 1NCBL 4FLQA 2X41A 3DX7A 4OZHB 4HX1B 4PRPE 2XLLA 1VEPA 2NNFA 3QFJD 5E00A 2XN9B 4NUJB 5DS2A 1T1WB 3DDFA 4ZXBC 3RGVB 4GFXA 4A38A 3MXWH 4MSWB 5J6GA 1GYCA 5T5FA 5KYYB 4AUUA 4NHUA 4XP1H 5HYSB 1QATA 4XVSH 5DQDH 4UDTA 3TX4A 1ZWIB 1ZHLA 1XV8A 2R9HD 1BGXL 3SKNA 5DMKB 5SWQB 3DIFB 4TRPH 5AVTB 3SCMD 4XN5A 4JPVL 4HWBL 1LMKA 5KVDE 1KFAH 3IDMB 5SWZD 1RK1A 1BOYA 3TIEB 2PP8A 1QNIA 4MX7A 3TASA 3MDJA 4N8CH 2PYED 5C08B 1WA2X 1J5OL 3UBHA 2NY0D 3WMSA 1FIEA 2V2WA 2HLFD 2BSED 3EGSA 5CP3A 3L9BA 1ACXA 2Z93B 5AB9A 4XN1A 5I0ZA 3IDXH 1R3IH 5BMFH 4G43A 5GHWH 3MRMA 1A65A 1TJGL 4MQXC 4X7EC 4B9KC 4ONGH 2WPGA 2GCYA 2X42A 3BMWA 1QLFB 3PAYA 1OM3H 2CNZA 4LMQE 1VHPA 2X4TA 4OM1L 1IVTA 3I6SA 3STLA 4HOZA 3L7EA 4KTGA 3U9WA 4WW2F 3K4ZA 5LGJB 1RD6A 5E1IA 1KACB 3BDYH 3V5DA 3WN6A 4OD3H 4PUBH 5C0GB 2CLZA 2EEAA 2K7QA 2R27A 3O4LE 5CJBA 3SY0B 4E2OA 4E9LA 3GJFH 5C9JA 3SKJH 5IBLD 3H4HA 3S8GB 2W07B 4EO5A 4GEJA 1DVUA 1AR1C 1IFGA 4MXVF 5DZVA 2YMTA 1PG7W 1BEYH 1LO4H 4G7SB 2BOLA 2JCWA 4FADA 4JRWA 4K8RC 5FYKL 2RJMA 3RU8H 3N41F 1QFPA 1DSWA 2WVVB 3DTUB 4P2RA 3GSNB 3FXIC 1JNLL 5DWUH 2J1WA 4GW1B 4PWFA 2E4TA 2EKSA 5F9WC 1L3NA 1YY9D 3TZVD 2KMWA 1OGAD 1QZNA 4NQEB 4AGNA 2NY4C 3OR7B 1F8TL 3VWKB 2EUXA 2C1OA 1KN2L 3QUKA 1FGVH 3K81A 3D3VB 1LL1A 2YXMA 4L8BB 4N9OB 5LG6A 4Q6KA 1HYRC 3JWOL 4UCFA 5D72H 4UM8B 3C60C 3P73A 3TBTB 2DQMA 4NN7B 5EO9B 4EUPA 4IRJA 5I73B 5CEZD 2QT6A 3ECBB 1QX1A 2JKWA 3RWFB 8FABB 5CGYD 1Y18A 4QCIA 3II2A 3LZLA 2VJXA 3K91A 1DYZA 4JEGB 5TQ2H 1FSKB 3E6HB 5FCUH 5CZRA 2AQSA 3S37H 5T3XL 4UNTA 1VFMA 4H4NA 5EOCH 4ZFOB 3B3BA 2XWZA 5GRVK 1T7XA 3LEYH 4A7VA 3QGVA 5AEAA 1JXGA 4X5RA 1Y1DA 4WDIB 3GZQA 4XOAA 4OFDA 1MKFA 2QPUA 2DN7A 4N22A 4A7GA 3VG9B 3DLQR 3HC3H 2WQAA 3H56A 2HLAB 1T7YA 2L04A 4GQRA 5K9KA 1ZA3A 3B2VL 3DV6B 4Z7WE 5AB2A 4UUJA 4GQ9H 5EF3A 1GTNA 1G4RA 3X12A 2WWKT 5DMGC 5F9OL 3KYMB 2PCFB 3U79A 3BP6A 3QAZB 4DEUA 3F2LA 4MBRA 3V4VL 5C71A 4RBPK 3LNHA 3QJFB 4Q7DA 5DWPA 4C4KT 4EMZA 3MTRA 3QZPA 4PY8I 5DJDB 1CTMA 2VMDA 3VXQB 1UHVA 1Z9PA 4OCSH 4HH9B 2MQ0A 1SYVB 3MGTB 2H7WA 3C6EA 4XNAA 3I02B 4QRAA 3RX9A 4BH7A 1UKQA 3VXOA 4LEEA 2Y36H 3BMVA 4LEOA 3QULB 3F7VA 4HJ1A 1G9EA 2K8MA 5BS0A 4U3XA 2UY7B 4K15A 1P4BL 5F2FA 4R2GB 3VXTB 1NMAH 1IGFL 4KXDA 5BRPA 1TJHL 2B3RA 4I2XA 4L4TE 4LLAA 4B60A 5HDQH 1ZIBA 4TTDC 1I3GL 1UZGA 3LKQA 1KCVH 1GJWA 1B0GA 1HT6A 4IKIA 3HS8A 5IESL 3DRTA 1KELL 3F62A 1T0MB 2VLRD 3FB6A 1JZDC 3K2KA 4C8XA 5EZIH 2YQGA 3TBYB 5ITBH 3ZY7A 1W6WA 3LEVH 4FHBD 5E2TH 3IXAA 2ZZUT 4WU7A 5CLXA 3H9SB 1BAFL 4H26B 5FXCH 2X7LB 2EAEA 4EI6A 1U8IB 4KUCF 1PNDA 2VC2B 2ERJC 3TA3C 3JV0A 3TO4B 3T0EE 4XNZB 2H6OA 3FO9B 2IAAC 4RMQA 1ZK5A 4TULL 4Y5VB 1MNUH 5TDNA 4EXKA 3VXSA 3LHPL 4HMDA 5IIEA 5IQ7L 1OK8A 3KLAA 3KJ4B 3DTXA 1BECA 3P9LB 1JPSL 4LLVB 1F2QA 3G5VA 1U3HB 1WHPA 2F19L 1OLLA 3E80A 2YD1A 3ZLQC 1NCAH 2J8OA 1MFNA 1J7VR 2ADJB 3OPZH 3V6OC 1NBVL 5GGVY 1G7PB 5CLTA 2H5UA 2J1XA 2PF6A 2FECL 4NSKB 1PDKB 4I0PD 3FCUB 1QHPA 2LOEA 4N0UE 4A2LA 2FX7L 5KS9F 5E1HB 3PV7A 3N44F 5DJYA 2OP4H 1BFOB 1WBXA 2R2CA 2VLME 3G04B 7FABH 1UTDA 1ADWA 3N43F 4H25A 1FLRH 4QHUA 1F02I 1LP9E 5DD5L 3TEZA 2WJ7A 1F5WA 1NL0L 4PW9A 1KYDA 1EO8H 2IH3A 1A6TA 1BM3H 1FNAA 3CC1A 2BK8A 4FXKB 2OYPA 3INUL 3MV11 4OZHA 4GAJL 3HZVB 2F1AA 5E4OA 4O51B 4Y1SA 3V9CA 2XN9A 1JNHA 1T1WA 1QRNE 2P47B 5EOQL 3RGVA 3UTTD 3MLTA 4MSWA 1S8DB 5KBPA 2IG2H 3EJJX 5JR1L 5KJRL 5DMJB 5KYYA 4C4UA 1Q72L 3NCCB 2D31B 2H2SC 4CSSA 3GS4A 2BVYA 2AMGA 2VSDA 5DMKA 3HNTL 5SWQA 3DIFA 3T65A 1AKJD 3CVBA 3GXTA 3IJHA 1CFQB 2BP8B 4YWGL 2K3TA 1VFAB 4ODBD 2IQ9L 4N1HB 4LASL 4Z5RB 3SZ6A 4DGVH 5HDOA 3IDMA 1RAMA 4YX2H 4LXFA 4YSAA 3TIEA 4IM8A 5C08A 1SYSB 4JG0L 4FCHA 2DWSA 4L3ED 4WNJA 4G1MB 5C0AD 3VFVB 3KGUA 4OJDH 2FQGA 1MOEA 2GBUA 2Z93A 1J1PH 1MQKH 4ZS6D 2ICWJ 5LNGA 2WINB 4KJPC 4ZYKB 4BQBA 1BWMA 2BNUA 3OAUH 3NFPA 3NIDF 2AEWA 2X3AA 1MPAH 4YUEH 3LZOA 1YRKA 1QLFA 1KY6A 1MHEB 1IT9L 2A4CA 2QHRH 4OCWL 4LPXA 3HG5A 3MRQB 4FLSA 4ZO6A 3C5ZB 2K9UA 4I85A 3QNZB 4K3HA 5LGJA 4QI3A 3KL3A 1IBZA 4LSRH 5C92A 4UQIM 1CDHA 2YD3A 3SY0A 3VFPA 2VC2H 1HK6A 4AQZA 2EH8L 4RIRA 4NAMA 1CG9B 1KCKA 2A3TA 4A63A 1HXMA 2BIHA 4ADGA 4I18C 1B6UA 2AS5M 3DMMA 3UYOD 1IFHH 4QRPE 4Z6AT 3QVAA 2EVHA 2DQJH 1V7ML 3DO3A 3B56A 3HG1B 1CPUA 3NJGA 4AVJA 5AYTA 4IKLA 3GSNA 4H88L 3WY2A 2Y5QA 2AJ3B 1YMMD 3ETBF 3MCG1 4GW1A 1V05A 3G6JE 1H9VA 1PGRB 1Z32X 3C09B 3HEIB 4QGYA 2HG5B 4NQEA 3IMTA 2BLFA 2AJSL 3OR7A 3BZEB 3VWKA 1UFUA 3PJSB 3MREB 4XXDB 1CIUA 2F8IA 2EXYC 1WV7T 3CBRA 3PU7A 1DJHA 3EOTL 3D3VA 2FHCA 4GRWE 3GINA 4N0YH 4PV9B 2A77L 2Y1AA 4P2QD 2CA3A 4UM8A 1YJDH 5EO9A 4Y4HB 1DQTA 4AM0A 4RGMB 4HAKA 3BQVA 3RKDD 3A6BL 8FABA 4TUJB 1M7XA 1C1EL 3FFCB 4WVRA 5HDBF 3BWUF 4FI8A 1QW8A 1GGBH 3E6HA 1HHKA 2DLFL 3P2BA 1NBCA 3VXMA 4P5KB 1X3DA 3QFGA 4JGMA 1URZA 2EEDA 3FZUD 4ZFOA 1IGIH 4R8WH 4ODSL 1MY7A 2DYPB 2ICES 5FA4B 4WDIA 5I6PA 2CA4A 1ZVYA 4MFHA 2OJZL 1ZVSA 4XBEH 1E27B 5E8NB 5SV4A 2ZCHH 3QUYD 3DX9B 3TVMA 1ZS2A 4G70B 1R46A 4N8VB 1QFOA 4TQHA 1ZLWK 2J8UB 3ESPA 2N7SA 3DV6A 3HAEH 5E4IA 4N2CA 4JFSA 7TAAA 4AW7A 1I9EA 3KYMA 3VXRD 4BA0A 2PCFA 5EWIH 1A6PA 4BINA 1ESOA 1E9QB 35C8L 3DURB 4NFBA 1G7QB 3KXFB 3WFBL 2ITCA 1GR7A 3D85B 3HBZA 4Z7VB 3OL2A 4ZJ9A 5CZXC 1J0HA 1YEDB 5DJDA 3PNWB 3VXQA 1KTDB 1BZ9A 1A6VH 1CF8L 3DECA 1MFAL 4QAMB 3GLEA 5HI4C 4F33B 2WUCH 4OSUL 5DD0L 4JPWH 5DHVB 1O6TA 1JWUB 2PWDA 3QULA 3MOAL 4YK4B 3DHJA 2UY7A 2HB0A 4TPRH 1TG8A 1N64L 2BJML 4DTGL 4OZIA 3W9EB 4PJIA 4MCMA 3WNKA 1BD2E 2ENSA 2GJ6D 4JO2L 1E67A 2AFNA 1SHMA 2Z4QB 4Y4KA 3CLEH 1GAFL 3JV4B 1T0NB 4HYTB 2FRGP 3S6CA 3WLWD 5E0FA 1IQWL 3REWA 3KGRA 4WEBL 4EQ2A 1AFVL 1MAKA 5D55A 1SEBB 1T0MA 2CRYA 4YHZH 4DOHE 5ID0B 3TBYA 1YEJH 1Q0YL 1HH9B 4KXCA 2XKNB 4H26A 4ODVH 3D25B 2X7LA 4HT1H 1O9VA 3JVGC 1U8IA 3FS9A 1FF5A 2PPDA 2Y6SD 3H9HB 4JM4L 4DUWA 4WEUD 1EMTL 3FU9A 2APXA 2ZKMX 5HPMB 4LPCA 1DUYB 2HRGA 1P5VB 3FO9A 4IDJH 4ELDA 2NZ9D 3IU3B 1QSED 3TFKD 4Y5VA 1F6LL 1T5XB 4PV8B 4B7IA 1RY7B 2VZTA 3M7OA 4WW1A 4KNQA 3VXUA 1AC0A 3OKOB 1A4AA 2YAOA 4PGCB 1YQVH 2XOTA 3F7RA 4IMKC 1NZRA 1Q94B 2BVEA 4LIQL 4D7BA 4M48L 2O6FA 3QNXB 5MI0C 1R0AH 3HG3A 2ADJA 1ILSA 2F18A 4YE0A 3I9GL 4OLUL 1IGCH 4UOJA 1G7PA 1AO7E 1NLDH 3QUML 5F6IC 1AKPA 3MA7B 4HA1A 5LDSA 3BWAB 3EDDA 4BXVA 3HBGA 5DC4B 4ZD3L 1BFOA 3G04A 4PB0L 1RJYA 5GGTL 1O0VA 2AXGB 1KXTA 4FG6C 1CE1H 2OMXA 3MV9D 4OF5A 5BQ7A 1AYRA 3MLRH 4DGIH 2JJVA 5FO9A 2AKRB 2VQUA 4FXKA 4S1SH 3QB7C 4LPUA 5I0WA 2Q3XA 3F58H 3HZVA 3V0EA 4RRPA 3Q6GH 4XOCA 4MMYB 5FC9A 5ETUB 1R5IB 3ESVF 1GJUA 1S8DA 1BXXA 4LCWB 4KUZH 3CU1A 2DLHA 2VDMH 3RAJH 2WHVA 4PBXA 3UBXI 2D31A 1FUNA 5SX5K 4F7TB 5E9DA 3TBWA 3BZFB 2FGWH 4M7ZB 3GTNA 3O2WL 2FUQA 1RZ7H 2WQVA 3ORJA 1CFQA 2BP8A 3EJQA 1VFAA 1RERA 4YLCA 1CDYA 2AVFA 4Z5RA 3NRFA 1MCOL 5E2WH 1CD8A 4LHUA 4NRXB 4L2LA 5D1ZA 3U1SH 1G7LB 3WJMA 4D94A 3VVWA 4G1MA 4KI5C 5M94B 1PD1A 3VFVA 3BAYA 5HHQB 5D6CB 2V33A 2I9LB 2IV8A 2FEDC 3QRGL 2ZCKL 2WINA 5FYJH 4ZYKA 3BH9B 2OCJA 4NIYE 5D4QA 3BKYL 4GSDL 3KPRB 1M6UA 3MUHL 3K72A 1IEAB 5SWSD 3QUGA 1GSKA 1DVTA 3MRQA 4KTEH 5CJQH 5DUJA 3MJ7B 1CBJA 4GYBA 4RISL 4W81A 3QDAA 2QSCL 2PW1B 5I8OL 3DUSB 1ZD6A 2IPUK 4JFDE 3KWWB 1NOLA 1ULVA 4GKSB 5BO1H 2DQGL 2K45A 1BA9A 3WHXB 3A4AA 5ILTL 1CG9A 4MWFB 4FF9A 1S78D 4BZ2L 1UT1A 2WBJD 1INEL 2VTFA 4NC1C 1JPFB 3EFOB 4E9QA 3WE6A 3KPSA 4Y5YB 2WLYA 2KHAA 3BCDA 1H8NA 3FTWA 3PWLA 3MLWL 4R26L 1IIKA 2AJ3A 1K85A 3JWDL 4XN2A 3BQUD 4LDCA 1BJ1H 1IC7L 3BPOC 2CDGB 3VG0L 3LY6A 4MYPA 3L1OL 3MR9B 4YHLL 3BZEA 2ZOKB 4PRIE 4OCRL 4K3EH 4JX0A 3RB7A 3JZYA 4XP5L 2BC4B 1J8HA 5LXGH 4A7GF 3R8BB 4ZFQA 1XIWD 1RZKL 3DPDA 1JZGA 3HI5L 4PFEA 5FYLL 4ORGA 1YEEL 3HMWL 3QG6B 1KJ2H 4ZQTA 4TUJA 3A6OA 3HZYA 1ZGLP 3NSFA 4AENB 3L4VA 1BZEA 1EAPB 2Y5TB 2D3LA 3QORB 3IPBA 3CVIH 4HK3J 1MFCL 3IDYC 1OCOB 3FCTB 4HUWB 3LB6C 4O58H 2XWXA 4AH2A 4WHTB 5IVZA 3AGWA 1UM5L 5FA4A 1KIQB 5F9AC 1OP9A 1E27A 3OHMB 5E8NA 3NSDA 3SPHA 1DANT 2FJSA 4M4PA 4LSVH 1D2PA 2K7PA 3H4FA 4N8VA 3SE9L 2NZ1A 3V0VB 5K1VA 3WXVL 4AYEC 5MERA 5AG9A 1TMQA 4ONFL 3O6ML 3V7AG 5JHBA 3DURA 1G7QA 2ZX9A 3KXFA 3VQLA 4DKTA 1U4FA 3D85A 3FUIA 1OQXA 3SN6N 4ZSOE 3V7AE 4JUTA 3L3GB 3PNWA 2C5DC 4PRHE 5IK3A 1KB3A 4NO3B 1BQSA 1HYSC 3D69A 5GRUL 1B2WH 2WMPB 2WSPA 2OYLA 1FYTE 1P7QB 3U1PA 4F33A 4POZD 1IBFA 4QNPE 4LHJB 1M4KA 3NH7H 4NKIH 5DHVA 1TKWA 4P9HC 1HXYB 2NXYC 4F7EA 5KBNC 1J9TA 1P4IH 3W9EA 4FG4A 2Q3AA 2YUZA 4YHKL 5L8KB 1KWGA 5GGVL 3JV4A 1T0NA 2L0DA 5DLML 2ZUQB 3RVUD 3QYMA 5H35B 1OAQH 2W9DH 2PETA 1F1DA 3I9AA 1SEBA 3MX0A 4XHJD 5HHOB 4FL4B 1V55B 2NY1D 4OZGB 5ID0A 4PJ5B 3FO1B 4UDUB 2A9BA 3QW9A 4NHCH 1KTKE 3UXFA 1HH9A 4NQSB 3IJSB 2XKNA 3FTGA 1I1FA 4MAUL 2P5WB 2MFNA 3D25A 2J88H 3H53A 3H9HA 2X87A 3RWGB 2J8HA 3DDGA 4AEEA 4AJYV 4MMXC 4IRSC 3H55A 3TN0A 5HPMA 5D93B 4HJJH 4E41A 1P5VA 1G1CA 5F21B 1LWJA 3IU3A 3BE1L 2D2CC 4MNGE 1AZRA 1T5XA 3U0TB 2IH1B 3HA0A 4PV8A 5CFAA 2D3NA 2Z7UA 4G3YH 2Y0SA 4S0HA 5EIIB 2BFVH 4M4RB 5A2JH 5LGHL 3OKOA 3VXNB 1W80A 4X9YA 3VVVA 2DQIH 1OB1B 3EHBC 3K6IA 4Z0BL 3FPXA 4CMMB 2GK2A 4TQEL 3QNXA 2WBKA 5T5FL 4YSRA 5C2BL 5IB3B 4C56A 3L5IA 4QJ3B 2VN4A 2M2DA 1KLUA 3QFJE 4XNBA 4LLMB 4LAJH 1E6OH 4UIKL 3UERA 3S9DB 3D9AL 3SYAA 2ZYRA 1PMYA 3W56A 1AGCB 3H54A 3K5RA 3DC0A 1YPZF 1U8NB 4HPYL 5FIEA 4DGYH 2OM5A 4HUKB 4JO4H 4EN3B 2VABB 1WZLA 5B1KA 2DTSA 3KPPB 4G9DB 3MV8D 3K6NA 2VWEE 3IDJB 2AKRA 5I6KA 4PQXA 2F8XC 2ZCLL 5TF1L 2VB5A 1KOAA 4IOFD 5T33L 5ETUA 1R5IA 1RLWA 1W2KT 4X80H 2B9AA 5SWZE 1JV2A 1Z3GL 1ASQA 4LCWA 1YECL 3R1GH 1KENH 1O7DE 2PYEE 1F41A 2EQDA 5DFVC 3C6LD 4F7TA 4UF7C 5IB1A 4Z7NF 2DTMH 1JBJA 4L3CA 3EJCA 4PLOB 5AKTA 5TK2A 1AZCA 3RX5A 3QNYB 4F58H 3Q2VA 4XMLH 1CC3A 2CGYA 4ERSL 2PR4H 1MZYA 1Z0MA 2OCCB 4NJAL 3THMH 1ZE3H 1MWAB 4XO9A 4GH7B 4DN3L 1M1SA 1GW0A 5BRZD 3EGDB 1G7LA 1GVIA 1I85C 2MPAH 5KN5B 2R1XB 4Y89A 2NY3B 3C5SB 2QV2A 1MI5D 3SDYH 5HHQA 3DROA 3NA9H 5D6CA 2GAZB 3U7WL 4I0KA 2I9LA 4J27A 2WTPA 3BUIA 1N4XL 2P5ED 4KUCD 4OAWB 5EUOB 2FNBA 1SY6L 4KKBC 3DI3B 3T3PE 5EBGA 3ROOA 2YZ1A 2ZPKL 1NBZA 1CFBA 1TPXC 9PCYA 5CCKL 1M56B 2V3DA 3NSCA 5AVYB 2CHNA 5FYJU 3EH2A 1E5UI 1IEAA 3MRNB 3WS6A 3S3JA 3CZEA 5K93A 2ZAGA 1IQDA 5ES4B 4OF3A 4AQ1C 2PW1A 2OZ4A 1TSHA 3DUSA 4G8IA 4S0TD 4EOWH 1NEZB 4KKZA 2V3FA 4EXPX 5D1XD 3L16A 4GKSA 4QXUL 5IHBA 5EU5A 1OGAE 1MVUB 3WHXA 3GSVB 3L2MA 4BFRA 5AD0B 3S88L 4TNFA 4MWFA 2B39A 1OAJA 4WUKL 3QARA 4C55A 4ZNCD 1JF5A 3OB0K 3VCLA 3U7YL 3ZE0E 1HZLA 5E94B 2UXGA 3ARWA 3BAXA 1D6VL 1JPFA 2EE0A 3CQFA 3FFOA 4IGBB 5D7LA 2G3NA 2JQMA 5DK3A 4LRNH 4PRAB 2WZ0A 4Y5YA 2VAAB 3IT8D 3CE1A 4PJDB 2YLKA 2OTWB 5CEZE 1LO2L 1ED3B 2IQAB 2WLKA 2XICA 5A6IA 1VERA 1CQKA 5LCVA 3MR9A 2WGXA 2ZOKA 1S5HB 1QWNA 4MNQB 3LN4B 4M93B 4LO9A 5E2JA 1AS8A 1CUOA 4U4IA 3UMNA 1NGWB 1A1OB 1ZSDB 3RTQC 2DDQH 3QP3A 5JA9A 3ZTNL 4OF7A 1XZ0A 3I74A 1WTLA 4HIEB 5E2VL 5BXFB 3QG6A 1PEWA 3GNML 1KBVA 3HRZB 4IU3B 4OCMC 2CDFA 1OZUA 5I8EB 2NT1A 3FU6A 3J27A 5DGRA 4Z7QB 2E9GA 4AENA 3Q6FB 5C0RH 3ULVF 3FRPG 4XC3H 1EAPA 1B4JL 4OCXL 2XJKA 3QORA 4PGBB 2DQHH 5IHZB 3V55A 4A7UA 2IALB 1EV2E 2D7QA 1GIGL 1X4YA 4HUWA 4MQTB 1JVLA 4KFMA 4HBCL 4WENB 2ESVA 4AMKL 3DJTA 3RNQB 3T5WA 5DFAA 3HN3A 4U4BA 4IRZA 2GHWB 1IM9B 2P8PB 4OZIF 4PJIF 2IJ0C 4OLZL 4NOBA 4U2YA 5KVFL 2GI0A 4NENB 5CP7B 4KY1L 1D5ZB 3BZ4B 4JQXA 4Y9FA 5GJTL 1P4UA 1FFQA 2AJXL 4FYSA 1EAQA 2BOBB 4NO3A 3O45A 2AGJL 4XP6H 2WMPA 5FUZH 5K9JH 2WYZA 4Y2OA 2VLRE 3ILQC 4KHXL 1W0VB 4XRCB 2OMNA 3W5MA 2L7JA 4CNIB 1KCLA 3GS7A