1WFUA

Solution structure of fibronectin type iii domain of mouse hypothetical protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
120
structure length
120
Chain Sequence
GSSGSSGMEPHKVVPLSKPHPPVVGKVTHHSIELYWDLEQKEKRQGPQEQWLRFSIEEEDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTRESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of fibronectin type III domain of mouse hypothetical protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords unnamed protein product
total genus 10
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wfuA01
3GMPA 4ODSL 4QRTB 1FL3B 3DV4A 2F58L 1F8TH 4R4FH 1A4KB 1EHLL 4OJFL 3O8XC 3X3FL 4F7EB 3GSRA 3RA7L 1U2HA 2WBJB 1S9WB 1WEJH 4Y5XB 5DMKA 3QEQB 4F58L 5L2JB 3E2HB 1BWMA 3OV6A 3TZVB 3CFJB 2WINB 1GIGL 4EBQH 2OL3A 1I8IA 4E5XB 3C6SB 3HZMA 2NY5L 4YHPA 3P40A 5TE7H 3BRFA 2X4NA 4MA7L 1WZLA 3EO0A 1YUHA 4C83A 1L9MA 4OIAA 3FONA 2DD8L 1PAMA 5FYKE 1T7VA 1G7IB 1XH3A 1FNSH 1EVUA 1EHNA 4M8QA 3VD3A 4JHWL 1KLGB 3O3DB 4WTZA 5HHMD 1R0AL 2A9MH 4KHTH 4GS7C 3S34L 1UGNA 1AO7E 3RY5A 4M5YL 1HILB 2Z35A 3P73A 3QEHB 1I7TB 4UNUA 1NAML 4XXCC 1LWRA 5DD5L 1FQ9C 1NGYB 4KGJA 3NIGF 3X13A 1P9MC 4I48A 1JHTA 4WWKC 3TJHD 4NC0B 4K3EH 1M7IB 4NRXB 2RFXB 3BWAA 3O2VH 1MWAA 2J3SA 4A2MA 4LLMB 4OZFH 3T4AA 3JWOC 2I60H 4BELD 4M48L 1EUTA 4H26A 3BH8A 5HY9B 4POYA 2FGWH 4FQQB 3A67L 1IKNC 1OSPL 1NLBH 3WYRA 2IPUK 1VEMA 4TSBH 1RFDH 2H1PL 5FF6B 4FFYH 3IF1B 3QIUA 3MJ9L 3UTZB 3C8DA 5MEPB 2Y07L 2W0KA 1MIEH 3E2HC 2X4TB 3VWJC 3UYOD 4YHKL 3MSPA 5DJZA 4PJXF 3BW9A 1ACZA 2IJ0C 5GJTH 4GAGL 1QFPA 3PQYE 1NUNB 5CZXC 3T2NH 2VLME 1NEZA 4NZTL 1VFBA 4P23C 3QUMH 5J0BA 3L5WA 4XBGA 1YDPB 4R0LA 2DQTH 5AD0B 2VAAB 4GAYA 3TNNB 4QY8B 2BY0A 3D3VB 1YN6B 2NW3A 3AS1A 4LHUD 4MA3B 4UINH 4X99A 5IVZB 1RJYA 1HXMA 4LSVL 4OGZA 2BERA 3HTLX 3BPLC 5ACLA 1BF8A 2R1YB 5E4IA 3NAAL 2XN9A 2DQDL 1R0AH 3ARXA 1G9NH 1HSBA 3K7UA 3AAZB 4XBEL 4ZG1A 4B7LA 1VFMA 3V4VL 3GSWB 4OGAC 4PREA 3AU1B 2AJYL 1HYSD 1B9ZA 1NCDL 4GKSB 5C0GB 1OM3H 3FO1A 3UO1H 4QRSA 4YGVB 1JNNL 4HKXB 1TZIA 1KTKE 3TIEA 3MZGB 1OWWA 4OCNC 2CKBA 4H25A 3BGFB 5JPMB 4XXCA 2HJLA 3B2UD 3L5HA 4NIKB 5DMIL 4CN1A 3FO0H 4BFIB 1AR1D 1IM3B 4OJFH 4YK4B 1P4LA 3U0PB 2B5IC 4OD3L 4AEHL 3GMQA 1D5XA 4HQQL 1MHHB 3G9AB 1CL7H 4XNMA 3MV9A 3FZUC 3LKRB 4OZHF 3QG6A 1BECA 2CRMA 3AXLB 3K80A 4YWGL 5ELIA 4Z77A 2D7TH 2YWZA 2FEEI 3C08H 2I07A 1TENA 4DUXA 5KW9H 1G7QA 1VESA 1A6AB 3TBYA 2VSCA 2VRAA 3UO1L 3OHXA 5K59E 5GJSH 2FYYB 5DJ8B 3RUGA 1J1XL 2BVUA 3VWJA 4ODXB 3U0TB 3W0WB 5CJOL 2AKRB 2MPAL 1JF6A 3CJJA 1G9NC 4XBEH 3VWKA 1HHHB 3J7HA 4PJHE 1U3HA 2XZQL 2A83A 35C8H 1ZLVK 3EFDL 1CXHA 1YY8B 2DQDH 1MI5B 2CKBH 4PJ5A 4D9LL 4HUUB 3QNZA 4UQ3A 3TV3H 1JGVL 1HIMH 4Z7OF 4JFQA 3R4DA 3H9HB 5F1NB 1MCRA 1WICA 3HC3H 4LLYB 1K9TA 5C07E 3UAJC 2EYRB 4P49A 4WTWA 2NXZB 1DQTA 5DR5L 3TT1L 5C2UB 1GHFH 3B2VL 1GSMA 4CVUA 5FUCC 5E2TL 4U49A 2IH1B 4JY5L 3ARVA 2Q3ZA 6FABH 1JWUB 4J1UA 5C0BE 4I8DA 2ZWLT 5FFLA 1BBJB 1IC5H 2EIZA 5F9AC 5BVJA 4HDIA 2HJFA 3T77A 4GG8A 2LU3A 2VXTL 2BC4A 4Z0XA 4EI5C 1SJEB 3TVMB 3LB6D 1A22B 4OCSH 2DM3A 3V52L 1WQVT 5A3ID 1KTRL 3A6CH 4POUB 1KJ3H 2R2HB 4BZ1L 4HKBB 2R2EB 3UCRA 4ZNEE 3LS4H 4OM0L 4YDLC 4GRLC 3OKDA 4DGVH 5TH2B 3GSVB 3WE6B 3TIDB 1MLBB 1Q9KA 3MRNB 2OQJB 3T4YA 1HZHH 4WDIB 1I8LA 4Z7VA 3DYMA 3WLBB 1IAIL 4K3EL 2IQ9H 3LSOA 1AQKH 1L7IH 2XG4A 1U8PB 4W4NA 3NZ8B 1XCQA 5CJXC 5MHSD 3F6IA 3FRPA 5I1HH 4M5ZH 4NO5A 4P2RA 2UWEB 4QOKA 4KKAD 3SJVA 1FE8H 3CC5A 1D5IL 3B9EA 1WC7A 2OZ4H 4YFLI 1I3VA 2X05A 3HLAA 5JPNA 1X7QB 2WK2A 3IU3B 1WK0A 4EDWH 8CGTA 3DURA 4LNRA 3O6FA 4ZPVB 3DUSA 1HHJB 5D7JC 3QNYA 4LEOA 2WLZA 1R24B 4JFOA 4QHUB 1HHGB 2DWDB 5E9DD 1T7YA 3E0GA 3WUZA 3ZSSA 1EEZA 2DN7A 4PJAF 2P8PB 5EU6B 2MJWA 5HJ3B 4F3FB 1FGNH 5ICYA 2Z0BA 4P46C 4Q6IC 2EDBA 5HHME 4F37K 1KLUA 1T4KB 3AMLA 4DZ8B 5FUZH 1J1PL 2FEDC 3RGVA 3MYZA 4FQCL 4BK5A 2VLRA 2DLHA 4JFDA 2N7BA 4DK3A 3WXWH 1MJ7L 3HMXH 1X5AA 2UUDK 4WW2C 3BZ4B 3QUXA 5I17B 4AK1A 2BSED 1JL8A 4IM8A 1O7VA 5JXED 2VQ1A 2ATKA 2BDNH 3V6OC 5HGBB 1NCUA 3VXNA 1B4JH 3G08B 3MODL 3FFDA 1QVOB 5CJQL 1T2XA 1I9JL 1N5AA 2XWJA 5ISZA 1YYML 2YD4A 3VFVA 4J3SA 5ANMB 3O6KH 4DKEH 3PHSA 2V7NB 2YN3A 1MLCB 1RZKC 1FV1B 2WQ8A 5T1KD 2BY3A 1OAYL 4CNIB 2BNQE 1QA9B 1BVKB 5JDSB 4ZD3H 1FO0B 5INDA 3ROOB 2GIYA 1CLOL 1R3IL 2XN9E 3EYOA 1PQZB 5DC0A 5TGBA 4FZEL 4LCCA 2Y25A 4L4TB 2ERJC 3HNTH 5BOPA 3HNVH 5DSCB 4P5TB 5FB8A 5D7JB 1P9MA 3VWJD 4Q9RL 2ZG1A 5FO9A 3F12A 3C9NB 4Z5RA 5GGQH 1T04B 1U58A 3BVNB 4LOUD 1OPGL 1EO8H 3QDGD 1A7PH 4P3DA 1W0VB 4OZGA 3WFCH 4YBQD 2YUWA 3L3JA 3GSNH 1MY7A 5EO1B 4M7KL 3OR6A 5F7UA 2DRUA 2AGJH 5KS9E 4F7EA 1VGKA 4U3HA 3FB6B 4JDZA 3SKJH 1QPPA 1QSFA 2UV3A 5E8EA 1NJ9A 4KKCC 2DBJA 4NWTH 1TVHA 4GRWF 3CFJA 2VIRB 3NH7H 5TF1H 4ZO8A 3V0WL 2BVTA 2X1PA 1IAIM 1MCHA 4G9FA 1KGCD 4LKCB 3G5VB 43CAA 3FFCB 1YUHB 5I0ZA 3V4UL 2OX5A 3JWDH 5I1AB 4R0LC 1KT2A 5GSRA 1GZQA 1WAAE 2HYMA 4KJYA 4KTEH 1T20B 5DEFB 4UDTA 4XRCA 1KLGA 5DVLA 4XNZB 3K8LA 4DVBA 1XF4B 3O2WH 2J5LB 4BFGA 5D7LD 3D85B 3NFSL 5IR1B 2Q7YA 1MCPH 3MRLA 4NPYB 1TNMA 3V5KB 5I18L 3U36A 1OTSC 4NZUH 4P5TC 2V9QA 3ULUH 4RA0C 4ONOA 5DFVC 1EDQA 1F4XL 4GRWH 1JHTB 4CDGC 3SGJC 4NRXA 5I1EH 3QAZC 5CEYA 4XPAL 1K5NB 1SBSH 1LK3H 1JPTH 1MWAB 1F4HA 1H5BC 1UCBH 4UB0L 1A6PA 2E5EA 4Y0GA 5AZEH 2NZ9C 1YPZA 5GS0H 4QRTA 3BH8B 5DI8A 1IZKA 4WUKL 4E9LA 5EZOH 1DQML 1VFAA 3GSRB 2HFGL 4APQC 3D3VD 3S88L 1MUJA 1ZLSH 2V5YA 5DMKB 5HGHA 4KFZC 1FL6B 5L2JA 4XVJH 1OQXA 3HUJE 1MRCL 5D1XB 1TETH 2B1AH 3E1F1 4G8GB 1JMXA 2YD6A 5J06A 1KCVL 4HBQA 4D9QE 1IM9D 1EFXD 3EO0B 3DBXA 4KXZH 4MA8L 1DQDL 5IMMA 1JYVA 3BKCH 4WFHE 2ICWA 4R0LB 1QR4A 3K8MA 4J12A 2Y1VA 5ITBH 1UT9A 4ZOBA 3RY6C 1W0YT 3HG1E 4R90H 1DR9A 3D3VA 4HWZB 1G7MA 4AG4L 3U1SH 4MA3A 4X99B 4U1LA 4WW1B 5F7NC 4MHHG 1Y0LB 1GC1C 2X9YA 5C92A 2Z35B 3ET9F 1I7TA 4I77H 1E6JH 5E99L 5DD1H 2VOTA 5LGJA 2JJWA 3MRPA 1EGJH 3FAWA 5AWNL 1YQVL 3BWAB 3D3VE 3SDXF 3GSWA 1Y6MR 3AU1A 4LLVB 1QQDA 1IBGH 4NQTA 4NQDE 3VH8A 3O9WD 4JQIH 2H41A 3ZT5A 2WWKT 4FQQA 4KVCL 4PRDB 1ZGLA 2JB5H 4PGJA 1G7LA 4XNYL 2W0LA 1NCAH 4PJBB 1A7NH 4O2FA 3P0YH 3SE4C 5GZOC 5EBMB 2EDHA 1QYGL 4YUEH 2ESVD 4YHYC 3KPRD 3CLFH 2AS5M 2J88L 1FFQA 3T0ED 2F53E 1A7OH 4RIRB 4HCRL 2I9LB 1GGBH 1P4LB 3P0VH 2VKXA 4FQLH 4KWUA 3PV6B 2IADB 2LV4A 1MREL 4HX1A 1U8QA 5LVEA 3CK0H 2YPKB 4ELKB 4LCIL 3VXSB 2RBLA 2C3HA 3GIZL 2L0DA 3PWUA 4XBGB 5IWLA 1BQLL 2K7QA 5AD0A 3G6DL 2ED9A 1PKOA 3ILPA 5CIPH 4X9IA 5F97E 2I07B 5GHWH 2NTSP 5F7YC 6CGTA 3VXOB 2FRGP 3SDXE 3NABH 1D5BB 1MCQA 3KNBA 4Z76B 4TOYL 3UBXA 1ES0A 1X5ZA 1A9BB 4YO0B 5EA0H 1KENL 3CXHJ 5D7KE 4G6AC 1N26A 1I8LC 3EOAA 2X4SB 1J8KA 5GGVL 3RIAK 5C0IA 2WAHA 3AAZA 4YBQC 1JIBA 3LMJL 1R3HB 3P0YL 1MI5A 2FO4B 2E7MA 4N68A 5ICZA 3GI9H 4JFQB 2V6HA 4H20L 4YGVA 3MLVL 5JQ6H 3ULVL 1BD2E 5T1LB 3LEXA 4JO3H 5A43C 5A2FA 2A6JB 5BZWA 1PBYA 5CSZA 4QGYA 5MI0B 1EGJL 4UZGA 1DBML 2DM4A 2GK2A 4PGZA 1EZVY 1EEYA 3TA3D 4QRRD 4M1GL 1RPQA 4UOW1 3Q2CA 3VXRB 2R56L 2E7HA 2V7HA 1F6FB 3BO8A 4HDIB 1O0VA 4WUUA 3LKRA 3RNQB 1ZVSB 4WFFD 5D72H 5JQHC 1J0HA 3OJVC 1CGSL 3DHJA 4Z7QF 5DMGC 3X11A 3CH1A 1RUAH 1VB9A 4F9LA 5DMJB 4AH2A 1CGSH 4ZUVA 4YHML 3MLRL 2FIRT 1YYLL 2VL4A 2R2HA 3TBYB 2R2EA 4K7PL 5FYKU 3OHXB 2CKNA 2FYYA 3UYRH 5GGSA 4LPXA 1I1YB 4MCYA 5EOTB 5IB1B 2O5XH 5J4MA 2V2TB 4X80L 3B3IB 2R15A 5F3HA 4QRRA 3TBTA 2AKRA 2IPKA 5MERB 5CHNB 3WLBA 3M45A 3MPCA 5KBNC 2P43B 4YPGA 3QQ4B 1IARB 1YY8A 1NBVH 2HVKB 2YXMA 3TESA 4G43B 5JQ6L 1YMME 1BFTA 1T1ZB 1XF3A 5F1SA 5FYLL 3U46B 1RHFA 1ZXQA 4FQ2H 4X7EC 3Q48A 5ICXA 5F7EL 5HGGS 2X41A 4U33A 4UB0H 2HRPL 5DUPH 4FNLL 1YNKH 5JOEA 5EB9A 5CGMA 1P4BH 1CT8A 3KR3H 5E9DE 5DK2B 3EOBB 1QFUH 4PJDA 2VR9A 5GGVH 4OTXL 2DKMA 3DXAE 2HMIC 3HI6H 3ZHDA 3QWRD 5JA8B 5AYQA 1JYWA 1JYXA 4BH8B 1RU9H 3EYUL 4FABL 1ZT4A 2EIEA 3U6RB 5MENB 3DUSB 1MVUA 4ZUTA 2E27H 3H3KA 2QKIA 5DJCA 2R0KL 3QJFB 1J1OH 3SE8L 4QHUA 4OKDA 3TVMA 2CLZB 4P5KA 5T1MB 2P8PA 5GISL 2ZJSL 4Z8FH 5C0EA 4X98B 3GIVA 4MJIB 1P1ZA 1OTTD 1UVQB 5CZVH 3CK0L 3HI5H 3C60B 1QLEL 2A0LC 1HXYA 5FO7A 3RX8A 4JFDB 1Q38A 1NGWA 4MSWA 4P4KA 5BW7C 1V3LA 3TEUA 5I8OL 2GK0B 4PGCB 2AJSH 2UZIL 4LMQI 4XVUD 4HUXA 2GJ6E 4YDVB 3BP7A 3LSOB 3SKJL 3AVEA 1MCLA 1U8PA 4POZD 1S78D 4UV7H 1XCQB 4WEBL 1CF8H 3FFDB 4JQXC 1N5AB 4NO5B 1EAPB 4P2RB 5CGYC 3RWDB 2UWEF 1IGJB 2R23A 1INEL 2YN5A 3CFBA 3NCYP 4XAKD 2P47B 1K8IB 4P9HC 3DOSA 4HWBL 3L5IA 5DDHA 4V1DD 3RZWA 2ARJQ 3W82A 2ZCKH 3QDMD 4P4KD 5JDSA 4NUJB 2GFBB 5INDB 2Y23A 4KKBD 4Q0XH 1TJHL 4APQD 5I16B 3RBSA 5BS0B 4P5TA 5FB8B 3K81A 5C1MB 3MFFA 3B5GA 1TITA 1U42A 1UXSB 1QFWM 3U1SL 3I6LD 3RFZC 1QSEA 3P4OB 4Y4FC 1HHGA 1FSKB 1RUPL 3SPVB 2A6DA 3K0WA 4DUVA 3C9NA 4LVHC 2BNQB 4PJAB 4ZUWA 5HJ3A 4TUOB 5E2UL 1P53A 5ICYB 5ID1A 3LN4A 2AJSL 3FFCD 3RWCB 2H2PC 1Q72H 3FMGH 5C0NC 2Z93A 3KDMB 1VKXB 3L3DA 3K4DA 2M8XA 4DZ8A 1LEGA 1A2YA 4BSJA 3O8XB 4I5BA 1QLEH 4HAGA 2J5LC 4APQA 4FTVA 1MRCH 3DTXB 5B8CA 4NN5B 4XVJL 4PFEA 4TPRL 1FVCA 2EE2A 4GG6F 4WHDA 4WCYH 1J9CT 4P2QE 1C7SA 1K6QH 4GSDL 3RTQC 1P7HL 4R7DA 5E2WL 5IJVA 4WFEE 4FTVE 4Y19D 4H88L 2VZUA 3VI3F 2XWJB 1TMCB 43CAB 5E56A 1H5BB 3DGCR 2ZCHH 2PXYD 1V7ML 4WHYH 3RUGF 4JM4L 4GUPA 2EZ0C 2VDQH 4YHOL 3VE0A 4OCLC 2O93L 1FH5L 5HHOB 1T20A 1CFVH 2MTPA 4F57L 2V17H 2V2WA 3RPKA 5IHLB 1EUUA 1VDGA 5BW7A 2EYTA 3D85A 1DEEB 4M6NH 1RZJH 3GEWB 1RMFL 5AYUL 4G7YH 2NY5C 3EHBC 4NP4H 3U36B 3V5KA 3RZCA 5LXGL 4L4VE 3CFDB 4KDWA 4KZEH 3GB7A 5I1DA 5HGAB 3IDMB 4JQXA 2BXZA 3MBED 3VH8G 1SEBB 4LVHB 5IW6B 3M17A 4OGAD 3JWDL 3I6KA 1YY9D 3BD5A 4W70A 5GRUL 5IBLC 1ZWIB 1TIUA 3L3JB 4NQUA 4G80A 1I3GH 3MJ9A 2V5TA 5IFAL 2Y5TA 1ZANH 5I1IH 1HCFX 2OMBA 1UH4A 2KZ1B 1G7JA 5HGHB 3HMWH 1IILE 5E8EB 1IAIH 3WKNA 4LP4A 5T3XH 2B8OT 1I7ZB 3SKMA 4POZC 1WFUA 5D7IA 4E41B 5A3IC 3RTQB 2AGJL 3ZTNH 1JZ4A 1GGTA 3G5VA 4OQTH 2YD1A 1GZQB 1YEKH 3AM8A 3P2TA 2BY1A 1MFCH 4UDTB 4QHMB 3SHSA 3F7VA 4P3CH 3WKML 3HG1A 5CZKA 3TH4T 4U1LB 1FNAA 1G0XA 1LDPH 1MI5D 4XCCL 1CD1A 1A6TB 4OZIE 2Q7YB 2IBGA 3IDXH 3OGCB 2JJSC 4G42A 2QQNH 6FABL 1ZSDA 5C09A 5SWZB 3LMJH 4YHLH 5JORB 1HK6A 3UTOA 5LQBH 5SX4I 5CEXA 4XBPB 4QXTB 4U05A 1QQDB 4HFUH 3PWVB 2X6MA 4DEPB 2HH0L 3QDHA 4ONFH 1QHPA 2PW1A 1ZOXA 3DROA 1N5YL 1JGVH 5DI8B 2XA3A 4XNZC 3HFMH 4XX1G 3CZFB 4XNXL 1Z0NA 1MUJB 3TLRA 1FNEA 1WIUA 2A74B 4PJGE 2CIKA 2R9HD 1BQUA 1G9MC 1X4ZA 2I9LA 1ULVA 2B5IB 5DUML 4AEIH 1ZGLP 4ZNCD 2AJXL 1DE4B 2IADA 3WL9B 1KPRB 1VGEL 3P0VL 4LCWE 3DRQB 5CIPA 3C87A 1TLKA 4ODUB 2VDKH 5EO0A 3LB6C 4H5SB 2IFFL 3P9WB 1J5OH 1IE5A 1FDLH 1T2QL 3G9VA 5IBUG 2R4SH 4BH7A 2PTVA 4DUWA 4JHAL 3UBXB 5F9DC 4NZRL 5MI0C 2ICWJ 1FZKB 2AP2A 3E6FA 4AEHH 1BVLB 4RWHA 3KXFE 2JCCA 3EDJA 3EOAB 3D69A 3NCJH 4AL8H 2VDRH 3H7BB 3FT2B 4XCFL 4PLOB 3MRPB 3EJZC 4J4PA 3HHRB 5ALBH 4I18A 4LLVA 4NWUH 1Q9WB 5E99H 4FXGA 4JO4L 4OKVA 1QP1A 4YIQA 5HHNB 5IVXF 4DEPC 1MCJA 5GIRB 2P8LB 4U7MA 4XP4L 1X9QA 1NCDH 4HHAA 1OGAD 1OTUD 1G7LB 1S7SA 5SWQA 4ZTOH 4PJBA 4O2FB 4PJBF 1MI5E 2BJML 5EUOF 4CAGA 2WP3T 5ITBL 2WUBL 3NCCB 1G9NL 4ZAKB 1JN6B 4KC3B 1FAKT 3VXQB 5SX4H 4JR9H 4XVUC 1RVFH 4R97B 5CILH 3MRHB 3O3AB 4WUUB 1UB6A 1U8QB 5I75B 1BFOB 4CW1B 5CAYB 3VXSA 3PWUB 3FOMA 3T3MF 4X9FA 3TVMC 4YC2C 3QEUA 3UZEA 5J12B 3QXDA 4NRYA 2F5AH 4BUGA 3ILPB 4NUGL 5TFSH 4ZMAT 4OSUH 1OAUH 2MQ3A 1U8MA 2EDTA 5DHYA 1DLHA 1C08B 2ZCLH 4ZODA 2FECI 3MV7E 3KYMA 1E4WL 5CBAB 4NQVB 4K3JL 4WW2F 1I1YA 5IW3A 5EOTA 4MNHA 4P4KC 1LHZA 5AZEL 2CJUH 2EDJA 5E2TH 1NC2D 3EDFA 1F4WH 4I9WD 3QI9B 5J6GA 5LWYL 4YNYB 1GGCL 4GBXD 5DGRA 4DJMA 2FO4A 2UYLA 3KHOA 1XF3B 2BVEA 4X9BA 3EKCA 4HXAH 3BYTA 3O0RH 3OJ2C 4XNQB 3K1KC 1DLFL 4RAUB 5JR1L 3ZE0E 3H0TA 4JRYE 2CKBL 4RISH 3BEVB 4WENB 2DB8A 2YPLE 3I50H 4NKDA 2OYPA 1ND0A 3BZEA 2A6JA 1IL1A 3MRDA 4P48A 1I1AB 2KQNA 5CJOH 3QCTL 3VXMA 1UZ6E 4BH8A 1H3VA 3QDGB 2VSDA 4HH9A 5MENA 4RDQG 1MVUB 2KKQA 5HHVH 4Y4FA 5TQ0H 1CXEA 3RL2A 2ADGA 4GOSA 4JDTL 2CLZA 1WFNA 4DAGH 3X11B 4LQFH 3ALXA 5T1MA 4M7ZB 4NWTL 2SEBB 5GGTA 2LU4A 2YEZB 4PJ7B 2DQFB 4UT6L 2WBKA 4M61B 5C0EB 4X98A 2Z91A 3CD4A 3QUKA 5HVHB 4OM1H 4GAFB 4PJXB 4NKOB 3BP5A 5HYJB 2DQUH 1CE6B 4U6HB 1LEKA 4XVSL 1DANU 2BY2A 2WUCH 3OKNA 4HQQH 2APTA 3DO3A 4PJIF 3D39D 4P4KB 5B8CC 4LVOC 4U3XA 5ADPL 5MERA 5CHNA 1PKQE 4GO6B 4KRPC 4IHOA 4M02A 5DJ2B 1NGZB 4G6MH 1MRFH 1TTUA 3RBGA 4Z6AT 3FL7A 1U92B 1IEAA 4Q9RH 4I3SL 2MCG1 1PY9A 1T1ZA 1DVFB 4PJFA 1CFTA 2Z8VC 5B22A 4FZEH 3HR5A 1KB5L 3CFBB 5J9PA 4KAQH 4LLQB 3I2CL 1OWRM 1PLGH 4UILH 3CFEB 1D3CA 3K1DA 5E9DB 1MAKA 5JW4M 3EOBA 5IKCB 5IUSA 5F7HA 3NCYS 1QSVA 5L2KD 5GZND 4F7CA 5EBLA 3KPRE 5I15L 4JFXB 3U6RA 1MFDH 3S35X 1MFDL 1NDMB 4LSVH 5I1LB 3HCVA 3KPNA 3VXUD 1QSEB 3NZHH 3P4OA 1X5YA 2A6DB 5F72S 1IMHC 5TPWH 1AO7D 1OAZH 2YPVL 4ZOAA 3MJ6A 3SGEH 4TUOA 1V7NH 1Q1JH 3LN4B 1QSZA 2H2SD 4UILL 3RWCA 3GSQA 4NQDD 1XGRB 2M1KA 2OR9H 3HE7C 3L3DB 3WFEH 4XC3L 1KN4H 2IPTH 3UJJH 3OSKA 3MUGB 2K3TA 1EFXB 3BSZL 5T3ZD 1M05A 4ZFOA 3SGKC 5DHXB 2IMMA 1FVCB 4HW6A 1ERNA 2J8UA 1Q0YH 3GMLA 4PLJC 5HDLA 5JOPD 4FFYL 1IQWH 2ZUQB 1RURL 2FGZA 1GOFA 5C6TL 1C5CL 3T0VA 5BZDA 4LFHG 4R7DB 1T03L 1JPST 2VWEE 4PJ5D 4WI3A 3NIDF 3LAFA 3RWDA 2KZWA 3IB4A 4XMLH 3HC4L 4XVSH 2R23B 5JXAH 4WNQB 1LO4H 1LO2H 1K8IA 4L4VB 4WGWB 1U9KA 4QHNA 4ZFGH 1WGOA 3C60C 3VFPA 1XAUA 3DETC 4OB5L 5JA9A 4DOHE 4UT9H 3BRDA 2MHAB 1D5IH 1WCQA 1T1YB 4S10A 2EYTB 4HFWB 3ARFB 4LFHD 3PG2A 5FGRA 3UROR 1IFHH 3MBXH 3CFDA 3VCLB 1KEGH 4ORZC 4ETQA 12E8H 1SM3H 4NHUB 2R8SL 2YRZA 2VLKD 4E41D 1L7IL 2A9ML 3SPVA 1YMMD 4IRJB 3FO9A 5C0AB 2AW2A 2BNQA 4TUKL 3Q3GB 5D5MF 2COQA 1FNSL 5F7FA 1OSZA 4WI4A 4KKNA 2IBZY 5I2IB 2Z93B 1UACH 4PP1C 5IG7A 4IIQC 4WWKD 4MA7H 3TBSA 3WN5B 4K71B 5CD3A 5TE7L 4W6YB 3MOBL 2EIBA 4DVRL 3V5HA 4MD4B 4YDIL 3DVNA 3QFDA 2XTJE 3OZ9H 4GW4A 3O4LB 4GG6B 3CIQA 3QG7L 1F4WL 4E42A 3OF6A 3VMNA 1RV6X 5IJVB 3GHBH 5MEQA 4F2MB 5J56B 1A3QA 1FFOA 4I2XB 4R4FL 4MD5B 5FM5M 2CPCA 1FO0L 3U2SB 5EN2B 4NC2B 4FXKB 3C5ZA 3VG0L 1PG7L 2EKJA 4HS3B 3QULB 1QLFB 3BIKB 3B2VH 1T1XA 4IRSB 2VLJA 4IMKC 2F5AL 1TVBA 5ESAB 3DECA 4OF6A 4HMDA 5KVDL 1EV2E 4ODWA 5I1JL 2X09A 4OFDA 2FL5A 1CD1B 1A6TA 4AT6B 1S5HA 4M7LT 3FQNA 4ODVH 1QRNE 1GGIH 1GPOH 1E6OL 3ULSA 1H3PH 5SWSD 3N85L 4JKLA 5DUBB 5I1DB 1BM3H 1BBDH 2M26A 2BFVH 3UC0H 1KXVC 1SEBA 4G3YH 1FLRL 1I3UA 1FLRH 4TVPH 3OAYK 1FNHA 3BUTA 5JNYA 4FG6D 1R3KA 1BZQK 4JFED 3CX2A 1DQQB 1LNUA 5JTWA 1NBQA 3ARDD 4KK8C 3O45A 4OD1H 4FS0A 5F1IA 1GC1L 3RVWD 4G80B 3OKOA 5EUKA 1PX3A 5F7DB 3OKLB 1HYSC 3GMOB 4J4PD 1NKRA 3JV4B 2Z92A 4LF3A 2VDRL 2VH5H 1LO5B 4NRZB 4XH2B 3RWFA 1YEJH 3LIZH 5DJAA 2X40A 1KPRA 3TF7C 1U8JB 2I5YL 3IYLW 4MB5A 4GBXC 4ENED 1E27B 4EI6A 1PYWA 4RA3A 4U6YA 1MFAL 4QXGH 3QXAA 4JM2A 2IG2H 1J5OL 2VUOA 5EO0B 4Y2DA 4NCDA 1CL7I 5T1KA 1X5FA 3VWKD 4LAJH 1T6VN 4PB0L 3BEWB 3MV8A 1AGDA 5K9JH 1JRHI 5BQ7B 2KPNA 1FZKA 4XTRD 5EFIA 4G42B 4ZS7L 2AJXH 3CPLB 5C08E 4WO4C 2EDLA 5I71B 4KXZI 3PGDA 4JZNA 4OUUB 3LPFA 4PV8A 5L9DH 5CS7A 1XF5A 1Q9WA 2MNUA 1I7RB 8FABA 1GGUA 5J13C 4F8TA 5IHUL 4RFEB 2PW1B 2HFFB 5HYSB 1FFPA 4Z78B 1F97A 1KPVA 3BYYA 4M9PA 5SWQB 3CDGB 3PWPB 5MP6H 3RX7A 1FNFA 2D7OA 1FNEB 2YD5A 3MLPA 5C0JB 2A74A 4JN1L 5I9QB 4XXDA 4ETYA 3I3DA 1UB5A 5T3ZH 3TBWB 3HRZA 3LOWA 4RFOH 3OB8A 2LFGA 1JN6A 3VXQA 5KSBF 1P2CB 2R0LL 5FGCE 4PR5B 4NZTH 1JI2A 3S37H 2EKSB 4YX2H 3QZWA 4J3VA 3FQRA 3C60D 3MRHA 3QPXL 3J8F7 1BFOA 2FX9H 4CW1A 1A64A 1RIHH 2CRIA 3SDAA 1MCCA 2Y36H 2J6EH 4I0PC 3JWNC 4R7NA 1UM6H 4MAYA 3S4SG 2MKLC 2P5WD 3TO4D 5CBEA 2H8PA 2HN7A 4GRWB 1F4AA 4D9RE 4Q9QH 3BT2L 4M4PA 3W0WD 4EEEA 2AJZA 2QR0B 5E24E 3E6FB 4KTDL 2A9NL 3STZB 3PWPD 5D71H 4YXKL 2EXWD 2Z31A 2DLGA 2HLFD 5I71C 1UKTA 4N1HB 2DLFH 4UIKL 5IOPA 3L9RB 3QI9A 1V7NL 3BHBA 3L7FA 4Y16D 5J6GB 4V1DB 2Q6WB 2J1KA 4I18B 5AEAA 1NCBL 3HZVA 3Q6GH 3DMMC 3MRFB 1GGYA 3PIQA 4XP5H 5L7XL 3LN9A 3VG9B 2P8LA 5BS0D 5I15H 2DYPB 1D6EA 2EYSB 1S7SB 2GYSA 2VYRE 3E8UL 4N8CH 1T5XA 3FHAA 4NKDB 5ACMA 1KSRA 3QH3B 2NY4C 4OFYD 1S9KC 4ZAKA 3HPLB 2YMXH 2C1OA 5KSBA 1MJJB 5C0BB 4WO4A 3DUHA 3L3IB 2I24N 3JTSA 1EXUA 4CJ0A 1G7HA 1HHKB 1UWGH 3WHE1 4NCC1 1LP9E 4KDTA 5F9WC 3ZDZF 4RAVA 2VR5A 1ADQL 5ECJE 4O9HH 3RL2B 1K2DB 3LH2L 4MZ2A 5E8PB 4NRYB 1AE6H 4LLWA 1INDH 2KDGA 3IRPX 4YAQB 3SDCA 4TRPL 5D7JD 3HE7A 5ITFB 2F74B 1YN7A 5DD3H 4JG0L 3WLWC 3BP5B 5FIEA 1CE6A 1LGVA 3KYMB 4Y19B 2ZCHL 5EC2A 4NQVA 2WSKA 3WD5H 4QLRA 1JJUA 4RX4D 1DBBH 1G6RH 1N7ML 2EDNA 1R3LB 5E2WH 4PLKD 3SGKA 1AHWC 1I85A 2YBRA 5FHBL 5C09E 5LJYH 4R97C 3WHXB 1I8MB 3N0PB 4LQFL 2XQBH 2AXFA 2O5ZH 4FQXC 1SMOA 4NFCA 1U92A 1IEAB 4KKBC 4XVTL 4I0PA 3AC0A 4Q2ZA 4N8VB 5J12C 3S7GA 3UPRB 2E7LC 2ESVB 2D7PA 4W4OA 4UMGA 1AD0B 3LQAL 4YZFF 4YZFE 3GRWL 4OLXH 5J1AA 1MEXL 5C7XH 1F6AA 1II4E 2YXFA 3BEVA 5IQ9A 4C59B 5C70A 1ND0B 3L6FB 3CCHA 2E7BA 3RU8L 3BZEB 3REVB 1C12A 3A6BL 2OMNA 2FNBA 4KI5D 3JTTB 5LKNA 2GEEA 1ZT7A 5B4MD 3SDXB 4P9MH 1WT5C 5EDXA 1JFQH 5FKAB 2PCPA 3WSQH 3PNWA 1ZGLM 4HT1L 4K3DL 1CE1H 1NGQL 4L8SC 3T0DA 4WIQA 4UV4H 5FEBA 3DHMA 1OGAE 3DMMA 3UX9B 3NIFF 4RGNE 3MLUL 1T66D 4H1LA 4DK6A 1NANH 4TSCL 1EEQA 2R1WB 1FNLA 4M61A 4HWBH 5JOPE 1XGRA 5L88L 1UJ3A 5ALCH 3PL6D 2Z8WC 3M1BA 4NKOA 3KVQA 2WWKO 3OKNB 2BSSB 1I9EA 4WHTB 1JRHL 2XKUA 4JCMA 4PJIB 4HGWA 3K2MC 3IETB 4RWYH 4HWEL 4LSRL 2J8UB 2R0WL 4EVNA 4C56D 4GQ9H 3QDJB 4KRMB 5BZDB 2UZYB 5EIQA 2RCSH 2VDLL 4EIZC 4Q97A 5F9JB 1XGYL 5EU7E 4M6OL 1DBAH 1NLDL 2VITB 2VLKB 1A3LH 2L7JA 4PJFB 4OI8A 5H37H 3NPSC 3EYQC 4LLQA 3NMEA 4AM0B 4HWUA 4QHNB 3KPPB 4UT7H 3I6LE 2FX7L 5GRWA 4NQEA 1F3RB 2YSSA 3RWHA 4BQ8A 1KTDA 2BJMH 2H9GA 4M43L 5JO5A 1H8NA 1IC7L 4YJZL 5J7CC 4ZXBD 2NNAB 5BMFH 1BJ1J 1G84A 1Q94A 3EOTH 4PGEB 3ZDXF 1MPAL 3KYAA 4ETQB 2OK0L 1S7TA 3FHQA 4V1DE 4K2UH 2QQLH 3OMZA 3SOBH 2XZCH 5KZCD 3FO9B 5C0AA 5IFHL 4EXKA 1K4CA 4XX1E 3OPZH 4XAKE 2JK5A 4XHQA 1PEZA 2DQEH 1Q9LB 2YZ8A 1OTSD 3IDJB 3D39A 1MHEB 3Q1SH 1MWAH 5EU3A 2EH8H 4M1DL 4JVWA 2PYEE 5ILTH 3MV7B 1F90L 4K3HA 5FYLH 3W9DB 1U8OB 3V8OA 1WZ1H 4G8GE 3VFUB 1R5IA 4KY1H 1ORSB 2EH7L 3T09A 3I3EA 1HCVA 4ZFOB 1DBJH 1LMKA 3GUTB 4GG6A 4KK8D 1H0DA 4NC1E 1I3RA 5IVOA 4KDVA 1IGCL 3BUYB 3CMOH 3RQ3A 5D2LE 3GNML 5DQ9A 5EOQH 3KHQA 4QRPB 2FEEL 3F5WB 1DN0A 1K8DB 4L4VA 3VFRA 1R3JA 2E8YA 4X6FB 4KPHH 3S3PA 1AKJA 1N64H 4JB9L 3RWEA 3VFPB 1LD9B 4JFZL 4PRPE 1CS6A 2GJZB 1JGEB 5ESVA 3QUYC 4JE4B 4AMKL 5H2BB 2FX8L 4KMTH 1AIFA 4ODWB 3QHZL 3GMMA 4IRZL 5BJTB 1YNTA 4O02L 1ZHNA 3ME0A 4ENEC 4ZUSA 3ARFA 4P59L 1S5HB 3I9GL 3WMSA 2IGFH 5IROC 5T3XE 3HFML 4D9QD 4RZCA 1HSAB 3ECBA 4ONFL 2W9DH 1TQCB 4LGRB 4DW2H 2ZZUT 4HFUL 3BGAA 4OLZL 3VGFA 3QIBA 3OJDA 3UZVB 2DIJA 4LRNH 4JFDD 5EZJA 4KQ3H 1R3KB 2CDGA 1AKJD 4LSSL 2D0GA 3EYVB 2G60L 5BRZE 4IOIB 2L7UA 2QV2A 4X5XA 2Y06L 4QRPD 2Y06H 3GI9L 1UQSA 3QPQD 1V3MA 3DVNB 4CN4A 3QFDB 4JKMA 5EBWB 4GW4B 4P3CL 2UY6A 1CI5A 2D9QB 2HRLA 4PBWD 1FZMB 4DWHA 3QUMB 3MA9H 3O3UN 1A1OA 4HUVA 4MD5A 3F62A 3LKPA 3TJEL 2DKUA 5EN2A 5AAWA 3IRZA 3I9GH 4NFBA 1BGXH 4L8BA 1UZ8B 3C5ZB 5KOMC 3QHZH 4IRZH 4DN3H 1GYAA 3QO1B 3WN5C 3BIKA 3MCKA 4NKIH 5T1KB 4OFVA 5ETUA 2VDPL 1JWMA 1P7QA 3HMWL 1TVBB 5ESAA 1T0MB 3IT8D 1BWWA 3W9EA 5CKAA 3EYFA 3LEYH 4DZBB 2XNAB 4YBLC 5FYKH 4AT6A 5BQ7A 4JFEA 1WV7T 4KRNA 4L4TD 4PUBL 1H9VA 3IFLH 1NMAH 3D6GA 3LRSB 3QRGH 5GRUH 2Z31C 4NGHH 1JK8B 5C6WH 5JLZB 3QCVH 4DN4L 5DUBA 2BSTA 2ATPB 3VD7A 3LV3B 4K23H 4WVRA 1BFVL 1RZKL 3R1GL 3GJFA 2ZNXA 3QFJA 4G6AD 4L1HA 4BYHA 4K7FA 4BA8A 1FCGA 4NDMA 3V6FB 4N5EC 1Z9SA 2HVJA 3P30L 4LRIC 1NAKH 5HYSA 3OKOB 1NKOA 4OZHE 1YEFL 1A8JH 5EU4A 3KPSB 1BEYL 2V9TA 4MLSA 1N6UA 3PWJA 1I4FB 1IJ9A 3GKWH 3HZKA 3BESR 4O5LH 1AGCB 4XCYB 4KUCD 2HKHL 3H42H 4YHOH 3W0WE 1MAMH 5IHZA 1V7MH 3FQRB 2OTUA 3EOTL 2E6PA 1U8JA 1OP5H 1BOGB 3H9ZA 4U6YB 4HIXL 1A7RH 4QNPF 1RIUL 3T0XA 3X14A 4AG4H 4JM2B 5KVGL 1K6QL 1BD2A 4ZXBC 5TDOA 1NFDE 4PRIE 3BEWA 5FGCB 3KLAA 4I1NB 4D8PB 5KS9F 5JHLL 5L8LB 1T0NA 5FYJH 5BRZA 1DQDH 1Q8MA 4XMPH 2YKLL 2MWCA 5DC4B 3GMPB 2Q3AA 1YEIH 3CPLA 5I66B 5E6IC 4K94H 2Q8BL 3CSYA 3BAEH 1I85C 4YHZH 5GS1B 4MQXD 1S9WA 3MXVH 5IMKB 3S97C 4RMTA 5DJ0B 4FQXA 1ODAA 3HZVB 1MFNA 1XF5B 2K7PA 4QRPE 4FQIL 5HI5D 5D6CA 8FABB 2BNRD 3PWPE 4NQCE 4NM4L 4P99A 3MZTA 3X17A 3C8HA 1D6EB 5IF0B 5JXEA 1KPVB 3EAKA 3RTQD 3MOAH 3LEVL 5C0JA 4PRPA 2XZZA 5L88H 4Y2DD 1JPGB 5T5FL 1V5JA 1ZEAH 3MXWH 1G7IA 1SBSL 4HJ0C 5HD8D 5D5MA 2JJUA 2NY0C 2PXYC 1NUDA 3ZL4H 5KSBB 4PR5A 4WO4B 1BEYH 3L3IA 4G7VL 4S1RH 1DDHB 1HHKA 4Y1AE 1BQSA 1F58H 4RAVB 4ELMF 3BH9A 4YDJB 3SDAB 3ILQD 2GJ6D 1JVKA 3TN0A 5BXFA 2C5DC 4P2QB 1NGYA 5JW5A 2O5YH 1E0OB 5D1ZB 1DP0A 4YXHH 4MD0A 4LRIA 2C9AA 1M7IA 2H8PB 4D3CH 2F9BT 4YBHA 2HKFH 1YN7B 5GRYA 3EYQD 4LLMA 5DK0A 4QO1A 2PYEA 3R8QA 2AJZB 3LS5H 1B2WH 5DRZA 3I3BA 5F88A 5DURD 5I8KL 3O6ML 1CQKA 4LK4A 4HBCL 3QIWB 2X1XR 3QQNA 1CGWA 4U1JA 5IBLD 1MJ8H 5I74C 3L7FB 4LEXL 2OTPA 3RVUD 4V1DA 1TJGH 3WO4B 4YXHL 2AXFB 2X4TA 4Q2ZB 1JNLH 4H8WC 4M7KH 5EORL 4DGIL 2A38A 4YHIB 1B4RA 2A6IA 2CRYA 2DTMH 4G5ZH 5DYOB 1RU9L 3LQZA 1J7VR 2JJVA 4G9FD 2JJTA 3NTCH 4OTXH 2ZKHL 1KIQB 3GSUA 1INQB 1AGFB 3MR9A 5KSAA 3KR3L 5T5NG 4JFHD 3SDXA 3MXWL 1S9VA 4G6KL 1DSFH 2XKSA 4FG6C 3D18B 4QY8A 3LEVH 2AK4D 4LDOB 3G5XB 3HE7D 2BSRB 2NZ9D 3VMPA 3T3ME 3DUUB 1MFBH 4PG2C 1WISA 4C56B 3R06A 4ZFZA 2EE6A 2QTEA 2JLLA 3IS0X 4MJID 4JFFA 1FRGL 4HWBA 4LLWB 3MXVL 4HV8A 1FP5A 3SDCB 2QSQA 1HSBB 4R8WH 1X5GA 2YD9A 3DSFH 5JXEC 1LEIA 3B9AA 1KACB 1AFVH 3OGOE 1CVSC 4OLZH 3O6LL 4YH6A 5AG9A 1YYMH 3HNSL 2NY4B 3K2UH 4PJHF 1CFQB 4PJIA 5C0GA 3UYRL 1NDGB 2ICEB 5E6ID 1RD6A 1SYSA 2ADJA 4P2OC 5JIKA 1A6WH 3EZJB 4AMKH 1GAFL 1I8MA 4XHJD 5CP3A 3AUVA 5F9JA 2CKBB 3I6GB 1I7UB 4CN6A 3WXWL 2A6KB 4F15B 3VD4A 2HJLB 5D72L 2VXUL 2OSLB 3LKSB 5D71L 5FA4B 4YXKH 4MLIA 1QO3A 1MHHA 2XZAL 3B43A 3CVHA 4GLRI 1H15A 1LO0H 4P46D 3AXLA 3QXUA 3L6FA 3CCHB 4UTBH 1RZFH 1FGVL 3SGDI 3SDCD 4Z77B 2VAJA 4UQ2B 1KTDB 1DBJL 4L5FL 2PCPB 1T5WB 1OCWL 1PG7W 4NKMB 4G9FE 1WWAX 4QNPE 5E7FA 2NNAA 3CVIH 4PP1D 4HEME 4PJ8B 2B1HH 4ELME 1NMBH 1S7TB 1FORH 3MV01 3VFGL 1YEDB 1JTOA 5HVGB 4NYLB 4ODXA 2GCYA 5EUOB 2R1WA 1BFVH 1RZKH 4JN1H 1HEZB 1UJ3B 5EU3B 5IFHH 1U3HB 5FV1L 4LCWB 2QQLL 2BRRL 2W07A 5J1TC 2W92A 4PJ5B 3ARDC 4PRBB 1BFSA 1BJ1H 1NEUA 3U30B 2BSSA 1QBMH 1NMAL 4ZS6D 2X4UA 3B8YA 1Q0XL 2G2RB 1ORSA 4KZDL 4IBLT 3Q5TA 4PRPD 3LEYL 2H32H 1ZHKA 2J8UF 3FOLA 1S7RA 1YPZE 4U7SA 2FX7H 1N59A 1HNFA 4N0YL 1UYWH 4X6DE 1BAFL 2VITA 3BUYA 4HS6A 4JY6B 1IEBA 4PJFF 1JWUA 5HHOD 4WW2B 4QRPA 1F13A 4U31A 4FQHB 5EU7C 3VFRB 2HJFB 1KJ3L 3CVHH 1A7OL 2OI9B 5EOCJ 2RCSL 1YEEL 4J8RA 1JGEA 4OLWL 5C0AD 1D5ZA 4NQEB 4MQTB 4M62H 4CMMA 4MXVE 1U93B 1N3NA 3R0NA 1X5JA 2BVOB 3GMMB 4LCWD 5BJTA 2CIIB 5F9OH 3UTSE 1QBLL 5HYJE 1F00I 4H1LG 1WAAA 1JZ7A 4D2NA 1YEJL 1HQ4B 4JRYB 4ZPTA 3DLQR 4D9RD 1ZE3C 3MRNA 4XNUH 5ALCL 1FVEB 4Y5VC 5JW4Q 2WP3O 4Z7VB 1K4CB 4NFDA 1T21A 1YQVH 1P7QD 4Z0BH 4D0DA 2VLRE 3D39B 3PDGA 5HHPA 2CDGB 1DANT 3TA3C 5DD1L 4Z95L 5DD0L 3I02A 3NZ8A 4X5XB 2DIBA 4JY4A 4LGSB 4MX7B 3ZKXC 5D1QD 4LPYA 3O4OB 1B0GB 4U1GC 1NCWH 2B0SL 4M8VA 2N56A 5IB3A 3VFUA 5DJYB 1VEPA 5SV3A 2AI0L 2XXCB 3IFPB 1I9RL 4WFHD 4OZGE 4DCQA 2OJZL 1H0DB 1MNUH 3UTPD 4JKKA 3WUWB 4PJ7F 1IGFL 5IEKA 3CXHK 1KTLB 3ZTJG 2MPAH 3OXRB 1PD6A 4UU9A 3OWEA 2KQMA 5C7XL 3L3HB 1DTUA 2DM7A 5BV7C 1XMWA 4GFTB 4PS4L 1JHKL 4WTZG 1FYTB 1TQBB 4WFGE 5HHQA 3MC0A 3OB0K 2GSGB 1DN0B 1K8DA 1HHJA 5GGTH 4HUWB 3U4EB 1KIUA 2B1AL 4L9LA 3PWNB 4JN2B 1R24A 2NXYB 4JPVL 1LD9A 4Y1AB 2X4RA 3HE6A 2DWDA 1JWMB 1P7QB 4RSVA 1T0MA 2VXVL 1R5VA 3IS1X 3W9EB 1VHPA 1G6VK 4DZBA 3S88H 2NY2B 4GKZA 4MNGE 4LLAA 1ZHLB 1Z9OA 4R4ND 3O9WC 1WZ1L 4JFEE 1REIA 1T4KA 1A14L 3ECBB 2BNUB 5HPMB 2EXWC 5GS0L 3NCEB 5ISZE 3LV3A 3DJ9A 4R2GD 2CQVA 2GW5A 2OR8A 4Y5VB 4GRMA 4KMLB 1LK3L 2FECL 5FHAL 1M1SA 3GJFB 3QFJB 5GRJL 3BZ4A 3QUXB 3TC9A 2HMID 3TZVC 3ISWA 2DLIA 4X8XA 3V6FA 7FABH 1JZ6A 2HVJB 3B9KB 4L3CA 4S1SH 3WDIA 2J4WL 5JW4N 3G08A 1F3JB 1Y6NR 4NN7B 1G7PA 4Z7WF 1KFAH 4R9HA 1ZVHA 1JGUH 2Y6SD 3LKOB 2FZ3B 5ANMA 2ZPKH 4P2CG 3V79C 4TUKH 3QEQD 1CGXA 4KUZL 3QUMA 1BVKA 4HUKB 1FO0A 5IHZB 3V6ZA 4N8CL 4WTXA 4XPTL 2IC2A 3EYOB 4S1QL 4PJFE 5SX5H 5DSCA 3FB8A 3TN0C 1XCTA 1CZ8L 3MJ7B 4HSQA 4P23D 2JIXD 5TDOB 1IC4L 3MYJA 5KN5A 3G6JE 3F12B 2DI8A 3FT4B 3P0GB 3KLAB 4D8PA 3QUML 2LAAA 3DMMD 4RWYL 2AJVL 4C54A 4NBZB 3BJ91 5FYLD 4GAGH 4L4JA 4KMQA 3B5TA 5I66A 5GJTL 1JK8A 1EO8L 1N8ZB 1G0YR 3CFKB 2ATPA 1QNZH 3OR6B 4YHKH 4O2EB 3FB6A 2YRLA 3TH2T 5GS1A 1YEHL 3VXRE 3MJ9H 3KPLB 1QSFB 5DJDA 3RUGE 5E00A 3QEGH 1TVHB 4TSBL 3U7YL 2VIRA 3S36H 2IPUG 5C3LD 4WWKA 3LKQA 4X7DC 4LVEA 3HI1A 3KPQA 5T33H 4HT1H 2DDQL 4TNWF 2I60L 3VFOA 5TE6L 1I4FA 4RFNB 3U4BH 2AQ3A 3KG5A 3KLSA 2R4RH 5D5MB 2AV1B 2EDWA 3RIFF 3A6BH 2YPVH 5T3ZL 3JWDC 1XF4A 3V7AE 3EO9H 5DJ6A 5HDOA 3TWCH 4A6YB 4YDJA 2B2XH 2IH3B 2VC2L 5K33A 2HP4A 3RP1A 1A47A 3TN0B 5BXFB 2Y9RT 4HAFA 3RRQA 3S34H 3DO7B 2FHCA 3QJHB 4JG1H 4PLKC 5IMLB 3LZFL 3MGTB 5L9DL 4NO3A 4ONHB 3QZWG 4IMLB 5C0CE 1PLGL 5SWSB 5KS9B 4NNPL 1AC0A 4ONGL 2HG5B 5L2KA 5TDPA 1EA9C 1TXKA 2DD8H 1CGTA 3QO0B 5BCAA 3O6FD 3VXPA 1JWSB 3S4SA 2EC9T 2NY5H 4JRXE 3SO3C 3LCYA 4BJLA 1XFPA 4KI1A 4KQ4H 4F58H 1U8NB 5DJ0A 1FL6A 3VRJA 1HKLH 4ZFFB 4Y89A 1ACYH 3KPSE 2X1QA 4LHUG 3QQ9C 2FBJH 4HIJA 5C2BH 1JZ5A 1CDGA 2AJ3A 4JPWL 5DYOA 4ODSH 2NX5B 1VFOA 3WXVL 3LKNA 5ESQB 5IMMB 3HB3C 1GCFA 3UTTA 4JJ5B 1KIQA 2Z8SA 3RHWK 4IOFD 4Z7UE 1A9EB 5ID0B 3LDBB 2VQTA 2VLRD 3SO5A 3PQYA 3LZFH 4PJEE 3G5XA 2EDXA 5FO8B 4HWZA 2Q76B 3IU4H 4WW1A 3GBNL 1IM9A 2B2XL 4M5ZL 1NGPH 4ELMB 3FQWA 4NCC2 1CK0H 1GOGA 1UWXH 2A2QT 4A6YH 5DVKA 4G8GD 5JW5B 3MRMA 1NCBH 4MJ6A 4MHHI 5LGJB 3HS0B 2KUTA 4ODHH 4TVPE 2OL3L 4S2SB 1XZ0A 3UC0L 1YECL 4JRWA 1PZ5A 2DLFL 5DK0B 2FB4L 3LVEA 1HZHL 3TT3L 2FBOJ 5JR1H 5DZOA 3WV0A 3NGBB 4S11A 5DRZB 1F5WA 3O0RL 4B50A 1L7TH 1NDGA 2A9NH 2ICEA 3ES6B 4NQSA 3DARA 4WWID 4AIZA 4Q9QL 2ADJB 2VNCA 3JV6A 5E4EC 9CGTA 2DJUA 1OARL 2DTSA 4I3RL 3B83A 1S3KL 4F7TA 3QUZC 3I6GA 2OJEB 1XF2A 4RIRA 3LKSA 2J6EL 2XXMB 3L3GA 2Y36L 2Y6SC 1FO0H 5D1ZC 3X3GH 1QO3B 3UJTL 2F54D 1U3HC 4Y2OA 1EZVX 3U30C 5JW3H 2ZSWB 1BQHB 1VPOH 3IDNB 4JREC 4N8VG 4UQ2A 4LBEA 3H8NA 4RFOL 4QCIB 5EUOE 2AV7B 3OZ9L 2H2PD 4QKXB 1KB9J 3VXOA 5MP6L 3QNXA 3O41A 3DUUA 4YDLB 4RRPA 3BMVA 4C56E 4HK3J 2D03H 4C56A 1RVFL 1DFBL 3DETD 2NY1C 1AY1H 4XWGL 3IKKA 4NQDB 1G6RA 3VFNA 2YK1H 2FB4H 4TNVF 5EUOA 5C0IB 3RVVC 1NGXA 2AK1L 1FC1A 1LEIB 1HWHB 3GI8L 5KJRL 3QXTA 3EDEA 4WY7L 1QFWI 3MO1B 4JPKH 1KEML 4OCWL 1KFAL 3NGBC 5ICZB 4QEGA 3NFNA 1RJLB 2J4WH 4LSUH 4JO4H 3V0AC 4ZYKB 1SYSB 5SWZD 4R4NC 2BMKA 2IANA 3GSXA 4OB5H 5E4EB 4U6VL 1ITCA 4OUOA 5CSZB 2VISB 4OD2B 2XIDA 1UFUA 3BQUB 1P5UA 3DNKA 5JMRA 1U3JA 4JRYD 1EEYB 4L4VD 5IB5A 1LO2L 5EOCH 2YS4A 2QADD 1QLRB 4HXBL 1F3DH 3BO8B 4UDUB 5KVFL 2AK4A 4RMRA 4XPGL 4CU8A 1H3TA 2O61A 2IFFH 1U93A 4N1EA 2CDFA 3ALWA 4AH2B 3P9MA 3K3QA 1JCKA 4R96B 2BZDA 2YHGA 5A16A 5GGTL 1BOYA 2IPTL 3G5YB 1CLYH 3E6HA 4XC3H 4MCYB 5IB1A 3TBVB 3DX9B 5F71A 1VSCA 4F15C 4QRRB 5F3HB 2GCYB 2OR9L 3DXAB 5C0DB 3IJYA 3QQ3A 1T21B 3GSNB 3FKUS 2WZPD 2OJZH 1OAZL 1XR8B 3MV8D 3PHOA 3QQ4A 4HC1H 3I02B 5EWIH 5HYJD 1NCCL 1TZHA 1CWVA 4JY4B 4MX7A 1U8LB 2WWMC 1LP9B 3BP4B 1B0GA 5I1GH 1NAMB 2AEQH 4Y4HB 4ORGB 3RGHA 3OAZH 3EO9L 5HDBE 4X4ZA 5LGHL 1D6VH 5H8DA 1KG0B 4PYGA 3DX8A 2FSEA 5B3JE 3QQ9D 3GO1L 3WUWA 3HZYA 1Z9LA 3EHBD 5DK2A 4WO4D 3CU7A 4UU9B 3C5SB 4XNUL 3P11H 5H35B 1FG9C 43C9A 2FO1A 4NN5C 5IHBA 2ZUXA 4WW2A 4JHZA 5F89A 4L3ED 1LDSA 1WJ3A 2VL5A 5F70A 3UJTH 2PW2A 4WEUD 1KPUB 3V6OA 3PWNA 2CK2A 3U7YH 2ZUSA 1S7VB 4J8RB 2Y07H 3S36X 4GKOA 3FQUB 4PJBE 3NCFB 1R5VB 4I3RH 5MEOB 1JUFB 2M2DA 4GKZB 1CFSA 4J23A 3CMGA 5ADPH 1QNZL 3SJVD 1K3ZA 3BIBX 4LDLB 4Y4KB 1W72H 3MOBH 5FV2A 4AY0A 3BKYH 1HXYB 2A73A 4HZLB 1R5WA 4MSWB 5DFVD 2RAMA 4Y8DC 2WANA 4Z7VF 4XTRC 4X4YB 4FFZH 2OL3H 5B3JF 3WIHA 4I0PD 3OG6B 5C0CD 5HYQB 3GBML 3O11A 1BZ7A 1E4KC 1Q0XH 3S37X 1IFHL 4Y4HC 4S1QH 3GBNH 3T65A 1KIRA 3DI3B 2FZ3A 4KHTL 4DCQB 5K9KB 1K4DA 4BQBA 3BXNB 2VB5A 3OXRA 1HQRA 1N0LA 4HGKC 2C3XA 4X6CA 3QYCA 4HF5H 4NP4L 4PRHA 3RWJA 1F11A 5BS0A 1RMFH 3FB8B 1RUKL 1ZHBA 1EBPA 3ELAT 4NO0D 2XACC 2ZOLB 2VXSL 4PJEA 5F3BB 4S0TD 4J3XA 4J3UA 5EU5A 1B90A 4CVZB 1CFVL 3B6SB 2BOCB 2AJUH 4F57H 4Q6YA 2IMNA 2GAZB 4ZUWB 1RZ7H 4UTBL 3RDTA 3OJMB 1ZHLA 1ZLUH 4C58B 1NC4A 3KDMA 3T2PA 1VKXA 3RVVD 2KH2B 4H0IA 1ZLVH 4HK0A 5E6IB 4RMWA 3O8XA 4FOMA 4KK9D 4X9HA 3WFEL 4IS6B 4APQB 1WIPA 4MJ4A 1Y18B 2F53B 4I13B 4GRMB 5E94A 2BNRA 1NFDA 1BREA 3HAEB 3MV7D 3WDJA 5CKGA 3P4NA 3EO1B 2QSCH 3BPCB 4ZTPH 4IJ3C 3JZ7A 1D9KB 4WWKB 3LKQB 1CFBA 2VC2H 5JMOC 2DKSA 1SY6A 1G7PB 3O3BB 1RZ8B 1H5BA 2JCCF 4EUPA 2VO5A 3LKOA 4EXPX 1Q72L 3FRPG 2YA2A 4EN3C 3GK8H 3VE0B 3AFLA 4LCUA 1QR1A 1UXWB 1TJIL 5DLML 4KI5E 1S5IL 1KBGH 5C07B 4HIHB 4ZTOL 2OBGA 2ICES 3GSOA 3MGOA 3F7YA 2KL6A 1CTOA 1S9XB 2P5WB 3MLZH 4Z18A 4BQ9A 5KAQF 4I9WE 2OP4H 2PUQT 3RKPA 2R29L 2CMRL 5I30H 1A5FH 2X7LA 2YD7A 1MRFL 2ZCKL 1E4KA 4IRSD 4CVWA 5I6XC 3QA3A 5SWSA 2MFNA 4AJ0A 5DO2D 1U3YA 3T1FA 5IW6A 4WU5B 5L2KB 2GQHA 3TCLB 3I6KB 2D9CA 3GMNB 1YEGL 4KI5C 1MSPA 2ESVE 2A77L 1QKZH 4XMKH 1N8ZA 3CFKA 1KNOA 1W0WA 1A4JB 2DQJH 2G5RA 3GJEB 2PO6B 3UTTE 3QEQA 1TJGL 3QUZA 3G6AB 3MNWA 5DJDB 4XHJC 2FJGB 4ACPA 2GTWA 3V9FA 2UZIH 3UTQA 5FDYA 4E41A 3ULUF 4M7LH 3C5JB 3MX0A 5I8KH 2NY7H 1VGEH 2WQRA 4L3EA 2X4NB 2NX5A 1B3JA 4C83B 1T80A 3VFOB 4WY7H 5DUMH 4AEIL 3C8KB 2GJJA 4YHNA 3I85A 3VFSB 1UYWL 1A9EA 1OAXH 2HA1A 2HKFL 4KROC 5D1ZD 3PGFH 2WNGA 5D93C 4X5LA 4CUCA 2Y72A 4JRXA 2ZPKL 2HAZA 1C7TA 2O5YL 1MQKH 3HG1B 5FO8A 3PGCA 4JO1H 1GJIA 4MQ7B 3SEPA 2IH3A 4LIQL 1XIWA 5B21A 3OGCA 3IKCB 3DO7A 4FQJH 5IMLA 2CUHA 3MMEA 3OKEB 2PO6D 4R26L 4NO3B 4ONHA 4NN6B 3MROA 1XZ0B 2RFXA 1FNGA 1ZLUK 4IMLA 3IDIA 5F93C 5FUOL 2ARWA 4XBPA 4DGYL 5J11C 4XB8A 4QXTA 1I8KA 4JREB 1OB1B 3VXPB 5IWLC 1JWSA 3S4SB 4JRXD 3ES6A 4I4WA 2XYCA 1AXIB 4NM4H 4XCCH 2Q20A 4MAUH 2F8XC 5B38A 4QHLB 5C9KA 3QWOA 3H3PL 2UUDH 4BSWB 2I9TB 3IF1A 3MACH 3QIUB 4XAWH 1OAUL 4OSUL 4OFYA 3VRJB 5MEPA 5J3HD 3KPMB 3U9PH 1QBBA 4N90E 3F58H 1B6UA 5IP4A 4M93C 1SEQH 4YE4L 2XY1A 3DWTA 5ESQA 3NA9H 4MMXC 2B4CH 1KJMA 4GKNB 5EZIL 1MRDL 3BKMH 4JJ5A 3DRQA 5AZ2H 1YMHA 2VAAA 4QCIA 1MNUL 4ODHL 4GAYB 2AV7A 2P24A 3CZJA 3FB5B 3PQYB 3KJ6H 4G8IA 5KVGH 4E0RA 1PDKA 1MOEA 3IDUA 5KSUA 4QWWD 2B0SH 2VLJD 5JHDB 1D7FA 4ELMA 5GGVY 5GGRB 2R1YA 5BVPL 3QDME 4Z7WA 1U91A 4M6ML 2W0PA 4NQDA 5E2VL 3WEXB 2OZ4A 3SE9L 3I75A 3CU1A 3F7PC 3V95A 4R8WL 4S2SA 4O5LL 1JZ2A 2Z31D 4GXVL 3DGGA 3TO2B 2BHUA 5TQ2L 4KK9C 1CXFA 1ORQB 4KZEL 3CFCL 3S8WA 4HC1A 4OKVB 2GHWB 1YEFH 3PUCA 2N4IA 3U9UB 3WS3A 4NQSB 4F9LC 2KBGA 3ZYZA 5DK3A 4X8JB 1WUNT 4QRSB 2FBJL 5DQJA 5D2NE 4JHAH 1C5DA 4ZYKA 2R4SL 5F9OL 4JM2F 1ACYL 1DSFL 4G6KH 1HKLL 2P45B 3JV0A 4OZFG 1YEEH 2Y7QA 3P4MB 4OLWH 3RIFK 1ZT1A 3ULVD 2G5BA 3ARZA 4ZDHA 2ADFL 5HDQL 3FTGA 3UTTD 5IVXE 1QPXA 4X7SL 1TPXC 3GMQB 4M93B 4XWOD 4PJDE 2DYPD 3M07A 4UDUA 4XNMB 5GS0D 4G6JL 1UB6B 3QG6B 4GW5B 2OI9C 1NQBA 2DI7A 4RBPK 3OAZK 4YPJA 4HZAA 1KJ2H 3NACL 3UJIH 2N1KA 1DVFC 2ZNWA 3IDNA 4PV9A 1ADQA 2D4DA 2DQCH 2FEDD 1U6AH 1U8MB 5DRWA 3FRUA 1DLHB 4R96A 4JG1L 1AXTH 5FYJE 5A16B 3KLDA 1C08A 1I9IH 2IAMC 4TYUA 2XTLA 1VADA 3TP4A 2APXA 4U1IB 1UEYA 2PF6A 1FAIH 4L4TE 4PLJD 1P4IL 3TBVA 1ZV5A 3U0TA 3KPOA 1I75A 4AIXA 5DXWA 4HCRA 4D3CL 1A6VL 1MCOL 3VWKB 1M71B 4FFWC 4S1DD 4YHLL 3U4BL 5TE6H 1NANI 3ZE0F 4HUUA 1RI8A 2JB5L 1XR9B 1H3UA 4LHJB 4M9OA 5T33L 1NAMA 4Y4HA 5DHVH 4ORGA 3EOYG 2CXGA 2AXHA 2F54E 3LQMA 5JHDE 4XNQA 2ITCA 4HMEA 4LLYA 2EYRA 5CLTA 5DT1H 2BMKB 3NIFE 4TTGA 1CDUA 3QEGL 1RZGA 4Y4KC 4MS8C 3U83A 3IDYC 5F96H 1H8SA 4GMSL 2DBLL 4ERSL 3VGBA 2H6PB 4ZSOB 4P57A 3U7WH 5H35A 1J0IA 1KF9B 2D2OA 3O6FC 4HS8H 3N50A 3QI9D 2EIZB 4HH9B 3IXTA 1CLZL 4GJTB 15C8H 1IKFL 3T77B 4GG8B 4LLUB 3FQXA 1TCRB 1TDQA 1NPUA 2NXYC 2BC4B 4Z0XB 5HI3D 4K9EC 3MRBA 4GW1B 5T3XL 4EIGB 3FJTA 2SEBA 4GLRH 3KXFA 3WJJC 3RDTC 4PJ7A 2DLTA 3P9MB 4U1MA 2QQQA 4PYHA 4WI2A 3SE3C 1A7QH 1QFWH 4KPHL 3QUKB 4J3OC 4LASL 4EN3D 2RR3A 4PY8I 1OHQA 3RVWC 5HYJA 2X5PA 3OKDB 3HAEG 3LQAC 3E6HB 3WE6A 4N0CD 1MY5A 4HZLA 2OQJA 3CMOL 3T4YB 5ISZD 4QT5A 5CZVL 3IJYB 5D5ME 3QWRA 3QUXC 4X4YA 5I8CB 4JGJA 4X7CC 4IHOB 5DJ2A 3RPIA 2HFGH 2XG5A 2EH7H 2PYFB 3BD4A 1OAKL 2P5EB 5CP3H 1DVFA 1LP9A 3BP4A 4GS7B 5J6HA 1LP9F 2WIMA 4G7YL 3SY0A 1CXIA 1DUYB 3MBEA 3O8XD 2BXYA 1M7XA 1XGPB 3SQOL 4EN3A 3F8UB 5J9PB 4PGDA 3DX8B 3R8BB 2NY6B 1WC7B 2CUIA 3RIAF 4BZ2H 4DGYH 1QFUL 2V17L 4Y1AD 5LAXA 3HZYB 3CFEA 4F33B 3PABB 5I1EL 5FHAH 2LVCA 1QFOA 4R26H 3RWGB 5IKCA 1WLHA 5F7KC 2H45A 4K2UL 4BSVB 3QHTC 1BX2A 3SQOH 43C9B 3U7AA 3MRQA 4MQXC 3GFUA 4OBSA 1CD9B 3GHEL 3O6FB 3WIHH 4TVPD 4PJHB 3LHPL 2PW2B 4KJWC 2C26A 1NDMA 2I25N 5CWSB 4PRAB 3JSSA 3HCVB 1HH9A 3IGAA 1NUGA 4GSDH 4JFOB 1S7VA 2DWEA 3FQUA 1HHIA 5IIEB 2X4PA 5EU5B 4RAHA 4WCYL 5DZLA 4CVZA 4FA8A 2VXVH 3PV7A 4KTEL 5MEOA 1DUZB 2GAZA 3R1GH 4NQCD 4OV5B 2W38A 2GJ6B 4Q9BA 2ZUVA 4HULB 4LPWA 3GM0A 1KJVA 1L6XA 1EJOL 1YJDL 4Y4KA 1MJUH 4N8PA 2IF7A 4PS4H 4XB7A 2NY7L 1B0RA 3ARGC 2A73B 3AY4C 3ORJA 5KVEH 4OIBA 2LQRA 1M05B 2BHZA 2N7AA 5D7LB 4GQ9L 4UI2A 2FHFA 2QEJA 2ATKB 4LSRH 2VZVA 4RMUA 4DN3L 3AS2A 4CU6A 1D9KA 1DCLA 4JVPA 4HWEH 2PYED 1BZ7B 1BGXL 3ZKSD 4K9EH 4FZ8L 2Z4QB 2P7TB 3BN9D 4D0BB 3VGGA 3ARPA 2ZSVB 4G7VH 3U7WL 1SMAA 4IOFC 1R6VA 5IBTL 5L6YL 2DBLH 3BXNA 4ERSH 1RHHA 1JGDA 5L6YH 4RDQF 4HIHA 1M6OB 2YC1B 5DT1L 1T1YA 4FMFA 1PQZA 3MV11 4L4TA 3F7YB 4PRHB 4OCRH 3RWJB 4Z7UB 2BVPB 4R3SA 4FZ8H 1TTFA 3CNKA 4X4XA 2XY2A 2G60H 5CP7A 5J1SC 4HG4J 5FO9B 3H3BC 2P5EE 4LSSH 4ZD3L 5D1XD 4PJEB 5F3BA 3SDDB 4BKLB 3B6SA 4X5WB 4I2XE 5HGDA 1RJZA 4F37F 4DKEL 4PD4J 3UYPA 3X12B 1W0VA 5IG7B 4OLUH 2D0HA 1UEMA 4HK0B 3HPJB 1ONQB 3SO3B 1NBZA 4XMPL 1EJOH 1YJDH 3V5HB 5E08L 1I9IL 5FYJL 3SGEI 5IK3A 5DWUH 3MV8E 4ZTPL 5E94B 4CKVX 2BNRB 2XQBL 2FCBA 2BVQA 2NPLX 4ZS6C 3ZE2F 4NO2A 2GTWB 3EO1A 2X70A 5LGKA 4E42B 3UTQB 4HKJA 4JFZH 3VI4E 3NPZB 2XN9D 5KSVB 4HIXH 5D2NA 5EO9A 3C5JA 5MEQB 2R69L 2E27L 2DF3A 1FFOB 4G6JH 1T89A 2CLVB 3ARBC 1SY6H 1C8PA 4CADA 4AQOA 5EBGA 3EYUH 4FABH 4CL7A 3ZKQD 1IGCH 5DD3L 3VFSA 1FLTX 2E6QA 5GSRB 4FXKA 1J0JA 3S3SA 3RI5F 4WHYG 4O58L 1QLFA 4HS3A 5FK9B 4PRIA 4JRXB 4IRSA 4BFEA 3WFHA 3EUUA 5DUPL 4LSDA 4LQ1A 5C07A 3W39A 3AY4A 3ULVE 3PGCB 4ZO6A 2GKIA 1H8OA 2HLFC 2WWMD 1JPSH 2B1HL 4HF5L 3IKCA 4PP2B 3ULVC 3CVIL 3TNMB 3RAJL 4QRQB 3T0EB 1C1EL 1KN2L 3OKEA 2X7LB 4UTAL 4U3CA 1HYRC 4GXVH 4K8RC 2O26U 1YC7A 4C55A 1CU4L 1K5NA 3O2DA 4K3GA 4WU5A 4ZUUA 1RZFL 2OZ4L 1UM4H 3TCLA 1LO0L 3GZKA 4M6MH 5E2VH 5EIIA 3QFJD 5F1IB 5DRXA 1KELL 4WU7A 2NX5D 4LASH 1LE9A 3GBMH 3HUJF 1YC8A 2B20A 5F7DA 2FR4B 1QFWL 3ABZA 2VLJE 3S9DB 3B5HA 3GMOA 3KPMA 3ZYIA 2X9WA 4ZOEA 3T0AA 3JV4A 4LF3B 5SWSE 1IGMH 4G8GA 4OLVL 4TSAH 4P2OD 4JJHA 2B4CL 4L3EB 3VW3H 5DJAB 1ZLWK 4OZGF 5F7WC 5AUMB 3D9AL 4EDXB 3BP6B 1KJMB 4I18C 4P3WA 3O3EB 3ZKND 4TTDD 1E27A 4M6OH 4EI6B 4OCYL 5TF0A 1RAMA 1UA6H 2ADIA 3DSFL 1YMHB 4YFDB 1AQDB 4LHUA 2P24B 2XRAL 2R0WH 2X1OA 4G8IB 4JO3L 3MV8B 3S6CA 1G7MB 1UM6L 1AGDB 2ARJB 5FM5O 1OLZA 4MAUL 4RCAA 1JNHB 4MS8D 1KXQE 5K9OA 3P3YA 1IC5L 4F9PA 5E8NA 4OCRL 4Z7WB 3HC0A 5F6HI 1T7XA 3MRKB 3QRFM 4YX2L 1MF2H 4WV1B 4U6XB 3MMEB 1TPXB 1X4YA 4BFBD 4WFGD 4KQ3L 3WIFA 3MROB 4RGNC 1FNGB 2NLJB 3PGDB 4JZNB 4OUUA 1T89C 3ARBA 2EDKA 5HYSG 2ZKHH 3NTCL 1ORQA 5CFHA 3VH8B 4DW2L 3KPTA 4NZUL 4KROB 4UNVA 2DTML 2AEQL 2HFFA 5I1GL 5DTFA 3TV3L 4PRDA 1ZGLB 1C5DB 4JANA 4K9EL 5B38B 4QHLA 5EORH 4Z78A 3QWOB 1Z5LA 1JFQL 3WS6C 4KMTL 5EBMA 1U6AL 2DLEA 3K8KA 2Y7QB 3G6DH 4U2ZA 1N6VA 4L29A 3RU8H 4M1CD 4NJAL 5CINL 4PBVC 1NCTA 4P46B 4Q6IB 4R4BB 4W81A 5KVEL 1RULL 3LQAH 3QZWB 2DS4A 5DVMA 5EOQL 5GRZA 3TPUA 1MJUL 3QFJE 4KKAC 2YPKA 4ELKA 3NH7L 2APWA 1CG9B 4XI5D 3EBAA 3PDOA 2J8UE 3MUJA 4X6CE 5FA3A 4Y5XA 2P49B 5FHBH 5JIIA 4MVBC 1OGAA 3GMRB 1N2RA 2NXYD 1VADB 5HHOE 4U1IA 2OL3B 4KVCH 3MUY1 4E5XA 3V7AG 1BQHG 3N9GH 4YHPB 5ILTL 1YEGH 1U91B 3FN0L 3LIZL 3NN8B 4RGOL 5FCUL 2DMKA 4LVOB 1OP5K 3V5DA 3LY6A 3L9RA 4RGNB 4L8SB 5KOVC 2EE9A 2CMRH 2K9UA 5IB2A 3SOBL 4R2GB 5D2LF 1UWEH 2HLAA 4XP1L 3VRLF 4A2LA 3U9UA 3WS3B 4KHXH 1OL0A 3QEHA 1UWXK 2DYPA 1OAKH 2EYSA 1S7QB 3LEXB 4I48B 4G6FB 3QXVA 1P84K 5B39B 1SYVB 3QH3A 3RGVD 5IVNA 1ZT1B 2BFVL 4ZSOA 3HPLA 4UT7L 1XGQB 4Y88A 2H32B 1MCFA 1YJDC 3CDCA 2VN7A 2PKDA 5C0BA 1AY1L 1T1WB 4XWGH 1E6OH 1I9JH 3ZHLA 5CJQH 1NC2A 4YE4H 1SEQL 1TCRA 3FQXB 4TTDC 3V6OE 4Q58C 4XP5L 4X9GA 2OR7A 4KK6C 1UKSA 1TETL 2BDNL 1A7QL 2VDLH 4PV9B 2GUOB 3EJJX 3OQ3B 1J0YA 3BN9C 3E3QC 5M95B 1CDBA 4J6RL 4MWFA 5FYJD 3NPSB 3FRUB 1ZLSL 3HMXL 3HE7B 2NY6C 1RK1B 5CJBA 5EZLA 4D94A 5ITFA 1A7RL 3T2NL 1JMZA 5GGSB 2NX5E 3ARGA 4PTUA 2V2TA 1SJHB 3B3IA 1NEZB 5M94B 5BRZD 2IPKB 1T7ZA 1VFBB 3S96B 2XWBB 2HKHH 1JPTL 3H42L 2YBRB 2EXYC 5F6IB 4GMSH 4LOUC 3VXRD 5F96L 3GKWL 2YD2A 2CR3A 3QEQE 4WI6A 4OIIL 1X5KA 2EZ0D 2PYFA 3INUL 4R2GC 5B38G 5L8KB 2P5EA 3PL6A 5D2LA 3ULUL 3ZT6A 4BZYA 1DJSA 4TULL 1L7TL 2ESVA 4PJ9C 4Y5XC 2ITCB 1AD0A 3S37L 2VQUA 3ESVF 2IBZX 1JTTA 2APVA 3REVA 1CT8B 3SKNB 4OLEA 1Z2KA 2H6PA 3V8CA 4PJDB 1SVZA 4P5MB 3ZKNC 5FKAA 3MRRA 1CIUA 3GRWH 3ROLB 4U1SB 3PNWB 1ZT4B 5I73B 4RMSA 1W2KT 5E2JA 3D2UD 1I1RA 1CR9H 3SN6N 5FGSA 4LLUA 4HJJH 3FO1B 3UPAA 1HH9B 3IGAB 1V3JA 1MH5B 2XWTA 4GW1A 4FTVD 4UT9L 5IIEA 4P5KB 2UY7A 3OKKA 4PTTB 4FFZL 1EO5A 1QD0A 3TN0D 4H25B 1B0WA 1UVQA 3UJIL 1PZUB 2VDML 3TYFB 1N7MH 1T7WA 3C60A 3GKZA 1MAJA 1IM3A 3GSNL 5JXAL 3BKYL 3AROA 4ODBD 3NCBB 5FO7B 5EULV 3TJEH 1D5XB 1HNGA 5C2BL 3IDGA 3LS4L 1NGWB 3MV9B 4L8DA 4HGWB 5K9JL 1C5CH 2VWEC 4HUXB 1NL0H 5GGQL 3CSGA 3QDJA 1WEJL 4KQ4L 1WCBB 2J2ZA 4O2CB 2IBBA 3HAEH 2VXTH 1A6AA 4PGBB 3IAQA 1EAPA 1IGJA 1XGPA 4NZJA 4NNYA 1GL4B 4LSTH 3VWJB 5CEZH 5K59F 5IV2A 1NC4D 4ZO9A 4F33A 4IRSC 1JGDB 4NUJA 1MCBA 1E4XL 1M6OA 2A83B 2ZOKA 5JO5B 3RZCC 3TWCL 1GC1H 4Z9KB 4X4XB 5CWSA 5L7XH 4QTIL 4PGEA 4W68A 4Y8AA 4P59H 4KGLA 5IEHA 1X5IA 5FOBA 3EFDH 3KJ6L 4Z7QE 3SDDA 2QSCL 4X5WA 4M6AA 1DUZA 5FGBC 1RJZB 2HTKC 2JK5B 1F02I 5ID1B 3STLB 5AZ2L 3IDJA 3CFIC 2HT3D 4YHYB 3BPLB 1KB5A 3L1OL 4HLZG 3C5ZC 1MRDH 1X6LA 3BKML 4U1NA 2R9HC 2FJFB 4IMKA 2PR4H 1BBJA 5GJSL 2C7UB 3RX5A 3MTRA 3DTXA 4YBLB 2AXGB 2UZXB 5KVDH 1BZ9B 3U9PL 3KYNA 4XAWL 4MMZC 4HKJB 1YEHH 2DQHH 2JELL 1I3RB 1HINH 5KSVA 4NQXB 2AQ2A 4JO2H 5KVFH 2Z4QA 1FBIL 1F90H 1EX0A 4CADB 5JHDD 4LPUA 2WUCL 1CBVH 4OD3H 3OB0H 1MLBA 2EH8L 2R0LH 1FFNA 5FUOH 3RWEB 3FN9A 2DQEL 2VDNH 4NJ9L 5GZOD 3QG7H 2GJZA 5ESVB 2V2WB 3H9YA 3QWQB 3W39B 4B7IA 3HB3D 2YWYA 1FE8L 5HHVL 4FQJL 4GH7B 4Z7UA 2JJSA 4Z7UF 1AGBA 2BVPA 4R3SB 3RZCB 4PP2A 5E95B 2FLBT 3OF6D 3SJVB 4NNXA 2NCMA 3GB7B 1MQKL 4PJEF 3V4VH 5HGAA 4Y4KD 2ITDA 1HE7A 1IGIL 5J11B 3TO4C 2W9LA 5EZJB 5BV7L 3NAAH 1Z6JT 3EYVA 4MXQC 4MAYD 5IM7A 3HPJA 4HJ0D 2NY0D 4M7LL 2P1YA 3KGRA 5IK3B 2VTFA 1KULA 7FABL 5ENWB 1G7JB 4EI5A 2BHYA 4NO2B 3MRCA 2AQ1A 2DQTL 2VDNL 1WFOA 4FXLA 5BO1L 3FN3A 4ZFGL 5D7IB 5C0CA 1MFAH 1FZMA 3ILQC 3BDXA 5D2NB 5EO9B 3B9KD 5E0QA 3SDDC 4EOWH 2A77H 3BKJL 2NXZC 5GS0C 1TVDA 1BIHA 2AVGA 3O3EA 4N5UA 3K46A 4HLJA 5D7IE 5EPMB 4MJIE 4M1CC 1E28B 2QQKL 1LILA 2DQHL 1AQDA 2JELH 4LHUB 4TSCH 1GHFL 5FUCE 3F7VB 5TFSL 3GJFK 5DR5H 1A5FL 4WJ5A 4JPVH 4XPHL 2XNAA 2J6EA 1JNHA 1OSPH 1KCSL 1X5LA 3W81A 5CJXA 4X7FC 4LDEB 1O7SA 1J0ZA 5FDWA 1NGQH 3MRKA 3D0LB 1ZSDB 4ZAKD 5CLWA 4IDLA 3TCXA 3WSQL 3L1OH 5SWZA 1S5IH 2XZQH 2OXGA 35C8L 1OP9A 4P9ML 3RVTC 3TPKA 5JORA 2F19H 5F8QC 3ARBB 4TVPL 1MLCA 4GRLB 5HPOA 5CEXB 1QRND 5TPWL 1BBDL 1X6NA 7CGTA 1CXKA 2IANE 3C5ZD 4YC2B 2IQAA 4TUJA 2RJMA 1IC1A 3WLWD 1MQ8A 4URTB 1CK0L 4A6YL 2WLYA 5FM4A 4OFKA 3DROB 4Z7WE 5TGBB 3QDMA 5DRXB 2HJKA 3BWUC 4JANB 1KCSH 3Q5YA 1OQOA 1Z5LB 3KPSA 3PXHA 3HUJB 3ZKMC 2FR4A 1M7DB 1E4XH 1KYOJ 3F65A 2IALA 1JPFB 4OGYH 3B8SA 2UVEA 4L29B 2XA8H 2CK0L 1AGCA 4I0CC 4DKFH 2F54B 1PG7H 2IEPA 2QQKH 1QSED 1JGLH 4BQ6A 3RL1A 2ILLA 1DBBL 1G6RL 3WXVH 3G6JA 3QI9C 2OTUB 4OZGB 4HXBH 4EDXA 3TPUB 2FATH 4QXUH 5HYFA 4I3SH 4MJ5B 3EGSA 3GHBL 2C3WA 1FDLL 3QSKB 3PDOB 4NQCB 4WI8A 4M62L 4JDZB 4O4YH 1NJ9B 5DEGA 1G9EA 2RB8A 3WBDA 3IVKB 2ARJA 2IAMB 5E8OA 4ISVA 3LH2H 2W59A 5DFTA 2XKNB 5DZNA 2CDEA 4M3JA 1T3FB 3T8XB 3WNPA 5K9OB 2P5ED 3AB0C 1TZGH 3HC0B 4LIQE 3NN8A 3VDAA 2JCCB 2HT3C 2J12B 3FT2A 3OL2A 3P77A 1CXLA 5IFJB 3BISA 4KDTC 1WTGT 5E03A 4XRCB 3S35H 1QSEE 4OF0A 2X89A 5IMOB 3VDBA 2PTUA 3CUPB 1RIVL 3PL6C 4U0QB 5DF0A 2HLAB 5HVFB 2R1XA 1L9NA 3BMWA 3WNLA 3BOVA 3SDCC 4UINL 3T2OA 4HUMB 4YDKH 3IDYB 3WNOA 3FCTA 4JGMA 1WBZA 4UIKH 2D7MA 2H32A 2W1NA 4K8RH 1P7KB 1AHWA 5IQ7H 3P4LA 4OT1L 1DDHA 3KYKH 4PJ5E 5B39G 1X5XA 2ZUYA 3IDXL 4YLQT 1W72L 4FRWA 4KJWD 3IAGC 3FOMB 3INUH 3WNKA 1MHPL 3QXDB 1CG9A 4N0FB 4PJ9B 1S3KH 4MD0B 4MWFB 1YEKL 1UH2A 2NTFB 1OGAB 3GMRA 2CJUL 4X6EA 2PYEB 5CD5C 4OFIA 3A67H 5CBAA 2DJSA 2FGWL 2FX9L 4FFVC 5F88B 1SJHA 3KYKL 1KLFA 2Q8AH 3DBXB 3V5DB 4Y4FD 1LK2B 3TT3H 4HD9A 2ZCLL 5I76A 4X6DF 3RVTD 5I73C 1UENA 2IAND 3L5JA 2ICWB 3VFTB 4L8SA 1Q1JL 3U82B 4YNYA 3SDAD 4LSPL 5IB2B 2UYLB 4YDKL 4F7PB 1CCZA 3PL6B 5D2LB 5IFAH 4V2BA 1S7WB 5C3TA 3K2UL 4PRHD 1T22B 3MUHL 3H0TB 3FQTA 1RIVH 1ROWA 5D7LE 2VLLB 1IL1B 1A02N 1C16A 1J8HB 1WBXB 3MRDB 1AGFA 3SDDD 1SYVA 4LLDA 3SGJA 4YR6A 1FRGH 1LE5B 3VXMB 4P5MA 4RX4A 4IEFB 4HEPG 3VFMB 2BSRA 5J89A 1CLYL 1NUFA 1TZGL 1NC2B 2DM2A 4EBQL 4Y4FB 5I1CL 1UWEL 1MH5A 2XWTB 1TFHA 3NA4A 2GUOA 3CDYA 3QXWA 2Z9TA 4G6ML 4O4YL 1A6ZA 5ALBL 2YEZA 3L3KA 3DPBA 5D1QC 2GITA 2Z91B 2DIAA 4QXGL 4OGXL 5C71A 5KAQG 3TYFA 1DL7L 1EHLH 3FN0H 2R2CA 1CICD 3PV6A 1JNJA 2VZ1A 3IDGB 2FJHB 5DHVB 3VU2A 2VDMH 4ONGH 1BD2D 4NNPH 3S96A 3ARFD 2XA8L 2E3VA 3H9SB 4XZUA 1WCBA 4PJGF 5CJ8A 4N0UB 5GGSY 1J10A 4MJ2A