1WFUA

Solution structure of fibronectin type iii domain of mouse hypothetical protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
120
structure length
120
Chain Sequence
GSSGSSGMEPHKVVPLSKPHPPVVGKVTHHSIELYWDLEQKEKRQGPQEQWLRFSIEEEDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unnamed protein product
publication title Solution structure of fibronectin type III domain of mouse hypothetical protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wfuA01
3NCJL 5BZWA 1BLNA 1HYRC 4Y2DC 2FSEB 1OCWL 3H42H 5JW3L 1LE5A 1DQJA 4ZDHB 3DX7A 3O6FA 3VWKB 1KTDA 2OBGA 3P2TA 2EO9A 1JF1B 2W07A 3D3VA 1P9MC 3WS6A 1BF2A 1CD1B 1S9XB 1OF2A 1ODAA 1FE8H 4ZFFA 1NCCH 2GAZB 3WFDL 2HT3C 4K71B 4GLRI 4KGJA 4NM8H 5FO9A 3JWNC 4MJID 2FWOA 2I5YH 5GRJH 4EXKA 5I1AA 3RVXC 3U2SA 1FZOA 4MAUL 5AD0B 1A14L 5CCKH 1J11A 3CUPA 1W8OA 3STLB 3QCVL 3O4LA 2R9HD 1UXWA 4M1GL 5GJTH 1CVSC 2BZDA 3C5JA 4Y5VA 3P4MA 1XCTB 3FHAA 1DQQB 1IAIM 4WIQA 4XNXL 3RGVB 1FGVL 3PQYD 5E5UB 4HPOL 4WY7L 4HKZA 2LU7A 4Z7UE 3KPSA 3X12A 3DMMA 1TJIH 2X4NB 3ROLB 1T66D 1JF6A 4M03A 1T3FB 1TNMA 4PJGA 1EXUB 3QFJD 3LB6C 1I1CA 7CGTA 3VXOA 1P7HL 1LO2L 1PZUB 2Z8VC 1KIPB 3F6LA 1AO7A 4S0TD 1H5BB 2IF7A 1AGBB 4JJ5B 2BRQA 2WP3O 3MA7B 5HYJD 1IGTA 3CC5A 5HPOA 1JPFB 43CAB 1KENH 2CKBB 3QRGH 2OI9C 1HKLL 1PSKH 3GIZH 5E6YA 3ZLQC 4HJJH 4PJEE 3S3JA 3DURB 3S5LB 1TDQA 5C1MB 1QNZH 4FMKA 2PXYA 4PJ8C 3ZSSA 2BP3A 2V17H 3KYNA 4HKJB 1BFVL 1SMAA 1TJHH 1IGJB 1LWRA 3U4AA 2FRGP 3V4VL 2VR4A 3FOMA 3TPUA 4NN6C 2EDBA 4LLMB 5ENWA 5KVGL 4P2OC 5GS2D 5BW7C 3SDYH 4I2XB 5EUKA 4U33A 1B90A 4PGCA 4XBPA 2NY5C 1DSFH 1CD8A 3X3GL 4GW4B 5F1NB 5K9KA 4ZPVB 1J9CT 1KIRA 1PBYA 4UV4H 5I74B 3HB3D 2CIIA 3IJSA 4GLRH 3U7WH 1KJMB 1RZFL 2XA8L 4C4KO 5ISZD 4ZG1A 4LKCB 3OKEB 5CHNB 4FQCH 2I24N 3CFJA 3BMWA 5DQJA 4FFZL 4OCWL 3CVHL 4FQPA 2VXQH 3QDJE 4LMQE 3ILPB 3T04D 3SGEH 1ORSB 4KTDH 1S7SB 1K5NA 4J23A 2ADFL 3OMZA 4HGWB 3GKWH 3F65A 3ROOB 5CP7A 1GC1L 2GTWB 1BD2A 3RWIA 4PRDB 5FDWB 3RY4A 4M5ZL 2FX9H 3AXLB 1NCBL 2FO4B 3P9MB 1C1EL 3E6HB 3RWHA 3P0VL 3AAZB 5ID0A 4ALAH 1FLTX 4C56A 5LWYH 1FVCA 3I6GB 7FABH 4LSQH 4X4XA 5D5MB 3U7AA 4YC2B 5FKAA 3RPIB 2P7TB 4EXPX 3ILQC 4CADB 2DQHL 2HFGH 5BOZG 4Z7WB 1DDHB 4IMLB 4R4ND 3QEQA 1U8HB 3ZT6A 4N5UA 2EXWD 4LK4A 3MRNB 1HINL 4NQDD 1JMXA 2BXZA 2B5IC 2EZ0C 3T2PA 1MREL 1UKTA 4JRXB 4QXTA 2UZIH 5A16A 5D8JH 1ZMYA 5EA0H 3K2UH 4NNPH 4PJ7A 4HHAB 4GO6B 4HIJB 1I7RA 4FZ8L 4JY5H 4PFEA 4ODWB 2VDQL 4GRMA 3BIAX 3EO0A 4ELME 3PIQB 2NY2B 4F33A 3R1GH 3PDGA 5F6IC 3DTXA 1EAPA 4W4OA 4XHQA 3HR5A 3D5OF 3NZHL 4OB5H 4JZJB 4JG0H 5BO1H 1MWAL 1MIMH 1PKQA 3BPNB 3X11A 3G6AA 2OL3L 4YXLL 1V3KA 5TDPB 4MCZA 1P2CB 1CFTB 4LKXB 4IDJL 1EEYB 5KJRL 4EN3D 4N8CH 1GHFL 4RQQB 5HY9B 1HDMA 4JJHA 4R7DA 1O7VA 3MRLB 4JRYD 5F8QC 4MMZC 3S3SA 5A2LH 4DVBA 4ZTOL 4XWGL 1MIEH 5JORA 1Q0YH 5DMKA 5D7IF 1UVQB 5FGBC 5F70A 2X4PA 3PV6B 4JPKL 4LARL 4OQTA 4QF1A 3QPXL 4K3EL 4OZGB 5JMRA 1HE7A 3BGFB 3MUGA 3P3YA 2G2RA 2NY0C 1WLHA 1J05B 4XBEH 1EEZA 1YPZA 2J88H 2YD2A 4I0PB 1NBYB 5CIPA 3AU1A 5DRZB 1UQSB 1KIQA 4G6KH 3BHBA 2V2WA 4YHML 3BP4B 1KGCE 3C09C 2FECI 4WHYH 5F7KC 3RAJL 4D8PB 3WEXB 1WFNA 4KAQL 4M6OL 2LTQC 1DQLL 1P7KA 1S9VB 3RNQA 3SE3C 5I30L 4E5XB 1A3RL 1OQXA 3T1WA 1K2DB 3SDCD 5E6ID 4L5FL 4LAQL 4NHCH 2V7NA 3KJ4B 4IRZL 4OAWB 4LVNB 4R2GB 4WO4A 2B0SH 2FHFA 3RWCB 3OAZH 4IRSA 2ICWI 4U1JB 5FOBB 5K9OA 2NY4D 2BNRB 4L4TD 2ZUSA 2VIRB 2Z31D 3LQMA 2V2TB 1FBIL 5I75B 1ZSDA 3W39A 3LAFA 4D9LH 4AQ1B 1OPGH 4OJFH 2BJML 4X6FA 4I18C 1XEDA 4MS8C 5D7JA 3SKOA 3Q0HA 3BGMA 4NO3A 5IHLB 4XMKL 4OM0H 4CW1A 3FCTA 2KUTA 3OJVC 4XMLL 4N9GB 1JK8B 3B3IB 1RPQA 3NTCL 3OR7A 1WEJL 4X6CE 4GXVL 1M05B 3GMQB 2DQGL 5EOQH 4XCYB 1RHFA 1CT8A 5LG1A 3GSNB 5C07E 3RY6C 2C1OB 3H42L 1TITA 1M7DB 1M7IA 1QQDA 5F7WC 4MDJB 8FABA 3O11A 4GAYA 4LU5L 4DTGL 3QJHB 2VZTA 4PRAA 4Q9CA 5F97E 5I1HH 3GBNH 4MB3A 2JCCE 2BDNH 2X4TB 5DGRA 1G0XA 5EB9A 5ICXA 1MCBA 4W6WB 1MFNA 3IDGB 4WGWB 4XVSH 1QBMH 2H1PH 5KTEH 1FE8L 3VFWB 4OZIB 5H8DA 3NGBB 2YXFA 1MVUB 1ZEAL 1OGTA 1T1ZB 4NM8L 3SJVA 3BQUA 2I5YL 3KPRD 3QDMB 1NFDE 1BZ9B 1QSFE 4YK4C 4HKZB 4XPFH 4LCUA 3UTZB 5C0CE 5EZOH 3RKDD 4CN6A 1VFAA 3PQYA 4QHNA 4WVRA 1HHGA 5GJTL 3MGOB 4Y2DD 2WUCH 4OLVH 4UNUA 2ATPB 3T8XB 2DIBA 3F7YA 4PGEA 2BCKA 4NZTH 3NFPB 3QFJA 4DCQA 1XAUA 3IETA 2KQMA 2BNQE 3HCVA 1G7LB 4G80A 4U6HB 4JLRB 1TJIL 4LSSH 5AYUH 3CDGA 5HYJA 4HLJA 2C3GA 2HT3D 1J8HB 1A6UH 2XTJC 2VAJA 1AGDB 1N7MH 1RZGA 3RVXD 1MCWM 3OX8B 1UWGH 2OSLA 1YZZA 3MV11 2GK0A 2PYED 1JWUB 3I84A 1F00I 1UWXK 4D9QD 3QRGL 2K9UA 3QUXC 5DVOA 1CXLA 2X40A 1PSKL 3GIZL 4ODXB 3HNSH 4HJJL 3T0VA 1MCHA 4E0RA 1QNZL 3GMOA 5JHDE 3UPAA 5AZ2H 1BQHB 3QG6A 2V17L 1G7JB 2FIKA 4HUNB 4MGXA 3ARFC 1JNHB 1VACA 4RWHA 5DYOA 1RUQH 2UY7A 3ARPA 1FNGA 1L0YA 2I60L 4TUOA 3PE9A 5J1TC 5T1KB 4PP2B 3I9GL 3RX7A 1IKNA 3CFBB 1KJ3H 3LB6D 3KR3H 3L3HB 3CZFA 3SKJH 1TVBB 1DSFL 2ARJQ 2EIBA 4HD9A 5JW4N 2VZVA 4JQVC 5F3HB 3MNZA 5ISZA 3DO7A 2EDEA 5F1IA 2O61A 4UV4L 2XWJB 1BP3B 1I8IB 3HI1A 2E7HA 1BQLH 1C08A 3U7WL 3VFNB 3PABA 4N1HB 4NKQB 5C71A 3V6OC 4DAGH 1MFAH 5CGYC 1INDH 4R7NA 2P8LA 5TE6H 1E27B 5DLML 4F2MB 3FQTB 4OUOA 5IT2H 3FT3B 3KPQA 3ES6A 5E99H 1MLCA 1KB9K 3KDMA 1TXKA 2VXQL 4ENED 4KTDL 1T1YA 4P2OD 4PJCA 3FQRB 1I9EA 1VKXA 4KRMB 1NC4B 4JDVB 2FX9L 5TE4H 4JKMA 5J12C 3MRRA 2BVQA 1OT1A 4XNZB 1H9VA 1KG0B 4L8SA 4C83A 3O3BA 3S9DB 2NY3C 2XPGA 2VDNH 1A6VL 2IAND 4ALAL 4HV8B 5LWYL 1JTPA 2A6DA 4GAGH 4HZLB 7FABL 4P99A 4LSQL 2F8XC 4F37K 3NAAL 2XN9E 4EUPH 5JPNA 1I3GH 4Z7VB 1I7RB 2HFGL 1PFCA 3D48R 4PD4K 1LEIB 2W59A 3WL9A 5JR1H 3KWWB 3MCKB 2AK4D 3BIKB 3D69A 5D1XC 1HXMB 3UBXI 5ALBL 2UZIL 5D8JL 5EA0L 5D6DC 5GSVA 1UYWH 3TBTA 3FB7A 4JY5L 3P73A 4UQ3A 2EKJA 3VWJC 3R1GL 5BV7H 3IFLH 4R7DB 3IAQA 4RBPK 4M6NH 1X4XA 5CZXC 5BRZB 3V7AE 3MJ9A 5CBEB 4S10A 3VJ6B 3IYLW 3LKRB 4EN3A 3FQWA 4H1LG 4JG0L 5BO1L 3BO8B 4I4WB 5DRWA 1Z9LA 4D0BB 1IQDA 3ILQD 4JRYA 4W70A 1T1WA 4U6TA 4KK5D 1WF5A 3MX0A 4OIAA 4Q2ZB 5EU4A 4DKDC 3G08B 1FC2D 4IRJB 1GGIH 3GI8L 4ZXBC 3ZE2E 1D3CA 4IIQA 4Z0BH 1TVHB 3PDDA 4FQXA 3JUYA 3G5ZB 2EZ0D 2VLJE 2C26A 2RB8A 1ES0B 1I7TA 2NY1C 5F6HJ 5IG7B 1LEKB 4NWTH 1IGYA 4ODHH 2DBJA 4ZS7H 2D03L 2EDHA 4HQQH 4OD1L 1HQ4A 3H9HB 4YXKH 3ZHDA 2R8SH 1KFAL 3F58H 1Q8MA 2V7NB 3GSUB 1CI5A 2MJWA 5F1SA 3A6BH 2Y06L 3H9SD 1Q9WB 4ETYA 5E8OA 5E6IA 4IOIA 2UWEA 1U6AL 4UINH 1EH9A 2BSED 4OIBA 1FFRA 1X5KA 2PF6A 1VGEH 4NNYB 2AEWA 2Y25A 1Z5LA 3BGAA 3EYSL 4RFOH 1W72A 4G8IB 4NHCL 1KCUH 5I6XC 5HHMD 3PDOB 3N1MC 1ZHLB 4WW2A 1B6UA 3QZWA 1OLLA 2UVEA 3D0LA 4KXZI 3VXQA 2NMSA 3MV7D 1FIEA 1AGCB 2B0SL 2D0HA 3WO4C 4D3CH 2NLJA 5E7FA 1J0IA 4D9RE 4X4YB 1ZWIA 4P0DA 4HZAA 5DC0A 1X5AA 1MFDH 4HIXH 5CGTA 3QXAA 3QUZB 3TF7C 4D9LL 1FFOB 3EUUA 1OPGL 1MH5B 4OJFL 4BFIA 4OF5A 5LGJA 4MZ3A 5GRVL 4XP6H 1JGLL 5DD5H 4NQXB 1MLBB 1FFPB 3WS3B 2A73A 2NZ9D 1CR9L 5EORL 5DJZB 4R97B 4CVZB 4OM0L 3O6MH 5JOPD 4GKZB 5CD5C 5JHLH 3P9LA 4G6FD 5EOQL 3M8OH 4LVHB 3MRCA 2VDPH 2QADB 1FPTH 1LE9B 3BQUB 3W0WA 2DF3A 4YDIL 5J13B 1DVFB 2DLGA 3N85H 5DD3L 4YHIB 4JDZB 2VLRA 4FMFA 2FZ3B 4JFHD 3WN5A 5I1HL 3FN3A 4GAFB 5H94A 3GBNL 5IMLB 4I2XE 4MAYC 3MO1A 4TNVK 4NP4L 2IBGA 4XVSL 2H1PL 2PR4H 4Q0XH 5KTEL 3TPKA 1M71A 4Y7MA 5DA0B 4MXQC 1KV3A 3L6FB 5HGDB 3UX9B 5DT1H 1U8NA 3I85A 5E9DE 4G42B 4XPFL 2FECL 1LQSR 2K1MA 5C0DB 1XF1A 5EZOL 4U6YB 1ZVHA 4U49A 2P5EE 1TQBC 4QOKE 5EBGA 1NGZB 4CVUA 2IWGA 4EIZC 1P9MA 3A6CH 5I1KH 1HSBB 1CVRA 3H6JA 3K1DA 3OZ9H 3QUYB 2OZ4H 2GK0B 3AREB 1J5OL 3WJLC 4KXZH 2Z92B 1JFQL 1RK1B 2P8MB 4LSSL 3HRZB 4JKWA 5AYUL 1YNKH 5HDQH 3V2AR 2R0WH 3ULVC 2PYEA 1KJ2H 3MUJA 4R26H 3NZ8B 4YDJA 1A6UL 1AHWC 1G7PB 1FNGB 2AJYL 4A2MA 1H15B 2FGWH 2P24A 2SEBA 5CJOH 5I16B 1EUUA 4ZNCD 5DGQA 4LIQL 3HNSL 4U1GC 4KKAC 5HBBA 3OKDB 1AGEA 4L1HA 5AZ2L 3C8DA 3TBSB 4ZTPH 2XOTA 4JHAH 4ZFOL 5EOTB 3V5DA 5DZNA 1RUQL 1BVKB 2ED9A 4JRXE 4KMQA 5HVWA 2VE6A 2ENYA 4FTVD 2PUQT 1VADB 3QA3B 4DEPB 2P8LB 4I9WD 1KJ3L 5INCB 1QLRA 3KR3L 1TTFA 3SKJL 1RZ8A 2XTJD 1NGXB 4N1EA 4MVBC 1CLOH 1DN0A 2WP3T 4QCIB 5EIIA 4AT6A 5L2KB 4LLQA 5IJKC 1QTYT 2OJEB 4PJ7F 5LVEA 1BQLL 4PJ8A 3QUXD 2YRZA 4L3EA 5J0BA 1CFSB 1MFAL 1INQA 1INDL 1MHPH 1T89A 5GS1A 4TSAH 5DJ2B 4V2BA 3DGCR 4P2OA 3TBWB 5BW7A 2WIIA 4MD0A 1VHPA 5DFTA 3UTQA 1Q9OA 3ARFD 2A6DB 4NQVB 3QIBC 3FFDA 1FSKB 5EZLA 1DR9A 2G75B 2J5LC 1NEZA 3RPKA 3UTOA 2IANA 4KUCF 4OKDA 5TE4L 3HUJA 2WIMA 2K3TA 4E41D 2YK1H 1E4XI 1EK3A 5IK3B 4WJ5B 4P5TB 2VDNL 2VLLA 4Z76B 3PWNA 5EBMA 4MQ7A 3T1FA 2EDOA 1V5JA 4GAGL 4C4KT 1R5WB 1HH6A 1DANT 2P5WE 4Z77B 4JFFD 4NRYB 1T4KA 5CGYD 1CLCA 4PRIE 1I3GL 1XGPB 3DX8A 4X6DA 4PJIA 5EFIB 3TBTB 1YPZF 3MLXH 1JGDA 3MLSH 4RFNB 2GT9B 1UJ3B 1UEYA 4XPTH 2ESVE 3CXDH 4WDIA 5B8CC 4HS8H 3FT4A 5KOMC 4P5KB 5IUSA 3I2CL 3UROR 5CS7A 5EBWB 4WV1C 4HDIA 1I3RA 5HGHA 3BE1H 3HS0B 1G1YA 4K2UL 3F7PC 1RJLA 5E4IA 12E8H 3ULUF 3RWGB 2BNRE 3RWJA 4AH2B 5HHPA 1QR1B 3VXMD 5ACZB 3PL6D 4JEGB 4LLVA 1MAJA 4U31A 3F7RA 1DBBH 1OL0A 2NY3D 1IMHC 3IFLL 1S5IH 1HHIA 1LMKA 1JZ2A 3SDAC 4Y8AA 2Z8WC 4HUVA 5IB1A 3O4OB 4ODSL 2XT1B 3L5WA 4LHUD 1FFNB 3CVIL 4D0DB 2GFBB 1IAII 4UAOC 3QNYB 3QNXB 2YA0A 2H8PA 5I1LB 1GGIL 5DHVA 2C1PA 3CXHJ 4X9HA 3CLEH 5DJCB 2X4QA 3WIHH 2LU4A 5A3IC 2HT4D 3FB8B 4JCLA 2GY5A 1FAIH 3VA6A 2AJUH 4OF6A 4ODHL 1U8IA 2E3VA 1F6FB 3TWCH 3OF6D 4YXKL 2R8SL 4W6XB 3F58L 3VWJD 4TSCH 5FA3B 1WITA 1DBAH 1E4XH 3A6BL 3EYVB 3DV4A 4FNLH 5F7DA 2EC9U 2OQJB 1XF5B 3QDME 5HHOA 5I8CA 4RMRA 2O5XL 2CKBH 4GS7B 2X1OA 4UINL 1GZPB 4DN4H 5JW4M 5GGTL 1N3NA 3OB0K 1VGEL 1U0QA 4ZXBD 5L8LB 4PJGE 5FGBA 2DQTH 4R9HA 3FQXB 2XQBH 5FECB 5L0QC 1JUFB 4JVWA 4BFIB 1F3JB 5DR5H 2XFXB 2BMKB 1AO7E 2ZOKB 4PRHB 2DTSA 2XZZA 2NY1D 4NN5C 3TVMB 4D3CL 4K55A 4HMEA 1BBDH 5D2NC 2BY2A 4HWBA 4TOYH 2PCPB 4ZAKD 5DQDL 3MRFB 1F4WH 5F96H 1MFDL 2RCSH 1CIDA 4HIXL 4JGJA 5GS0H 1NC2D 4LEOB 5F7UA 2DMBA 2AJVH 3MRCB 3SE3A 3FFCD 2RQ8A 2EDKA 4F37F 5LBSH 1X5ZA 5DD5L 5J11B 1GGBH 2VLRB 2W91A 4HCRH 1ETZB 2CH8A 2W38A 5FUZH 4L8BB 3O6ML 5FV1L 2YD1A 4BSJA 5IB2A 2Y36L 3RIAK 1IAIH 1Q0XH 4ETQA 5JHLL 4X80L 1WAAE 4EOWH 1CDGA 3M8OL 5EBLA 1YECH 1FPTL 3TO2B 5FYJD 1JNLL 5ERWB 1BOGB 4MA1C 4O2FB 2QR0B 1GSMA 2GY7B 4OLWH 4I18A 3T0EC 3MOAL 4H1LB 1XF2B 2IPTH 5IMOA 2PR4L 4Q0XL 3DXAD 3ZL4L 5I1JL 2HFFB 4HEME 4Q6IB 4V2CB 5T1MB 3O9WB 3FB6A 1JGEB 5EU6A 2PNDA 5DT1L 1WWBX 1JHTA 1A4KA 2EDQA 1F58H 43C9B 3VE0B 3BN9C 4DKEH 2D7OA 2GTZB 4KJYA 3RY6A 4C58B 1P7QB 5CD5D 3VMNA 3PWJA 1UZ8B 2CMRL 3VH8G 5E6ZA 2VWEE 3G5XA 1N59A 3IFPA 4EZMA 4RZCA 2NY6C 3A6CL 5I1KL 1N8ZA 1DLHB 1Q1JH 1ADQH 4GW5A 3VGGA 3OZ9L 2OZ4L 1ZLVH 1I7ZA 3KPLA 3RDTB 3BEWB 5MEQA 1EO5A 4PJBF 1YNKL 5HDQL 2N4IA 1LGVA 1Z3GL 4ODBD 1KJ2L 1JNNH 3QEQE 4R26L 4Z7NF 4MXQD 3CFKB 1I9IH 3GGWB 3HAEH 4NC2B 4BUHA 4EI5B 5GJSH 1KXQE 4PBWD 2WNGA 1JZ5A 3GMLA 4NQEB 5DQ9A 4PJCF 1UKQA 1IM3A 2FGWL 5CJOL 2CLRA 5F88B 3IF1A 3D85D 4HKXA 4L8DA 4YDKH 5HYFA 3Q2CA 4ONGH 4Y4FB 5FM4A 4FTVA 2W9DH 1S9YA 5FYJL 3TJEH 1PKOA 5K9QI 1MJJB 1IFHH 3LMJL 2RAMA 5M95B 2XTLA 3C08H 1HI6B 4NJ9H 1NMCB 1EJOH 5AUMB 4Y1AD 5FK9B 3KYAA 1R3HB 1MFBL 3MLUL 1X5XA 3ULVD 4L4JA 4QHLB 4L9LB 3QUXA 5EDXA 1VB9A 4APQC 2YD7A 1CLOL 3BZ4A 4LPYA 1OT2A 5BRZE 5E1HB 3EJYC 2GSGB 1QSED 3I50H 4I1NB 3UTTA 3ARDC 3DV6B 5ITFB 5I9QB 1QRNB 1NDMB 1MHPL 5I71B 4OZHB 4TSAL 3EOAB 1S3KH 3MV9B 1YPZE 3FONA 3I02B 1RJYB 5ESVA 5FYKE 2Z93B 4NKMB 2VLME 3V5HA 2G60H 4ERSL 4NT6A 2Y23A 1I8MB 5EO0B 1G6RB 3RRQA 5DD6B 2UVFA 4U1HB 4U1IA 5L9DH 4F58L 1XF3A 4JQVA 4TNVF 3KXFD 2D4DA 4Q74A 1Q94A 3O3DB 1A0QL 2NXZB 4LPWA 2VXTH 4X6BB 5HHNB 3UDWC 2YK1L 1X4YA 1LD9B 3V6OA 4JFFA 4WI4A 1T21A 2J8UA 2V5MA 1A7NH 5ID1A 1BIIA 5DVNA 2B1AL 1O5DT 2OTUB 4CDGC 3MLTB 3ZYZA 4KK9C 3MLXL 3MLSL 3M45A 3N50A 3GB7B 4XPTL 4K23H 3CXDL 5DURB 5E8NA 1MEXH 3GSNH 1ZV5A 3KPPA 2QQQA 3BYTA 4KDTC 2UWEF 5F9DC 1T5WB 4PG9A 4LCYB 2VDRH 3WUZA 4UV7H 3QIBD 3VXMA 5IV2A 4XPGH 4OLZH 1HOCB 2YHGA 12E8L 1N26A 3IVKB 4P3WA 4Z95H 1ZK9A 2ZSWA 4XP4H 2DICA 3BUTA 1XCQB 3GBLA 4WW2F 4LHUA 2AXGA 5B4MC 4RCAA 2EEBA 5C9JB 5IJVA 5MENA 4JKLA 4IS6B 4YDLB 2ZUUA 3MV8D 3WNKA 1K8DB 5AG8A 3MACH 4F7PB 2ZPKL 4RAVA 5D1XA 5DHYB 3F12B 4YZFE 5B21A 4BM7A 4WCYH 1KYOJ 4XCEB 4JPVH 2ICEA 2HN7B 1O7SA 3SJVE 1A6WL 1DQTA 4NRZB 5GGSA 4QRSA 3OXRA 4YE4H 4ELKB 4DGYH 2AJUL 5IM7B 4PJFA 2IPUG 1ZHBB 4P2QD 3TWCL 3NMEA 1ZANH 4D0CA 3WFHB 4TSCL 4OF3A 5CGMA 1DBAL 1E4XL 4FNLL 3QHZH 1CFNA 4ZXBA 5F7YC 2VN4A 1U3HD 1J88A 1CL7I 2Y07L 2FJHB 3D25A 5LJYH 2OP4L 3VCLA 2NX5A 3OR6B 1MHHB 1ORQB 2FNBA 1SBBA 3FO0H 5IQ7H 5A3ID 1B4JL 3NCMA 5DR5L 4JFYB 5CFHA 5F9WB 2CDGB 1DFBH 5CJXA 1NC2A 1BBDL 3M1BB 3FFCA 1F90L 1S7VA 4TOYL 4J3TA 5F96L 1F4WL 2R0KH 5GS0L 3TZVC 3KYKH 3WSQL 5SWQA 3B9KB 4W4NA 4FFWC 1FORH 2AJVL 2FL5A 2IAMB 3KPNB 4PY7A 5LBSL 2GITB 2HRPL 1GGBL 4XC1H 5F93C 4HCRL 1G7MB 4XP1H 5FUZL 1D5ZB 4GKOA 4R4BA 3BSZL 4NIKB 3GNMH 1Q0XL 4P3CH 5I15H 1MJUH 4X9FA 1SJEA 1DBKH 2P48B 4EOWL 3IAPA 4AMKH 2XZCH 1VA9A 3BKCH 2HFEA 3GSXA 1YECL 3HZVA 4U6VH 2J12B 2YKLL 3U30C 3DXAA 2IPKA 1RUPH 4M7KH 2H3NB 2R2CA 4Y89A 4OLWL 1WSST 1GVIA 2E7BA 1G9NC 2DWEA 2IPTL 5CEZH 5IVNA 4KROB 2LV4A 4J3XA 5ANMB 3IFPB 1AQDA 1XH3A 1N8ZB 3GK8H 4GRLB 2JB5H 1OAZL 1BEYH 2VABB 3AUVA 5LGHH 1RIHH 1S7UA 3LEVL 2XV6B 1CE6A 3O41B 2IQAB 4GJTB 5C0EA 3C2AH 4ZUTB 3WKMH 1CL7H 3CX2A 3RL2B 1RK0B 2DI8A 3VRIB 5FA4B 1OAYH 4MAYA 3DROA 2BVPB 2CDFB 3E6FB 1I1AD 5E94A 1Q1JL 1BFOB 4UNVA 5D6CA 3F62A 1RZ7H 2DQJH 4XNMA 2UYLB 4NBZB 2X41A 1ERNA 2J8OA 1K4DB 3CFDA 1RU9L 2BVEA 3I75B 1KB5B 1AKJA 5EPMB 2EECA 4HWUA 32C2A 5E2VH 3VFTB 4YPGB 2VN7A 1JNNL 4G8GD 1ZHNA 5C0GB 5CEXA 3D18B 4ZUSB 5GJSL 4XRCB 4WHCA 3NABL 3ZZ1A 4PYHA 3D85A 3BZFA 1Y18A 3NCBB 2ICCA 4JY6A 3BN9D 3CU7A 1FNEA 3HUJF 3QSKB 4YDKL 4H26A 5IESH 1U36A 4Y1AA 5CLTA 4ONGL 3VXPA 1RZJH 3WJLA 3PJSA 1TLKA 1IEHA 1IFHL 4BQ9A 4F7TB 2CDEA 3C08L 3LDBC 4M5YH 3Q5OA 1EJOL 3TNMA 3MGTB 3KPOB 3VXUB 2AGJL 1GOGA 3IU4H 4X6DF 5I1EL 4PJIF 5JW4R 5IVOA 5IMMB 3IDNB 3DYPA 2EIZA 1AHWA 1NH6A 2WMPA 4QHKJ 5M94B 2VXVL 3MBEC 1BHGA 3MLRH 3GUTA 1QSEA 2I9LB 5T5FH 2GCYB 1INEH 4GG6A 5ESVB 2IH1A 3B5HA 1QLEL 3IFOA 4BZ2L 3DSNA 3ZKMD 1EPFA 1U8KB 1KCVH 1XGRA 3L7FA 3ZT7A 3T2NH 5ADPL 1GZQA 3I50L 4UU9A 5IEHA 1H3XA 4LCWD 3BZDA 1WT5A 2AABH 1KCRH 1NUFA 5L8JB 3LN5B 3L5IA 5E8PA 3GRWH 3WDIA 1FV1B 1K4CA 4MLSA 4MYWB 1S3KL 1S7QA 3IKCB 4RGOH 3PHQB 4C57C 5I76B 2G60L 4MNHA 1HNGA 1A4JA 4ESKA 1OP3K 5DJ0A 1SYVA 3LQAC 3OXSB 3BWAA 4JM2C 3MRQB 4K9EH 1EHNA 5C0RL 3ARGC 4RNRB 1QFPA 1B0GB 2VXTL 1TCRA 4WW1A 4BZYA 3T0DA 5KSAC 1TPXC 1VFMA 4S1SH 5GGUA 2PTTB 4NYLB 3EJYD 3JWOC 1FYTB 1RJCA 1ZVYA 2RBLA 4BKLA 1A7NL 4NBYB 2JIXD 2YSSA 2J6EL 3ARDD 5KN5B 2BOBB 2ARWA 3CH1B 1R3KB 2W0FB 2VUYA 2VKWA 3L3IA 1LO3H 1G7HA 3QIBA 1Q9KB 4MNQA 3SDXF 5T3XH 4B7IA 4K23L 5CJ5A 3HC0B 1F2QA 2GUOB 1MEXL 3G6DL 3WNLA 4QKXB 2YPKB 5H2BA 4BSVB 1S5HB 4PTTB 4PRHE 3MRHB 4MHHI 5BV7C 1JZ8A 2XQYG 5DWUH 4OLZL 3DUUA 4XBGB 1ZKAA 5EG6C 3V5KA 1Y6NR 9CGTA 1F2XK 1T22A 1A22B 1B2WH 4N8VG 3FN0H 2IC2A 1BIHA 3TT1L 4EI6B 4XP4L 4LQ1A 1JYNA 2DM4A 3E0GA 3MV8A 2APTA 2FH8A 2JKXA 2ICWJ 2CUMA 5SX4I 3U79A 3W0WE 1D5BB 5D93B 4QRSB 1GGUA 2VLKB 5DDHA 3CXHK 5B8CA 2VLRE 4F15B 2I9TB 1D5MB 2AV1B 2NTFB 2HVJB 3RVTC 3NN8A 4WV1A 4YHNB 4KK9D 2IG2H 3L3GA 2H6PA 3OAYK 1U8MB 2WLZA 3U9UA 2H32A 1BREA 3IS1X 1IARB 2GJ6A 4HKBB 3SBWC 3RJQB 4Z18A 3NA9H 4HX1B 1D5IH 4YE4L 4U3HA 3AFLA 3DRQB 2E7LA 3RTQC 3BUYB 4QRTB 2YPLA 2OLDA 1V05A 3IXTA 4IHOB 3SDAA 5LGKA 3HR6A 2WUBH 4I77H 2V6HA 5FUOH 2IFGA 2NX5B 2VO5A 1Q9LA 2BHZA 5IF0B 4M6MH 5SWSB 2GYSA 5B4MD 3S96A 3ARBB 3QHZL 3HMXA 3V0VA 1NAMB 2EDXA 4MXWH 5IKCA 4QRUA 3T0XA 4HMCA 2BFVH 4O2CB 1XGUB 3VFMB 5ESAB 2QKIA 4GG8A 3L1OL 3FO0L 3SCMC 3NFNB 5IQ7L 4Y19A 1U9KA 2VXSH 2MQ3A 4UTAH 1JL8A 1TZGL 2DJSA 3NPSB 2R2EA 5EU5A 2WQ8A 3X14B 3PGFH 4GBXB 4PGJA 3OWEA 5DRNB 2R69H 4PBXA 2F53B 5FM5O 4OCYH 2VAAB 5DI8A 4G9FA 2R0KL 4CU6A 3SGJC 4U4BA 3WFCH 4PJAB 4LCIH 3OKOA 4NUGL 1FORL 4YBLB 1DEEB 3BYYA 3GMMB 3L3OB 3GEWB 1HWHB 3MRBB 6FABH 1C8PA 4NQEE 4XC1L 1ZLSH 5IGXH 5SX4H 1NGYB 3AMLA 3NCFB 3O2DA 3K3QA 5CAYB 3V52H 1I75A 2BSTB 1YY8A 4N90E 4WGVB 3S37X 1AJ7H 4FZEH 3U0TB 4P3CL 2HLFD 1MJUL 2WAHA 4XGZA 4XC3H 4AMKL 5D2NA 1KNOB 4LLDB 1RMFH 2OMNA 3BKCL 3EOBA 1AFVL 3VGAC 1B4RA 5JOFB 4U6VL 3MMEA 2GK2A 5ACLA 3HE7B 3PG2A 1WWWX 2YBRA 3IDJB 1J0HA 3IFNL 1RUPL 4L3EE 3OGOE 3BPCA 3BD5A 2Q7YA 5C08A 3TZVD 3C9NA 5CEZL 5LQBH 4FFWD 4U1SB 3GK8L 4XI5C 3S37H 1KPUA 3Q1SH 1BEYL 4RMUA 1KTKE 4M9PA 1D7FA 4YHPA 5LGHL 3HLAB 2ITDB 1ZAGA 1OTUC 1BZQK 1RIHL 5C0AB 4Y4KA 3HG1B 2P45B 4JANB 4MD4A 3WKML 4Y5YC 5IR1A 1CL7L 5E4EC 4OZHE 5DMJB 3TP4A 4ZFZB 1OARH 2W65A 4NZRH 1BBJA 1OAYL 1T2QL 3HPLA 3T0EA 4GSDL 4F7EB 2IH3A 1UB5A 4PJ5B 4FS0A 1JPTL 1RZ7L 1P5UA 2PO6A 3KYMA 2VR5A 1L6ZA 5IB4A 4G8GA 3RI5K 2Z91A 4PRBB 1FNEB 4ZQKA 2IALA 2I07B 4X6DE 2VDMH 2MQ0A 5B22A 2Q8AL 2DYPB 2BVOB 2G9HA 4HS3A 2X70B 5EO1B 1EUTA 4HXBH 3D6GA 1HCFX 4K7PY 5BZDB 3RWFB 3STZA 1T7ZA 4MD5B 3ZHLA 1IL1A 3SKNA 1JGUH 1KJVA 4X99B 1KCSH 3TO4C 2RJMA 1MHEA 1JI2A 2FLRT 3W11D 3IKKA 4YBHA 3BEVB 3W9DA 2N7BA 1RZJL 4MA3A 2J8UF 2FATH 4PYGA 1P53A 4KUZL 5IIEB 4Y16B 4M5YL 3WE6A 1PW3A 3IU4L 2WBJB 1IEAB 2NYYC 4NQCB 3ME0A 4MJIB 2NPLX 3MLRL 2C4XA 3R8QA 4FA8A 2R1YA 2Z0BA 2YUVA 3TIDA 1INEL 5IWLC 1TQCC 4DN3L 5DJDA 5BJTB 3VW3H 1T0NB 1A4JB 1KCVL 2MKLC 3T2NL 5IVXA 3QDJD 3WUWA 5I1IH 1E28B 4HFWA 4HK3J 2OTWA 1A1NB 2AABL 5DK2A 1XGQB 1QUNA 4Y5XC 3CVHB 3GRWL 2BSRB 2QHRH 1H0DB 2V5YA 1ZT1A 3FTGB 4JDTH 1FYHB 5D9SB 1JPGA 2R1XA 1CXIA 4RGOL 4X7EC 1BZ7A 2AS5M 5E08H 4CUCA 3IDYB 4XP5L 5D2LB 3EOYG 4KVCL 5HHOE 5FGCE 2LQRA 1YEHH 1K9TA 1NFIB 4APQA 3MFFB 3LKPA 1T04B 1DLFH 3P30L 4O58H 4K9EL 3LRHA 1IM9A 1I7UA 1JP5A 2BNUA 3JTSA 4N5EC 5MEPB 1X5IA 3FO9B 4KKNA 2JIXA 3ARDA 4PTUB 3T09A 1FGNH 3VMPA 1YYLH 2FCBA 4X9GA 1I9RH 4GQ9H 1ZS8B 4ISVB 1XR9A 2JJTA 4PJFF 5DC4B 4HAGA 3ZDXF 4J12A 3D2UA 1CFQB 4YWGH 1LO3L 4NSKA 3QISA 2XKUA 5CEYA 4HBCH 1PAMA 1KPVA 3PXHA 4F9PC 3U9PH 5LAXA 1MI5A 4BH8A 3Q48A 2EYTB 4K71C 3UDWA 4CMMB 2DD8H 3QUKA 5DWUL 4JM2D 3WXVH 2HLAA 3U4EA 1FL6B 3MLWH 3MNVA 3U46B 4H1LH 3ARGD 2VSCA 3OKNA 4RIRB 3FN0L 1D6VH 2X7LB 2MCPH 2QLVB 1CXFA 2YWZA 1I3UA 5KSAD 1FL5A 3MRMA 5HPMA 3VFOB 1MWAB 1LO0H 2OL3B 2DL9A 1KYOK 2O5ZH 1PG7X 1P84J 4TYUA 3RGVC 3L7EA 4OF8A 1CDBA 4ODVH 3DIFA 1VERA 1GAFL 4UOW1 4M4PA 3V6ZB 2NZIA 2IG2L 4MSWA 2Z35B 4PJBB 3MJ7B 1VDGA 1E4JA 4YGVA 5FHBL 3OKLA 5J8OA 2AP2A 2BRRL 5EU6E 3NA9L 4OFYD 1D5IL 5IKCB 3FOLB 1KGCD 1IEBB 1H5BC 1B0WA 2VISA 5C0FB 4P9HC 1PG7H 3C5SA 5FKPA 3HN3A 4KKLC 3T2OA 3PWPA 4ZOEA 1KUMA 4I77L 1F11B 3MRDA 1Z9MA 2R23A 4QNPE 3ARYA 3QHFH 4XB7A 1FRGH 4O5LH 4JN2A 5IFJA 1C12B 2E6JA 2FH6A 4R0LB 2H26B 2YZ8A 4LCCB 4BUGA 4RWYL 3L3KB 1A47A 3CIQA 2DLEA 1IE5A 3RVTD 3MC0A 1HHHA 2BFVL 4PR5A 2FGZA 4UILH 1QYGH 4NKOB 3WXWH 3JVGC 2VH5H 4NQDB 1FL3A 4LNRA 3H3KA 2DWDA 5FM8A 5ALCL 4UTAL 4QLRA 2NY7L 3U0PA 2ADIB 2CLZB 3STBA 1CDJA 3PGFL 3CZJA 3RTQD 4KWUA 3GSOA 3FT2A 3AS3A 5I74C 2R69L 3T3MF 1PYWB 3SDDD 3LQZA 4OCYL 5C0IA 2BSSB 2DJ4A 4DOHB 3GSVA 2QL1A 1PX4A 2JB6A 4LGSB 1MFEH 3WFCL 4FTVE 4LCIL 4WWKC 4MDIA 2P47B 2DLFH 4F8QA 5C07D 1ZLSL 5IGXL 4ZO6A 5E8DH 2KKQA 1CN4A 2A6JA 4M48H 3V52L 5J1AB 3O2VL 4X5WB 5EZIH 3SO5A 4H5SA 1AJ7L 4FZEL 4KFZC 3SCMD 1MCKA 2C7UB 2A77H 4XC3L 1EZVY 1RMFL 4N8VB 3WHXB 1GL4B 4L8CA 1G6RH 3IDMB 3SOBL 3O81A 4GRWF 1ONQB 3UTTE 1T5XA 4H25A 1QSFD 5DJ6B 1ITCA 5DK3A 1DJSA 3S36X 3AB0B 5DJAB 5EU3A 4YC2C 5C0CD 1NBZB 4GUPA 5CMAB 2VB5A 5LQBL 1OB1A 1JI1A 4QXGL 2ZP0T 4GT7A 3ULVF 3S37L 3Q1SL 4MB5A 1IC4H 5D7LA 5F9JA 1FIGL 3SDCB 4R8WH 3VRJB 4PV8B 5FYLE 2C9AA 1D6EA 2BNQD 2HVKA 4GG6F 1GGYA 1R24B 2GJZB 3GHBL 4DZ8A 1S78D 4HS3B 4NC0B 1OARL 4NZRL 3S36H 2MOVA 3V6OE 5L6YH 3HZMB 5J6HA 2NY2C 4XPAH 2NY4B 5F7EH 2J8UE 4L4TB 4LPUA 4HK3N 2Z31B 1GJIA 3B43A 3QEHA 5KVMC 1ZT7A 5E24E 4AENA 1FLRL 3EDJA 4JZJC 4TN9A 4LPTA 3RBSA 3ETBF 5B38G 3QO0A 3VGFA 3LRSB 1LNUB 5GSRB 2ADJA 1X5FA 1WZLA 5JHDD 3QQ3B 1YNTA 2UUDH 4FQIH 4HXBL 3UJJL 3HI5H 4ZUWA 4N0CC 4HULB 3VMOA 1OTUD 1U8JA 1KLUA 5E2JA 2ICWA 4KJWC 4I8DA 3VFVB 1JGUL 4U7MA 1KCSL 4G3YH 4OCNC 4NDMA 2YZ1A 1OSZA 4OLUH 1IGCL 4MA8H 4M6AA 1G0DA 3BGFC 2FATL 3MRKA 4ZO9A 3OAZK 3QCTH 4P49A 5LCVL 4QRRB 5MENE 2HKHH 2ATKB 4U3CA 5E8EA 1C5DB 3KLAA 2X1QA 3FB5B 1F5WA 4PB9L 2D31A 1FZMB 2X1PA 3WIFA 5B39A 3H9ZA 3KPRB 4U1LA 2D0FA 1JPGB 4NN7B 2R1XB 1K8IB 2LAGB 5ESQB 4XAKE 3EYFA 5KOVC 2VTFA 1EVUA 3MFGB 3EDFA 3KJ4C 2A83A 3BKYH 1A9EA 4GKNB 4LAJH 4LVNC 4R2GC 4JY4A 4PJFE 4Y2DB 3TO4D 4NQSA 1T1XA 1UZ6F 4FQHA 2QHRL 1NCTA 4K3JH 4U1KA 2XNAB 4JDTL 4AK1A 5E08L 5BXFB 4HUUB 5I75C 3LKNB 2WW8A 3MBEA 3V0WH 2WWKO 5DC9B 5E2WH 3BKML 5GRWA 4L3CB 1CBVH 3O3EA 1YEHL 4HIIA 4AM0A 3VA2C 4JM4H 1DLFL 3J8F7 2NYYD 1TCMA 4FG6C 4O58L 5GGVY 3D2UB 3FRUB 1EHXA 4S2SA 2XN9D 3BT2H 2FJGA 5DJXA 2NX5E 3FZUC 4YHKH 5BVJA 5SWZA 3WS6C 3MJ8A 2ED7A 3JUZA 4OCXH 2ARJA 2JJUA 4J7RA 1YYLL 1I9RL 4D2NA 2XWTB 3QJFB 4KKCC 2XWBA 4LOUC 1GOHA 3FQNB 4DUXA 4JFEB 1NCAH 4ELMA 1ZA6A 1HIMH 4YWGL 1A8JH 4LLAA 1IAKA 4JO3H 4GW1B 4JM2A 2WBKA 1T7XA 3U9PL 3NCYS 4OQ1A 2Y5EA 3ARGA 4X5LA 3NGBC 3T4AB 2CUIA 4MWFA 4EUPA 3RI5F 2I26N 2DD8L 1R0AH 3CFEA 3WXVL 2VDOH 5KSAA 1WBYA 5IOPB 3MLWL 4H8WH 4TVPH 4KC3B 1XGTA 4N5ED 4K7PX 5D72H 3LRGA 2LABA 1HILB 1R3JA 2MCPL 4JFXA 2G5BA 5C2BL 4PREA 4PJAE 5JNYA 4UIKL 4P2RA 4WEBL 1A6TB 3T0WA 1AXSB 1LO0L 1U41A 2O5ZL 2RFXB 4K7FA 4M7ZB 1G9MC 2VLJD 1UFUA 3KPMB 4HK0A 4ODVL 1FZKB 3P77A 3U1SL 3ZE1F 5E1AB 2P43B 5EZJA 4QXWA 2ZUVA 4OFYA 4PRPB 1JYXA 5IEKB 1TZIA 1X44A 2EYRA 3VD3A 1A1OA 4NO2B 4K7PH 1PQZA 2LFGA 5IFJB 3T08A 1KT2A 1EGJL 4HUKB 3CH8A 1RIVH 2VYRE 1JPSL 4OGYH 3PWUB 4QHMA 5BVPL 3EFFA 1B6DA 3BD4A 1PG7L 3BXNB 1ZVSA 1KB5H 5HGAA 4R90H 3T3ME 2CK0L 1YMHB 1F6AA 4CAGA 3GMRA 3QHFL 4NUJB 1NJ9B 4GFTB 1FRGL 4O5LL 4O2EB 4J6RH 1GOFA 2X9YA 4XVJH 3WNPA 4B0MM 2CIKB 5DS8B 3LEYH 3RGVD 5TDNB 4JREB 1AD0B 1YQVH 5FGSA 4FXGB 3REWA 3SBWA 4UILL 4A6YB 4ONFH 1QSZA 4D9RD 2V2XB 2Y4SA 2VH5L 3UTSA 4MXVE 4U6XA 2AK4B 4QTIL 3RTQA 1RHHA 2JK5B 2F8OA 4XH2A 3MLPA 2COQA 2EKSA 1U95A 3O3UN 4PJ5E 1TZHA 1X9QA 2GJJA 5FB8A 3ORJA 5DMGC 4JFDB 1EDQA 5EC2A 2D7QA 2OTPA 4AIXA 4JO1H 4UQ2A 1MFEL 2WWMC 4HS6A 4R3SA 1QFWI 3LS5L 1FNLA 1OLZA 3ARXA 2VWEC 3OKYA 2JCCA 3H0TA 3U0WL 5L7XH 1V7MH 2OJZL 3B6SB 1T7WA 5E8DL 5JOEA 4M48L 2OS7A 4HJ0C 4KMLB 4NHUA 5C0JA 3OGCA 1S7WB 5EU3B 5EZIL 1U92B 4TTDC 2A77L 4GG6E 1NFDA 3QDGB 1QSFA 4I5BA 5H35A 3PNWA 4XNZC 3SGJA 1HQRA 3EFDL 3X3FH 3OHXA 1I1YB 1A9BB 2FX8H 3BD3A 4NJAH 5E9DD 4NQCE 3D39A 3INUH 3H9SB 3O3AA 2P5ED 4WWKD 4QOKD 2OK0H 4HLZG 4ORGA 1QEWA 2AKRA 4NFDA 3C6LD 3SDXB 1IC4L 4LP5A 1KELH 4CMHC 5CSZB 5JDSB 1WFTA 3KS0H 3NBNA 1YDPA 1KXTB 3BP6A 5HHMB 1DBMH 4CVWA 1BMGA 3BPLB 4XVTH 2V7HA 4NO5A 3S36L 5L6YL 1G7QA 3IXAB 4M8QB 3MYJB 5IVXF 5D2LE 1ZHKA 4XPAL 3PXJA 5F7EL 5GGQH 5JMOC 3EYOB 1MPAH 3HZKB 4P59H 1U8JB 4TNWF 3MSPA 2QSCH 3L3DA 2O5YL 4G8EA 5JHDA 2XKNA 1JJUA 3KGRA 3D0VB 4FQQA 4BK5A 1FO0A 4G7YH 1A7RH 1JWMB 1FAKT 4O9HH 4XXCC 4MNQE 5EOCJ 2BC4A 4WNQA 4NFCA 4RGNB 3MRKB 5I17A 1FVDA 1MNUH 3LZFH 4FQIL 2HP4A 4Y5YA 2PYFA 1KN2H 4L1DA 4LLWA 1QFWH 4CNIB 3U82B 2WBWB 3JWDH 3O8XB 2W9LA 3RWEA 3W9EA 2HTKC 4JRXD 3EZ8A 1QA9A 4G3YL 1AR1D 4NKIH 3VFRA 4OLUL 4ZFOB 4MA8L 1UZ6E 5CD3A 3BZEA 3GMNB 3QG7H 4NZUH 4QGTA 2NY2D 3QCTL 3R06A 2HKHL 5I66B 4OI9A 5D96B 4PJ9D 3SQOH 1NCNA 1CGVA 4LPCA 5K9JH 2X4SA 3MJ6A 1LO5A 3GIVB 1NLDL 2GJ6E 3IT8D 4U1NA 3TO4A 4AEIH 4I13B 3MXWH 2W60B 1N64H 4QWWC 4F3FB 4NPYB 3TIEA 1EZVX 3BKYL 3CU1A 4KJWD 5TQ2H 2YPLE 4PJDB 2D7PA 4F7CA 1BFSA 1WBXB 4P4KB 3BRFA 5DJYB 4K3JL 1J12A 3MJ8B 5TPWL 4X5XA 2JELH 3AVEA 1QSVA 3RUGB 5T3ZH 3QH3A 3LKOB 2XY2A 1VGKA 3QUZC 4Z5RB 2XN9A 4PGDA 5E2WL 1CBVL 1S8DB 3B5TA 1SBSH 1KC5L 5DFVC 1UH2A 2P5WD 4HH9B 4PRID 3BT2L 4R97C 4YHKL 3I3DA 3O2WH 2C3VB 1ZLWH 4OCXL 4Y19E 2ESVD 4X9BA 3DVGB 2QSVA 5IHZB 5F7HA 4LVHC 3I6KB 5DJ8A 4UT6L 3RWDB 2QADC 1WC7B 3BQUC 4R2GD 3DI3B 5J13C 4KRLB 4UDTA 1YN6A 2R1WB 3JTTA 4G9FE 3F7VB 2AERT 5J06A 4NQUA 4XMPH 1A2YA 2BNRD 4JO3L 4NOBA 1P5VA 3FO2B 4F7MB 1T20A 5B38B 3GSWB 1P4LA 3FMGH 1FNAA 4U1MB 4XHJC 3EDDA 5I8KH 5TF0A 3QO1A 1YJDC 5FEBA 4JQXC 1R0AL 2VDOL 3KYOB 2ZG2A 3ALXA 4FG6D 3O6FD 4H8WL 1IEBA 4OLXH 5D72L 2FSEA 2NW2B 3FZUD 2EYSB 2X89A 3AM8C 4JHZA 1ED3B 5D2NE 4LEXH 2XICA 4OKVB 4ZDHA 3VWKA 3EGSB 4MAUH 5CIPH 4PY8I 3VFSB 1YEGH 1JF1A 4KKCD 3S35X 2VZSA 1CD1A 1S9XA 4F9PA 3QUYC 1SEQH 1WTGT 3AREC 4L3AA 1RZIB 2GAZA 4L9DA 5C08E 1F6AB 3DLQR 2Q86B 5KANI 5HYQB 3ULUH 2RGSA 4K7PL 5HD8D 4HPOH 5IQ9B 1JZ6A 1OAQL 5AD0A 1Z2KA 2APFA 3TH2T 1RIVL 4OGYL 3STLA 4R96B 4PUBH 3QDMD 3S35H 3WLBB 4E41B 3DX6B 1XCTA 1WCQA 1DQQA 4R90L 4Z0XB 3WIHA 2A9MH 2F5AH 4YR6B 3RGVA 4Q7DA 3T0EE 4RDQG 5IB3B 5K59E 4J6RL 3UXFA 4OIIH 4XVJL 1AO7D 1C16B 3HAEG 3BFOA 2X4NA 3ROLA 1YQVL 1T3FA 1EXUA 3I3EA 3AGVA 3V79C 4ONFL 1KIPA 1YUHB 1H5BA 2Z8SA 1AGBA 4JJ5A 4DEPC 4Z7UF 3MA7A 3VFGH 1M6OB 5EUOB 3ZDZE 1MCCA 1JPFA 1QO3B 5ELIA 43CAA 2CKBA 1MRFL 1S7RB 2I25N 3ALPA 3UBXB 4YFDB 4OGXH 5J12B 3IDUA 3DURA 3PL6B 1W0VB 3S5LA 4HIEB 3X3GH 5J89A 2NY3B 3AC0A 1V3JA 1JZ4A 3U6RB 4N0FB 3I6LE 4HKJA 1IGJA 1P4BH 3BH9B 3TNNB 3K8MA 4LLMA 1RZFH 3JVGA 5IROC 5BS0B 1KCLA 2A6IB 4I2XA 5L7XL 5GGVH 1AIFB 2AJ3B 3FAWA 4GW4A 4OCWH 1R6VA 5T1KD 5F1NA 3CPLB 3D39B 4KPHH 3DBXA 4ZPVA 4J3OC 3O3AB 3VI4F 1F3RB 2AK1L 4HCRA 5ICZB 4QRRE 1NCDH 4LKCA 3OKEA 5HTSA 5IVXE 1SJHB 3X3FL 5CHNA 3D87B 4M5ZH 4P5TC 4PJHB 1F4YL 4NJAL 5DMGD 3VWJB 1C1EH 1FH5L 3WIIH 1HK6A 2Y9RT 3VXSB 4P4RB 3RBGA 3INUL 5JPMB 2YC1B 3F5WB 3ILPA 2OK0L 1ORSA 4X7TB 8CGTA 1UJ3C 4DUWA 1S7SA 1KELL 1ZXQA 4HGWA 4N68A 3ROOA 2GTWA 2DQHH 4PRDA 5FDWA 1R5VB 4HJ0D 4UT9H 3AXLA 5KS9B 1ZT4B 1G0YR 2FO4A 3P9MA 1DBML 3E6HA 1F3DJ 2WQRA 3VXRB 1IILE 2DTML 3AAZA 3FKUS 4EDXB 4XVTL 4PGBB 4KZDH 1NC4D 1MREH 5FAAA 3I6GA 5HGGS 3PWVB 5GS2H 3QEQD 5D5MA 3MUY1 4PD4J 1H3PH 3RPIA 2P7TA 5GGQL 1E4KC 4FQXC 1QBBA 1MPAL 2GSIB 4ZAKB 4CADA 4P59L 4AYFA 2DM7A 1LDPH 2A9NL 2QSCL 2F58H 4Z7WA 4M1CC 1DDHA 4IMLA 1KJ2B 1J0JA 5ADOH 4O51B 3O4OC 4G7YL 3MRNA 4O9HL 2GI7A 2QHLA 1ADQA 4OZFG 4X98B 1WIUA 1JV5B 4JRXA 1MWAH 2DMCA 4DVRL 1MNUL 1KN2L 1MI5E 3GJEB 1QFWL 4HHAA 1J1PH 3P4OB 2H41A 2KZWA 3JWDL 4NM4H 5CKGA 4B5EA 1J1XH 4L29B 4HIJA 1SY6A 4ODWA 4JFEE 4BQ6A 3FRPG 3PIQA 3CX5J 2EDRA 4ZTOH 2E9JA 3TBVB 3QIWA 4NKIL 3HKFA 1OAUH 5T1DL 2FIRT 1XR8B 4JZJA 3QG7L 4JPKH 5TDPA 2YEZB 4KUCD 4LARH 1P2CA 1OY3B 1CFTA 4LKXA 4ELMF 3MNWB 1EEYA 5BRZD 3SQOL 3VGBA 2V5RA 1N0XH 1FZJB 4RQQA 5HY9A 4JM2F 2JJWA 4NFBA 3C6SB 2ITCB 3CLFH 5I1CL 3MRLA 2XRAH 4YHMH 4RAUA 3RAJH 4X5XB 1CD0A 4JPIB 5TDOB 3QH3B 4M6OH 1UVQA 3S4SG 4AEIL 3PV6A 3KHQA 3U36B 5FYKD 3MXWL 1A7OL 5KZCD 1N64L 2VLMD 3CNKA 5I30H 1B9ZA 3OQ3B 4OZGA 2X05A 5TQ2L 2HTKD 4MCYB 2YD5A 2HH0H 3N1GC 3GJFB 1J05A 3TVMC 3PWPE 4KZEH 3QXWA 4I0PA 1NBYA 4ZOAA 5K33A 3S8WA 5DRZA 1UQSA 4PRPE 3BP4A 2NNAB 1S7XB 4D8PA 5FO7B 1QLFB 3WEXA 1X7QB 5CJQH 1CGWA 3TCXA 1S9VA 4E5XA 2X4RB 1SBSL 2A38A 3TYFB 1K2DA 4DJMA 5J11C 1XT5A 1DQMH 3JTTB 2MQCA 4IRSD 3QT2A 3FO1B 3T3PF 4TQEH 4WHDA 3DARA 4OAWA 3O0RH 1ITBB 2ILLA 4WFGE 3RWCA 3QB7C 4HH8A 4QWWD 4U1JA 5FOBA 1ZGLP 4ODUB 2VERN 3BW9B 5DSCB 2BNRA 4XMLH 2VZ3A 2VIRA 3GMPB 3HPJB 3NTCH 3QDAA 1WEJH 4OCMC 2V2TA 1T03H 5SV3A 5JXEA 5FFLA 2FD6L 3OPZH 4GRWB 4YEFA 2X5PA 4XMPL 4KDVA 2KH2B 4KH2A 4N0UB 1ZLVK 4LU5H 3VG9B 4DTGH 1KEML 3FMGL 3VDBA 4C54A 4Q6IC 5I8KL 3O9WC 4X83A 1JVKA 4N9GA 1JK8A 3B3IA 5DFVD 1K6QH 1WFOA 1M05A 3GMQA 4JFDE 4OLXL 4XCYA 1ZEAH 3GSNA 4XZUB 2C1OA 1AGFB 1H3TA 1M7DA 4MDJA 4LEXL 3C87A 5F7NC 3QJHA 1YEGL 3SJVD 4U1GB 4X6CF 3BQUD 1XIWB 2X4TA 3IDGA 1SEQL 3VFWA 4OZIA 3UP1A 3RDTC 4TULH 2QBWA 1MVUA 3QQ4B 1T1ZA 1K3ZA 2BHYA 3ULUL 4FABH 3QDMA 1HHJB 1BZ9A 2JCCF 3KXFB 3MLZH 3QDGE 3TN0B 1UM5H 4XHJD 2L0DA 3UTZA 1ZA3B 1X3DA 5D7LE 1OTTC 4EI5C 4PUBL 3VI3E 3S35L 3MBXH 4XNUH 3MGOA 1YY9C 5MI0C 2OMBA 2ATPA 3T8XA 1NFDF 2A9ML 2F5AL 4J2XA 1A6ZB 3MRJB 5LXGH 5CLWA 3NFPA 3BP5B 2ICES 2J4WH 2R2BB 5JZ7C 4OIIL 1G7LA 4ZSOB 4U6HA 4JLRA 4WEMB 4TUJB 1IAOB 2AJZB 1IC1A 4J4PC 1NMCC 3ARED 1QFUH 1J8HA 3E1F1 1AGDA 3RL1B 3OX8A 4YO0B 5SV4A 1T89C 1KF9B 3VFGL 1RFDH 5GS1C 4NO0B 1GXEA 1JWUA 2XACC 2I60H 2J5LB 4YNYB 4EIGB 4L9LC 3VI4E 1WICA 1A1MB 2DS4A 3CSYB 3VXNB 4E42A 3I9GH 4LP4A 4OGXL 4ODXA 5HDOA 2HJLB 3FQUA 2PW1B 1WAAA 5DO2D 2F74B 1BQHA 5HI4D 1G7JA 3DBXB 5HGBB 4KRPB 5I9QC 1P4BL 5EO9B 5I71C 1JNHA 3DI2B 1YMMA 5T1KA 4PP2A 1BOYA 5GGVL 3ZTNH 4EKXA 2Y5TB 3CFBA 4TPRL 5DLMH 3L3HA 1TVBA 3OTTA 5F3HA 4KPHL 4U0RC 4X8XA 2XWJA 1I8IA 4NZJA 2NXZC 3FN9A 3VFNA 5TQ0L 2BY3A 4KGLA 1NCDL 4P2QB 1IVLA 4MJ5B 1E27A 4UZGA 4F2MA 3FQTA 3FT3A 3WIIL 1HH9B 3QWOB 1A6VH 4MQXD 1U3HB 3L9RB 4PS4L 1ZGLM 3P4LA 3NAAH 3HNTL 1BVZA 4MNGB 1RJZB 1MELA 3FQRA 2HG5B 4UT9L 1NC4A 4JDVA 3Q3GB 3IJHB 1NGQH 4PJXB 2H2PC 4PJDE 1KG0A 2BOCA 4QY8B 5FO8B 4OCSH 2DQFB 5F3BB 5SWZE 4KZDL 2X2YA 4HV8A 4HZLA 3RUGE 5ALBH 1CK0L 1H3PL 2R29H 3PWLB 2HMIC 4Z7VA 1Y0LB 3SGKC 1LDPL 2F58L 4HFUH 1LEIA 5ADOL 3HAEB 4YFEA 1RZKC 3KWWA 1UADC 3QIWB 3MCKA 3BIKA 3UYPA 1HXMA 2HWZH 3P4NB 1FP5A 2X4OB 1LILA 2AEQH 3DETD 1YYML 5I1DB 1J1PL 4NM4L 3HC4L 1J1XL 3GKZA 2A2QT 3GI8H 1VEPA 4W68A 1R5IB 5DUMH 1A7QH 2NXYB 1ZLUK 2PETA 4WTZG 4RAUB 5BRZA 1OAUL 5CBEA 4P2RE 3VJ6A 3LKRA 2YD9A 5KW9L 3BO8A 4I4WA 1VFBB 4HT1L 5FCSH 4FQXD 4XXCA 4D0BA 2C3WA 2IBZY 2D03H 2NY5H 3LD8B 4H20H 1BX2B 4OD1H 3MRIA 4Q2ZA 3G08A 2OR9L 1KFAH 1N0XL 4IRJA 2WSKA 4JFQB 1DEDA 1TVHA 1U8PB 4KQ4H 3CLFL 1RIUH 3G5ZA 2XRAL 4YHYB 2MCG1 2Y06H 1ZGLB 1ES0A 3T3PE 2UZXB 1U6AH 5IG7A 1LEKA 3TT3H 4RFEB 1X5HA 1MCWW 5D1QB 3ZE2F 1K3IA 1X6NA 5F9WC 4A6YH 3EYSH 1E4WH 2HH0L 3H9HA 4Z78B 2VQTA 4YIQB 4KZEL 1UC6A 3GSUA 1I1AB 4G9DB 3X17A 1Q9WA 1JWSB 3G6JB 5F1OB 4WFHE 3TBYB 1M4KA 1MCQA 5CJQL 3B9KC 4UBDC 2IAMC 3LKSB 4NNYA 4IBLT 5DVMA 1W2KT 3QQ9C 1DQML 4G8IA 1KLGB 3PDOA 2P4AB 1OP5H 3UTSE 4TQEL 4MHHG 1JGLH 1ZHLA 3O0RL 5HJ3B 3RX8A 3UJTH 3PP3H 1AGCA 2ZKHH 1CR9H 5EORH 1A6PA 4X4YA 4FFYH 1BVLB 1U8OB 2QSQA 3MJ9L 3X13B 3TV3H 4PRHD 3HI6H 2NR6C 1T03L 2DJUA 3TVMD 1I1FB 3QUZA 1H3VA 1OGAB 1FFOA 3OPZL 1MH5A 1A3QA 3K8LA 3DGGB 4YDIH 5DD3H 3IJYB 4NQXA 3VFUB 1MLBA 5EUOE 1FFPA 3WS3A 4KROC 4URTB 3RZCB 1WIOA 1F97A 5DJZA 4CVZA 4OZFB 2HT2C 1SJXA 4GRLC 4K3DH 4XVUD 4NP4H 3W0WD 3ARQA 1IJ9A 1CF8H 4GKZA 2VLRD 1K6QL 2YMXL 1WV7T 5I73B 1LE9A 3SPVB 3QULB 4CJ0A 1G9EA 1DVFA 4YHIA 4JDZA 2FZ3A 3MZGB 1OVZA 4LCWB 5JXAL 1PEWA 5BS0E 1MQ8A 5IMLA 4ZUUB 1GIGL 3CMOH 1CXHA 3HE6A 2WINB 4ZNEA 4LLUB 2VDKH 4TULL 3D39E 3BDYL 2NW3B 4JQXA 1Q72L 1XZ0B 3L6FA 5HGDA 4FABL 1W72L 1J8KA 3MLZL 1J5OH 4G42A 2Q8BH 4CKVX 1UM5L 1DE4B 1ROWA 1WTLA 3O9WD 5DF0A 5C0DA 1WJ3A 5IVZB 5TGBB 3AM8A 1JFQH 3MREB 4U6YA 4ONHB 1RUAL 2IADB 2HAZA 3S4SB 2E6QA 3L95B 3MBXL 4XNUL 3IGAB 1NGZA 4HWBH 3CFIC 1IT9H 2F19H 5DEFB 1HSBA 1T2XA 3VXSE 3FHQA 5LXGL 3QUYA 3SY0B 4AEFA 4YX2H 1UB6B 3AREA 2J4WL 2AJYH 5IP4A 1CD9B 1AE6H 5ECJE 2Z92A 4E42B 4WEUD 2E6PA 3UMTA 1RK1A 2P8MA 4LIQH 3HRZA 2VL5B 1LEGB 3FQUB 4YBQC 4FOMA 5TFSH 3MODL 3RDTD 1QFUL 3NZ8A 3VXRE 4P23B 5KG9B 3IU3B 4XCFL 3V6BR 1EFXB 1G7PA 1RFDL 4F57H 1II4E 4M9OA 2VZ1A 1J10A 1YMMB 1H15A 5HVFB 2ERJC 2ZCKH 5I16A 3SE8H 4NQED 1YY9D 3OKDA 1JCKA 4FFVC 2F8VA 5C3TA 3TBSA 3L3JB 5J6GB 5EOTA 2Y6SC 5D5MF 4N90D 3MGAA 1BVKA 1RVFH 2ADGB 1UXSB 1VADA 3QA3A 3CCHB 3ZTNL 3HZYB 4CN1A 4Z7WF 3AMKA 5ETUB 3QFDB 4J4PD 3T65B 5INCA 5JW5B 2Y7QB 4PJ8D 3WNNA 1U8QB 2H9GB 4L3ED 1NGXA 5DK0B 4YFLF 1YN7B 4QCIA 4OF0A 4G8FB 1V3MA 5L2KA 1HYSC 2OJEA 1T0PB 3TM6A 4LBEB 1A02N 1OTSC 1CFSA 1HHKB 5DUBB 1AI1H 1LP9B 5DJ2A 5F9OL 4OD3L 5IROA 4P46B 4JZOB 2BOCB 3TBWA 3B8SA 4QRQB 4HW6A 5MP6H 1PZ5B 3H3PH 4NQVA 1LK3H 4EVNB 4M93B 5KSBB 2AV7B 5DUPH 25C8L 2G75A 1F8TH 2XZQL 2P42B 1N6VA 3LV3B 1NGQL 4P9MH 1N5AB 3LN4B 2IMMA 2X09A 5IK3A 4WHTB 4OCSL 4IDLA 4WJ5A 3I2CH 4LSUH 2IEPA 4P5TA 1AD9B 2B4CC 4Z76A 1CG9B 2C3HA 2BK8A 1R5WA 3MRGB 4OZGF 4K2UH 4Z77A 2DQIL 4NRYA 2R29L 1Q38A 2Q76B 4JFOB 2Q6WB 1XGPA 2Z4QB 5EFIA 5D93C 2GT9A 1UJ3A 4HFUL 2YUXA 4F15C 3MOBH 4P5KA 5E2TH 3U83A 5INDB 5EBWA 4M8VA 3VFPB 1SEBB 2HWZL 2AEQL 3LIZL 3CX5K 3HS0A 3QXDB 4ODSH 4XPHL 3CVIH 3LKQB 3RWGA 4AH2A 2JF1A 1QR1A 3MRIB 1T2JA 1U93A 2H2PD 3OJMB 5ACZA 4NGHL 1E4KA 5DUML 1A7QL 5FYJU 4HSQA 3DVFA 3KNBB 2H2SC 4ZS6C 4N0UE 4YEEA 4K8RC 3NCCB 1NCUA 4DWHA 3AS1A 1FFNA 1UM6H 4WFFE 4FP8H 4D0DA 2GFBA 2NY5L 4H20L 3TZVB 4Q97A 5L2JB 1ZOXA 1CQYA 2CJUL 3QNYA 2FR4B 3ARBC 1IRAY 3QNXA 4Z9KB 5I1LA 4QRPB 5CJXC 3LH2L 4G43A 1NGPH 5DJCA 4KQ4L 4L4VB 1RIUL 4HWEH 4G6AC 3FB8A 2O5XH 1N2RB 4HUXB 3TT3L 2JLLA 4XCNB 4Z7UB 3QUMB 5GGTH 5HHOD 3C60B 5TF1H 1OHQA 4A6YL 5KSVB 1E4WL 1J1OH 3C8KB 4GBXC 3MA9H 5FA3A 4S1QH 2AJXH 2IFFH 3EYVA 1SJVA 4IMKC 2OQJA 1XF5A 4MA7H 5A40E 1GZPA 4YBLC 5HI3C 3ARRA 4OD2B 4RISL 5DQDH 3IAGC 2NY0D 4PJEB 1X5YA 3WHE0 3FQXA 5FECA 4NNXB 4OGZA 1JUFA 1F3JA 4J8RB 2XFXA 2BMKA 3DUSB 1JMZA 2ZOKA 4PRHA 5J57B 3UJTL 3TVMA 4UUJB 2ZKHL 1UT9A 4FFYL 4PJGF 4ZSOE 2I27N 4YQXL 2DIJA 1KIUA 3JV5A 2PCPA 1WZ1H 3TV3L 2Y36H 3MRFA 3HI6L 4MZ2A 3HE7C 4X80H 4KMTH 4LEOA 3GDBA 5GIRB 3VD7A 1BQSA 1CDHA 3HNVH 3KS0J 1E6OL 1JNLH 1IC5H 1ETZA 4ZPTB 2MHAB 3B9KD 4EQ3A 1NDGB 4L8BA 4UBDD 2IAMD 3V95A 3DRTB 5C0NC 4K3DL 3MOAH 1J87A 4HJGB 1PY4A 3HE6B 1CF8L 3ZL4H 5I1JH 2CLVB 5CZVL 4G5ZH 3TO2A 3ULSB 3BDXA 4MS8D 2X42A 3TA3B 5ERWA 1BOGA 3OKMB 3QDJB 5J9PB 1NUNB 4O2FA 2QR0A 4CGTA 3N06B 1WAAF 1HXYB 4H1LA 2NR6D 1XF2A 5EU6D 3CMOL 3ARUA 1FJ1B 2Q3AA 3M17B 2CMRH 2HFFA 2VDKL 2IBZX 4Q6IA 4QHUB 5T1MA 4DGIH 3ELAT 3O9WA 3LDBB 2CO6B 3K81A 3HMWH 4OZ4B 1JGEA 1S7TB 2F54B 3B8YA 4K07A 1W8NA 2Q8BL 43C9A 2J7LA 3VE0A 2BY1A 2HT2D 5CWSA 2GTZA 2FO1A 3O6LH 4DQOH 1P7QA 1YEDB 4X7CC 1VEOA 1Z3GH 1UZ8A 4JFPB 2DKMA 3RNKB 4RMWA 4HWBL 4F9LC 1IT9L 2OR7A 2F19L 1GH7A 1DLHA 2LU3A 3SO3B 3ZDYE 1RURH 1B0RB 4K94C 5MERB 4YX2L 3S98A 3RDTA 3BEWA 5D5ME 1AE6L 4FXLA 4JZNB 3PGDB 3LVEA 3GFUA 4Y16C 5TFSL 2UY6A 4Z7WE 4PJXE 4HIHB 3VGHA 1FNHA 5CBAB 5EU7E 3DNKA 4PGZA 3CFKA 5FYJH 3GGWA 3G9AB 2WBJC 3LMJH 4EI5A 1WT5C 5HYSG 3QAZC 4DKAA 5FF6B 3RGHA 4NQEA 1KPRB 3A67H 3REVB 4F57L 3UPCA 1LK2B 4J1UB 1MFBH 3BPOC 2ZCKL 3MLUH 5F88A 6CGTA 3B9VA 3SE8L 4I48B 4LSDA 1TTGA 1I8KB 4Y4FA 3QBTB 5C6PB 1MJJA 5C0BB 1BFTA 5FXCH 4JHBA 3L5XL 1HI6A 4J4PA 1YNLH 5C09B 5AUMA 1RVFL 5FK9A 4Z7VF 4BH7B 1R3HA 3IDYC 1E6JH 4YBQD 1GRWA 4QHLA 4LLYB 3GJFH 3N1PC 4N0YL 1GC1C 1U2HA 4L9LA 3UTTD 3A0OA 4NBXB 4N9OB 4ERSH 2CO7B 4FQ1H 5DVLA 2QQNH 2GSGA 3TC9A 4F58H 5IBTH 2E8YA 3DV6A 1NMAL 5ITFA 1A0QH 4HLZH 5D1ZB 1QRNA 1AI1L 4OZGE 1NDMA 4XT1C 5HYIA 4OZHA 5D7KE 1A6AB 2CUHA 4HUMB 4IJ3C 3TGXA 3EOAA 4FFVD 5F89B 3MV9A 3I02A 1RJYA 4MJ6B 3B9EA 3SKMB 4RMSA 2Z93A 5FYLD 4NKMA 5MP6L 1BAFH 2Y6SD 3MOQA 4JHWH 1I8MA 5EO0A 3H3PL 1G6RA 1PG7W 1REIA 5DD6A 3V9FA 4U1HA 1KSRA 3BDBA 1LK3L 1EMTH 3L5HA 2ED8A 2B1AH 5HHQB 4OM1L 5DUPL 3O45B 3O3DA 1AP2B 4M7JH 1F8TL 3ZYJA 4WU5B 4XNQB 5GZOC 2JE8A 2APWA 3BVNB 4X6BA 5HHNA 4P9ML 1CZ8H 3WO3B 4GRWH 1LD9A 4LF3B 1CICA 4PV9B 4P3DB 5IFHH 3NIFE 2R0ZH 4LSUL 1HYSD 1OTSD 4RA0C 3SDDB 1GGTA 2BHUA 2OTUA 4OUUB 4HPYH 3ULVH 1YEKL 1KXVC 3MLTA 1U93B 1WCBB 4QEGA 3GB7A 1VFOA 2E7LC 4LL9A 3MOBL 1UM4H 5E2TL 2X4UA 3OAYH 1DUYB 3MROB 5C07B 1WZKA 1T5WA 1XF4B 4LCYA 3E3QE 4OSUL 1P1ZB 1HOCA 2VMFA 1Z9SA 3BRGC 1G1CA 3WLWC 2ZPKH 3ZHKA 3IVKA 5IW6B 3C2SA 4BELD 5ICYB 5MEND 3SCMB 4YAQB 3NACH 2HJKA 1CS6A 4BSWB 4G43B 1OGAE 1XCQA 5HVHB 1NANI 2X1WL 3B2UC 1A6WH 3SGKA 5D1XD 5C9JA 2P8PB 4MX7B 4IS6A 4NWUH 5GGRB 2YA1A 1MRDH 4G6MH 1K8DA 1UM6L 3JV6B 4FP8L 4XAKD 4BA8A 4F7PA 1N4XL 5C0CB 5DHYA 3F12A 4X8JB 4R0LC 4LCCC 1ND0B 4XCEA 2KZ1B 3B83A 2EH7H 4M7LH 4OZIE 4X4ME 1NGPL 5FYLL 5JIKA 5IW1A 4JGMA 3DHMA 4KTEH 2HN7A 2V9RA 5CZXD 4R4NC 1JYVA 2CRYA 5DTFB 4NRZA 2EXWC 4HWEL 4AIZB 2AQ2A 3TLRA 2XI9A 5DRXB 3DX9B 4ELKA 4YZFF 1XMWA 2Y07H 3ARSA 5IM7A 3RA7L 2BNQB 1ZHBA 3GBMH 4JVUA 4BK4A 2OP4H 3OKKB 5TF1L 4AG4H 1QPXA 1J1OL 1D9KB 1CLZH 3WFHA 4QTHB 3MA9L 1B4JH 1QKZH 4S1QL 1PJ9A 2AJXL 2IFFL 1GPOL 4ZS6D 4EBQH 2NX5D 4JAMA 1MCJA 4K8RD 4MA7L 1YQ2A 1F90H 2FJHA 2A1WH 3MPCA 3DECA 3G5VB 5I1GH 4Y2OA 5T5NF 3OR6A 1MHHA 1ORQA 3WSQH 5I8OH 5E5MB 1J8HE 2X1XR 1CFBA 4JFYA 3AS2A 4G6AD 2HRPH 4TUKL 1KBGH 2CDGA 4WUUB 4TTGA 2D4FA 4QYOB 1A21A 5IB5B 3M1BA 3VDCA 3TCLB 3BSZH 1WZ1L 3V6FB 4WU7B 1G84A 3GSRB 4KMTL 4GBXD 1X5JA 3B9KA 3HNVL 2IAMA 3KPNA 1OAXH 1FN4B 4LSRH 2VNCA 4Y4KC 2YKLH 1NANH 2H32H 2QQKL 3AB0C 2GITA 1IC5L 3ARTA 1G7MA 3NCEB 1YMME 5IMKB 4G7VH 5HI3D 1D5ZA 3HC3H 4NCDA 2HJFB 2CGRL 5MEOB 5CSBA 4JKPL 2PO6C 3L5JA 3GM0A 3PGCB 3C5ZA 1OAZH 4G5ZL 1QVOB 5I8EB 4AQOA 1BWMA 4M61B 2H3NA 4XXDB 3LEVH 5ILTH 5CWSB 3HMXH 3OAUH 1R3LB 3NIDF 3HE7D 5EC1B 1D5XB 2NY4C 4NRXB 3LEXB 4AY0A 4PLJC 5ANMA 4M7LT 1CGSH 4DGIL 1HSAB 4GRLA 3NOIA 4UDUB 2VABA 4UTBL 3HMWL 4O00A 2O26U 3OB8A 5CILL 3WDJA 1U91B 4MAYD 5C0ND 3O41A 2IQAA 1RU9H 2YN3A 3O6LL 4JG1L 4ZUTA 4DQOL 1DP0A 2AQ1A 3RL2A 2FBJL 2EH8H 4NKDB 5CEZE 1RK0A 3VRIA 5FA4A 3N9GL 2BVPA 3S34H 2CDFA 3E6FA 3NABH 1RURL 1BFOA 1PGRB 5AYQA 1AKJD 4JPWH 2UYLA 1OWRM 2Q3ZA 3JV0A 3H7BB 4LPXA 4CVXB 4Y5XB 2DKUA 1K4DA 2W92A 4Z7VE 5D7IB 1TTUA 2PTVA 4Q6YA 1KB5A 3I75A 4PJ5D 5EPMA 3CDFA 3VFTA 4YPGA 2AXJA 1M7XA 2UV3A 3DVNB 5C0GA 1U58B 3D18A 4ZUSA 4XRCA 5JLZB 5DZLA 2DYPD 2LE9A 3A67L 3LPWA 2AGJH 5I1EH 4WTWA 4NN7C 4YHOH 1VPOL 2VXVH 3ZKNC 15C8L 1U8LB 3SKUD 1L9NA 1QLEH 1XFPA 4BZ2H 4QT5B 4F7TA 3ECBB 1YNLL 5ADPH 1DL7H 2VLJB 2E9WA 3KPOA 3MGTA 3VXUA 4RAHA 5HVGB 4OV5B 5IMMA 3IDNA 4KKAD 3EO1B 1E6JL 4Y16D 2JJTC 2I9LA 2GCYA 4UIMB 3WJJA 2WBJD 2QEJA 1NQBA 3EW3B 4NQCD 1U8KA 3KVQA 2YPVL 4FQ1L 4OT1H 2QQNL 5IBTL 1NGWA 2VKXA 5C0RH 3LN5A 4U2YA 1FV1A 4JO2L 4QRPE 3VRLE 3WHE1 2DM3A 3IKCA 4MVBD 35C8H 1CICB 1BQUA 2AXHA 3PHQA 4L4VE 1X4ZA 5J3HC 1QHOA 1BAFL 5I76A 4H0IA 1T0MB 3SGEI 4JHWL 1S9WB 5GPRA 1EMTL 2J6EH 4KVNH 3OXSA 5DEGB 3MRQA 2XZAH 2EXYC 3MTRA 1N0LA 4M7JL 1P6AB 1OD7A 2FYYB 3UTPE 4O4YH 4RNRA 4HUWB 3LS4L 1B0GA 4J3VA 5E00B 2AXFB 1NAKH 1CZ8L 3Q5TA 4XNYH 3WNMA 2DDQH 1KOAA 1SMOA 3G6DH 2W9EH 4CU7A 3F7QA 5IFHL 2X4UB 4LSTH 2R0ZL 2PTTA 4DK3A 4C59B 4P57B 4NYLA 3VH8A 1FYTA 4MNQD 3R0MA 5T1LB 3JV4B 5IBUG 1AR2A 5JO5B 5KN5A 2BOBA 3BP7B 4I0KA 4OZFH 3CH1A 4HPYL 4MJ4A 3ULVL 1R3KA 2W0FA 3TT1H 2VC2H 1Q9KA 2HJKB 3DSFH 3HC0A 2GUOA 4M7ZC 1UM4L 1MCPL 3UYRH 4K94L 2YPKA 4BSVA 1S5HA 4PTTA 3MRHA 4CU8A 3OL2A 4WI6A 4ENEC 4YXHL 4XBGA 5TH2B 5HYSB 3EO9H 5GZOD 2B39A 4EI6A 3NACL 3CD4A 4HGMA 5T3XE 5IW1B 3QIUB 2FJFB 3QWQB 1UCBH 4WI7A 1CYGA 1D5BA 1H8NA 2EC9T 2CK2A 2VLKA 1KACB 2ZCLH 2I9TA 1D5MA 2AV1A 5GRYA 2DM2A 4LHJB 2GJ6D 2NTFA 4NWUL 3T77B 1YEJH 5E9DB 4ZYKB 1MRDL 2HVJA 4G6ML 4S1RH 4YHNA 1U8MA 1MCLA 1RUMH 1WGOA 2P5EB 4ZNEE 4WWKB 1OP9A 2EH7L 3LY6A 4M7LL 4QOKB 3MYZA 2YPLD 4JREC 1PLGH 4KTEL 2ZUQB 3C6LB 3SDAD 4HKBA 4OI8A 2NQCA 5C3LD 4HX1A 4JAMB 5BMFH 4PRNB 3DRQA 3T4YB 1FVEB 3WLWD 3BUYA 4QRTA 5A2KH 5I2IB 5IFAH 3OJDB 5FM5M 5KSUB 4IHOA 3GBML 3I3BA 3L1OH 5GGRY 5EULV 4GKSB 4AG4L 3AROA 3S88H 1J0KA 5D7SH 1L6XA 5DXWA 1CGUA 1CLZL 5IF0A 1DUZB 1R3IH 3B2UD 5SWSA 3MRPB 1QKZL 1TZGH 5KAQF 3EDKA 5EN2B 3ARBA 4OLYH 4EBQL 2F54E 3WFBH 1NAMA 2RHEA 3IB4A 4RMQA 4Y19D 1HEZB 4O2CA 1XGUA 3VFMA 3G04A 2A1WL 5ESAA 4ONOA 5I1GL 5I8OL 1X5LA 4KK5C 3NFNA 2HRLA 4NUGH 4HC1A 1LDSA 1IC7L 4G9FD 3RJDA 4QHKI 1KBGL 2AI0L 2EDWA 3X14A 4X0KB 4GBXA 5DRNA 2F53A 4GMSH 4HG4J 2VAAA 4IMKA 3VXTB 4M00A 5C8JB 1CGTA 4Y4HB 3HA0A 3QI9B 1V3LA 3NIDE 4PJAA 1MHCB 1S9KC 3C5ZB 1AFVH 1OAXL 4LSRL 1DEEA 3GMMA 3L3OA 3MR9A 5C2UB 3MRBA 3PHOB 4PJ9B 1NGYA 3IFNH 3OBAA 3UO1H 4G7VL 2PW2B 3HC3L 3G5YB 3GSQB 1YEFL 2BSTA 5KANG 1OWWA 2EE2A 5T5NG 3U0TA 1JHLH 3R0NA 4JO4H 1KLFA 1KNOA 1CDCA 4LLDA 5C0BE 5JOFA 1MAKA 5L2KE 5C08D 4ZUVB 3HE7A 3GI9L 5C09E 4V1DB 3BPLC 3IDJA 3UPRB 2OXHA 5ILTL 4X6EB 3E2HB 4NCC2 3HMXL 1NL0H 3OAUL 2R15A 2R56L 1MRCH 2MMXA 1YEIH 5GRUH 2CRIA 2E7MA 2D7MA 2B7DT 3BH8B 1T2QH 4U1SA 4MQTB 1CGSL 4GSDH 4Y4KD 4CJ1A 1AXIB 3B9AA 1JPTH 2R39A 5F1KC 1W0WB 2ITDA 3HLAA 5BQ7B 4R6UA 4P2CG 4YDVB 5C0AA 3T0ED 1BJMA 1MAML 4RGNC 2P5WB 2NZ9C 3QPQC 4JQIH 3HG1A 4JANA 4PRIB 2Q8AH 2PO6D 3RVVC 2EH8L 1JRHI 2DI7A 4ZFZA 3O8XC 2ESVB 4KI5E 2EO1A 3S34L 4F7EA 2R2HB 4TRPL 1FG2B 3BJ91 4PJ5A 4JPWL 1JN6B 4LVOB 2DRUA 4OZHF 4PRBA 2MPAH 1MY7A 2I07A 4EDWH 4ZD3H 2DYPA 3O2DL 2BVOA 1CE1H 4PLJD 4Z7QF 2NY6D 2R0LH 1I1RA 2X70A 5D96C 4DZBB 5BZWB 5CP3H 5EO1A 1BLNB 3ZKXB 2RR3A 4KUZH 2YR3A 3I6LD 4UB0L 3IS0X 5BZDA 1LE5B 3ARVA 5JIPA 1DQJB 1C7TA 3GO1H 3DX7B 3RWFA 3O6FB 4F9LA 1KTDB 4YHOL 4MD5A 3RQ3A 4X99A 3D3VB 3LHPH 3WCYA 5LKNA 4WFEE 1OF2B 3BEVA 1ZLWK 1KCKA 2Q20A 3CGTA 4LMQI 4DN3H 4ZFFB 2GQHA 5IIEA 5FO9B 4Y16A 2FWOB 4P4KC 5I1AB 1I3VA 1DL7L 1RQ5A 1N6QH 4YHZH 3U2SB 4U7KA 1NGWB 1QFWM 2WBJA 1FZOB 1FC1A 1IEAA 3RIAF 1KULA 3QUMH 3CUPB 4NQCA 4QRRD 4MJIA 3O4LB 2MTPA 1YA5A 1UXWB 5GISH 3C5JB 2EIEA 4Y5VB 3P4MB 1I4FA 5BJTA 1NCCL 3DO3A 4XP5H 3K8KA 1T0NA 4KVCH 4POUB 5GRJL 4OT1L 3WD5H 1E28A 4OFIA 3P30H 1A1NA 1G9NH 5CCKL 3KPSB 1XGQA 4P5MA 3X12B 3DMMB 4ZODA 3ZKND 3CVHA 2BSRA 1H0DA 3WNOA 3FTGA 4PJGB 5D9SA 4APQD 35C8L 1EERB 1JRHH 3VXOB 1IM9D 5D2LA 1OQOA 3HFMH 1AO7B 3VH8B 4KVNL 1IGTB 1NFIA 3MFFA 3CC5B 1T04A 4WRLA 2EDLA 2W0KA 2XZAL 1JHKH 4ACPA 5MEPA 4O4YL 3FO9A 3JXAA 1MQKH 2OX5A 4GXUN 1NAKL 2HKFH 2IPUK 4J3UA 4XNYL 2DDQL 2PXYB 4PTUA 2W9EL 3PP4H 1ZS8A 3D2UD 4ISVA 4LSTL 3KYNB 4B7LA 2FDBP 2ZZUT 5CUSH 3FOMB 3TPUB 5SX5H 1WWAX 1BECA 5ENWB 1KENL 1BGXH 1MI5D 1CFQA 5EUKB 2VC2L 4PGCB 3DSFL 4XBPB 5J3HD 4JFED 1UG9A 1T6VN 4J3SA 3UYRL 5K9KB 3PV7A 4LDLB 1KIRB 4WUUE 1TJHL 2IBBA 2EYTA 4CMMA 3IJSB 2CIIB 3DOSA 3QDHA 1FL6A 1J0ZA 2EXYD 3EO9L