1WFJA

C2 domain-containing protein from putative elicitor-responsive gene
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVALSFKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative elicitor-responsive gene
publication title C2 domain-containing protein from putative elicitor-responsive gene
rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 12
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfjA01
4FHJA 2X38A 4IQHA 5KJ7E 4FULA 1DJHA 5EDSA 1K5WA 2WXHA 2CM5A 3DBSA 4KITB 4L1LA 4LCVA 3NSJA 1E7VA 2FK9A 3LJ3A 1DQVA 3TJPA 2K45A 1DJZA 2JQZA 3FDWA 2CJSA 3F04A 5H4YA 4PS7A 3S2AA 4GNKB 1TJMA 4KZCA 4MJJA 2YOAA 1UGKA 1CJYA 2K4AA 2WXFA 3QR0A 2CM6A 3L9BA 2NSQA 2WXIA 4KZ0A 2WXMA 2NQ3A 2WXNA 3L4CA 1GMIA 3M7FB 5H4ZA 3PYCA 2YRBA 2WXLA 3FBKA 4WAFA 3KWUA 4QAMB 4FJYA 3TL5A 3N5AA 3PFQA 4J6IA 1A25A 2ENPA 1RLWA 2Q3XA 3RPBA 4HVBA 3SD5A 1UOVA 4G11A 3ZVVA 4A55A 3W57A 4TUUA 4FHKA 3L16A 4QJ4B 4WEEA 1RH8A 3PS6A 4DK5A 1QATA 3ML8A 4TS6A 4AOFA 1BDYA 2NCEA 1DSYA 4BGDA 3R7RA 3ZIMA 4PS3A 3L17A 4XX5A 4ANUA 2DMGA 2A5UA 4LDCA 4L23A 2WXKA 3F05A 3OHMB 4F92B 1UOWA 4WWPA 3TWYA 3L08A 1E8YA 1V27A 3IM1A 3ZW3A 5JHBA 4L1BA 4F1SA 4HLEA 3T8MA 4OVVA 3L54A 1DJGA 1TJXA 2WXJA 2ISDA 2FJUB 1RSYA 3HIZA 2N1TE 1WFMA 3PREA 2B3RA 3PRZA 4BFRA 3OAWA 2EP6A 4WWNA 2K8MA 4FADA 2D8KA 4JPSA 2WXQA 3W56A 4FJZA 4QJ3B 4AJWA 4V11A 3APFA 4NPKA 2CHWA 4ICWA 4WWOA 4EZKA 4FA6A 1HE8A 2ENQA 1DJXA 3MJWA 3NZUA 1E8WA 5T8IA 3APDA 2V4LA 2QZQA 4NS0A 2CHDA 3JZYA 3QARA 4F93B 3GPEA 5CCGE 1YRKA 2Y3AA 3F00A 3QAQA 5G2NA 1DJWA 4Y1SA 3ML9A 4XZ4A 5JHAA 4ANVA 2WXOA 1E7UA 2CHXA 2LHAA 2BWQA 2UZPA 2RD0A 2ENJA 3CSTA 2WXRA 3F01A 3DPDA 5CCJA 3RDJA 3ENEA 4URKA 2Z0UA 4Y1TA 4EZJA 2WXPA 1E8XA 5G55A 3KWTA 2ZKMX 4QJ5B 3QK0A 1DJIA 4DNLA 2WXGA 3R7QA 3NZSA 4XE0A 1W16A 4GB9A 4F91B 1WFJA 1BYNA 1QASA 1E90A 4IHBA 4EZLA 1W15A 3QR1A 3CSFA 1E8ZA 4FLHA 4ANXA 3APCA 4ICXA 3QJZA 3IBEA 4TV3A 2K3HA 3P2BA 2R83A 3B7YA 2DMHA 2CHZA 1DJYA 5CCHE 2QZ5A 4NP9A 4OVUA 2KI6A 3HHMA 4PS8A 2A4ZA 3L13A 4L2YA 3HN8A 2Q0ZX 4ANWA 4LT7A 4NPJA 1BCIA 2CJTA
chains in the Genus database with same CATH superfamily
3QFJB 4WFGE 5JW3L 1MXDA 5ABDE 2WLLB 2C4FT 1REIA 1PIGA 1RY7B 2O30A 1OP5H 2Z31D 1JVLA 3D52A 5ERWB 3ULUC 1F90L 2XN9B 3C8DA 3AQZA 1CBVH 2X0WA 1ZRUA 1RUKH 5LXGH 1GY2A 5I16A 3MOBH 4WEBL 2N4IA 2A0LD 2FX9H 3C75A 1E4HA 1T66C 1HOEA 2ORBL 1D9KA 4C4UA 4DAGH 1USQA 4IGBD 2TRYA 2FBJL 4FLQA 4QPEA 1SVBA 2XG5B 4AXWA 4Z7QF 5FUCC 1PG7X 2X1OA 1YUKB 3BZFB 3MRRB 4I0PA 1FO0H 1B0RB 3MCYA 4JVUA 4QXVA 4G42B 2OL3H 3FUKA 5B22A 4JW3A 1Z6JT 3FO2A 1WA2X 1DLHB 3HZYA 4JFYB 1UWYA 2ZCZA 4G43A 4N8VA 3HG1A 4AEIL 4Z95L 2P5WA 4IBYA 3S4SB 1AY1L 1EA9C 1JGLH 1NCBH 3O9WB 2WXKA 4OV6F 5JIMA 2N01B 2FGZA 3R1GL 1BECA 3IM1A 3A67L 4ZTOL 2BSRB 1GIGL 5E4EC 1I9IL 4XAKD 5JPNA 1NCOA 1W80A 3S48A 2DQJL 4P2AA 4K94L 3GBNH 2G75A 2FIRT 4GMSL 4HPHA 5CBEB 1EUTA 3HAEG 2ESVE 4FQHA 4XNYH 2JCCA 2FO4A 3FCGA 3QEHA 1ZEAL 2YD9A 2WAHA 1ZPUA 3WUWB 4EJ1C 1NCWH 1T7YA 2DRUA 4PUBH 3RG1C 1P84K 3O6FD 4NO0A 5C0JB 1BP3B 4CVXB 1XF5B 1Y6NR 5D7LE 1EH9A 5LGKA 3TEUA 4B9CA 3WO3B 2H1PH 4OZGE 4C56D 1GCFA 4UV4L 1KXTB 4O02H 2VJXA 1QSFA 2GBVA 2AZUA 4U31A 4I1PA 3CHSA 1Z7JA 5BPPA 2NY0C 3M8OH 1UWXH 1AG6A 2BJML 4KV5F 3RGVB 5DZOA 4MA8H 1IGCH 1OE2A 2LVCA 1BGXH 3A24A 4GAJL 1DEDA 5FOBB 1D5MA 1AD9A 3S3PA 4JFFE 5AKVA 4X0KB 5FYJE 4UTCA 5DI8A 2MPAL 2EDKA 3EFDH 2WAQA 2AV7A 3QDGD 2Y3NA 4WHTB 1AGFA 1JPST 1V55B 2EO7A 3KL3A 3RUGB 1GAFL 2QZ5A 2GJPA 2GJ6B 3WIFA 3TEYA 2CIKA 4WV1B 4AX3A 3GXNA 1XSKA 2N7AA 4L3CB 4LVOB 5DHYA 3TZVD 2ZZUT 4MJHA 3LKNB 1QWNA 1FE8H 2JJSC 4JO1H 2ICEC 4PB9L 1FFNB 2ZF8A 1MREH 2WIMA 1P4BL 3JV4A 5MERA 4BINA 3ZL4L 2WD0A 2FSDA 1Z3RA 5J8OA 4HEME 4CDHA 5IFHH 3LEYL 1WBZB 4XO8A 1VB9A 4BZ1H 3WJMA 1HOCA 4PJBA 5IBUG 4Q0XL 3Q6FB 2OYLA 5KBPA 2J4WH 2XRAL 3FXIC 4K55A 2ICES 2J8UF 4HK3J 3BRDA 1AQKH 1YEHL 5ACMA 3RYMA 1W0WB 3WKMH 5D7SL 3M7FB 2P8PB 1NC4D 4BRVA 3W0WA 2PWHA 1YEGH 4AYFB 1RJYA 2XYCA 1PZ2A 2WBXA 5D7JC 4FQXC 3WDJA 4N5UA 4LBAA 4NP4L 2GSIA 5CEZD 4DN3H 3V0EA 3L9RA 4NRYB 2DV6A 4W6YB 4S1SH 3E1ZA 2WC7A 3INOA 3US0A 3VI4F 3CX5J 4YUEH 2X89A 4JFZL 3UGUA 4LGSB 2F1EA 3B56A 4Y16B 5B3SB 3K1DA 1NGXB 1NBZB 3APNA 1MHCA 3G04B 4GAYB 5I74B 3UZEC 1FC1A 4FC3E 3TOPA 4JPKH 3D51A 2FWUA 5GZOC 4ODBD 2R0WH 2Q6WB 3LQAH 1J8HB 2VR5A 3KPOB 3KBFA 3S3CB 5DGRA 3VRIA 1Y6MR 1NEZA 4XCCL 5PAZA 1BW8A 2IAMC 5J57B 2JJTC 3VQMA 3T65A 1Y0LB 2OMTA 1PSKL 2I32A 3SHSA 4FEIA 2CAKA 4B3VA 2VLKD 5KJRL 2AABL 2Z31A 3NCYP 3FF7A 4CVUA 4GY4A 1A1OB 3VMPA 1BZ7A 2D03H 4KHTH 2LABA 4ZODA 3E8UH 2BOBA 3GSNH 5JXEA 3DPDA 2ZXAA 3VFWA 1Z9OA 4FTDA 3T9WA 4IGBA 1KFGA 3MJ9H 3MGTA 4EZJA 2FWLB 3PHOA 3CFEA 3ZDWA 3T0EA 1FNHA 4XMKH 2DDQL 1QUNB 4Z9KB 3ZL2A 2GKIA 1LO2H 4GW5A 4RGNE 2FX8L 1UD3A 4QRAA 5I6MA 3KJ6L 1MNUL 2P8LA 4UT6L 5CFHA 3T77B 3AWEA 1DVYA 2JELL 2Z91B 3VFUA 1AO7B 1EGJH 2KI6A 4JHVA 1IAIH 4QF1B 5F89A 1FVCB 2X4QB 3OKOA 1OZTG 3GB7B 3VI3B 3MRKA 4OCNC 5FYLE 1TQBB 3FT2A 3DO3A 5E6IB 4TTGA 3C6LB 4RMWA 4TPRH 1KLFB 4K3EL 3MCKA 3EYUL 1IM9A 4IU2A 5D9SA 5C08B 4CAGA 1YECH 3SGEH 2I5YL 2OXHB 2BVTA 4ZXBD 1G4RA 1KYOK 3LQMA 5DCCA 1TJIH 4HCRA 1E5AA 5AB9A 3B3IB 3MLVL 3T0VA 3NDZE 4NHUB 2KZWA 2O6PA 4RETB 4W9EC 1KTLB 4KX8A 3QT2A 4GOSA 4Z7OB 2VN4A 3M1BB 4U0RB 2HPTA 3VXRD 2XXFA 3HI1B 1HQRA 4WFEE 3T0DA 1F90H 4HGWB 5JW5B 2RR3A 1PZ5B 4OF6A 1CLOH 5F8RC 2Q7NA 5F1SA 4JQVA 5BZDB 1G7QB 4WEBH 4X4YB 3FQNB 2VM3A 1XV8A 2WVTA 4DGVL 2DF3A 5IMOB 4WENB 5TK2A 4K71C 3QCTL 4PRAA 4U05A 4I9WD 3KPQB 1CL7I 3GJFA 4DSYA 4P5MB 1M9SA 3SDDD 5J6HB 1E8YA 1JN6A 1SYSB 1YEKL 1RZQA 5E8NA 1DVSA 2MCPL 1QHQA 3C5JA 4PU2A 5JPMB 3PGDA 3RHWF 1J1PL 2A9BA 4HGMA 1HVXA 4FG4A 1SY6L 5K9QI 2WXJA 1G5GA 3RWEA 3UH8A 1N9PA 2X70B 3ULUL 2O5NA 1MY5A 1IGTA 2CWRA 4Z95H 3RVXD 4EUPG 3ZMNA 5C0GB 3CAFA 2OTPA 1AY1H 5JIHA 3TZVA 5KS9A 1H8LA 3MGOB 3BAYA 3RWHA 1B90A 4P8QA 4ZTOH 4XI5D 3ZMEA 1Z0MA 2UUDK 1ZXKA 5DUJA 1I9IH 2OX5B 4TTDC 3NCJH 4U6XB 1FZOB 3VFVB 1I8KA 5JHDD 2IC2A 3I6KB 2WGXA 4MJ6A 4K94H 1B4JL 4XVSH 3NFSL 1EANA 3TO4B 1A7QL 3K91A 5HJ3A 5GS1A 1P4LB 2R15A 4MGXA 4MQ7A 4D7BA 4GKZB 2F74A 4E9WA 2VDOH 1G0XA 2QGCA 2V7HB 1ZEAH 4UOW1 4Z76A 3N2JA 4GB9A 4Z7NB 3NCFB 5FGBC 3DGDA 3VXME 1GZPB 3O11B 2AEOA 2VXTH 1NAMB 4TSAL 3QJZA 1ZLWK 3QJTB 2ZXWB 3VD3A 3ULSB 3TV3L 4YE4L 2H1LM 4OB5L 2NXYB 1UA3A 4L4TD 4UV4H 2IBZX 5I1LB 3CHOA 4L4VB 3UXFA 1MHPL 3KPMB 3UP6A 4NQSA 1Z9SA 2BJMH 1U2CA 3MRIB 4P3DB 4BIKA 5IMMA 4OI9A 4R0LB 4XZUA 3VWKC 4CN4A 1GJUA 3B9KB 1E9OB 4GAJH 3SBWC 1ZLSL 4P06A 5DVMA 1KTDB 3QRGL 2ICWI 2PP9A 3T08A 4GNKB 1KWKA 5DHMC 3WCYA 2E56A 1SXCA 1AGBA 4Q7DA 5IK3A 4CC4A 3FUIA 1GAFH 5KZCD 3ULUF 5DUBA 1KJ2L 2WHVA 4UNUA 4XOEA 2WWNA 1ZMYA 3G5YB 5HHOE 3QQDA 3CXHJ 2H6PA 2DJ4A 1HL9A 2VLKA 3MA9L 4U1IB 4PB9H 2R1WB 2ZSVA 1P4BH 5SWSE 4ODUA 3FTYA 1HX0A 3LEYH 5DEJA 3RI5F 2PW2B 1KXQE 2DH3A 2EDOA 15C8H 5GRUL 4PRPB 5CEYB 1R6VA 4HZLA 3RQ3A 3QIBC 1LE9B 4R4ND 1Q9LA 2BERA 2WLIA 2E9JA 3FZUD 1N6VA 4GRLA 1HKLL 5FO8A 1LD9A 2IOIA 4GAGL 1YEHH 5AUMA 2F53B 5DFWH 4OIIL 5I8CA 3GTVA 2QVIA 4W9DC 3OPZL 4G7YH 2B5IB 1NPNA 4MNQB 4R26L 4KUCD 3C9NB 4LVEA 3RIKA 4XN8A 1HZHH 3JWDH 4NP4H 5E1AA 3M17B 1TJXA 2ZWZA 1JGUL 1UT1A 3OHXA 4JDVB 5CGBA 4FXKC 2HT3D 3MV9D 2QSVA 5GHWH 2EP6A 3VAEA 1RIVL 5IQ9A 4NCC1 4PRIB 1G7MA 3TH3T 4BELD 2QKIC 1U3HD 4NLAA 2VDPL 1T1YB 2E8YA 1WZKA 3NAAH 1K2DB 1DJXA 2E75C 3FO9B 4NBXB 5FXCH 1I85A 1OT4A 2OTUB 3ZSTA 1DVFA 1SJHB 1XXFC 5KVEL 4FXGB 5DURD 1AHWA 1K5NA 3F7YA 1V54B 4ONGL 4TNVK 1PDKA 1FP5A 4ZXBA 2R2EB 4HH9A 4ZFQA 4XCCH 1PZAA 1L9OA 1U8JB 1F4HA 2CCLA 5IJDC 5CP3H 4MNGE 2NR6D 2E47A 3ENEA 3FT4B 2VGLM 3BDBA 3RBGA 4Y2OA 3ESUF 1F00I 4MMXC 4XMLL 1OGAB 2EYRB 3KWTA 1NCJA 3NZ8B 1B0IA 1LDSA 4JQIA 1HXMA 5KJRH 2IDFA 4PBVC 1LO5A 3OB8A 1J0JA 2CD0A 1X5LA 1PLBA 4BQ9A 1X6NA 4F7PA 1JTPA 5I0VA 3RY6C 2NXZD 3P54A 3BUBA 1DR9A 1F8TL 4W4OA 1KIPB 1AZBA 3WFEH 2GQHA 2OSLB 5E8OB 5L6YH 2J6EL 3P1VA 1H8SA 2CALA 5C9JB 3BIKA 1FO0B 1DL7L 2UZIL 3LKOA 3QWOB 4F20A 3FYEB 2AXHA 4P9HC 4APQC 4UM9D 2BNQE 4LOUD 2IDQA 2OL3B 3DO7A 3DSNB 2DDQH 1R4XA 4I2XE 2VO5A 4U1SA 5HHXL 3PWLA 3GKWL 3VXSE 1R46A 1QSEE 1RERA 1LK3H 3CQQA 1JWSA 4UT6H 3ZJAA 2IQ9L 1SLXA 2AVGA 3FSOA 3NJNA 4WWID 3PUCA 3UIYA 5KYYB 2ZCLH 1BVZA 1ZWIA 3BAIA 2A4CA 1JNHA 2GC4C 4L3EE 1P2CB 3WEAA 4QR7A 1U2YA 4D0BB 1NCNA 2PYED 1WT5C 1D7CA 1GYCA 4RAUB 5SWQA 1ZLVK 3T3PB 1BJ1J 3WAJA 3L4TA 5DWUL 2ZOKA 4RH4A 4NQCB 4JO2H 3U7WH 3QUZB 1F3DJ 2WVSA 3CSYB 5J56B 3L9YA 4PW3A 1QRNA 3ULVE 2C1OA 1AHMA 4RMTA 2J6WA 3EAKA 1UEYA 1UUNA 4Z7WB 4G82A 3NSXA 5IROA 1W9XA 2WQUA 1KZQA 5HHVL 3GDBA 4ZS7H 2W9EL 1XH3B 1U8NB 2WLHA 1IC7H 4G8EB 1CD8A 1QEWB 1FLTX 5D1XB 3QNZB 4ECNA 4OJCA 2VDRL 1GJIA 4ONOA 4OLXH 2J1WA 3MNVB 4L4TA 4HKJB 4XNUL 3GK8L 3W56A 3HJ0A 4XNDA 2DIJA 1JDDA 3QCTH 4F33A 5I82A 5IEKB 4Q9CA 3IFOA 4NQDD 4TUKL 4DERA 5JOEA 2A6IB 2FJFB 2K8QA 3EJPA 4NCC2 2JIXD 1CICB 4OJDH 2YEQA 4OI7A 2YPKB 3P4NA 4YDVA 5HGBB 4LGPB 2MCPH 2GBTA 5DFVC 4AQ1C 3MRBB 4YWGH 3QZBA 1J1PH 1KBWA 2F5BL 2YD4A 2X2UA 4IJTA 4OZHE 5BMFL 1G6RA 1MLCA 3RPIB 1SY6H 5F9JA 3RBSA 3RL2B 5E8PA 4AH2A 1TDQA 3ULUH 2F7QA 1D5IL 3QH3A 5T5FA 1J87A 3VXTB 4JFOA 1URZA 2ZUVA 2YO3A 1QPXA 2F15A 5BZZA 2GFBA 3ZR5A 4DN4L 1ID5I 2HFGH 1YYML 4FDWA 3V4PL 3JT0A 4G5AA 4JZNA 4PJIA 2KS0A 4X5XB 3WHE1 4KY1H 4XO9A 3QDHA 1DQMH 1ZVYA 1DDHB 4TUOB 3E2HB 1KT2A 3HBPA 4F5CE 4N2MA 2VN6A 3S37X 1I7ZA 2D0GA 3NFSH 1A7QH 4HKXA 2R7EB 2HT2D 1P1ZA 5JW4M 1DQIA 2X6AA 5IB4B 1RULL 1N8ZA 1B3JA 2YQ2A 4HEPA 3F64A 4MRBA 5JYMA 3GZOA 1AXTL 4TSAH 2KDYA 2HVBA 5FA3A 5DJDB 5C0BE 4BUQA 3MV9A 4AWJC 5BRQA 4JO3L 4YE4H 3VQLA 4OB5H 1DFBL 4MWFB 2NSQA 4HOWA 4GUCA 4ORZC 3GMLA 4JCLA 2LAAA 3FT3A 1U3HA 4B27A 3V52L 3PDOA 1MHPH 1ZLEA 2BNRB 2Y06H 2J7LA 4GXUM 3OJVC 2QSCH 1NCAL 3CX5K 4GINA 4KI5D 5L8KB 1BZOA 1GGCH 2BVOA 4LSVL 2GHZA 1KJVA 4NPYA 4WKZA 1BZ9A 3LEXA 5IESL 1HCZA 3MMEB 1FL5A 2GITB 3D05A 1C8QA 1I9JL 1YPZF 5HHQA 1MFDL 3QQ3A 1H5BA 2VDKH 3VFMA 5I73C 4LAJH 4LASL 1S9WA 3JWNC 4TF4A 3MA9H 2XV6B 2F2HA 1AE6L 4FQJH 3L2MA 3B3BA 4ABVA 4JM2C 2HLAA 3L1GA 2TRHA 4C4KO 2LGNA 3GSNB 3WL9A 4MQTB 4FADA 5GRUH 1C5DB 1YY8A 2ZYRA 5DMKA 1IKOP 4XO4A 1F02I 1A6TA 5E23A 5CXPA 2BH0A 3D3VE 5GZNA 4YNYA 4Q56A 4OIIH 5JHDE 3GJFK 4I1NB 5DK0A 5IP4A 3GMNB 4FE9A 1GL4B 1L0YA 3OPZH 3KNBA 4D3CL 4KKLD 3ULAB 4LKCA 4R26H 4NB7A 8FABB 4GP5B 1I82A 2EZ0D 1FHNA 4UIKH 5ESVA 2OBGA 1AR1D 1DEEA 2ZUQB 4PJ8B 4ZD3L 1WF5A 1BREA 3BT2L 5DSCA 4MTMA 4MCZB 2HKAA 3KAAA 4NNXB 1RIVH 3NCYS 3EBAA 2FGWL 3GSXB 2KUTA 4RFNB 3D50A 2Y7OA 4TNGA 5A2FA 2FAUA 4LKXA 5LBVA 2Z8RA 3QORA 3KEDA 3QXTA 2CCWA 1KLGB 2G5BB 3U9UA 4K3GA 2ADFL 5KVEH 4FQIL 3AM8A 4ONGH 5J3HC 5CIPB 3QULB 2R2HA 1MAJA 1U58B 2ZAIA 2NY1C 4OJFH 3WN6A 3ETSA 3QIWD 4OF5A 3UPRB 4LPXA 3SQBB 2NX5D 1IVTA 3PXHA 3F7VA 4FFYA 4LCVA 1IFRA 5KAQF 4KMQA 5GJSL 3AVEA 1NM4A 3FSWA 3U2JA 2M2DA 5AVWB 1MCJA 5EFIA 4ES9A 3VE0A 4YHIB 1OTTC 5KOVC 3QXVA 1LWRA 4FFWD 1MW2A 3L5JA 5LLIC 1XBDA 4JAMB 4PMEA 4YDJA 1YNTF 3WIIH 1OE1A 4NQDA 5D4QA 4H2AA 2UZIH 4PGBA 1TTGA 4R84A 4BZ2H 4HXBL 3W9EB 3F6IA 5C0FB 3CBJB 3DV4B 2VT0A 5DHVB 5HHXH 5E2TL 1M71A 4FZ8H 5D7IF 1LEGA 5HYJA 3D7PA 3JV6B 4IBWA 1X5XA 1PG7L 2IQ9H 3NSFA 1WVZA 2IALB 1PZUB 2KMWA 2NYYC 2GBAA 4RIRB 2P8MA 1TTBA 3FRUA 4BFOA 4QI3A 1XR9B 5C09B 4V2BA 5BUGA 2Z3FA 4HJJL 3VTTA 5KBKA 2N56A 1WFOA 4ILDA 4P5TC 4AQ8A 2J44A 2GSGA 2HJKA 1X5JA 1R3JA 2CA4A 4Z7UE 1VKXA 2DLGA 3WO4C 2DWXA 3KM1A 3HNSH 4P9HL 3N42F 1Z5LA 2FYYB 1A6ZB 1KTBA 3QO0A 1LK2A 3UBXG 3GXIA 4FTVB 5HGHA 3S34L 4M7LT 5C0NC 2J1ZA 1LMKA 2FECL 1A9EA 4RGOL 5D71L 3LKQB 4OKDA 3DDGA 3J27A 5D2NA 5HHVH 3LIZH 1QLRA 2F5AL 1MFCL 1P0SE 3S3DB 3VI4B 1IBZA 4L8SA 1AMYA 1S7XA 3BLPX 4LBEA 3AREC 4YLBA 2VDRH 4NDMA 4M29A 2Z35A 4LO9A 2SEBB 4XNUH 1QHPA 5HYFA 1TQSA 1T5WB 1PMYA 3NIDE 3QPQD 2GW5A 4WW2A 2GYSA 5AZEH 4TUKH 2R29L 2JB6A 3GBEA 4XCFL 1ZGLB 4DEPC 3K3QA 1EEYA 1LEIA 3R06B 1KCVL 2CBPA 3H0TB 3MUZ1 4IJ3B 4J6RH 1YNLL 2F5BH 2C7UA 3CFDB 4LP5A 4PJAE 1BBJB 3IBEA 4PJEA 3DMMC 3V4UL 3F8UB 1I4FB 2WIIB 5E6SB 5LG1A 5K1VA 5EU4A 1NC2D 3JWNG 5D96B 3QRFM 5FGRA 4FULA 3UTOA 3OKDA 3GRGA 3LVTA 2W92A 5D1QB 4Q6IB 4GG6E 3EYFA 1DQVA 1RJZB 4IBLT 1D6VH 2NLJB 5E6YA 2YD7A 3DVIA 4DZ8B 2RACA 4GBXD 4M7ZC 3M88A 1VIWA 3ECBB 5KSUB 2WN3A 3MROA 4KZCA 3I6GB 1NKOA 1IKFH 4DHLA 3CXHK 1PX4A 4L48A 5GGQH 3BCDA 2R56H 3BH8A 1ZPLA 3L6FB 4G6FD 3HZVA 3O6LH 5I6KA 1D5XA 4RFOL 3QI9B 1FN4B 3REWA 4HUXB 1I8LA 3ARYA 3KL5A 3TJEH 2MRYA 2WQAA 1WIUA 1NCGA 2XWXA 4WEMB 1YAIA 4D0CA 1E6OL 2XXGA 3FTVA 4QCIB 3B8SA 3QWRA 4BWUA 5C07B 3VGEA 3QEQB 1LP9E 5DQ9A 1TVHA 4HG4K 1EXGA 1JZJA 1MHHA 1KPVA 1XT5A 4BCXA 4KMLB 3CD4A 4GSQA 1DFBH 3IDXH 1HHKA 2P49B 1O7VA 2OP4H 1HYSD 3AITA 3V52H 1S9XB 3TP4A 3PNRB 4DP6X 1OTSC 4M8VA 1OT2A 5DZ9A 2PN5A 4S0SD 2B20A 3JBG7 1D9KC 1E4XI 2DWEA 1NCAH 5I30L 4DEWA 3FCUB 2CMRH 1GH7A 3HAEB 1PS3A 3RB5A 5F3HB 3FU7A 4JQXA 3MACL 4UOZA 1N64L 2X4OA 2R69H 2Z1PA 4AEEA 3O8XA 3B6SA 4UZSA 5EEYA 4M43H 1AI1H 1I9JH 3GF8A 3L7EA 3O4LE 5CLWA 2X7LB 2AJUL 4JB9L 3D87B 1MFVA 3FUMA 3NZUA 3GRWA 4AT6B 5I6NA 1C08A 3A6CL 4P07A 4HUVB 4E5XA 1AE6H 5ACZB 1HNFA 3DX9B 2XZAH 5KYXA 1SOXA 3DSFL 4F2EA 2VR9A 4R90H 1AIFA 2ARJB 1PZSA 2EAEA 3FU9A 4L4JA 4L9LC 4X7SH 2HFEA 5H2BB 4IMLB 3RZWA 3QUXD 1RI8A 2W1NA 4HZ1A 2BS9A 4PJCA 2NSMA 1C8PA 4X6CF 1OM9A 3H9SB 1KIRB 5BS0A 1JGIA 1QWHA 2UZXB 2O1AA 1HCFX 1WFJA 4JREC 2FJHB 4D3CH 4JDZA 2BIPA 3AC0A 4MS8C 1CFBA 3O45A 5EBMB 3BWZA 2Q8BH 1NMAL 1JL8A 4F37F 3CZNA 4FG2A 2DQTL 5DRNB 3TNMB 1ZHBA 2APWA 2V0AA 3BT2H 3K72A 4QWWC 4PCSA 5DK3A 3PWVA 3MLXL 5IB2B 4B7IA 4X7TA 2WMPB 3DYMA 2EADA 3MKKA 2PP7A 2VOTA 3PWJA 5IBUB 1IAOB 4EDXB 5JXAL 1H6TA 2OMNA 3Q1SH 5I6OA 3OMNB 3OBAA 4FQIH 2WSKA 3ARUA 1P7QD 4NC1E 4KVNH 1WRFA 2AQTA 5GGRY 4Y4FB 1FNAA 4K5PA 3H3PH 5D2LA 4UT7L 4ELMF 4KI5E 4HALA 3EO9L 2QJDA 3UAAA 5DO8A 2IGFH 1NM9A 2BXYA 4R7XA 4Z77B 5GJSH 4MQXC 2CXKA 5EC1A 1UKSA 4ZMWA 4P5RA 1BFVH 3NABL 2LW3A 4JG1L 3GZQA 4NRZA 4ZOCA 4ZUTA 4OBSA 5HDBF 3QNYB 1EERB 3QUMH 4JHWL 1Q90A 4AM0B 3TBSB 3KDPB 2HUEA 1FCGA 1NCTA 4GRMB 5TD4A 4KROC 3ZKMC 4Y7OC 5IHBA 1VDGA 1Q9KA 1XCWA 4GS7B 3GHBL 4MNHA 1CE1L 4OZIA 4XPTL 5EZLA 1SMOA 3FTGB 1BG9A 2OCJA 4OF7A 4FHBD 3KPRA 4HXBH 3RE0A 5IOPB 1UD2A 5DVOA 5EZIL 4MD4B 1A6PA 1OE3A 2Z93B 4UBDC 5I1KL 2F54D 4P2OA 4N2LA 2H0EA 4OTXH 3MRQB 4HIEB 3EUUA 5SV4A 5TH2B 3ZE2E 2MQ3A 1TITA 4BSWA 5A3IC 4ZO8A 2GTWB 5C0DB 2JB5H 3RDTC 3ZE0B 2NT0A 3RVWD 2Q20A 1QFWM 2NZ9D 3KLSA 2OLDA 3PNWA 1BQ5A 1R3LB 2Y9RT 3ZKSD 3QIUD 3ZLQC 2YD2A 4TL5A 3AG4B 2NT1A 5FO7A 1E9PB 4K5MA 1DUZB 3OL2A 3ZYIA 4F15C 1ZIAA 4LHJB 4Y7MA 1WISA 4KUZH 3IMSA 3KG5A 5LN4A 3X1BA 4F7MB 4UOJA 3MRPB 3TN0D 2X0VA 1MVYA 3UROR 1RURL 3BUTA 3VH8A 3CE1A 5D71H 2L7EA 5ELIA 5AVSB 1SDAB 3CCHA 2ARWA 2WXGA 5DMGD 2ZX6A 4S2SA 3QQ4A 1DQQA 4XR8C 4Z78A 1UD4A 4ZFZB 3VG0L 2F5AH 3N1FC 1KBBA 3AABA 2X2JA 3TT1L 1ZK9A 1OSEA 4P2RB 1UCTA 2EE9A 3LPPA 5E4EB 2VB5A 4IRJA 5GGUA 1OK0A 1XF3A 1TZHA 1U8LA 2MOQA 4HSAC 1OWWA 4XP5L 4XMWA 1IGYB 1AZZC 1TMQA 2A0LC 5D7HA 4X83A 3B2VL 5F1NA 3IJYB 1H3GA 3B9VA 4OD3L 4EIZC 3WIHL 1EAJA 1CYWA 2UWEF 4NBZB 1JV5B 5FCSH 2XU9A 1GGIH 2W38A 4R3SA 1ZANH 2Y6SD 4CBZA 1KJ2B 4B96A 2Z7WA 4KY2A 4N0YH 2DQHL 4W68A 1NGYA 1NLBH 1ONQB 3ARTA 5ES4B 4C83B 4U6YB 3IMVA 2ILLA 4LCYA 2ICWJ 3T8XB 4QRRB 1NUDA 5AVVB 1DVQA 3A6OA 2ZXQA 4V1DB 2NY0B 1WG3A 4X5PA 4DK5A 2FQGA 1JZ8A 1AP2A 2NCMA 2JE8A 2XOTA 3NDYE 5EH1A 4X8XA 2DLTA 3ZIMA 3NP4A 1A7BA 2PPFA 5BW7A 1WK0A 4HFUH 1YEJL 5DU7A 1T04A 4HX1B 5J1AB 4RFOH 5FWRA 1MJ8L 1TVBB 3AS3A 3QUXA 3RWJB 5DD5L 1JHKL 3U46B 4Y19D 4UF7C 1F6AA 1E6OH 4TNWK 2HT4D 1W0VA 1YQVL 4H5SB 2WLMA 4J8RB 2ICEB 4EUPB 1DN0A 3AXLB 4PJ9D 1QLFB 3LH2L 4YBQD 5D6DC 2X9YA 2K8MA 4RQQB 1DHKA 1VADA 1P5UA 3BUPA 1ED3A 4YDMA 1RJLB 4I1RA 3WTWA 5EMYA 3LKRB 2VDPB 2PWEA 3NSYA 1RK0B 3MVSA 3QVAA 1NGWA 3GXDA 3D18A 3PAVA 3O6FC 5IR1B 4JQVC 4ZX3A 1JVOA 1MCEA 4IW4C 4H25A 1OPOA 3OM3B 1XWVA 4YXLH 5IW1A 5JOPD 3W37A 2Q7YB 4CC1A 1H6FA 5I30H 5KTEL 1OGTA 2A74C 2XQYA 3BUYB 4OUOA 2CBOA 4FQXB 5D5ME 5D7JB 5SX4H 2FEJA 3MACH 4BFIB 1O7DC 1H6UA 4AV4A 2NUPB 1NAKL 1TZGL 2WXPA 1YEFH 1F13A 5BJTB 1JFQH 4DOHE 1VGEL 3V6OE 1K3IA 4JB9H 4M5SA 4UM8A 4P3WA 4JPWL 3OC5A 3UTSD 1XGTA 3A6CH 5ESQA 2FD6L 1QHOA 3EYSH 2XPGA 4PJHF 3TZVC 5FO9B 1EJ6A 3HHMA 4F9PA 5CZRA 4FKKA 3MBWA 2QVFB 3UTPE 3BEVA 1B4LA 3AUVA 3OAYK 3O4OC 3IDJA 3A5VA 2IAMB 2F7RA 3QZWG 1OB0A 4FNPA 1A14H 1S8DB 1N18A 1JMZA 3GEFA 4XP1H 4A37A 4O58L 1L3NA 1Q8MA 4PTUA 2ZKWA 3U36B 4AZUA 4PS7A 4B95C 2NNCA 5GS1C 5CBAB 3HVNA 4JFFA 2F54A 3JWNH 4AUYA 5EUOF 1R47A 3N40P 3ZYZA 2NQ3A 5BOPA 4JDEA 2J43A 2YZ8A 4C54A 1A3LH 4QLRA 4BWTA 1U9KA 3BAXA 3MLXH 5F1KC 2WXLA 4E42B 5EF2A 4HLZH 2UX6A 1BAFH 3U2SA 2Q86A 4QTFA 3K80A 1NMCC 1CDYA 5JXAH 2OQJA 4ZSOE 1YEEH 2WLZA 3B7UX 4UTBA 2ZCKL 3NCWA 3LXCA 4K9JA 5F6IC 5GIRB 4LAQH 1ES0B 5JIDA 4FCHA 2OZ4L 3CPLA 1DSWA 4IOFD 2GIMA 4N26A 3TN0A 4KVCH 1TZIA 1JS4A 1JPTH 4BH8A 1MFBL 1PZBA 3N04A 2AGJH 1RIUH 2H0FA 3PXLA 3KBHE 2VISA 4HIHA 1OM3L 1AGCA 3X17A 5IB3A 1MFAL 2EEDA 3Q5TA 5BVPL 5CN3A 2VDRB 4JG1H 3NABH 3UO1L 3L5HA 1WUZA 1WV7T 3DTDA 1QZ1A 1BVKB 2EIDA 5CWSB 3F7QA 2PCXA 3K6DA 3KWWB 4XC3L 3GHBH 3S5LA 4H1LG 4AQEB 1U95A 2QKSA 4XPTH 5AZUA 1VFMA 4LSQH 1D2PA 3U2IA 4E41D 4CU6A 3CFKA 3QDAA 3U7AA 1EZSA 4QYOB 2EACA 5EZIH 4ZOAA 2X6CA 2OMUA 5EIVA 1T21B 5I1KH 3DOSA 3FAXA 2BOLA 5DJXB 1W72A 3ARDC 4X4XB 1YLBB 5ICUA 4BDVA 2GPZA 4NQED 4X42A 1ZE3H 2V2WA 5EU6E 5KVGL 3CLEL 4KJYB 3V4PB 4K3DH 4K71B 3HG2A 4UZGA 2OYMA 1GYAA 3C5ZD 1JPFA 2Y5QA 3DGCR 4J23A 5FB8A 3CUPA 4ENEC 1EK3A 1XAKA 2FHFA 1S5IL 3P3UA 1OP9A 3B7YA 4U1HA 1DJYA 2EVIA 4S1DD 3ZTJG 3WOVA 4JRYD 2ZXDA 4AQAB 3RFRA 1UT2A 3MODH 4PH8A 5T33L 2A6JB 1CI3M 3VNYA 2PWFA 2QDWA 1AHWC 2DOCA 3TIEB 2ERJC 3KYKH 4CU8A 3FH8A 5F7HA 2VXQH 3VNZA 2JCCF 4Y19A 2W07B 3WUZA 3QFDB 1KXHA 4GP4B 3MREB 3S37L 2WTRB 3EHBD 2W91A 3VG0H 3WEXA 1XZWA 3A0OA 3BPCB 4PJ9A 4TQEL 3TT1H 1RK1B 1O7SA 4P23B 4IRSC 1GKEA 3JUZA 4KK8D 4PCYA 2LLNA 2H3KA 2PR4L 4K9EH 4FI8A 2KLSA 2O72A 4D9QD 3GSVB 1KB9J 3VVVA 5HI4C 1RZFL 4CGUB 4N3UA 3TCLB 2NY3D 4UIMA 2UV3A 3L16A 1WJ3A 5BRZD 4QJ4B 5E8EA 1JSYA 1X4XA 3I85A 4Q58C 1EO5A 4P5KB 1WUNT 1H3XA 3KPSD 3DLQR 1L6XA 3VFSA 1ITBB 3SDDC 4XO5A 1GTNA 3L45A 4ODSH 1VGKA 5EZJB 3UZVB 2Z65C 1AMXA 5LKNA 3NFPA 2XXCB 4G6AD 2DQHH 4NKIL 5KSAD 3UBHA 1N3NA 1T89C 1FL6B 4OVVA 4OM1H 4KRPD 1RZJC 1X5KA 1TTRA 1IGJB 4WHYH 2G9KA 3UTSA 1W2KT 5IVXE 2O61A 1IB5A 3PABA 3KH4A 1VZIA 3VWKB 4YSRA 3FOMB 3PGCB 4WFFD 3KS0H 4HSQA 1YNTB 5FYKE 1YEJH 4PJBF 1AZVA 2W0FA 2WZ5A 2JKSA 2XKNB 4DVBB 2OJEB 2IFFL 4B9ZA 1MJ8H 2YPLA 5DD5H 2HG0A 5IFJA 4FNSA 2VR8A 3IKKA 2R0ZH 1RUPH 3EOBA 2ZX5A 5C7XL 5IMKB 2IV8A 4J3VA 2EEAA 3SDAD 3DUHA 1RL1A 2IOMA 3QUKA 5EOCH 4XN4A 1XIWD 3LH2H 4KDTA 3UOAB 2QLYA 3DVNB 1HEHC 5DO2D 3V5HB 1WQVT 1X5AA 2AEWA 1HHIB 2P5EB 4A66A 5AAMA 1IT9L 5KVFE 4JZJA 3QIBB 5HGDA 3N41F 3EGSB 3MNWB 3QXAA 2H2SD 4LCIL 1MZYA 2AF2A 1UXSB 2GUOA 1LEKB 3P77B 3N42B 1I1RA 3QDJA 4NWUH 1QOKA 4PRHB 5FM8A 4XTRD 4AQZA 1HTYA 1AAJA 2FBOJ 2D9QB 1E9QA 4Z0XB 2XNAB 1P7KB 1T03L 4MXWL 2QHLA 2Y07L 4KWUA 4PBXA 1AGEB 2GAZA 4FXKB 1BZEA 4LLYB 4NZTH 4HJEA 2XVBA 2BS8A 5K9OA 3V5DB 3B5GA 5I0YA 3P3TA 2QKIB 3PXJA 2ZQKA 4JPWH 5SWZB 4CSPA 1BA9A 3RWIA 4EE2A 4K7PX 5CLXA 1XF4A 4GYBA 1T5KA 4MBOA 3NJFA 4GT0A 1N0XH 4HBCL 2AS5M 5T3XD 3O3BB 3VXMA 1KPRA 4DP1X 3F84A 2CM6A 5ALBH 1B0GA 5D4JA 2WXIA 4N1EA 2YWZA 3C08L 1ASPA 3FOLA 3BXNB 3QFJE 1A4JB 3Q8CA 5KG9A 1T7XA 4JFDD 4PWHA 5LGHH 1YEDA 4HVBA 1J5HA 2QMKA 1I3UA 4Z1PA 1JOIA 4MMXB 4O58H 1BEYL 1CQYA 4R4NC 1WBXA 2K3TA 4RMSA 3FT0A 4WUUE 1CG9A 4PRDA 1J5IA 4LLQB 1T83C 2IH1A 4YHLH 1PJ9A 5HYSB 3L8QA 2NY4D 1X5IA 4TVSa 1CD1A 3M7OA 3ZZQA 2C3WA 4FKHA 5CZXD 3PP4L 4GKSA 5HHOA 3KXFB 4IOIB 2HT3C 3L54A 2QPFA 3NGBB 5DS2A 4E9LA 2PPAA 2FT8A 3C5ZA 2HP4A 3NH7H 2WY3B 3U6RA 1RSYA 4APQB 1U3HC 1N0LA 3G6JA 3BIAX 5C0RH 3LVEA 4JRYA 3VWJA 3MOAL 4W9KC 1WBYB 3N91A 4YHMH 4IOSD 5KYUA 1FSKC 3F65A 1UASA 2R23A 1MFBH 3IETB 3RKDC 5EU7C 1IV8A 2XFXA 5TDPA 3VX0A 3B9DA 4RAVA 4B0MM 3MUHL 3KPLA 4G3YL 1OM3H 5CEZL 2NR6C 2E7BA 3BVNB 1MFAH 4FQQB 2Z7YA 5BVPH 1FC2D 1QYGL 4QRQA 3NSDA 1NH6A 4RWHA 3UO1H 5TF0A 2JJWA 2Y23A 2X1PA 3PWPD 4Y9EA 1VAHA 5F9DC 1XCQB 1U4EA 1FYTB 3GJEA 5IQOA 4XC3H 1NMBL 4L5FE 2NXZC 4P04A 4RBPH 1OB1B 4XXCC 4C47A 1DDTA 1G7IB 5BRZA 1E2ZA 1E8ZA 1YEWA 4GW1B 1GCYA 2AI0L 2WZ0A 1DLFH 5GRYA 3X1GA 1DYZA 3FQTB 4X7EC 2VZVA 1TETH 2ZP0T 2XQYK 2P3YA 3IE4A 4DUWA 3D07A 4LOUC 4ZUSA 5C8JB 2G3MA 4MNGA 5MENE 1W91A 2AK1H 1ZLVH 3MFFA 1NFDE 1PBYA 2OR9L 5PCYA 3WS3A 5KS9F 3N1QC 4AEFA 5GSVB 3FULA 3ZQXA 1X4ZA 1YMMB 2G9HA 4G9FD 2BP3A 4N90D 3RNQB 2VQTA 1S5IH 3IDYC 3OJ2C 2OMVA 3I9IA 3FPYA 1XH0A 3MJ8B 3LEVL 4AQ1B 3ARWA 4U1LB 5D8JL 1DZBA 3SKNB 2PETA 2VUOA 3EGDB 3UTTB 3OZLA 1MLBB 3IJSB 3UYRL 2A73A 2X4RA 4HXAH 5AD0A 3C60D 1IC4H 2D2OA 1MHEA 4RMBA 5I0WA 2OMBA 3C2SA 3ZE1F 4OD2A 1DSYA 1EZUA 3VXSA 5AYUH 1MWAL 3DNKA 1RJCA 3BVXA 5INCA 4BWWA 2EYSA 1MY7A 4F8LA 2ZOTA 3G08A 3C87A 5F7AA 5FCUL 4ZUVB 1EO7A 4QNPF 1UWGL 1J8KA 3MA7B 1YYLH 1CFNB 2PR4H 4L3EA 2R59A 1CMOA 4J4PA 3DI2B 3E38A 4L1BA 2DYPD 1EO8L 4MXQD 5DLML 1HEJC 1A7NL 3TBWA 3NIGF 3UBXB 1N5YH 4PGEA 2ATKB 5DJYB 3LRLA 3VGDA 1U92B 2R0KL 2YFOA 4PJ5D 5EN2B 2NMSA 3MO1A 3SPVB 1DCEA 3P9WB 3UCRA 3WNPA 1OV8A 2IDSA 2VZOA 3L5XH 4L0PB 4NQVB 1T1WB 4GLRI 4ZZFA 5JHMA 2ZOWA 4X5WA 1BVNP 3KMDA 4NKIH 1J8HE 4BH7B 1MUJB 5AZ2L 4N9GB 3GSOA 5HDBB 5BVJB 1QRKA 4NOFA 4HDIB 2RD0A 4H8WL 5FLVA 1WCBB 3THML 5FS5A 4F80A 1XB6A 1CK0L 2UZYA 3L3GB 5I1DA 1PD6A 3LIUA 1L9SA 2E59A 1UACL 2MJWA 3MBEA 4NNYB 4O51A 4NI3A 4J3OG 2YAMA 4K5OA 3JTTA 4UQ9A 1I7TB 3D06A 5EBGA 4O9HL 4PY7B 4ETQB 1EFXB 4UDUA 2ITFA 3A4DA 3CZJA 4WJ5A 3V2AR 5I73B 3DYPA 5C7XH 5C6PB 4OZHA 4JFXA 4BE6A 4ZJ9A 2IQAB 1RZJL 2IADA 2QGEA 2FH6A 5JR1L 4JM2B 1QBAA 4MMZA 4OCXH 2D9CA 3ROLA 1IT9H 4DQAA 1LO0L 1FLRH 5AALA 1I7RB 4YHKH 4NERA 4DP8X 3K6SA 2DKMA 3OG4B 1ROWA 4R8WL 1DBKL 3FHQA 3V9FA 2VSCA 2Q87A 4NJ9L 5D1ZC 4TQPA 2MQGA 1OAZL 4MDIB 4HCRH 1QFWL 1WIPA 3KLAA 4F5CA 4MXWH 2WN2A 2VITB 4NC2B 1ORQA 2XTLA 4PP1D 2Y07H 2ADGA 4CVZB 5K9JH 2EVJA 4LU5L 2AEQH 4KI5C 5C08E 1BLNB 2IWKA 4K7FA 4XBMA 5HSFA 2GVYA 2YUZA 3FN0L 4XP9H 1BD2D 4P9ML 4KKZA 4MD0A 1F6LL 3V4VL 3AQYA 4NQXA 3DROA 3BZEB 3O3DA 5ICXA 3H2PA 3NQKA 1G5AA 1HXYB 3SCMD 3PWPA 3VDCA 3ZU8A 1CO1A 1R1CA 4Z7OE 5TK4A 1UT9A 3C08H 4DCQA 3H2QA 4D9RE 4QHUB 3UCQA 4BKTC 5JQIB 2C9UA 3GJFH 2V2XB 3TIDA 4L0YA 4H7VA 2YD5A 1IL1B 2J12B 2B7DT 1NGQL 4PS4H 1JRHI 2WUCL 3S98A 4K0OA 4QRTB 5JTWA 3FCTA 5LDUA 1G9NC 3B7TA 5IVOA 3QJRB 3STZA 4Q97A 4MXVE 2TSBA 3APFA 4EZKA 2ITCA 5E9AA 1KIQA 4WVRA 1JPEA 4YDZA 1KNOB 1MCHA 4ZQKB 5FM5O 4KKLC 2YUVA 5T5FL 2QSTA 1MAMH 4Z18A 5JQ6L 4YO0A 3DARA 1K72A 2ZWNA 3A6BL 2EZ0C 3WE6A 3PP4H 1OL0A 2ZKXA 4PQXA 4JN2A 1AR1C 3EFFB 3MNZA 5HYEA 4I77L 5AW4B 4ONHA 1EEZB 4GMTL 5TGBB 1FJ1A 1BQKA 4OV5B 4FL4C 4QOKB 4R96B 3DXAD 1OCZB 3IDNA 3U4BL 4F7TB 1MG3C 1O9VA 4HWBA 3SJVB 1DBBL 4IRZL 4UQIM 1HN1A 2WNKA 4WUKL 3GI9L 3J8F7 3D3VA 3NZSA 4LZKA 1K8IA 5HHPA 2GEEA 2PXYA 4Z7IA 5MEQB 4DFIA 4U7KA 2EE0A 1ILUA 3PQYD 1J0IA 4G3YH 3QIWC 4P5TB 1JGDA 5CEZH 5GSRA 1YNKH 2YEVB 3DHJA 5H37A 4BFNA 2IGLA 5ID1A 1K8DA 1TZAA 2KZBA 4LSPH 3SKMB 5KANI 3WO4B 2X38A 3FB5B 1WP6A 3BPNC 4Y5XA 5EO0B 3AADB 5J11C 2A6KB 4BZYA 1RUAL 4B6ZA 5FFLA 4Z7NE 4CJ0A 5DRZA 2DYPA 1NMBH 2IAND 2J57A 2FE0A 2ZOLB 3W39A 1WZMA 1MCFA 3EYQD 2VDML 1J0HA 3BP5A 1T22A 3Q8FA 4PR5A 5D6CB 5F21B 2ESVB 4PGCB 3TT3L 1O6SA 5I1GL 2DEXX 2RFXB 2EKSB 1SYVB 3HPJA 1HL8A 3BN9D 4PJ5A 3PIQA 2HRGA 3QJFB 4LLUB 4YDIH 1FZMA 2WB7A 3CDGA 1KB9K 1OAUH 4IDLA 5EIIA 5AW8B 2VZUA 5LQBL 3ZRSA 2Z4TA 4NM8L 2EIZA 1RMFL 4L9DA 3AREB 2VLLB 2ZUSA 4BE5A 3GT6A 3ZSSA 2CE6A 4O5LH 1A4CA 5E2VH 2OR9H 4PBDA 5HYIA 3HG5A 1KLUB 2YAEA 3BZ5A 5T1DL 3Q05A 4DEPB 3LH9A 3U4AA 5DJAA 1DZ0A 1OARH 5A2JH 4ANUA 3LEVH 4ZW8A 5FA4A 1MKFA 2LU4A 3MLYL 4RFEA 1XZ0B 4GW4B 4FYQA 3D85A 3DMMB 3G3LA 3SBQA 1S7WA 1I1AA 5DJ8A 3PUUA 1B6UA 2CPUA 5BV7H 1A7RL 4K5LA 3GEWB 4YZFE 3DUUA 2Y4SA 1A64A 1AQDA 2Y7MA 1WTLA 2IWEA 4OGXL 1OF2B 4R4BB 1TYJA 5E5LA 3NESA 1W8NA 2OMZA 4X6DA 3TBYB 5IWLC 2DLHA 1G9MC 5EUOB 4KUCF 1KTJA 2A6DA 2Y7QA 2OR7A 4CVWA 4ORGA 2UY6B 4M7ZB 4NPKA 4MKTA 4TSBL 4PI0A 2VYRE 4BK8A 2EDBA 5FCUH 4MNQE 2VWEC 4U3XA 3N9GH 3R8QA 1EO8H 5DLMH 3VSTA 3M1CA 2ED7A 1A7NH 3B5TA 3OD3A 3DVGB 2XCMC 4PM1A 3I9GL 1E7UA 3VD0A 4ZUUA 1G0YR 4G7VL 3AS0A 1QO3B 2R0KH 2YPVL 3QPQC 4LCCC 4PRIE 5C0AA 1RFDL 3F62A 4LARL 2DWTA 3ZOAA 4C4BA 5J1TC 2C5DC 5J6GA 4OZFH 4LVNC 1BVNT 1M05A 3DURB 3B8YA 1WAPA 4Q52A 4QXWA 2I9TB 4K23L 4HV8A 2PABA 4AYBA 4YPJA 1HH9A 2B77A 4NM4H 4JQIH 3EJSA 3FUHA 2BHZA 2HLFD 3V6OC 2E74C 1KV3A 1PZ3A 2CBQA 2BP0B 6PCYA 1UVQA 1IILE 4H8WH 4J28A 2DQGL 1D9KB 3SCMA 3B2MA 2BSDA 1CK0H 3BW9B 3Q06A 1OGAE 4BCYA 3F6LA 1UACH 3FMGL 2BP8B 4NAMA 3QCVH 4RWYL 2QR0B 1SEBA 2BSSB 2UXTA 4GBXC 2B9AA 3CDZA 2GK0A 4B41A 3LNFA 3MLUL 4KXAA 5T1KB 2VMDA 1WC7B 5H4YA 2GT9B 3IFLH 1WAEA 1TJMA 5EIQA 1SVCP 4L8DA 4C59B 4GUPB 5IY5B 1H9VA 3GSUA 5HYQB 3D39D 4QXGL 3TESA 2CLVB 4MCYA 2P5WB 1RZJH 4PPTA 4NN7C 2YRBA 3BKCH 2FX7L 4EI0A 4R4FH 2R0LL 2C3VA 1QVOA 3P9MB 1VFAA 2LE9A 1X9LA 1KELH 3QNXA 4E9XA 4JKKA 1SFDA 3BO8A 2XZQL 1MSPA 4L9LB 4GG6A 1VFBB 4JMXA 3RIAK 4X80L 3UC0H 1DBKH 4QTHA 2OM5A 1HYSC 4JREB 3OKNA 1OAZH 1M7UA 3VFOA 4L8BA 3U79A 3OX8A 1F3JB 2AMUA 4FQHB 4ANKA 3QG7L 4XPGL 2FZ3A 2CQVA 5EG6C 3T3PE 3M1OA 4XMPL 1NIAA 5A16A 3SGKA 5INDB 4NQCE 4PRBB 1NCUA 3FN0H 3S9DB 2DBLH 2GUYA 4JDTH 4YJZL 2X4PB 1UA6L 5JO5A 3PRZA 1KIUB 3HG3A 3VRJA 4GXVH 1LP9A 3X14A 2ZWSA 3EDDA 5DJZA 5GXBB 4R2GD 1ERNA 4WI9A 3H42L 1FL3B 1U8QA 1SRDA 4KKAD 5B3NA 2AAAA 3RY4A 3AAZA 4Q2ZA 4KXZH 5TDOA 1S3KL 2PO6D 5TF1L 2E27H 4OFKA 1D5MB 1NGQH 3IJ9A 2BCKA 4NGHH 1Q0XL 5D1XE 3PFUA 4H0IA 2R27A 3VFRA 1R5WA 4XOAA 3ISRA 3TPUB 1ZLUH 2VIRA 3BSZA 4XCEB 5GGVH 4J5VA 1MCQA 4N0FA 3WIFB 1FZJA 1XTLA 3K0WA 3KLHD 2F68X 2I9LA 3DC0A 2NY7L 4PY8I 5T5FH 5JQ6H 2PPEA 3WFBL 5GRVK 3ECVA 3O4LA 2VL5B 3A6BH 2Y5EA 3L3JA 2WWOA 4KROB 4QXTA 3OF6D 3KL0A 1C7SA 1HNYA 1ZOXA 3EYVA 4ZMQA 3DGGB 1NDTA 2JCWA 2FSEB 4PJBB 2BVQB 1COBA 4GMTH 2NW2B 4NUMA 1PD1A 4I18A 4G80A 3C8KB 3QZWB 4LIQH 4NPJA 2EDDA 1SJEB 4YFDB 1BJ1H 1GZQA 4A7GA 1G9NL 3U4EB 2IDTA 3ZXAC 1M6OA 4IRZH 5I1AA 1KPUB 3QS2A 2BHYA 3MAWA 4WUKH 3GI9H 1AJ7L 4WU7A 3WSQL 1Z32X 2K45A 3GNML 4Y5YA 1H19A 4TUJB 2APXA 3TXAA 3L9RB 2GY7B 3RDTB 3WHXA 1UJ3C 3KD4A 3MYJB 4QRUB 1D5ZB 3A4EA 4RGMC 5DRWA 3EDKA 4M3KB 4XBEL 4A67A 1TU2A 1SJXA 4NENA 4F15B 3DTXB 2B39A 2HVJB 4MDJB 4HULB 3GQFA 1WE5A 5DD6B 1BQLH 3MUUA 2XETA 4WW2F 3SGDH 3IJEA 2Y7SA 2VH5H 3BDYH 5B38G 3RWGA 2VDMH 3RTQD 5GJTL 1JK8A 4G72B 1PG7W 2A3TA 4MLSA 3ALXA 2YD0A 4NNPL 1A0QH 3PHQA 3D2TA 1VHPA 2V9RA 3G5WA 4YSTA 1N26A 2LVEA 4RZCA 1XGPB 1BFOB 2BNRE 3BH9A 5IQLA 2L04A 2IH3B 1YUHB 1ZHLB 3ZDXF 4CW1B 1LO4H 3N85L 2H3NA 2Z31B 2XVKA 5F0PB 1P5VB 1A9BA 6FABL 2B1AH 1J1XL 3E1F1 5T1DH 3SKOB 1H15A 2J20A 1R5VB 3SE3C 3DX6A 3QO1B 2VABB 3NK3A 1NOFA 2BOBB 3LPGA 5A2AA 4H1LB 4R7DB 3ECWA 1E50A 3WV0A 2A9DA 5IVZA 1GOFA 2NZ9C 5LAXB 3CFEB 5F7LB 2QADD 5DTFA 2QHRL 1D5BA 3QIUC 3STLA 3DXAE 3S88L 4XVJL 3X2QB 4BRJA 4S1QL 3OR7B 3S8WA 3BUDA 5LBGA 3GXUB 1R5IA 1GS6X 1ODUA 3VRLF 4TSCH 2P8LB 3T04D 1HHGA 4YHPA 2QBWA 3VMNA 2VLJD 4JFTA 5T1LD 2NZ1A 1KDIA 1JERA 1FG2A 3K2KA 5F89B 3PQYE 1BFSA 2VR4A 1I9EA 3PF2A 2GHWB 4ZX5A 2OTWB 2DJUA 4EN3D 4G7QB 4M61A 5J13C 4NJAL 3MCKB 4G70B 1RZKC 3QNFA 3D4ZA 4O2CA 4TNEA 4XNXH 2MCG1 1FNLA 1WLHA 4Y2DD 3G6DH 2JMRA 3QYNA 2YPVH 4LARH 4HH8A 3IWUA 3C2AL 3Q9QA 1W8OA 2AW2A 2AK4D 1M9WA 2WP3O 1G9ML 1S7SB 3V8CA 3Q2CA 3SYOA 1V7ML 1G7HA 4D8PA 1K6QL 1JPGB 1S9YB 4JFQB 4GSUA 1J0KA 4FFYH 1QBBA 5G4OA 1DVUA 4LCWA 4Z3GA 1F11A 3O6FB 4N85A 4I0KA 5EO1A 2DQ6A 2Y25A 3C6SB 1LNUB 3EADA 4ZPTB 4CMMB 3FHAA 5IW6A 3EO0B 1JZ3A 3ME0A 5EU5A 4D8OA 1JF1A 2IF7A 4C56B 1JGVL 2DQGH 3D09A 5FV2A 1MCPL 1PY9A 3BWAB 1MCOH 4FFZA 3GJFB 2A74B 2OR8A 4K7PL 4QAMB 3HKFA 5D70L 4F2ME 3FMGH 5A7EA 4RWYH 2V9UA 3DUSA 3VM5A 1TQWA 2IWGA 4L1DA 4N2DA 1I1YB 3MLUH 1I3VA 5I17B 4PJCF 1HI6B 4PJGF 1U6AL 5FDWB 3ARFA 1HEZA 3RVTD 3UAJA 1TEFA 3UZQA 4YXKL 1NBVH 43CAA 3QDGB 2O6EA 3IXTA 4XNBA 4KV5E 3MSPA 5KN5B 3WS6A 1CFQA 4QXGH 4CNIB 3O3UN 4KHXL 1M4KA 1V3MA 2XIIA 3KYNA 5TDNA 5KWYC 2P48B 3TZVB 1U8OB 3SDCA 3IB4A 5JQHC 1F4AA 1LYQA 4AZ8A 4QO1A 2R0LH 2X1XR 3BH4A 3GMRB 3TF4A 5F7FA 1UZ8B 4LF3A 2XZQH 3OF6A 3KLQA 1JF5A 1CCZA 5DRXA 3CH1B 3B2UD 3EOTH 3W1ZA 1AZNA 4XBGB 3V0GA 1ADWA 3QZLA 2FVNA 2O4EA 3PJSB 2DMBA 4JY6A 5GS1B 4I2XB 2EO1A 4MJ5B 4WWKD 1L9TA 1GOHA 4PJ6A 2XWJA 5D2LF 4XPGH 2F74B 1NC4B 3FL7A 2PW1A 3FFDB 4UDTA 2C9VA 4XMPH 1FGNL 2YD1A 3LN4A 4FFVD 4YS4A 3MUGA 4Z76B 1CWVA 4H44C 3GLZA 2J8UE 3GRBA 1DJWA 2ZSWA 3IGFA 3GMPB 1X7SA 2IGTA 5DHEA 3ZBMA 7PAZA 1UWXK 2F7OA 1DJSA 4FTVE 1UA6H 4AMWA 1MDTA 4G8IA 4PSRA 4AY0A 1NMCB 4W4NA 4V2CB 2CUIA 3FQUA 1KFAL 3H42H 3OAYH 1ZHNB 5ANMA 2VDQL 1QLEL 4NQSB 5F6IB 3JWOC 1ASOA 3L7FA 3R18A 3QZMA 5L2JA 1DANU 3LV3B 1S3KH 3PU7A 5TF1H 4OZIF 1G7JB 3VI4E 4HWZA 1Q0XH 4WO4D 3D0AA 3RTQA 3TURA 3BT0A 2AANA 2R2BB 3MHZA 2DWDA 4XVUD 2CDFB 3X12B 5KJ7E 1O5PA 3APMA 4QY8A 4GP8B 3WKNA 3QQDB 4UUJB 1FIGL 1CL7L 3N44F 2VLKB 4G8GD 5F9OL 3WFBH 3NEOA 1GC1C 4X2UA 1A3ZA 2W5PA 2ZSVB 2DW5A 1XH1A 4KKBC 4PWIA 1FVEA 1DTUA 5MEPA 5J9PA 5KJ4A 1OWRM 2EH7H 2EVFA 1IIKA 2ZKYA 1DO6A 1KXVC 4AV5A 2HVKA 2Y5TA 3FTUA 3KLKA 4NFCA 3IDIB 2ZP9A 1LLAA 3K2UH 4LESA 2VKWA 5I8CB 3ARDB 3WSQH 3BUQA 4G1MA 2GTZB 4Y8AA 1E67A 5FM5M 5DD0L 1B9ZA 2R8SH 4I87A 4JJHA 1S7QA 1LE5A 1DQLH 1MWAB 3IPEA 5HPMB 1OGSA 1FNGA 4LNRB 3HR5A 3K6OA 4TM9A 1L5GA 1MF2L 3FPXA 5T1LA 1JGEB 4HHGA 1KEML 4XBEH 5E95B 1HSAA 5GGTA 4Y5VA 3U25A 4U1NA 4HT1L 3HRPA 3QUYD 4ZAKD 4HLEA 3EJJX 1AHWB 2ERJB 3K5SA 2DLFL 3QEQE 4JUSA 3V0WL 2B4CH 3VGGA 2O5ZL 2K4WA 3WY3A 3O2DA 3HPLB 5GJTH 2K9UA 4KTEL 4Y2DA 5DS1A 4OZFB 1LVEA 5EUKA 1NDMB 3NOIA 3FQ4A 2XJLA 2OS7A 3T09A 2V2TA 4Y2OB 5AOIA 5I0ZA 1MQKL 2N0MA 1NWPA 1JDAA 2PKDA 4IRSB 4Q9RH 4ODVL 1CGSL 5C0BB 3VXRB 5FIEA 3N85H 1LO5B 2Z6FA 4F93B 3SO3C 3QXDA 1XEUA 4FG6C 3HZMA 4WSGA 5DC2A 5K9KB 4GKNB 6FABH 1BF5A 1OTUD 2WXOA 5BNXD 3BPLB 4EXPX 1WPCA 3CFJA 1G7PB 4WI3A 4WI2A 4URKA 1MRFH 3VCLA 5LGJB 2NW3B 1IQDB 5LAPA 3US1A 4DP0X 4KQ3L 1KENH 3Q2LA 3ZZLA 6TAAA 2BS71 3MI6A 3LKOB 5CJXA 3SDDB 2QHRH 1U2HA 1Z5YD 1XTMA 2XN9D 4XVJH 3T2NL 4S1DC 1SMAA 3QC5X 4LHUD 5DFAA 4U6TA 4WU5A 5JORA 1XGQB 2DICA 4Z3JA 3H4FA 3PL6A 5CCHE 3HZKB 5GS0H 4AGMA 2OMYB 1K85A 5FK9A 2E3VA 32C2B 3D25B 5ICZA 1ZWIB 1ZA6A 2WXHA 2C4FU 1IBYA 2VXUL 3O2VH 5CD5C 4JKNA 3EHBC 4AMKL 5SWQB 2ADYA 1OW0C 3MRDB 1CGWA 3GSWB 2PTTB 4HMCA 4DGYL 4DFHA 1CC3A 4F7CB 3T2OA 1FPTL 1UGKA 4JFVA 2EVGA 2PWGA 5CZKA 2VE6B 4JFWA 3WMPA 5IJVA 4UTBL 4ZW6A 3S4SG 5JHDB 3OKLB 1K4DA 3ZX1A 2ITDA 1T7WA 2ADIA 3C2AH 2NY3C 1KCKA 4L29B 3VSQA 5KUMA 3O6KH 3GIVA 4WWKA 3QEGL 1G9MH 4JKPL 1N4XL 1MXGA 1DBML 5DS8A 5ADPL 1Q4NX 1AKJD 3C6LC 2XV0A 5I71C 2WV3A 1PYWB 3NJMA 5AAWC 4QGTA 2XY2A 3PV6A 5EV7A 3V4VB 2DD8L 4Y1AA 3JUYA 4DK6A 3ZHDA 3S5ZA 1P6FA 2G30A 3OLIA 4TNFA 4G6AC 5TE7H 1RZKL 4KTDL 3P69A 5KSAC 4WLCA 4L4TB 5KVFL 1JGVH 3T3MF 4IU3B 5HDQL 4JM4L 4KRPC 3WUWG 1RPUA 1IC5L 2CO6A 4K7PH 2NY6C 1PX8A 4EDWH 1CD0A 1UWEL 4XC1L 1NIBA 4JX0A 5L2KD 4TQIA 1U6AH 2BO0A 4WO4A 2R39A 1NEPA 4QT5A 3N43F 4YXKH 2Z7UA 3SE8L 4F27A 3K4DA 3MNMA 5F9JB 1ZS8A 1KJMA 3KHQA 3I3BA 4KHXH 1N10A 5KZCB 1A4KA 4EKXA 2MQCA 4HWUA 4OM0L 1SN0A 3TBVB 3HNTH 3UL4A 3MR9A 3SDAC 1UGNA 3TH2T 5JZ7C 4JZNB 5A7BA 4R83A 1XIWC 3O6ML 1U93A 2QDVA 4N2AA 5DO2C 1ZK5A 3ULUE 3GMOB 4MMYB 5IVXA 1E5CA 4Y2LA 2RQEA 5BRPA 1H8OA 4KOBA 2GJ6D 1JNLL 4XVOA 2NUTA 3FTWA 1O6TA 4ELKA 2VZTA 2ED6A 3K71A 4LEOA 4YAQA 4XTRC 3MXWL 2OPCA 5CGTA 2BW4A 2WUBL 4OJEH 5FUCE 1FGNH 4JPVH 2E0PA 2AK4E 1OCCB 2AV1B 5EU3A 5D7KE 5FA3B 5DC9B 3MV9B 1ZT1B 3U0PA 3V0VA 2VQUA 1IGML 4IQHA 5JHLA 5DD1H 3GMLB 3J07A 5DZVA 4Z7UB 1U3HB 5TE4L 5E2WH 2VDQH 1MFUA 2LFEA 2MFNA 4GSDL 2XY1A 1AGDB 1ZAGA 4KDVA 1ZGLP 3QUYA 2OULB 4ZAKA 2UVEA 4HFWB 5LG6A 5CO1A 2VDMB 5I5RA 1FSKB 3BWSA 3D0LB 4PEEA 4FA8A 2BNUA 2H26B 2YQBA 3L3HA 3MQIA 3ESVF 3SPGA 3JVFC 2WYZA 2VQ1A 4P48A 1G84A 4Y16D 3AS2A 5HY9A 3I50L 1KCRH 1DUYB 1FIGH 1CL7H 3AW5A 3HMXL 2R4RL 2P43B 4LPTA 5F9OH 3EJZD 5I23A 5IJKA 4PTTA 4WEEA 2NY4C 3VXOB 5AG9A 4JL2A 4KJPD 4FX5A 3ZZSA 4KKNA 3ABMB 3JWOL 5DEFA 4AVJA 2NXZB 4OCWL 2J1XA 3FSZA 1ZHKB 3B7SA 3BCFA 3KYOA 1F58L 5IKCB 4BQ6A 1A6TB 4YSPA 2E7LA 3QFJA 2F7PA 5LCVA 2JQMA 2WLLA 5L8JB 2XICA 3IPBA 4QRRE 4PJAB 4V1DE 2MOGA 4UM9B 5ERWA 3KCPB 2XN9A 3MLWL 4CKQA 4ETYA 5DMIH 2EEBA 4JJ5B 1WFUA 3K4AA 2G2PA 2E76C 5E08H 5J7CC 5JNYB 1DEEB 1GC1L 4JK0D 1RU9H 5DA0B 2ROXA 4LMQI 4JFSA 1QNZL 1FWXA 3TEWA 2WJ7A 2XG5A 3IDYB 4KJQD 4ALAH 1E6JL 4FAAB 3VXNB 3BZFA 5I1EL 3APDA 4HS6A 1EHLH 3MRRA 4ZX4A 4KO9A 2PYEB 3RJDA 4B9GA 2V7NB 5ANHA 1U21A 4PV1C 1J5OL 4P57A 4YEEA 2E86A 3X13B 2BM3A 4ZDHB 4M6OH 1DLHA 2O5ZH 4GO9A 4JFYA 2WXRA 4MA7H 4DUVA 4A6YL 3JTSA 3RDJA 1WFIA 1AO7D 2W9DH 4HS3B 4KTEH 3D0VA 5FKAB 2D73A 4K8RC 5AVXB 1SJMA 5CJOL 5TQ2H 5KVEE 4Z6AT 4NEHB 1G87A 3IDMB 4ODVH 2BSRA 5F7KC 4KX9A 3KDMA 4ADGA 3A21A 2QPUA 2QPEB 2FJGB 2JLPA 4M5ZL 1J18A 4LPUA 1QSVA 1F4XL 1ML0A 3GIZH 3VXQB 3RJQB 2J5WA 1Y07A 5IIEB 1I8IB 3NEEA 3CN3A 5KVDL 5HHNB 5CBEA 4Z8FH 1PZDA 4AGNA 2OV0A 2XTSA 3CV5A 3OLDA 5C3TA 4WGVB 1BQRA 2ZUYA 4M6AA 5AOKA 1ZVHA 3QP3A 1MRCL 4OY9A 4F7EA 2C9AA 2NTFB 2JIXB 4N20A 3L48A 3WUWA 4QTIH 2O6CA 2JKRM 4X4ME 3T2NH 1KBKA 3GMMA 1M71B 1IEAB 5KBDA 5C0JA 2NNXA 4CVXA 1XF5A 5I2IB 2N7BA 3L2NA 4ODTL 5CAYB 4KC3B 4M1DH 5F3BA 2AC0A 1QW8A 1A2YB 4KRLB 4YPGB 1KXTA 1U8IB 3WDHA 2XIDA 3PPEA 3FRUB 5H4ZA 2X44D 3H53A 4CUCA 5DJ0B 1YYCA 2G60H 3C60C 3NA9H 1UKQA 2VXUH 5JW4Q 2O93L 3Q2WA 5FOBA 1VKXB 1HDMB 4DGYH 1OAQL 4U33A 4X0KA 5I66B 2YLHA 3MV8D 4WHTA 1UM5L 2WBJD 2EIJB 3RUGA 3V6ZA 4ZYKA 4UTBH 3GZKA 3QO0B 2RAMA 1ZSDB 2GJ6A 2O5XL 1UOWA 4WV1A 4L3CA 4Y4HD 4MXQC 3RFZC 2J1KA 3LKNA 4U7MA 5E2UH 4WFHD 1WA1X 5GRWA 1KGJA 3V4LA 3CBRA 3QEGH 3D69B 2K70A 1MW3A 1FFNA 5I1JL 1DBMH 5ADPH 5EBLB 4YVUA 5IUSA 1DJGA 4Y4KD 5G4NA 5CEXA 5CF3A 2C1PB 4YHOL 4K3JH 1WBZA 4XGZB 2FB4L 3K8KA 1BYOA 1S7XB 2JXMB 3Q6FA 3RY5A 5K1JA 8PAZA 2GEQA 3JYBA 2J1YA 4NDMB 4OW6A 3L1FA 4KTDH 2L8AA 2Z35B 4XWGL 5DR5L 1W0WA 4B7LA 4PCTA 1Y1UA 5HDWA 5D1ZB 2P8PA 3WLWD 4JM4H 1JZ2A 1IC5H 2JB6B 2X09A 3ES6A 4DK3A 4H20L 2RH0A 4U6VH 4NKMB 1B4RA 1E5UI 1UWEH 1NIFA 3KR3L 2ZE0A 5H35A 5K33A 4WTZG 2C7UB 2R51A 1F3RB 3QR2A 4JMNA 4NRYA 2HJFB 1S3RA 3K6IA 2W9LA 5FOJA 2Z0UA 3AS1A 2D2CC 4KPHH 3SE8H 5EU4B 2HRLA 4WO0A 1CTNA 2RALA 1W72H 1XEDA 3ECQA 3IK2A 4L4VD 4Y16A 5C0CD 1AFVL 1EZVX 1AH1A 1HHHB 1MI5E 1NGXA 4ZOEA 5BOZG 1NBZA 3G04A 2VJ0A 4GAYA 1QI5A 1W16A 1Y7VA 2WWKO 3GLDA 4YXHL 2OW7A 5EORH 3CN0A 1Z3GH 3KPOA 3UG3A 1YPZE 3P0YL 5DYFA 4UINH 4HHAB 4MAUL 1URIA 4QLWA 2G5UA 3QEUA 4AYDC 2YN5A 4PY8J 4TLKA 3BH8B 4CSZA 1Y0LA 2GBUA 2BDNH 1JNLH 3LZLA 4OKVA 4XMUA 5FF6A 2PCPA 4JO8A 1J11A 4LDLB 5F9WC 1K5WA 3G6JF 1T5XB 3REWB 4HUWB 4YGAB 3NRFA 4D0CB 5DJ6B 4XPBH 1BQHG 3FDWA 1KCSL 3IS0X 1SF5A 2DI7A 1BSIA 1A1OA 1NQBA 1IVLA 3H9ZA 4PP1C 2PTVA 5DQ9B 4A2GA 3MLZL 3WEBA 2A83B 1AR1B 1KPVB 2BY0A 1M1SA 4XNMB 1IGMH 3NJLA 2JNZA 5CUSL 1AD0B 3OMZA 5TE4H 4FL4B 4GSDH 1QUNA 3OLEA 4CMHC 1OGPA 3MBXH 3OZKA 2E7MA 3L17A 3FH7A 3EH1A 5FAAA 4HC1A 2Z91A 5F9AC 1AO7A 1P53A 1CR9H 3FT1A 1FVCA 1P9MA 3QIWB 5L2KE 1MEXL 2E8ZA 2X4QA 5F0JB 4XNZB 5GRVL 3VI3A 4XOBA 2NX5B 4LRIA 4UT9L 5IEHB 5E6IA 3I50H 1KLFA 3HMXH 5C08A 3TVMD 2I26N 2R4RH 5B3JF 3ZKXC 1Q9OB 2OXHA 3BPNB 5ISZD 5J11B 1BIHA 4ZMLA 3RIAF 3JWOH 2WXQA 2O6FA 1OKEA 2VRKA 3LX9A 4AKQA 3O41B 4ICWA 4NHUA 4WWOA 3BIBX 1RVFL 1F58H 5HBBA 4I48B 2AXGB 1KTLA 3P4OB 1FAKT 5FHAH 4P0DA 1JCVA 1S46A 3UJJL 3DX7B 1I3GL 3M1BA 4GAAA 4O4YH 4PJGB 4QDGA 3BP7B 3QW9A 3ARPA 1GRWA 3HI1A 3NACL 4QRSA 3MLWH 4HGWA 5JW5A 3CC5B 1PZ5A 2ENJA 1GTFA 1G7QA 4LEBA 3MV7D 2JKIS 3FQNA 4HPOH 5IMOA 1GC1H 4HHWA 5I1IL 1NSNL 2BIMA 1QNZH 3KPQA 3K4ZA 2J2ZB 2ICCA 4P5MA 4UAHA 3CJJA 5GGVY 2GCYA 4TVPD 5D7IE 4AJYV 4MBRA 3SDXF 1SYSA 5A2LH 3GSRB 5I1EH 5JPMA 4A63A 1OCWL 1VRSA 2WP3T 4PCKA 1ZV5A 2HLEB 4TV3A 2FDBP 4ZMNA 1M7DB 1J5OH 2JSFA 1I8MB 1LO3L 4TULL 4WI4A 1C7TA 1TQCC 3LCYA 4OLYL 2X70A 1EIBA 2X6MA 4NN6C 5KYWB 2CHXA 2CJUL 5ILTL 4MJID 5C0GA 4M5YL 1EAOA 1X7QB 4RFNC 1JWUB 2YN3A 3MGOA 3R4DA 1OK8A 3SDYH 3ZHKA 4EI6A 5CJOH 1HSBB 2YGPA 2FO8A 4KI1A 1ND0A 1C5BH 2P42B 2MNWA 4Y4KA 2MHAB 2FRGP 3BN9C 5DJ2B 1WA0X 3P11L 1JNNL 4YSSA 3QDMD 4ZMXA 2WQVA 3WE1A 2K4AA 4U6XA 4ZQTA 1UZ6F 3L9BA 3VFVA 4DQOH 3I6KA 3NJHA 5KVDH 4NWTL 4PJFF 3UGXA 4B0MB 2WCPA 3IYLW 3TO4A 4M48L 4I88A 2P52A 3N0AA 1Q9KB 1ECYA 3BKYL 4LCCB 4GKZA 5B38B 1QFUL 5EZLB 5SWZE 1I8UA 1MRCH 2V7HA 3K5RA 5D5MB 4LVNB 2DQIL 3FUNA 1HCYA 4XXDB 3TA3C 3BSGA 1GZPA 4K8RL 3G5XB 2WTPA 2X5PA 3O11A 5I6XB 1OSYA 4G8AC 3ULSA 3VXUE 3ARBD 4P2QD 2PYFB 2G3ZA 2IPKB 4R7NB 1KY7A 5I1LA 1NC2B 3QCUL 3L4VA 3QUHA 3KPMA 4L4VA 4OR1A 3UX9B 4AGOA 3VSUA 5JOFB 4BSWB 3MRIA 1Z0NA 1FDLL 4R0LA 3B9KA 1YJDL 1E9OA 3UP1A 2J88L 4ZTPH 3T1FB 3VVWA 4HYTB 5F7MC 1LJMA 2IG2H 4RRPM 1J86A 4GBXB 1KTDA 1OAQH 2KQNA 2YMXH 3GC3A 3V10A 4DKAA 5KEZA 4U7SA 4XWOD 2V5YA 1UM5H 2ADJA 1L9RA 2F8XC 1CBVL 3OWEA 4G6FB 5LXGL 1UQSB 2O5XH 3AROA 3MOBL 4MYWB 2XWCA 3G5YA 4EKJA 2JK5A 5CGMA 4FQ2H 3CCHB 3BAWA 5HGAB 4E9RA 3NRPA 3BHBB 2WLNA 4M4RB 4DAGL 4BFEA 2CCVA 2R1WA 4NN7B 3F00A 4JRXD 1CVRA 5EF0A 3SPHA 1CTOA 4N2HA 2EE2A 2PW2A 2AKRB 3N1GC 1A1NB 4TQHA 5CEYA 4K94C 4PRPA 4OCMC 4CC0A 3MRCA 1LE9A 3HE6D 4LEXH 2VDQB 1QLEB 1ANUA 3FFCE 4QIRA 4BCZA 2F53A 2NDFA 2HLFC 4TN9A 3V79C 2WKOA 4IHBA 3ZR6A 3C9NA 1JGLL 4B3EA 4ODHL 1KYOJ 3M17A 1SLUA 3O3AB 3FUFA 3KR3H 1IE5A 4JKMA 4JDVA 3L13A 4OAWB 4JL1A 5IF0B 1X9RA 1FYTE 2KYIA 4PRIA 4JRLA 3H2WA 4PI2A 2KPNA 1SBSL 1T1YA 3GYRA 1AFVH 3GFUA 3CH8A 1K2DA 2XPYA 4HWNA 1FHGA 2C26A 2CK2A 3FO9A 2OTUA 4GRWF 1SJHA 4YXHH 4XNYL 3TVMA 4FXGA 1HXKA 2H4EA 3S2AA 4Z7VF 1XVSA 3ZT6A 1GGBL 4LL4A 5ISZA 4B9PA 2BP5M 5FYJU 2R2EA 3P4MB 3P0YH 4IJ3C 2FT6A 4MAUH 1EAPB 1N7MH 2BWDA 2CK0L 2WXMA 2RJMA 1NCWL 2WXNA 3QJOA 4J3SA 4MJ2A 4PUBL 5JYLA 3VD1A 1QI3A 3WXWH 1H0DB 3IKCB 1PKQB 2XXMB 3ZYJA 4U1JA 3WKPA 1QTYT 3WG7B 5DQJB 4QKXB 2EYRA 4AQOA 2H1PL 3CTTA 4J3XA 4NUGH 2DM7A 2JI1A 4O02L 4LSDA 1L6PA 2VNCA 3SO5A 4X99B 3REVB 2H2PC 4PS3A 4UAOC 1IGCL 2BOCB 1KBPA 2I85A 3FB6A 4I0PD 5CINH 1BGXL 4WDIB 3MLZH 1CT8B 1PY4A 3EF4A 3ESPA 4IYKA 4MAYC 1ED3B 2OSLA 5E8OA 3W3BA 3UTTE 5CUSH 3QE5A 5C9JA 1CZ8H 1FO0A 3QWOA 3HG1D 1ITCA 5FR3A 4IMKC 3GM0A 2BINA 2OL3A 1SDYA 1DQDL 3AACA 3DSNA 3JWDC 3QUGA 4QHMB 2E9WA 1MCDA 3T2QA 1TQUA 4JO1L 4R2GC 3L95B 1T6BX 1P7QB 4QHNA 3KS0J 5HTSA 3VFPA 2V17L 3AUWB 4E0RB 5IFHL 3NT0A 5E8DH 1PGRB 5CMAA 3VGAC 2PO6C 4BZ1L 2Q10A 1MEXH 1P2CA 1UJ3B 1BQSA 4YEFA 2D7MA 3LNHA 2G0KA 4RAUA 4RGMB 1ET7A 1HWGB 2E6QA 4M8UA 4IBUA 3WKML 2IPTH 4ELME 4NQCA 3KLHC 2I27N 5EOCJ 1U8PB 2XPGB 1YEGL 3QUZA 1VCBC 3CSYA 3IAQA 3O0RH 2ICWB 3OGCB 2MNUA 5T3XH 2HFFA 5FW7A 3VO0A 4DN3L 4NO0D 5B1JA 5EN3A 1WH0A 5AW3B 1FBIH 5G4MA 3MUY1 3AY2A 4Z7WA 1QFPA 4S1SL 1I3GH 1WZAA 2XWRA 1DBAH 3H8NA 4YUEL 2FLBT 1CURA 5HDBE 2WOYA 1QSFD 2KL6A 4CADB 1AQMA 1XH3A 3N43B 4NKOB 5D4IA 4A68A 1U8NA 3EJRA 4G8EA 1QEWA 4XP4H 3QNZA 4JPKL 1XMWA 1JHTB 4X6DF 3RRQA 3HN8A 4N2OA 3D2UB 3KGSA 3DA0A 4OT1H 5JMOC 3ARBA 4P2QA 3MNVA 5AB1A 4HKJA 5KVMC 4L1SA 1KF9B 5I1IH 1BOGB 3EBHA 2Y6TE 4M62L 5IEKA 3HC4L 2A6IA 2EO9A 2FJFA 5AKTA 2FR4B 1L7IH 2V5SA 1CICA 3RZCD 1Q38A 1WZ1H 2YPKA 3F04A 3GPSA 1OSZB 5HGBA 1XHHA 3BOVA 3H6JA 1ZSHA 1JCKA 2TSAA 3JWNE 1BWWA 3QIUB 1FORH 2P80A 2WXFA 3T71A 1LO3H 1RXLA 1XXDC 2YQGA 3EBGA 4OZ4B 4QRPD 4TULH 5F1IB 3RL2A 3MLPA 1N59B 4YL9A 3CPLB 2I69A 3I2CL 2JV6A 5C09D 2D03L 4M8QA 1U8CB 4X7CC 4BKLB 3VXTA 2CO1A 2OK0H 1N2RB 3PWNA 4ZNEE 1WGVA 4YHYC 3E8UL 3P2TA 4KJWD 4R5TA 3RL1A 5C3LD 1I3RA 2EILB 3RTQC 3PAYA 2OAAA 4WK0B 4X5XA 1OSPL 3P11H 1JNNH 5A6IA 5B21A 2WLYA 3W0WD 5J13B 5EWIL 4TUOA 4XMKL 1E4XH 5L4JA 2A5UA 3FSVA 3RGHA 4YFEA 1ID2A 2CRIA 3OSVA 4MA3B 4ODXA 4Y4FC 4NWTH 4E36A 3SQOL 2MTPA 2FL5B 2X4SB 1Z9MA 4UTAL 3MRJA 4QEGA 1EHXA 5HI3D 5C2BL 3NMEA 3S5LB 3DYOA 2R7EA 4OCLC 4PVMA 1QR1A 1EGJL 1QFUH 4HAGA 1M1XB 1IAIL 2X89D 2H8PB 2DQIH 4IK6A 5IB4A 3NIDF 4F3FB 5CCKL 3ASWA 4TPRL 4JFHD 1NIDA 4TMPA 5DJDA 4OF3A 2Q3AA 3ELAT 5T5NF 3CSBA 2QADC 5CKAA 1A6AB 4MWFA 2UY7B 4FA6A 1UOKA 3L1EA 1AC6A 3OPUA 2WCSA 1TJIL 4GIOA 3QCUH 3MV7E 2G2RA 1J48A 2VQ4A 3HBZA 1NTDA 2BNRA 1FV1B 3O3EB 4GRWH 1NFKA 2UWEE 3ABLB 4XH2B 4XPHH 1YJDH 2JTDA 5FB8B 2WPGA 3Q5OA 3H56A 4U2YA 4WI0B 3MRLB 1M6UA 2C7FA 4UZUA 3B7RL 4GG6F 3ARQA 1RCYA 3MMEA 1NJ9B 3DPBA 3BQUC 3LHAA 4JPIA 3MRNB 5B8CC 4Y5VC 4EN3C 1ETA1 1CLOL 4IBTA 3CGTA 2L0DA 2GG1A 4LLWA 4NXSA 4BQBA 2OA9A 4HWBH 1AXSB 4WUUB 4AGPA 2NYKA 5JXED 4Y19B 1R33A 4B5EA 2G5RA 5DEGB 1IGIH 1W15A 4ANXA 3CWGA 2WINA 4XVTL 5C70A 2EECA 4WTWA 3MLTB 4ZTEA 3T0ED 4QOKE 1ZDQA 3OQ3B 3ALPA 2A4ZA 3F12B 2B16A 4UMGA 3UDWC 2YKKA 5H37H 4Q9QL 1C5DA 3L2LA 2NQCA 2HCZX 3SJVE 2HKFL 3QDME 4F8NA 1LP9F 3QI9D 1HL5A 2JVUA 3FQRA 3T2LA 2NZIA 3SOTA 4OIAA 2EDEA 1FVDB 1IFGA 3U30C 1R34A 5K93A 1PQZB 3T6QC 1OAYH 3EBIA 4DGWC 5C07D 1JZ6A 4XMXA 8FABA 1QEXA 1BPVA 2W60B 3JQOB 4ODHH 5E8EB 2HSIA 3BVWA 3H9HB 1KOAA 4G8FB 4KK6D 4ZMYA 1IM9D 4PJ8A 2AJYH 4NAJA 4X6EB 3S6CA 4QRFA 4MCZA 1XF2A 2XG4A 4NNXA 1VGKB 1XSOA 3GSXA 3NCJL 3PG2A 2JKWA 1PEZA 2V37A 4YSCA 1NWOA 4NCDA 1SBSH 3RWDA 4UOW0 2XJKA 5E70A 3RVTC 4S1RL 4XVSL 1KLGA 2G5BA 3LZRA 1NUFA 2XTJD 5DGQA 4UNIA 1S7RA 5DDHA 1A