1WFWA

Solution structure of sh3 domain of mouse kalirin-9a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of SH3 domain of mouse Kalirin-9a protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Kalirin-9a
total genus 6
structure length 74
sequence length 74
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wfwA00
4HVUA 2GGRA 2CUDA 1WX6A 2CT3A 2L3PA 3VS7A 4LUDA 3EHQA 2KEAA 2KYBA 1QKXA 3EG2A 2YUPA 4OMPA 3LH5A 2RQUA 4D8DA 2DRKA 1LCKA 4Z89A 1OEBA 1N5ZA 2GNCA 2RQTA 4LUEA 3VS3A 1X6GA 1J3TA 1GCPA 1M3BA 2DYBA 1A0NB 1TUDA 2B86A 1KFZA 1PNJA 3NMZC 1KSWA 2PNIA 2KR3A 2KRNA 2DL3A 1AWJA 2C0OA 2GBQA 1GFCA 1GRIA 1GCQC 4AFUC 2EGEA 4GBQA 1AWOA 2LJ1A 2A28A 1RLPC 1M3AA 1SRMA 2JMAA 4RUGA 3U23A 3ZL7C 2LJ3A 4CC3A 2JW4A 1WXUA 1E6GA 2RQVA 1PKSA 2ED0A 1BU1A 3QWYA 5GJVB 5EC7A 3QWXX 1NEGA 2C0IA 1WYXA 1AVZC 2M51A 1UHCA 3UATA 4J9HA 2G6FX 1ZLMA 4RTVA 4DEXA 4J9IA 2LP5A 1M27C 2DE0X 2LQNA 3M0SA 2YUOA 4RTZA 1K4US 1UDLA 2D8JA 1NLOC 2BZYA 2F2XA 1I1JA 1T3SA 2O88A 2HCKA 1ZSGA 4ORZA 4J9FA 2OI3A 1RI9A 1T0JA 2KXDA 5GJWB 2FO0A 3C0CA 1ARKA 1K9AA 4AFZC 2FG0A 2DBMA 5I22A 4Y92A 2C0TA 2V1RA 3I35A 2QDLA 2DL7A 1JO8A 3NHNA 1K76A 1X69A 1UUEA 2PTKA 2BTTA 1Z9ZA 2CUBA 1GCQA 1AZEA 1YN8A 2AKKA 2EYXA 4OMQA 2CH4W 2W10A 2X3XD 5IHIA 2LX7A 1U06A 2MOXA 1H3HA 2DA9A 2E5KA 2DLPA 3UA7A 2A36A 1PHTA 1T0HA 2HSPA 4KRTA 2O2OA 4F16A 1X6BA 1B07A 3EHRA 1UHFA 2LZ6B 4M4ZA 2AK5A 2K3BA 4JZ3A 2LJ0A 1W1FA 2HDAA 5L23A 1GBQA 2LQWA 2K9GA 2EKHA 2AZSA 2DM1A 1WA7A 2JTEA 2K6DA 2V1QA 4Z8AA 2W0ZA 2FEIA 2CREA 2GTJA 3M0QA 4JZ4A 1W6XA 4E6RA 2VWFA 3TSZA 1AZGB 1QWFA 1H92A 2EYZA 1U5SA 3EG0A 4IIMA 1KIKA 3CQTA 1M30A 2RQWA 2BZ8A 1NYGA 2DL4A 2EYWA 2K2MA 4WCIA 1SRLA 2I0NA 4J9BA 3H41A 3R6NA 4CC4B 3SHWA 1JXOA 1NM7A 1B3QA 1ABOA 3REBB 2AKLA 3RNJA 1UGVA 4AFSC 1E7OA 2EW3A 3M0RA 1CKAA 4Z88A 4IIOA 2KT1A 2NUZA 3NPFA 1QWEA 4QT7A 1TUCA 4R0KA 1U3OA 2A08A 2YSQA 1NEBA 1AOJA 2D8HA 3VS6A 1JXMA 3M0PA 2EGAA 2ROTA 1WXBA 2KBTA 3VS2A 2DX1A 1HJDA 2YDLA 4FSSA 2A37A 2DILA 2DVJA 2JM9A 1WI7A 3M0TA 1JU5C 4HXJA 4RTUA 2FRYA 1GL5A 2FRWA 5FWBA 1UTIA 5FW9A 4JPBW 4JJBA 4CC2A 1WLPB 2O9VA 4GLMA 2LMJA 3RBBB 1G83A 1VYVA 4RTWA 2VKNA 1UFFA 1I07A 2KNBB 2YT6A 1YNZA 3VS4A 3O5ZA 2K79A 2DL8A 2KRSA 3SEMA 1AEYA 1RLQC 1X2QA 2O31A 1UG1A 1Y0MA 3H0IA 2L0AA 2EVRA 3UA6A 2KE9A 2KROA 3VS1A 1SPKA 2F2WA 2J05A 2CH4A 2RNAA 4AG1C 3TVTA 4LNPA 3KFVA 3H0FA 1VYUA 1HD3A 1QCFA 2BZXA 2EYYA 2L2PA 2MCNA 3FJ5A 1MUZA 1YP5A 2H8HA 2DF6A 4LN2A 2EPDA 4RTYA 1IO6A 2ENMA 1EFNA 1M8MA 1AD5A 4F14A 1ZUKA 5HCKA 3PVLA 4OMNA 2OAWA 4RTXA 2ABLA 2O9SA 1OPKA 4HVWA 1PWTA 3NGPA 4F17A 4AFQC 3I5RA 2CT4A 2RN8A 1ZUUA 5ECAA 1M3CA 1X2KA 1T3LA 3I5SA 3ULRB 1OOTA 2VVKA 1VYTA 4D8KA 2ROLA 3M0UA 5IXBA 1NYFA 1NLPC 1YCSB 1OV3A 2EBPA 2JS0A 3EG3A 4EIKA 1NG2A 1MV0B 2GQIA 4JJDA 1RUWA 1WFWA 1YWPA 3JV3A 2L3QA 2DNUA 2KGTA 1QKWA 5IXFA 1SSHA 4J9DA 1H8KA 1S1NA 1OPLA 3H0HA 3PE0A 1SHFA 2CSQA 1GBRA 1AWWA 4OMLA 1Y57A 2D0NA 4J9GA 3IQLA 3VRYA 2P4RA 1UJ0A 2JS2A 1GFDA 1K0SA 4JJCA 2FPDA 4HVVA 2KT8A 2JT4A 2FPEA 2DL5A 3VRZA 1PRMC 1FMKA 1I0CA 4OMMA 1CKBA 2EGCA 5IHNA 4CC7A 1K1ZA 1WIEA 1KJWA 3PVQA 2ESWA 1QLYA 1JEGA 1UE9A 3EG1A 1V1CA 5I11A 2J6FA 1G2BA 2PZ1A 2MIOA 2J6KA 1SHGA 1SEMA 1BBZA 1ZBJA 2ED1A 2OJ2A 1HSQA 2J7IA 1TG0A 2JM8A 2YUQA 1UECA 2JXBA 5IH2A 1FYNA 2XMFA 3TSWA 2DRMA 1VA7A 1JQQA 5IHKA 5FWCA 3EGUA 1ZX6A 2YUNA 2DJQA 2DBKA 2NWMA 1MV3A 2FPFA 2DMOA 3I9QA 1BK2A 2HEQA 4OMOA 1YWOA 2CDTA 2RMOA 2SRCA 1X43A 3VS5A 2K7AA 1K0XA 2GTOA 2X3WD 4ESRA 1ZUYA 4DEYA 1E6HA 1PRLC 4A63B 4J9EA 1PKTA 2ECZA 2LCSA 1W70A 4ZNXA 4K11A 1UJYA 2RQRA 4HCKA 4LE9A 4RTTA 4X1VA 3REAB 1XOVA 1AWXA 2RF0A 2J6OA 3GBQA 2AZVA 2KRMA 1X27A 2L3SA 1CSKA 2D1XA 1ABQA 2RPNA 2IIMA 2J06A 2EQIA 2HBWA 4J9CA 3A98A 2F2VA 3VS0A 1Z9QA 1BB9A 2CSIA 3UF4A 1WXTA 2LNHB 3THKA 2KYMA 2M0YA 2JMCA 1WDXA 2SEMA 4AG2C 2KXCA
chains in the Genus database with same CATH superfamily
2GGRA 1Q81C 3M57A 2VGNA 4WF2A 3KXTA 3NFCA 4C8QE 1F1BB 3E2UA 1IRXA 2DXUA 3OYAA 2P0PA 1WQWA 3EG2A 1QKXA 5GMKm 1R0CB 4OMPA 1SSFA 1Q86U 1BIAA 3OYHA 4D8DA 1VQ5T 1LCKA 2E65A 4Z89A 3OS5A 3CCET 1OEBA 3VS3A 1YI2Q 2MAMA 1PD0A 2E5QA 1M3BA 2ZPGB 1KFZA 2CZ7B 3CD6Q 1KSWA 2PNIA 1NJIU 1VQOA 1VQLA 1N6AA 2KR3A 2DL3A 1QVFS 2ATCB 1YITT 1GCQC 2EGEA 4GBQA 4L59A 1AWOA 1SRMA 3VYHB 4FYYB 1WXUA 2BIVA 2DYIA 3DB4A 1PKSA 4PJOF 3QWYA 3CCUT 4PJOC 3QWXX 4M78C 4A4EA 1AVZC 3GP8A 3L1AA 4J9HA 1I5LA 4GY5A 5LJ3d 2ZCFB 2A3LA 2LQNA 3M0SA 1KD1U 2AT1B 4RTZA 1UDLA 2BZYA 1T3SA 2YWWA 4M7AC 2HCKA 4PK4A 4ORZA 2XDBA 5CKFA 1D1AA 4J9FA 3A8OB 1TTHB 2FO0A 5FU6B 3CCST 1K9AA 1RAGB 4ZGJB 5HK0A 3I56T 2FG0A 3INZA 1WHKA 2DBMA 2KMTA 1VQ5Q 1WHGA 2KI7A 2EJFA 4IUPA 1YJ9Q 4XTWA 2K3XA 4EDUA 3X28B 2ZAEA 1UUEA 2X9HA 2CUBA 1AZEA 1YN8A 2E1HA 2XIDA 1EZZB 2KY9A 4C8QA 3JCMe 2MOXA 1YJWA 3G6ET 4KRTA 4X9CA 1WQ7A 2XG8D 3E9FA 5KYXA 2X4JA 2LZ6B 4X34A 2HKNA 2OTLA 1I8FA 4F7UG 1BI1A 1GBQA 2MWOA 2K9GA 1KC8C 2EKHA 2DM1A 2GF7A 2K6DA 3QYGB 2GTJA 2YHTA 3TSZA 2DPPB 2V26A 1AZGB 4ELYC 2RI2A 4KULA 5J3BA 4M7DA 3EG0A 4IIMA 4JLGA 1ZA1B 2DFUA 1KK7A 2EYWA 1YIJT 4WCIA 1PSEA 1ZSZC 4HKEA 1SRLA 1VQMQ 3H41A 1PD1A 3R6NA 2E41A 3HP9A 1VUBA 3SHWA 1JXOA 4DBRA 3FJPA 3EG9A 3OB9A 2QA4Q 3FRNA 4OVAA 5LJ3e 2QASA 3I55T 3PT9A 5KYNA 3JB9J 3M0RA 4FYXB 5D6WA 2F5TX 4C0GA 1IB8A 2NUZA 1RABB 1UGSB 1Y96B 5A2QE 1VQ9Q 1VQ4A 3G7ZA 1KD1R 3CBOA 5KH6A 1PM3A 2A08A 3GNGA 2R5MA 3VS6A 3M0PA 2EGAA 2ROTA 3FEOA 2CYZB 3VS2A 2DX1A 3CEYA 1M1FA 2DAQA 4FSSA 2DILA 3BW1A 3WVEB 3MPUB 4JJNK 1WI7A 1JU5C 2GCXA 4LDXA 2FRYA 2FRWA 2RJCA 1M8VA 3CMET 3DLLA 4JS5A 4GLMA 1QVGA 4XTYA 2F69A 3CCJT 1YHQQ 3J81E 4JLIA 2LDMA 3OYKA 2LCLA 1TS9A 2KNBB 2EJGA 3V7CA 1YNZA 4C0FA 2K5FA 1LVKA 4C8QG 2O31A 2P4TA 1Q86R 3OBWA 5GAN4 1VQ6T 3EAEA 1PG5B 2KE9A 5C6SA 3VS1A 2QQ9A 2J05A 2X4YA 3PMTA 2HQEA 3GNFB 1VYUA 2O01E 1VQKQ 2L2PA 1MGQA 3FJ5A 1MUZA 4XTXA 1X75C 2M0OA 2H8HA 2DF6A 4LN2A 3OYEA 2C06A 3CCSQ 1IO6A 1OX9A 5FRMA 5CVIA 1QP2A 1VQ8Q 1G8XA 1OX8A 2O4XA 2ABLA 4OB3B 4HVWA 1PWTA 2MK5A 3QDRB 4M7AA 2RK2A 1HK9A 1YHQA 1ZUUA 1X2KA 4J8OA 5HK3A 1T3LA 2ZPHB 1PC0A 2O4XB 1JJ2A 5GAMd 3C4SA 3V8KA 3M0UA 2QA4T 1K8AU 2RA2A 3RKXA 3EG3A 2D0QB 3E1SA 3PIOA 1YWPA 3JV3A 2L3QA 3PGGA 2R58A 1ZA2B 5KYWA 2KGTA 1QKWA 3CMAA 5IXFA 4YTLA 3R6OA 3H0HA 3PE0A 2CSQA 4OMLA 1QVFP 3JB9F 2PVDB 3JB9I 1O9SA 2P4RA 2CP5A 3EFOA 3L2ZA 5GMKj 1K0SA 4DOWA 3VRZA 2K2VA 3G1JA 5IHNA 2EGCA 1OU9A 2QA4A 3CC4T 1QLYA 3EFOB 2DD5A 2QG9B 1Q86C 4BDYA 4KT0E 3HHTB 5DM7R 2J6KA 2EJ9A 3UDCA 2G3RA 1BBZA 1XQHA 2J7IA 5GAMe 1QVPA 5LJ3f 2H3EB 3FC3A 4OF1A 1FYNA 8AT1B 5FU6C 2DETA 1VA7A 3CCVT 5KYXB 1KC8R 3GOXA 1OULA 3LGLA 3S3MA 4KH1B 3L2QA 5GANj 4DEYA 3DKMA 4A63B 5LJ5d 3CCQT 1YJNA 4DQ2A 3I56A 2K3YA 4PFOA 1WHHA 3QJ6A 4BE1A 1BCMA 2RQRA 4RTTA 5GANh 4X1VA 3S3NA 2QEXT 1C1AA 2J6OA 4XU3A 2AZVA 1TU0B 4C0DC 3KBGA 1FXXA 1X27A 2MF2A 3ER0A 2D1XA 1ABQA 2RPNA 4XAXB 3SDZA 5FROA 2COYA 4ATOA 3SWNC 2CSIA 3UF4A 2FB7A 2DTOA 2LNHB 1Y7XA 1NPRA 4O5VA 4C92A 2GFAA 1WDXA 2DXBA 4AG2C 2KXCA 5CKHA 4M77C 3M5AA 2JTFA 1M90C 1VOMA 4LXCA 2CT3A 4C5EA 3OA6A 5IT9E 1I5OB 2KYBA 5A0GA 3G6EA 3CXCS 2CGHA 1YJ9T 1K73C 2RQUA 2DIQA 2BE9B 3RIRA 4J6WA 3CXCA 3CCUQ 3I56Q 5GAN8 4E47A 1YIJA 2EKOA 3QZ9B 3OYFA 1VQOQ 2X51A 3S3OA 4PJOD 1TUGB 1AWJA 2GBQA 1GRIA 4M7DG 2A28A 3M55A 2JMAA 3U23A 3ZL7C 2LJ3A 3TQ7P 3A1PA 4ZN3A 2HD0A 2ED0A 1BU1A 5EC7A 4ZTJA 5KE2A 4F04B 2YRCA 1M1KC 1OZ2A 2QQAA 2M51A 2CZ0B 1UHCA 3CCLA 5CIUA 1N9RA 2G6FX 4RTVA 4XTVA 4J9IA 1HXDA 2DE0X 4XQ3A 1QCNA 1VQ8A 4GLKA 4MZMA 1NLOC 4M78D 4C8QF 5CKDA 4E2FB 2F5KA 3O8VA 4LD6A 1RI9A 1T0JA 3Q1JA 5A0DA 3OYDA 1U1TA 2QGGA 4KUDK 1JBMA 2P0QA 4M78E 1V29B 3VUBA 3CMAT 3I35A 1MMDA 2OAUA 2DL7A 1JO8A 2JZ2A 1UGQB 2PTKA 3TU4K 2EAYA 3CCEQ 2EYXA 2CH4W 2W10A 2LX7A 4JS4A 2DA9A 2E5KA 3EH1A 1NBEB 1PHTA 2E3HA 4A4FA 2O2OA 3MP6A 1X6BA 1G5VA 1B07A 1MMAA 5GAMh 1XTDA 1UHFA 1VQPQ 5GMKl 2ZGWA 2PUOB 5IAYA 1N8RC 1OQKA 4EPCA 1P92A 5GMKi 1RAFB 3LWHA 1YIJQ 3FIFA 3CCLT 2K4YA 3T9NA 4BE0A 3RKWA 4J7FA 3CCUA 2VWFA 1MNDA 1QWFA 1H92A 1XJWB 1M1KR 2QYZA 4VUBA 1M90U 3CC4A 1M30A 2BZ8A 1IZ6A 3OYNA 4PJOB 3PNWC 2KVQG 1NPPA 4CC4B 2ZZDA 4E7LA 3JB9G 1Q7YU 3M4YA 1NM7A 3QZ5B 1B3QA 1C6VX 3MEVA 4QQ6A 1FMVA 3OYBA 4FW1A 8ATCB 5GANf 5M9OA 3CC7T 4FL6A 3MHXA 1CKAA 1B7TA 2KT1A 2FYKA 1QW1A 3X25B 2K5IA 3URGA 1QWEA 3I55A 2RHIA 4R0KA 4E7ZA 3HL8A 2YSQA 2HL3A 3WVDB 1AOJA 3M53A 2DJZA 2E10A 3X26B 3ZFJA 5I21A 4F7UE 4EMGA 2KBTA 3CMAQ 2A37A 4DBQA 3JSCA 4M7DB 3LGFA 1UB4A 5GAOr 1UTIA 3J80E 5FW9A 3OS0A 4JJBA 4CC2A 5GAN6 2LC4A 2O9VA 3CPWP 2LMJA 1D09B 5GAN7 2VKNA 2ZPBB 4EMKB 4Q5WA 1BI0A 2HBPA 3RESA 2YT6A 2NLUA 4RKUE 1K9MC 2HNIA 4M7AF 1JB0E 1AEYA 2EQUA 2M02A 4C0DB 2X4XA 2F2WA 2CH4A 2RNAA 3LWIA 3TVTA 1KHIA 1IXDA 5KYWB 1HD3A 3QXEB 1WZOA 5GMKh 2BZXA 7AT1B 4C92C 4RCCA 4IUUA 4JRIA 2HAXA 1AHJB 2IG0A 1FX7A 3TREA 4OMNA 2OAWA 1W2BP 1OPKA 5GMKe 4F17A 2IPOB 4AFQC 2CT4A 2HKQB 4XU2A 3HFNA 4BDZA 3QHSA 1RAEB 1M3CA 3OBYA 4D6WA 6AT1B 1Q7YR 2VVKA 3N5BB 3EFSA 3JCMc 1NLPC 1YCSB 5DY9A 1OV3A 2JS0A 1KQSA 2RI5A 1JJ2S 1VQ8T 2GQIA 4JJDA 1RUWA 1M90R 3CMEQ 1VQMT 3AHUA 1D0XA 2CP7A 5CO7A 2PQWA 3CD6A 1QVGP 2DZCA 1YJ9A 2OTLQ 3JCMJ 3L2RA 4DBFA 1Y57A 2KK4A 1PSFA 2DZ9A 2RHYA 2RB6A 3L2WA 2MYSA 3IQLA 2XDDA 4J83A 3TCJA 1VQ9A 2JS2A 2FPDA 2JT4A 1FMKA 4OMMA 5GAN3 1W2BS 4LD9K 3QDFA 2LTOA 1VQ9T 4M7DE 2DTIA 1C0MA 3C95A 3RUXA 1K9MR 1JEGA 2XK0A 2M16A 1G2BA 2MIOA 3JCMd 1SHGA 3PIPA 4XU0A 1VQMA 2ED1A 2JM8A 2HQXA 2JXBA 5IH2A 4PJOE 4MMKA 4BUGA 3TSWA 3LW5E 3EGUA 1ZX6A 2YUNA 5GAMg 1MV3A 2FPFA 2M1HA 4DA4A 2DMOA 5KYUB 1BK2A 2LCCA 2QQRA 3AT1B 4FYVB 1I81A 2RMOA 2SRCA 4J6YA 1VQPA 2QTXA 3SWNA 4QQDA 1E6HA 4HA8A 4J9EA 2GFUA 1PKTA 3VKIA 2ECZA 4MMLA 4C92F 1R8OB 2LCSA 2LVMA 1X6OA 3CC7Q 1ZSZB 1H641 3X24B 4IKFA 3CCEA 1UJYA 2WACA 3RERA 4HCKA 1AWXA 1M5Q1 2RF0A 3H8ZA 1M2VB 3GBQA 5FU7C 4LDUA 4MZPA 2QAZA 2IIMA 4J9CA 2F2VA 2V8KA 2KAFA 3LYIA 1YI2A 3M59A 4PJJA 1WXTA 2LQ8A 5I2MA 4M78G 5GAOl 2JMCA 1D0ZA 3G6EQ 4M75F 1YITA 2CUDA 2OX7A 4O6JA 3QO3A 1SF9A 3EHQA 2CP6A 3MP8A 2EQMA 2JNGA 1V76A 4M75G 4M7AB 3UPUA 3A8HB 2YUPA 4M75D 1RL2A 3OSVA 1H3ZA 2RHUA 2DKGA 2QDYB 3JCMh 2DRKA 4J7IA 2VXFA 1N5ZA 2RQTA 4AT1B 1X6GA 1GCPA 2DYBA 3OYJA 1A0NB 5LJ3g 2B86A 1PNJA 1WJRA 2YRVA 3MJXA 5LJ5e 3JCMP 4RG8A 4BY6C 2QQBA 2XICA 2C0OA 5GAOm 1Q82U 2B8AA 2VGMA 2JTMA 4J6XA 4HT9A 3RR6A 4JRKA 2JW4A 4QW2A 3HFOA 1K73U 2FZKB 5GJVB 1NEGA 2KSSA 2C0IA 2CZ1B 1YJNQ 1B34B 3UATA 5GANg 1ZLMA 2YLBA 4LDVA 1D3BB 3V8JA 4PNOA 2YUOA 1WHMA 1SKUB 1K4US 2D8JA 3JCMf 2JOYA 1YITQ 2O88A 3GLXA 1ZSGA 3MO8A 3LH0A 1VIEA 1ZHIA 4ZGEB 2OI3A 2PU9B 5GJWB 3C0CA 1X01A 5J26A 1YBYA 2XU8A 4J5YA 2JN0A 1U8RA 3NTHA 2GQVA 4EMKA 1AT1B 3L2UA 4F7UF 2QDLA 3NHNA 1K76A 4QVCA 3CCLQ 4C5IA 1G3WA 1R77A 4OB1B 1Z9ZA 4FSXA 2AKKA 4N4GA 1SG5A 2X3XD 4ANJA 5HY6A 4BD3A 1U06A 3JCMX 3UA7A 1MMGA 4AMCA 1T0HA 2HSPA 4QVDA 3RMQA 4JZ3A 2LJ0A 2HDAA 5L23A 2LQWA 2AZSA 1WA7A 2I2LA 2XDPA 3FLGA 2JTEA 4NL2A 2E6NA 2V1QA 4Z8AA 2FEIA 3VUZA 4DOVA 4C8QC 5D7UA 1W6XA 4OP0A 4E6RA 2FZGB 1W2BA 2HSEB 4FCYA 4PJOG 1Q7YC 1KIKA 1WGSA 3CQTA 4FIBA 1NYGA 3GPLA 4M78A 2K2MA 2DEUA 2ZPEB 2I0NA 4J9BA 1K8AR 4R56A 3HRTA 2QEXQ 2QXFA 2DERA 1Y96A 4OB0B 4KGZB 3REBB 1NE8A 5CKEA 1ACMB 2F1LA 3RNJA 1E7OA 2EW3A 2L5QA 3OW2S 4Z88A 1EIFA 2MWPA 3LLRA 1JRIA 3SFMA 2VXEA 2CKKA 4QT7A 3OY9A 1YCYA 1U3OA 2BKDN 1NEBA 1Y71A 2D8HA 5LJ3h 2RO0A 3HRSA 2MPXC 1D1BA 2DO3A 2XI9A 1HJDA 2YDLA 2DVJA 2LT1A 3CBPA 3OS1A 2DIGA 1K73R 4HXJA 4RTUA 4KBMB 3V7SA 1GL5A 3VJPA 4BACA 1WNLA 1TSFA 4NL3A 3SWNB 4JPBW 1WLPB 1PCXA 2WSCE 2CP2A 3OMCA 4MZTA 3PTAA 1G83A 1VYVA 4L5GA 4RTWA 3L2VA 4BI8B 1I07A 3OMGA 1VQ4T 4M77F 4IURA 2D6FA 2V8IA 3CC2A 5LJ5j 3A8GB 3ZBDA 1MNEA 2K79A 2KRSA 1ZBXA 3EG9B 3SD4A 2RI3A 3CCSA 5FU7B 1X2QA 1UG1A 1Y0MA 2L0AA 3P8BB 1DJ7B 2EVRA 3UA6A 2DVEA 2KROA 2QGFB 1YFNA 4LNPA 3E19A 3OYIA 4FM4B 1UEBA 4XTUA 3H0FA 5D6XA 1QCFA 2PVGB 1ZSZA 3QYHB 1YI2T 2MCNA 3OQ5A 1YP5A 2LT4A 2EPDA 4RTYA 2JVVA 4M75C 2ENMA 1EFNA 3PMIA 1AD5A 4F14A 1ZUKA 3OS2A 1RI0A 3PVLA 4RTXA 2O9SA 4NS5A 1Q82R 3NGPA 3CCMA 1M4ZA 1RAHB 4N0AA 1VQ6A 3CCMT 1OOTA 4E7JA 4M7AD 1FMWA 1VYTA 4OGEA 4D8KA 2ROLA 4DBHA 5IXBA 4C92E 4Y91A 1I4K1 2Y4YA 3EH2A 4EIKA 1NG2A 2CP3A 3MEWA 3CD6T 5FLXE 1MV0B 4JDSA 2WSEE 4FW2A 2DNUA 3D7SB 3ZEHA 1H8KA 1S1NA 1OPLA 3QSUA 2Y90A 1SHFA 1IGQA 2PUKB 1GBRA 1AWWA 2YLCA 4RCBA 5KYUA 2KDSA 5EG2A 3VRYA 1W4SA 1N27A 2P84A 1QVGS 1UJ0A 1GFDA 4M77D 3MP1A 2KT8A 2DL5A 1PRMC 1U1SA 1I0CA 3MKDA 1N8RR 1M2OA 1CKBA 1UGPB 4Y28E 4CC7A 3CBMA 3P8DA 1WIEA 3KUFA 4A4HA 3CCJA 3EG1A 5DLOA 1MHNA 4XTZA 2PZ1A 4BI4A 1XNIA 2COWA 5KCOA 1ZBJA 2HZYA 1HSQA 1VQ5A 4M7DD 1M2VA 2X4WA 2XMFA 1TH7A 2DRMA 3OW2A 1MMNA 4E7IA 5FWCA 2NWMA 1QP3A 2KQWA 3MEUA 1IREB 3I9QA 4RMOA 2HEQA 3HTRA 4OMOA 4BI3A 2RM4A 3CMEA 2EQKA 3BY7A 5GAOq 1JJ2P 2CDTA 3EGXA 4FT2A 3VS5A 1BI2A 3BFMA 1VQNA 4E7HA 2GTOA 2X3WD 1ZUYA 1PRLC 4Z02A 3HPWA 4LDWA 4M78F 4C8QD 3CC7A 2OTJT 4M78B 4B9WA 3ME9A 3RKYA 3GIBA 2LQKA 5HKCA 1W70A 3G4SQ 4HCBA 4IUVA 2EFIA 1K8AC 3REAB 1WJSA 4C0ZA 1IHVA 1N9SA 3PFSA 3OSSC 5GAMj 2KRMA 2L3SA 4A4GA 1CSKA 5CKBA 3RMSA 2E70A 4HCCA 2FL7A 2RHXA 4PKCC 5I2SA 2A0FB 3DLMA 4B6MA 1QQJA 1NJIR 5AYFA 1BB9A 4HT8A 3F70A 3E9GA 1RAAB 1K9MU 3THKA 2KYMA 3NTKA 1VQ7Q 3G71Q 2H3JA 4NOYA 4CRIA 1QMCA 3NTIA 4HVUA 1WX6A 3HKSA 2L3PA 3VS7A 3J7AF 4LUDA 2FVUA 2KEAA 3LH5A 2BUDA 3OYLA 1TOVA 2FHDA 2E6ZA 3RDVA 3G71A 2R57A 1TWBA 2LRQA 3EGDB 2GNCA 4LUEA 1J3TA 3QKJA 5KE3A 4M77A 4OMFB 1TUDA 2EWNA 4PFZA 3NMZC 3BDUA 1M1GA 5DLQE 4E7KA 3EGDA 1VQLQ 2KRNA 2NUPA 1GFCA 3M9QA 2QQSA 4AFUC 2OTLT 3CCRA 2LJ1A 2VV5A 1RLPC 2L89A 1M3AA 4RUGA 4FU6A 4CC3A 1KG1A 1WJQA 3G4SA 1E6GA 2K57A 2RQVA 4C5GA 2AHJB 3FB9A 1YHQT 3OYGA 3ASKA 4PJLA 1WYXA 4C92B 5GAOp 2CS7A 4F7UA 5FRNA 3JB9D 3CCMQ 4DEXA 1WHLA 3H6ZA 1HYOA 2NYSA 2WSFE 2COZA 2LP5A 4M77G 1M27C 3A8LB 4QVZA 4BE2A 2JJ9A 2F2XA 1I1JA 4KH0B 4XU1A 2ZPIB 4KUIA 2NUTA 1Q82C 5KYYB 2DEQA 4JUVA 2JUFA 2KXDA 2D9TA 3MEAA 4XK8E 1ARKA 5CR2A 5J39A 4AFZC 3BDLA 2BE7D 1EX4A 2CZ6B 2VB6A 4R55A 2RH2A 5I22A 4PJOA 2P0KA 4N4HA 2PVOB 4Y92A 4LDYA 2C0TA 5LJ5f 2V1RA 1IHWA 4KGXB 2MMPA 1NZ9A 2YRDA 2VUBA 3BE3A 4M7AE 4PLLA 4M75B 1X69A 1M1KU 2BTTA 4RG2A 1GCQA 3META 3QG1A 4OMQA 1BCOA 5IHIA 4FT4A 1YJWQ 2XHCA 3CCRT 4M75A 1H3HA 4A54A 2DLPA 2A36A 5GAMf 4F16A 2XKOC 4C5HA 3CPWS 3EHRA 3CCRQ 2VC8A 4M4ZA 2AK5A 2K3BA 3UWNA 5IN1A 1W1FA 5LJ3j 4QKUA 1Q81R 2A7YA 4M77E 4PJNA 2W0ZA 3SB2A 4C92D 2CREA 5D6YA 5KYYA 4N0AC 3M0QA 4JZ4A 3M4GA 2RJFA 9ATCB 1VQPT 1G3TA 2EYZA 1U5SA 3V7RA 2RJEA 4TVRA 3I55Q 2RQWA 2DL4A 2YXYA 1GXIE 5L8RE 3QUIA 2Z0WA 1BKBA 2QI2A 3CPFA 2HQHA 3OYYA 4M7AG 2L3RA 4MDWA 5LJ5h 1ABOA 5A0LA 2EIFA 2AKLA 1UGVA 2L8DA 4AFSC 1OI1A 3UT1A 4IIOA 2E12A 1VQKT 3CCQQ 3NPFA 3JCMg 3JCMW 1WPYA 3CC4Q 3JCMV 1TUCA 1D0YA 5CAIA 3M54A 1B34A 1VQNQ 1JXMA 2DXCA 2EYQA 4JRQA 1WXBA 3CCVA 2FZCB 1QCOA 2RK1A 4ZTFA 3V8LA 5GANe 4N4IA 1RACB 2JM9A 4CI0C 4V2SA 3M0TA 5KCHA 3HRUA 3FDRA 5FWBA 2RJDA 1NJIC 4ZGDB 2DXTA 1VQ6Q 3RBBB 2QK0A 1LJOA 3CCQA 1M9SA 1YJNT 4X9DA 2K5LA 1UFFA 2VYTA 5CCAA 1WHJA 2HL5C 3OW2P 2DK3A 1N8RU 3VS4A 1TXQA 2LX9A 2X35A 4A53A 5GAN2 3O5ZA 2DL8A 3SEMA 1RLQC 2HMAA 1RADB 3H0IA 4MDXA 4C8QB 2OTJA 1SPKA 1S72A 4AG1C 1OYXA 3C94A 3KFVA 4ME7A 3EFRA 5GAOn 2CP0A 2EYYA 3M58A 3X20B 1BI3A 4KGVB 4OGCA 5GAN5 4BY6B 1VQNT 1M8MA 3CCJQ 5HCKA 2DD4A 2QEXA 4HCZA 1UGRB 3QPHA 4PJMA 4WTOB 3I5RA 3JAME 3JRZA 2RN8A 1OZ3A 2ZPFB 5ECAA 4QQGA 1LOJA 3ULRB 3I5SA 1S72T 4PL6A 2E4HA 1NYFA 2EBPA 1IGUA 3JB9H 5CQYA 3JCMb 4M75E 4II1A 4ELZC 1WFWA 2RHZA 3CPWA 2MI6A 2NUPB 1SSHA 4J9DA 3G71T 3TEEA 4EMHA 3OYMA 2D0NA 4J9GA 1VQLT 3M56A 4L6V5 4FYWB 1VQ4Q 1Q81U 4JJCA 4B9XA 4HVVA 2RD1A 1KD1C 2OTJQ 2FPEA 3H9NA 2E64A 1KQSP 3GF5A 1YJWT 4M77B 1K1ZA 3PVQA 1KJWA 3CXCP 2ESWA 4F7UB 5CK9A 1UE9A 4P5NA 3QIIA 4OB2B 3HSBA 1V1CA 5I11A 5LJ5g 5CQXA 2J6FA 1KHCA 1VQ7T 1KQ2A 3S6WA 1SEMA 3G4ST 2OJ2A 3A8MB 3JCMQ 1TG0A 2R5AA 1LNXA 5AT1B 2YUQA 2VASA 4IUQA 1D3BA 1UECA 3WXMB 2XD0A 3P8HA 1VIFA 5GANd 1RAIB 3LX7A 1O75A 1KQSS 4M7DF 1JQQA 4C92G 5IHKA 2DJQA 3CC2T 2DBKA 3DB3A 3OYCA 4PFPA 4A4KA 3CC2Q 1YWOA 3VYGA 1X43A 5C0MA 3QBYA 3CCVQ 2NUTB 5LL6S 2K7AA 2LNVA 1K0XA 1G3YA 4ESRA 3L42A 1ZQ1A 2V8JA 4ZN1A 1D1CA 2DTHA 2Y4XA 1KC8U 2M9UA 1OU8A 1FWZA 4ZNXA 2IVWA 4K11A 4LE9A 1XOVA 3VU3C 4PLIA 1QVFA 1BYMA 4M7DC 2EQJA 3VV0A 1VQOT 4IUTA 1LPLA 1VQKA 1G3SA 1BIBA 3QJYA 2J06A 2EQIA 2HBWA 3A98A 1R0BG 3VS0A 1Z9QA 1VQ7A 1Y07A 3MCAB 2QTVA 1S72Q 4UC4A 3A5ZB 2M0YA 3C12A 3EGXB 1Q95G 2E3IA 4JRPA 2SEMA 4E7SA 4EMKC 1KQ1A 2AIRB 4BB7A
chains in the Genus database with same CATH topology
4HVUA 2GGRA 2CUDA 1WX6A 2CT3A 2L3PA 3VS7A 4LUDA 3EHQA 2KEAA 2KYBA 1QKXA 3EG2A 2YUPA 4OMPA 3LH5A 2RQUA 4D8DA 2DRKA 1LCKA 4Z89A 1OEBA 1N5ZA 2GNCA 2RQTA 4LUEA 3VS3A 1X6GA 1J3TA 1GCPA 1M3BA 2DYBA 1A0NB 1TUDA 2B86A 1KFZA 1PNJA 3NMZC 1KSWA 2PNIA 2KR3A 2KRNA 2DL3A 1AWJA 2C0OA 2GBQA 1GFCA 1GRIA 1GCQC 4AFUC 2EGEA 4GBQA 1AWOA 2LJ1A 2A28A 1RLPC 1M3AA 1SRMA 2JMAA 4RUGA 3U23A 3ZL7C 2LJ3A 4CC3A 2JW4A 1WXUA 1E6GA 2RQVA 1PKSA 2ED0A 1BU1A 3QWYA 5GJVB 5EC7A 3QWXX 1NEGA 2C0IA 1WYXA 1AVZC 2M51A 1UHCA 3UATA 4J9HA 2G6FX 1ZLMA 4RTVA 4DEXA 4J9IA 2LP5A 1M27C 2DE0X 2LQNA 3M0SA 2YUOA 4RTZA 1K4US 1UDLA 2D8JA 1NLOC 2BZYA 2F2XA 1I1JA 1T3SA 2O88A 2HCKA 1ZSGA 4ORZA 4J9FA 2OI3A 1RI9A 1T0JA 2KXDA 5GJWB 2FO0A 3C0CA 1ARKA 1K9AA 4AFZC 2FG0A 2DBMA 5I22A 4Y92A 2C0TA 2V1RA 3I35A 2QDLA 2DL7A 1JO8A 3NHNA 1K76A 1X69A 1UUEA 2PTKA 2BTTA 1Z9ZA 2CUBA 1GCQA 1AZEA 1YN8A 2AKKA 2EYXA 4OMQA 2CH4W 2W10A 2X3XD 5IHIA 2LX7A 1U06A 2MOXA 1H3HA 2DA9A 2E5KA 2DLPA 3UA7A 2A36A 1PHTA 1T0HA 2HSPA 4KRTA 2O2OA 4F16A 1X6BA 1B07A 3EHRA 1UHFA 2LZ6B 4M4ZA 2AK5A 2K3BA 4JZ3A 2LJ0A 1W1FA 2HDAA 5L23A 1GBQA 2LQWA 2K9GA 2EKHA 2AZSA 2DM1A 1WA7A 2JTEA 2K6DA 2V1QA 4Z8AA 2W0ZA 2FEIA 2CREA 2GTJA 3M0QA 4JZ4A 1W6XA 4E6RA 2VWFA 3TSZA 1AZGB 1QWFA 1H92A 2EYZA 1U5SA 3EG0A 4IIMA 1KIKA 3CQTA 1M30A 2RQWA 2BZ8A 1NYGA 2DL4A 2EYWA 2K2MA 4WCIA 1SRLA 2I0NA 4J9BA 3H41A 3R6NA 4CC4B 3SHWA 1JXOA 1NM7A 1B3QA 1ABOA 3REBB 2AKLA 3RNJA 1UGVA 4AFSC 1E7OA 2EW3A 3M0RA 1CKAA 4Z88A 4IIOA 2KT1A 2NUZA 3NPFA 1QWEA 4QT7A 1TUCA 4R0KA 1U3OA 2A08A 2YSQA 1NEBA 1AOJA 2D8HA 3VS6A 1JXMA 3M0PA 2EGAA 2ROTA 1WXBA 2KBTA 3VS2A 2DX1A 1HJDA 2YDLA 4FSSA 2A37A 2DILA 2DVJA 2JM9A 1WI7A 3M0TA 1JU5C 4HXJA 4RTUA 2FRYA 1GL5A 2FRWA 5FWBA 1UTIA 5FW9A 4JPBW 4JJBA 4CC2A 1WLPB 2O9VA 4GLMA 2LMJA 3RBBB 1G83A 1VYVA 4RTWA 2VKNA 1UFFA 1I07A 2KNBB 2YT6A 1YNZA 3VS4A 3O5ZA 2K79A 2DL8A 2KRSA 3SEMA 1AEYA 1RLQC 1X2QA 2O31A 1UG1A 1Y0MA 3H0IA 2L0AA 2EVRA 3UA6A 2KE9A 2KROA 3VS1A 1SPKA 2F2WA 2J05A 2CH4A 2RNAA 4AG1C 3TVTA 4LNPA 3KFVA 3H0FA 1VYUA 1HD3A 1QCFA 2BZXA 2EYYA 2L2PA 2MCNA 3FJ5A 1MUZA 1YP5A 2H8HA 2DF6A 4LN2A 2EPDA 4RTYA 1IO6A 2ENMA 1EFNA 1M8MA 1AD5A 4F14A 1ZUKA 5HCKA 3PVLA 4OMNA 2OAWA 4RTXA 2ABLA 2O9SA 1OPKA 4HVWA 1PWTA 3NGPA 4F17A 4AFQC 3I5RA 2CT4A 2RN8A 1ZUUA 5ECAA 1M3CA 1X2KA 1T3LA 3I5SA 3ULRB 1OOTA 2VVKA 1VYTA 4D8KA 2ROLA 3M0UA 5IXBA 1NYFA 1NLPC 1YCSB 1OV3A 2EBPA 2JS0A 3EG3A 4EIKA 1NG2A 1MV0B 2GQIA 4JJDA 1RUWA 1WFWA 1YWPA 3JV3A 2L3QA 2DNUA 2KGTA 1QKWA 5IXFA 1SSHA 4J9DA 1H8KA 1S1NA 1OPLA 3H0HA 3PE0A 1SHFA 2CSQA 1GBRA 1AWWA 4OMLA 1Y57A 2D0NA 4J9GA 3IQLA 3VRYA 2P4RA 1UJ0A 2JS2A 1GFDA 1K0SA 4JJCA 2FPDA 4HVVA 2KT8A 2JT4A 2FPEA 2DL5A 3VRZA 1PRMC 1FMKA 1I0CA 4OMMA 1CKBA 2EGCA 5IHNA 4CC7A 1K1ZA 1WIEA 1KJWA 3PVQA 2ESWA 1QLYA 1JEGA 1UE9A 3EG1A 1V1CA 5I11A 2J6FA 1G2BA 2PZ1A 2MIOA 2J6KA 1SHGA 1SEMA 1BBZA 1ZBJA 2ED1A 2OJ2A 1HSQA 2J7IA 1TG0A 2JM8A 2YUQA 1UECA 2JXBA 5IH2A 1FYNA 2XMFA 3TSWA 2DRMA 1VA7A 1JQQA 5IHKA 5FWCA 3EGUA 1ZX6A 2YUNA 2DJQA 2DBKA 2NWMA 1MV3A 2FPFA 2DMOA 3I9QA 1BK2A 2HEQA 4OMOA 1YWOA 2CDTA 2RMOA 2SRCA 1X43A 3VS5A 2K7AA 1K0XA 2GTOA 2X3WD 4ESRA 1ZUYA 4DEYA 1E6HA 1PRLC 4A63B 4J9EA 1PKTA 2ECZA 2LCSA 1W70A 4ZNXA 4K11A 1UJYA 2RQRA 4HCKA 4LE9A 4RTTA 4X1VA 3REAB 1XOVA 1AWXA 2RF0A 2J6OA 3GBQA 2AZVA 2KRMA 1X27A 2L3SA 1CSKA 2D1XA 1ABQA 2RPNA 2IIMA 2J06A 2EQIA 2HBWA 4J9CA 3A98A 2F2VA 3VS0A 1Z9QA 1BB9A 2CSIA 3UF4A 1WXTA 2LNHB 3THKA 2KYMA 2M0YA 2JMCA 1WDXA 2SEMA 4AG2C 2KXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  2GGR A;  2CUD A;  1WX6 A;  2CT3 A;  2L3P A;  3VS7 A;  4LUD A;  3EHQ A;  2KEA A;  2KYB A;  1QKX A;  3EG2 A;  2YUP A;  4OMP A;  3LH5 A;  2RQU A;  4D8D A;  2DRK A;  1LCK A;  4Z89 A;  1OEB A;  1N5Z A;  2GNC A;  2RQT A;  4LUE A;  3VS3 A;  1X6G A;  1J3T A;  1GCP A;  1M3B A;  2DYB A;  1A0N B;  1TUD A;  2B86 A;  1KFZ A;  1PNJ A;  3NMZ C;  1KSW A;  2PNI A;  2KR3 A;  2KRN A;  2DL3 A;  1AWJ A;  2C0O A;  2GBQ A;  1GFC A;  1GRI A;  1GCQ C;  4AFU C;  2EGE A;  4GBQ A;  1AWO A;  2LJ1 A;  2A28 A;  1RLP C;  1M3A A;  1SRM A;  2JMA A;  4RUG A;  3U23 A;  3ZL7 C;  2LJ3 A;  4CC3 A;  2JW4 A;  1WXU A;  1E6G A;  2RQV A;  1PKS A;  2ED0 A;  1BU1 A;  3QWY A;  5GJV B;  5EC7 A;  3QWX X;  1NEG A;  2C0I A;  1WYX A;  1AVZ C;  2M51 A;  1UHC A;  3UAT A;  4J9H A;  2G6F X;  1ZLM A;  4RTV A;  4DEX A;  4J9I A;  2LP5 A;  1M27 C;  2DE0 X;  2LQN A;  3M0S A;  2YUO A;  4RTZ A;  1K4U S;  1UDL A;  2D8J A;  1NLO C;  2BZY A;  2F2X A;  1I1J A;  1T3S A;  2O88 A;  2HCK A;  1ZSG A;  4ORZ A;  4J9F A;  2OI3 A;  1RI9 A;  1T0J A;  2KXD A;  5GJW B;  2FO0 A;  3C0C A;  1ARK A;  1K9A A;  4AFZ C;  2FG0 A;  2DBM A;  5I22 A;  4Y92 A;  2C0T A;  2V1R A;  3I35 A;  2QDL A;  2DL7 A;  1JO8 A;  3NHN A;  1K76 A;  1X69 A;  1UUE A;  2PTK A;  2BTT A;  1Z9Z A;  2CUB A;  1GCQ A;  1AZE A;  1YN8 A;  2AKK A;  2EYX A;  4OMQ A;  2CH4 W;  2W10 A;  2X3X D;  5IHI A;  2LX7 A;  1U06 A;  2MOX A;  1H3H A;  2DA9 A;  2E5K A;  2DLP A;  3UA7 A;  2A36 A;  1PHT A;  1T0H A;  2HSP A;  4KRT A;  2O2O A;  4F16 A;  1X6B A;  1B07 A;  3EHR A;  1UHF A;  2LZ6 B;  4M4Z A;  2AK5 A;  2K3B A;  4JZ3 A;  2LJ0 A;  1W1F A;  2HDA A;  5L23 A;  1GBQ A;  2LQW A;  2K9G A;  2EKH A;  2AZS A;  2DM1 A;  1WA7 A;  2JTE A;  2K6D A;  2V1Q A;  4Z8A A;  2W0Z A;  2FEI A;  2CRE A;  2GTJ A;  3M0Q A;  4JZ4 A;  1W6X A;  4E6R A;  2VWF A;  3TSZ A;  1AZG B;  1QWF A;  1H92 A;  2EYZ A;  1U5S A;  3EG0 A;  4IIM A;  1KIK A;  3CQT A;  1M30 A;  2RQW A;  2BZ8 A;  1NYG A;  2DL4 A;  2EYW A;  2K2M A;  4WCI A;  1SRL A;  2I0N A;  4J9B A;  3H41 A;  3R6N A;  4CC4 B;  3SHW A;  1JXO A;  1NM7 A;  1B3Q A;  1ABO A;  3REB B;  2AKL A;  3RNJ A;  1UGV A;  4AFS C;  1E7O A;  2EW3 A;  3M0R A;  1CKA A;  4Z88 A;  4IIO A;  2KT1 A;  2NUZ A;  3NPF A;  1QWE A;  4QT7 A;  1TUC A;  4R0K A;  1U3O A;  2A08 A;  2YSQ A;  1NEB A;  1AOJ A;  2D8H A;  3VS6 A;  1JXM A;  3M0P A;  2EGA A;  2ROT A;  1WXB A;  2KBT A;  3VS2 A;  2DX1 A;  1HJD A;  2YDL A;  4FSS A;  2A37 A;  2DIL A;  2DVJ A;  2JM9 A;  1WI7 A;  3M0T A;  1JU5 C;  4HXJ A;  4RTU A;  2FRY A;  1GL5 A;  2FRW A;  5FWB A;  1UTI A;  5FW9 A;  4JPB W;  4JJB A;  4CC2 A;  1WLP B;  2O9V A;  4GLM A;  2LMJ A;  3RBB B;  1G83 A;  1VYV A;  4RTW A;  2VKN A;  1UFF A;  1I07 A;  2KNB B;  2YT6 A;  1YNZ A;  3VS4 A;  3O5Z A;  2K79 A;  2DL8 A;  2KRS A;  3SEM A;  1AEY A;  1RLQ C;  1X2Q A;  2O31 A;  1UG1 A;  1Y0M A;  3H0I A;  2L0A A;  2EVR A;  3UA6 A;  2KE9 A;  2KRO A;  3VS1 A;  1SPK A;  2F2W A;  2J05 A;  2CH4 A;  2RNA A;  4AG1 C;  3TVT A;  4LNP A;  3KFV A;  3H0F A;  1VYU A;  1HD3 A;  1QCF A;  2BZX A;  2EYY A;  2L2P A;  2MCN A;  3FJ5 A;  1MUZ A;  1YP5 A;  2H8H A;  2DF6 A;  4LN2 A;  2EPD A;  4RTY A;  1IO6 A;  2ENM A;  1EFN A;  1M8M A;  1AD5 A;  4F14 A;  1ZUK A;  5HCK A;  3PVL A;  4OMN A;  2OAW A;  4RTX A;  2ABL A;  2O9S A;  1OPK A;  4HVW A;  1PWT A;  3NGP A;  4F17 A;  4AFQ C;  3I5R A;  2CT4 A;  2RN8 A;  1ZUU A;  5ECA A;  1M3C A;  1X2K A;  1T3L A;  3I5S A;  3ULR B;  1OOT A;  2VVK A;  1VYT A;  4D8K A;  2ROL A;  3M0U A;  5IXB A;  1NYF A;  1NLP C;  1YCS B;  1OV3 A;  2EBP A;  2JS0 A;  3EG3 A;  4EIK A;  1NG2 A;  1MV0 B;  2GQI A;  4JJD A;  1RUW A;  1WFW A;  1YWP A;  3JV3 A;  2L3Q A;  2DNU A;  2KGT A;  1QKW A;  5IXF A;  1SSH A;  4J9D A;  1H8K A;  1S1N A;  1OPL A;  3H0H A;  3PE0 A;  1SHF A;  2CSQ A;  1GBR A;  1AWW A;  4OML A;  1Y57 A;  2D0N A;  4J9G A;  3IQL A;  3VRY A;  2P4R A;  1UJ0 A;  2JS2 A;  1GFD A;  1K0S A;  4JJC A;  2FPD A;  4HVV A;  2KT8 A;  2JT4 A;  2FPE A;  2DL5 A;  3VRZ A;  1PRM C;  1FMK A;  1I0C A;  4OMM A;  1CKB A;  2EGC A;  5IHN A;  4CC7 A;  1K1Z A;  1WIE A;  1KJW A;  3PVQ A;  2ESW A;  1QLY A;  1JEG A;  1UE9 A;  3EG1 A;  1V1C A;  5I11 A;  2J6F A;  1G2B A;  2PZ1 A;  2MIO A;  2J6K A;  1SHG A;  1SEM A;  1BBZ A;  1ZBJ A;  2ED1 A;  2OJ2 A;  1HSQ A;  2J7I A;  1TG0 A;  2JM8 A;  2YUQ A;  1UEC A;  2JXB A;  5IH2 A;  1FYN A;  2XMF A;  3TSW A;  2DRM A;  1VA7 A;  1JQQ A;  5IHK A;  5FWC A;  3EGU A;  1ZX6 A;  2YUN A;  2DJQ A;  2DBK A;  2NWM A;  1MV3 A;  2FPF A;  2DMO A;  3I9Q A;  1BK2 A;  2HEQ A;  4OMO A;  1YWO A;  2CDT A;  2RMO A;  2SRC A;  1X43 A;  3VS5 A;  2K7A A;  1K0X A;  2GTO A;  2X3W D;  4ESR A;  1ZUY A;  4DEY A;  1E6H A;  1PRL C;  4A63 B;  4J9E A;  1PKT A;  2ECZ A;  2LCS A;  1W70 A;  4ZNX A;  4K11 A;  1UJY A;  2RQR A;  4HCK A;  4LE9 A;  4RTT A;  4X1V A;  3REA B;  1XOV A;  1AWX A;  2RF0 A;  2J6O A;  3GBQ A;  2AZV A;  2KRM A;  1X27 A;  2L3S A;  1CSK A;  2D1X A;  1ABQ A;  2RPN A;  2IIM A;  2J06 A;  2EQI A;  2HBW A;  4J9C A;  3A98 A;  2F2V A;  3VS0 A;  1Z9Q A;  1BB9 A;  2CSI A;  3UF4 A;  1WXT A;  2LNH B;  3THK A;  2KYM A;  2M0Y A;  2JMC A;  1WDX A;  2SEM A;  4AG2 C;  2KXC A; 
#chains in the Genus database with same CATH topology
 2GGR A;  1Q81 C;  3M57 A;  2VGN A;  4WF2 A;  3KXT A;  3NFC A;  4C8Q E;  1F1B B;  3E2U A;  1IRX A;  2DXU A;  3OYA A;  2P0P A;  1WQW A;  3EG2 A;  1QKX A;  5GMK m;  1R0C B;  4OMP A;  1SSF A;  1Q86 U;  1BIA A;  3OYH A;  4D8D A;  1VQ5 T;  1LCK A;  2E65 A;  4Z89 A;  3OS5 A;  3CCE T;  1OEB A;  3VS3 A;  1YI2 Q;  2MAM A;  1PD0 A;  2E5Q A;  1M3B A;  2ZPG B;  1KFZ A;  2CZ7 B;  3CD6 Q;  1KSW A;  2PNI A;  1NJI U;  1VQO A;  1VQL A;  1N6A A;  2KR3 A;  2DL3 A;  1QVF S;  2ATC B;  1YIT T;  1GCQ C;  2EGE A;  4GBQ A;  4L59 A;  1AWO A;  1SRM A;  3VYH B;  4FYY B;  1WXU A;  2BIV A;  2DYI A;  3DB4 A;  1PKS A;  4PJO F;  3QWY A;  3CCU T;  4PJO C;  3QWX X;  4M78 C;  4A4E A;  1AVZ C;  3GP8 A;  3L1A A;  4J9H A;  1I5L A;  4GY5 A;  5LJ3 d;  2ZCF B;  2A3L A;  2LQN A;  3M0S A;  1KD1 U;  2AT1 B;  4RTZ A;  1UDL A;  2BZY A;  1T3S A;  2YWW A;  4M7A C;  2HCK A;  4PK4 A;  4ORZ A;  2XDB A;  5CKF A;  1D1A A;  4J9F A;  3A8O B;  1TTH B;  2FO0 A;  5FU6 B;  3CCS T;  1K9A A;  1RAG B;  4ZGJ B;  5HK0 A;  3I56 T;  2FG0 A;  3INZ A;  1WHK A;  2DBM A;  2KMT A;  1VQ5 Q;  1WHG A;  2KI7 A;  2EJF A;  4IUP A;  1YJ9 Q;  4XTW A;  2K3X A;  4EDU A;  3X28 B;  2ZAE A;  1UUE A;  2X9H A;  2CUB A;  1AZE A;  1YN8 A;  2E1H A;  2XID A;  1EZZ B;  2KY9 A;  4C8Q A;  3JCM e;  2MOX A;  1YJW A;  3G6E T;  4KRT A;  4X9C A;  1WQ7 A;  2XG8 D;  3E9F A;  5KYX A;  2X4J A;  2LZ6 B;  4X34 A;  2HKN A;  2OTL A;  1I8F A;  4F7U G;  1BI1 A;  1GBQ A;  2MWO A;  2K9G A;  1KC8 C;  2EKH A;  2DM1 A;  2GF7 A;  2K6D A;  3QYG B;  2GTJ A;  2YHT A;  3TSZ A;  2DPP B;  2V26 A;  1AZG B;  4ELY C;  2RI2 A;  4KUL A;  5J3B A;  4M7D A;  3EG0 A;  4IIM A;  4JLG A;  1ZA1 B;  2DFU A;  1KK7 A;  2EYW A;  1YIJ T;  4WCI A;  1PSE A;  1ZSZ C;  4HKE A;  1SRL A;  1VQM Q;  3H41 A;  1PD1 A;  3R6N A;  2E41 A;  3HP9 A;  1VUB A;  3SHW A;  1JXO A;  4DBR A;  3FJP A;  3EG9 A;  3OB9 A;  2QA4 Q;  3FRN A;  4OVA A;  5LJ3 e;  2QAS A;  3I55 T;  3PT9 A;  5KYN A;  3JB9 J;  3M0R A;  4FYX B;  5D6W A;  2F5T X;  4C0G A;  1IB8 A;  2NUZ A;  1RAB B;  1UGS B;  1Y96 B;  5A2Q E;  1VQ9 Q;  1VQ4 A;  3G7Z A;  1KD1 R;  3CBO A;  5KH6 A;  1PM3 A;  2A08 A;  3GNG A;  2R5M A;  3VS6 A;  3M0P A;  2EGA A;  2ROT A;  3FEO A;  2CYZ B;  3VS2 A;  2DX1 A;  3CEY A;  1M1F A;  2DAQ A;  4FSS A;  2DIL A;  3BW1 A;  3WVE B;  3MPU B;  4JJN K;  1WI7 A;  1JU5 C;  2GCX A;  4LDX A;  2FRY A;  2FRW A;  2RJC A;  1M8V A;  3CME T;  3DLL A;  4JS5 A;  4GLM A;  1QVG A;  4XTY A;  2F69 A;  3CCJ T;  1YHQ Q;  3J81 E;  4JLI A;  2LDM A;  3OYK A;  2LCL A;  1TS9 A;  2KNB B;  2EJG A;  3V7C A;  1YNZ A;  4C0F A;  2K5F A;  1LVK A;  4C8Q G;  2O31 A;  2P4T A;  1Q86 R;  3OBW A;  5GAN 4;  1VQ6 T;  3EAE A;  1PG5 B;  2KE9 A;  5C6S A;  3VS1 A;  2QQ9 A;  2J05 A;  2X4Y A;  3PMT A;  2HQE A;  3GNF B;  1VYU A;  2O01 E;  1VQK Q;  2L2P A;  1MGQ A;  3FJ5 A;  1MUZ A;  4XTX A;  1X75 C;  2M0O A;  2H8H A;  2DF6 A;  4LN2 A;  3OYE A;  2C06 A;  3CCS Q;  1IO6 A;  1OX9 A;  5FRM A;  5CVI A;  1QP2 A;  1VQ8 Q;  1G8X A;  1OX8 A;  2O4X A;  2ABL A;  4OB3 B;  4HVW A;  1PWT A;  2MK5 A;  3QDR B;  4M7A A;  2RK2 A;  1HK9 A;  1YHQ A;  1ZUU A;  1X2K A;  4J8O A;  5HK3 A;  1T3L A;  2ZPH B;  1PC0 A;  2O4X B;  1JJ2 A;  5GAM d;  3C4S A;  3V8K A;  3M0U A;  2QA4 T;  1K8A U;  2RA2 A;  3RKX A;  3EG3 A;  2D0Q B;  3E1S A;  3PIO A;  1YWP A;  3JV3 A;  2L3Q A;  3PGG A;  2R58 A;  1ZA2 B;  5KYW A;  2KGT A;  1QKW A;  3CMA A;  5IXF A;  4YTL A;  3R6O A;  3H0H A;  3PE0 A;  2CSQ A;  4OML A;  1QVF P;  3JB9 F;  2PVD B;  3JB9 I;  1O9S A;  2P4R A;  2CP5 A;  3EFO A;  3L2Z A;  5GMK j;  1K0S A;  4DOW A;  3VRZ A;  2K2V A;  3G1J A;  5IHN A;  2EGC A;  1OU9 A;  2QA4 A;  3CC4 T;  1QLY A;  3EFO B;  2DD5 A;  2QG9 B;  1Q86 C;  4BDY A;  4KT0 E;  3HHT B;  5DM7 R;  2J6K A;  2EJ9 A;  3UDC A;  2G3R A;  1BBZ A;  1XQH A;  2J7I A;  5GAM e;  1QVP A;  5LJ3 f;  2H3E B;  3FC3 A;  4OF1 A;  1FYN A;  8AT1 B;  5FU6 C;  2DET A;  1VA7 A;  3CCV T;  5KYX B;  1KC8 R;  3GOX A;  1OUL A;  3LGL A;  3S3M A;  4KH1 B;  3L2Q A;  5GAN j;  4DEY A;  3DKM A;  4A63 B;  5LJ5 d;  3CCQ T;  1YJN A;  4DQ2 A;  3I56 A;  2K3Y A;  4PFO A;  1WHH A;  3QJ6 A;  4BE1 A;  1BCM A;  2RQR A;  4RTT A;  5GAN h;  4X1V A;  3S3N A;  2QEX T;  1C1A A;  2J6O A;  4XU3 A;  2AZV A;  1TU0 B;  4C0D C;  3KBG A;  1FXX A;  1X27 A;  2MF2 A;  3ER0 A;  2D1X A;  1ABQ A;  2RPN A;  4XAX B;  3SDZ A;  5FRO A;  2COY A;  4ATO A;  3SWN C;  2CSI A;  3UF4 A;  2FB7 A;  2DTO A;  2LNH B;  1Y7X A;  1NPR A;  4O5V A;  4C92 A;  2GFA A;  1WDX A;  2DXB A;  4AG2 C;  2KXC A;  5CKH A;  4M77 C;  3M5A A;  2JTF A;  1M90 C;  1VOM A;  4LXC A;  2CT3 A;  4C5E A;  3OA6 A;  5IT9 E;  1I5O B;  2KYB A;  5A0G A;  3G6E A;  3CXC S;  2CGH A;  1YJ9 T;  1K73 C;  2RQU A;  2DIQ A;  2BE9 B;  3RIR A;  4J6W A;  3CXC A;  3CCU Q;  3I56 Q;  5GAN 8;  4E47 A;  1YIJ A;  2EKO A;  3QZ9 B;  3OYF A;  1VQO Q;  2X51 A;  3S3O A;  4PJO D;  1TUG B;  1AWJ A;  2GBQ A;  1GRI A;  4M7D G;  2A28 A;  3M55 A;  2JMA A;  3U23 A;  3ZL7 C;  2LJ3 A;  3TQ7 P;  3A1P A;  4ZN3 A;  2HD0 A;  2ED0 A;  1BU1 A;  5EC7 A;  4ZTJ A;  5KE2 A;  4F04 B;  2YRC A;  1M1K C;  1OZ2 A;  2QQA A;  2M51 A;  2CZ0 B;  1UHC A;  3CCL A;  5CIU A;  1N9R A;  2G6F X;  4RTV A;  4XTV A;  4J9I A;  1HXD A;  2DE0 X;  4XQ3 A;  1QCN A;  1VQ8 A;  4GLK A;  4MZM A;  1NLO C;  4M78 D;  4C8Q F;  5CKD A;  4E2F B;  2F5K A;  3O8V A;  4LD6 A;  1RI9 A;  1T0J A;  3Q1J A;  5A0D A;  3OYD A;  1U1T A;  2QGG A;  4KUD K;  1JBM A;  2P0Q A;  4M78 E;  1V29 B;  3VUB A;  3CMA T;  3I35 A;  1MMD A;  2OAU A;  2DL7 A;  1JO8 A;  2JZ2 A;  1UGQ B;  2PTK A;  3TU4 K;  2EAY A;  3CCE Q;  2EYX A;  2CH4 W;  2W10 A;  2LX7 A;  4JS4 A;  2DA9 A;  2E5K A;  3EH1 A;  1NBE B;  1PHT A;  2E3H A;  4A4F A;  2O2O A;  3MP6 A;  1X6B A;  1G5V A;  1B07 A;  1MMA A;  5GAM h;  1XTD A;  1UHF A;  1VQP Q;  5GMK l;  2ZGW A;  2PUO B;  5IAY A;  1N8R C;  1OQK A;  4EPC A;  1P92 A;  5GMK i;  1RAF B;  3LWH A;  1YIJ Q;  3FIF A;  3CCL T;  2K4Y A;  3T9N A;  4BE0 A;  3RKW A;  4J7F A;  3CCU A;  2VWF A;  1MND A;  1QWF A;  1H92 A;  1XJW B;  1M1K R;  2QYZ A;  4VUB A;  1M90 U;  3CC4 A;  1M30 A;  2BZ8 A;  1IZ6 A;  3OYN A;  4PJO B;  3PNW C;  2KVQ G;  1NPP A;  4CC4 B;  2ZZD A;  4E7L A;  3JB9 G;  1Q7Y U;  3M4Y A;  1NM7 A;  3QZ5 B;  1B3Q A;  1C6V X;  3MEV A;  4QQ6 A;  1FMV A;  3OYB A;  4FW1 A;  8ATC B;  5GAN f;  5M9O A;  3CC7 T;  4FL6 A;  3MHX A;  1CKA A;  1B7T A;  2KT1 A;  2FYK A;  1QW1 A;  3X25 B;  2K5I A;  3URG A;  1QWE A;  3I55 A;  2RHI A;  4R0K A;  4E7Z A;  3HL8 A;  2YSQ A;  2HL3 A;  3WVD B;  1AOJ A;  3M53 A;  2DJZ A;  2E10 A;  3X26 B;  3ZFJ A;  5I21 A;  4F7U E;  4EMG A;  2KBT A;  3CMA Q;  2A37 A;  4DBQ A;  3JSC A;  4M7D B;  3LGF A;  1UB4 A;  5GAO r;  1UTI A;  3J80 E;  5FW9 A;  3OS0 A;  4JJB A;  4CC2 A;  5GAN 6;  2LC4 A;  2O9V A;  3CPW P;  2LMJ A;  1D09 B;  5GAN 7;  2VKN A;  2ZPB B;  4EMK B;  4Q5W A;  1BI0 A;  2HBP A;  3RES A;  2YT6 A;  2NLU A;  4RKU E;  1K9M C;  2HNI A;  4M7A F;  1JB0 E;  1AEY A;  2EQU A;  2M02 A;  4C0D B;  2X4X A;  2F2W A;  2CH4 A;  2RNA A;  3LWI A;  3TVT A;  1KHI A;  1IXD A;  5KYW B;  1HD3 A;  3QXE B;  1WZO A;  5GMK h;  2BZX A;  7AT1 B;  4C92 C;  4RCC A;  4IUU A;  4JRI A;  2HAX A;  1AHJ B;  2IG0 A;  1FX7 A;  3TRE A;  4OMN A;  2OAW A;  1W2B P;  1OPK A;  5GMK e;  4F17 A;  2IPO B;  4AFQ C;  2CT4 A;  2HKQ B;  4XU2 A;  3HFN A;  4BDZ A;  3QHS A;  1RAE B;  1M3C A;  3OBY A;  4D6W A;  6AT1 B;  1Q7Y R;  2VVK A;  3N5B B;  3EFS A;  3JCM c;  1NLP C;  1YCS B;  5DY9 A;  1OV3 A;  2JS0 A;  1KQS A;  2RI5 A;  1JJ2 S;  1VQ8 T;  2GQI A;  4JJD A;  1RUW A;  1M90 R;  3CME Q;  1VQM T;  3AHU A;  1D0X A;  2CP7 A;  5CO7 A;  2PQW A;  3CD6 A;  1QVG P;  2DZC A;  1YJ9 A;  2OTL Q;  3JCM J;  3L2R A;  4DBF A;  1Y57 A;  2KK4 A;  1PSF A;  2DZ9 A;  2RHY A;  2RB6 A;  3L2W A;  2MYS A;  3IQL A;  2XDD A;  4J83 A;  3TCJ A;  1VQ9 A;  2JS2 A;  2FPD A;  2JT4 A;  1FMK A;  4OMM A;  5GAN 3;  1W2B S;  4LD9 K;  3QDF A;  2LTO A;  1VQ9 T;  4M7D E;  2DTI A;  1C0M A;  3C95 A;  3RUX A;  1K9M R;  1JEG A;  2XK0 A;  2M16 A;  1G2B A;  2MIO A;  3JCM d;  1SHG A;  3PIP A;  4XU0 A;  1VQM A;  2ED1 A;  2JM8 A;  2HQX A;  2JXB A;  5IH2 A;  4PJO E;  4MMK A;  4BUG A;  3TSW A;  3LW5 E;  3EGU A;  1ZX6 A;  2YUN A;  5GAM g;  1MV3 A;  2FPF A;  2M1H A;  4DA4 A;  2DMO A;  5KYU B;  1BK2 A;  2LCC A;  2QQR A;  3AT1 B;  4FYV B;  1I81 A;  2RMO A;  2SRC A;  4J6Y A;  1VQP A;  2QTX A;  3SWN A;  4QQD A;  1E6H A;  4HA8 A;  4J9E A;  2GFU A;  1PKT A;  3VKI A;  2ECZ A;  4MML A;  4C92 F;  1R8O B;  2LCS A;  2LVM A;  1X6O A;  3CC7 Q;  1ZSZ B;  1H64 1;  3X24 B;  4IKF A;  3CCE A;  1UJY A;  2WAC A;  3RER A;  4HCK A;  1AWX A;  1M5Q 1;  2RF0 A;  3H8Z A;  1M2V B;  3GBQ A;  5FU7 C;  4LDU A;  4MZP A;  2QAZ A;  2IIM A;  4J9C A;  2F2V A;  2V8K A;  2KAF A;  3LYI A;  1YI2 A;  3M59 A;  4PJJ A;  1WXT A;  2LQ8 A;  5I2M A;  4M78 G;  5GAO l;  2JMC A;  1D0Z A;  3G6E Q;  4M75 F;  1YIT A;  2CUD A;  2OX7 A;  4O6J A;  3QO3 A;  1SF9 A;  3EHQ A;  2CP6 A;  3MP8 A;  2EQM A;  2JNG A;  1V76 A;  4M75 G;  4M7A B;  3UPU A;  3A8H B;  2YUP A;  4M75 D;  1RL2 A;  3OSV A;  1H3Z A;  2RHU A;  2DKG A;  2QDY B;  3JCM h;  2DRK A;  4J7I A;  2VXF A;  1N5Z A;  2RQT A;  4AT1 B;  1X6G A;  1GCP A;  2DYB A;  3OYJ A;  1A0N B;  5LJ3 g;  2B86 A;  1PNJ A;  1WJR A;  2YRV A;  3MJX A;  5LJ5 e;  3JCM P;  4RG8 A;  4BY6 C;  2QQB A;  2XIC A;  2C0O A;  5GAO m;  1Q82 U;  2B8A A;  2VGM A;  2JTM A;  4J6X A;  4HT9 A;  3RR6 A;  4JRK A;  2JW4 A;  4QW2 A;  3HFO A;  1K73 U;  2FZK B;  5GJV B;  1NEG A;  2KSS A;  2C0I A;  2CZ1 B;  1YJN Q;  1B34 B;  3UAT A;  5GAN g;  1ZLM A;  2YLB A;  4LDV A;  1D3B B;  3V8J A;  4PNO A;  2YUO A;  1WHM A;  1SKU B;  1K4U S;  2D8J A;  3JCM f;  2JOY A;  1YIT Q;  2O88 A;  3GLX A;  1ZSG A;  3MO8 A;  3LH0 A;  1VIE A;  1ZHI A;  4ZGE B;  2OI3 A;  2PU9 B;  5GJW B;  3C0C A;  1X01 A;  5J26 A;  1YBY A;  2XU8 A;  4J5Y A;  2JN0 A;  1U8R A;  3NTH A;  2GQV A;  4EMK A;  1AT1 B;  3L2U A;  4F7U F;  2QDL A;  3NHN A;  1K76 A;  4QVC A;  3CCL Q;  4C5I A;  1G3W A;  1R77 A;  4OB1 B;  1Z9Z A;  4FSX A;  2AKK A;  4N4G A;  1SG5 A;  2X3X D;  4ANJ A;  5HY6 A;  4BD3 A;  1U06 A;  3JCM X;  3UA7 A;  1MMG A;  4AMC A;  1T0H A;  2HSP A;  4QVD A;  3RMQ A;  4JZ3 A;  2LJ0 A;  2HDA A;  5L23 A;  2LQW A;  2AZS A;  1WA7 A;  2I2L A;  2XDP A;  3FLG A;  2JTE A;  4NL2 A;  2E6N A;  2V1Q A;  4Z8A A;  2FEI A;  3VUZ A;  4DOV A;  4C8Q C;  5D7U A;  1W6X A;  4OP0 A;  4E6R A;  2FZG B;  1W2B A;  2HSE B;  4FCY A;  4PJO G;  1Q7Y C;  1KIK A;  1WGS A;  3CQT A;  4FIB A;  1NYG A;  3GPL A;  4M78 A;  2K2M A;  2DEU A;  2ZPE B;  2I0N A;  4J9B A;  1K8A R;  4R56 A;  3HRT A;  2QEX Q;  2QXF A;  2DER A;  1Y96 A;  4OB0 B;  4KGZ B;  3REB B;  1NE8 A;  5CKE A;  1ACM B;  2F1L A;  3RNJ A;  1E7O A;  2EW3 A;  2L5Q A;  3OW2 S;  4Z88 A;  1EIF A;  2MWP A;  3LLR A;  1JRI A;  3SFM A;  2VXE A;  2CKK A;  4QT7 A;  3OY9 A;  1YCY A;  1U3O A;  2BKD N;  1NEB A;  1Y71 A;  2D8H A;  5LJ3 h;  2RO0 A;  3HRS A;  2MPX C;  1D1B A;  2DO3 A;  2XI9 A;  1HJD A;  2YDL A;  2DVJ A;  2LT1 A;  3CBP A;  3OS1 A;  2DIG A;  1K73 R;  4HXJ A;  4RTU A;  4KBM B;  3V7S A;  1GL5 A;  3VJP A;  4BAC A;  1WNL A;  1TSF A;  4NL3 A;  3SWN B;  4JPB W;  1WLP B;  1PCX A;  2WSC E;  2CP2 A;  3OMC A;  4MZT A;  3PTA A;  1G83 A;  1VYV A;  4L5G A;  4RTW A;  3L2V A;  4BI8 B;  1I07 A;  3OMG A;  1VQ4 T;  4M77 F;  4IUR A;  2D6F A;  2V8I A;  3CC2 A;  5LJ5 j;  3A8G B;  3ZBD A;  1MNE A;  2K79 A;  2KRS A;  1ZBX A;  3EG9 B;  3SD4 A;  2RI3 A;  3CCS A;  5FU7 B;  1X2Q A;  1UG1 A;  1Y0M A;  2L0A A;  3P8B B;  1DJ7 B;  2EVR A;  3UA6 A;  2DVE A;  2KRO A;  2QGF B;  1YFN A;  4LNP A;  3E19 A;  3OYI A;  4FM4 B;  1UEB A;  4XTU A;  3H0F A;  5D6X A;  1QCF A;  2PVG B;  1ZSZ A;  3QYH B;  1YI2 T;  2MCN A;  3OQ5 A;  1YP5 A;  2LT4 A;  2EPD A;  4RTY A;  2JVV A;  4M75 C;  2ENM A;  1EFN A;  3PMI A;  1AD5 A;  4F14 A;  1ZUK A;  3OS2 A;  1RI0 A;  3PVL A;  4RTX A;  2O9S A;  4NS5 A;  1Q82 R;  3NGP A;  3CCM A;  1M4Z A;  1RAH B;  4N0A A;  1VQ6 A;  3CCM T;  1OOT A;  4E7J A;  4M7A D;  1FMW A;  1VYT A;  4OGE A;  4D8K A;  2ROL A;  4DBH A;  5IXB A;  4C92 E;  4Y91 A;  1I4K 1;  2Y4Y A;  3EH2 A;  4EIK A;  1NG2 A;  2CP3 A;  3MEW A;  3CD6 T;  5FLX E;  1MV0 B;  4JDS A;  2WSE E;  4FW2 A;  2DNU A;  3D7S B;  3ZEH A;  1H8K A;  1S1N A;  1OPL A;  3QSU A;  2Y90 A;  1SHF A;  1IGQ A;  2PUK B;  1GBR A;  1AWW A;  2YLC A;  4RCB A;  5KYU A;  2KDS A;  5EG2 A;  3VRY A;  1W4S A;  1N27 A;  2P84 A;  1QVG S;  1UJ0 A;  1GFD A;  4M77 D;  3MP1 A;  2KT8 A;  2DL5 A;  1PRM C;  1U1S A;  1I0C A;  3MKD A;  1N8R R;  1M2O A;  1CKB A;  1UGP B;  4Y28 E;  4CC7 A;  3CBM A;  3P8D A;  1WIE A;  3KUF A;  4A4H A;  3CCJ A;  3EG1 A;  5DLO A;  1MHN A;  4XTZ A;  2PZ1 A;  4BI4 A;  1XNI A;  2COW A;  5KCO A;  1ZBJ A;  2HZY A;  1HSQ A;  1VQ5 A;  4M7D D;  1M2V A;  2X4W A;  2XMF A;  1TH7 A;  2DRM A;  3OW2 A;  1MMN A;  4E7I A;  5FWC A;  2NWM A;  1QP3 A;  2KQW A;  3MEU A;  1IRE B;  3I9Q A;  4RMO A;  2HEQ A;  3HTR A;  4OMO A;  4BI3 A;  2RM4 A;  3CME A;  2EQK A;  3BY7 A;  5GAO q;  1JJ2 P;  2CDT A;  3EGX A;  4FT2 A;  3VS5 A;  1BI2 A;  3BFM A;  1VQN A;  4E7H A;  2GTO A;  2X3W D;  1ZUY A;  1PRL C;  4Z02 A;  3HPW A;  4LDW A;  4M78 F;  4C8Q D;  3CC7 A;  2OTJ T;  4M78 B;  4B9W A;  3ME9 A;  3RKY A;  3GIB A;  2LQK A;  5HKC A;  1W70 A;  3G4S Q;  4HCB A;  4IUV A;  2EFI A;  1K8A C;  3REA B;  1WJS A;  4C0Z A;  1IHV A;  1N9S A;  3PFS A;  3OSS C;  5GAM j;  2KRM A;  2L3S A;  4A4G A;  1CSK A;  5CKB A;  3RMS A;  2E70 A;  4HCC A;  2FL7 A;  2RHX A;  4PKC C;  5I2S A;  2A0F B;  3DLM A;  4B6M A;  1QQJ A;  1NJI R;  5AYF A;  1BB9 A;  4HT8 A;  3F70 A;  3E9G A;  1RAA B;  1K9M U;  3THK A;  2KYM A;  3NTK A;  1VQ7 Q;  3G71 Q;  2H3J A;  4NOY A;  4CRI A;  1QMC A;  3NTI A;  4HVU A;  1WX6 A;  3HKS A;  2L3P A;  3VS7 A;  3J7A F;  4LUD A;  2FVU A;  2KEA A;  3LH5 A;  2BUD A;  3OYL A;  1TOV A;  2FHD A;  2E6Z A;  3RDV A;  3G71 A;  2R57 A;  1TWB A;  2LRQ A;  3EGD B;  2GNC A;  4LUE A;  1J3T A;  3QKJ A;  5KE3 A;  4M77 A;  4OMF B;  1TUD A;  2EWN A;  4PFZ A;  3NMZ C;  3BDU A;  1M1G A;  5DLQ E;  4E7K A;  3EGD A;  1VQL Q;  2KRN A;  2NUP A;  1GFC A;  3M9Q A;  2QQS A;  4AFU C;  2OTL T;  3CCR A;  2LJ1 A;  2VV5 A;  1RLP C;  2L89 A;  1M3A A;  4RUG A;  4FU6 A;  4CC3 A;  1KG1 A;  1WJQ A;  3G4S A;  1E6G A;  2K57 A;  2RQV A;  4C5G A;  2AHJ B;  3FB9 A;  1YHQ T;  3OYG A;  3ASK A;  4PJL A;  1WYX A;  4C92 B;  5GAO p;  2CS7 A;  4F7U A;  5FRN A;  3JB9 D;  3CCM Q;  4DEX A;  1WHL A;  3H6Z A;  1HYO A;  2NYS A;  2WSF E;  2COZ A;  2LP5 A;  4M77 G;  1M27 C;  3A8L B;  4QVZ A;  4BE2 A;  2JJ9 A;  2F2X A;  1I1J A;  4KH0 B;  4XU1 A;  2ZPI B;  4KUI A;  2NUT A;  1Q82 C;  5KYY B;  2DEQ A;  4JUV A;  2JUF A;  2KXD A;  2D9T A;  3MEA A;  4XK8 E;  1ARK A;  5CR2 A;  5J39 A;  4AFZ C;  3BDL A;  2BE7 D;  1EX4 A;  2CZ6 B;  2VB6 A;  4R55 A;  2RH2 A;  5I22 A;  4PJO A;  2P0K A;  4N4H A;  2PVO B;  4Y92 A;  4LDY A;  2C0T A;  5LJ5 f;  2V1R A;  1IHW A;  4KGX B;  2MMP A;  1NZ9 A;  2YRD A;  2VUB A;  3BE3 A;  4M7A E;  4PLL A;  4M75 B;  1X69 A;  1M1K U;  2BTT A;  4RG2 A;  1GCQ A;  3MET A;  3QG1 A;  4OMQ A;  1BCO A;  5IHI A;  4FT4 A;  1YJW Q;  2XHC A;  3CCR T;  4M75 A;  1H3H A;  4A54 A;  2DLP A;  2A36 A;  5GAM f;  4F16 A;  2XKO C;  4C5H A;  3CPW S;  3EHR A;  3CCR Q;  2VC8 A;  4M4Z A;  2AK5 A;  2K3B A;  3UWN A;  5IN1 A;  1W1F A;  5LJ3 j;  4QKU A;  1Q81 R;  2A7Y A;  4M77 E;  4PJN A;  2W0Z A;  3SB2 A;  4C92 D;  2CRE A;  5D6Y A;  5KYY A;  4N0A C;  3M0Q A;  4JZ4 A;  3M4G A;  2RJF A;  9ATC B;  1VQP T;  1G3T A;  2EYZ A;  1U5S A;  3V7R A;  2RJE A;  4TVR A;  3I55 Q;  2RQW A;  2DL4 A;  2YXY A;  1GXI E;  5L8R E;  3QUI A;  2Z0W A;  1BKB A;  2QI2 A;  3CPF A;  2HQH A;  3OYY A;  4M7A G;  2L3R A;  4MDW A;  5LJ5 h;  1ABO A;  5A0L A;  2EIF A;  2AKL A;  1UGV A;  2L8D A;  4AFS C;  1OI1 A;  3UT1 A;  4IIO A;  2E12 A;  1VQK T;  3CCQ Q;  3NPF A;  3JCM g;  3JCM W;  1WPY A;  3CC4 Q;  3JCM V;  1TUC A;  1D0Y A;  5CAI A;  3M54 A;  1B34 A;  1VQN Q;  1JXM A;  2DXC A;  2EYQ A;  4JRQ A;  1WXB A;  3CCV A;  2FZC B;  1QCO A;  2RK1 A;  4ZTF A;  3V8L A;  5GAN e;  4N4I A;  1RAC B;  2JM9 A;  4CI0 C;  4V2S A;  3M0T A;  5KCH A;  3HRU A;  3FDR A;  5FWB A;  2RJD A;  1NJI C;  4ZGD B;  2DXT A;  1VQ6 Q;  3RBB B;  2QK0 A;  1LJO A;  3CCQ A;  1M9S A;  1YJN T;  4X9D A;  2K5L A;  1UFF A;  2VYT A;  5CCA A;  1WHJ A;  2HL5 C;  3OW2 P;  2DK3 A;  1N8R U;  3VS4 A;  1TXQ A;  2LX9 A;  2X35 A;  4A53 A;  5GAN 2;  3O5Z A;  2DL8 A;  3SEM A;  1RLQ C;  2HMA A;  1RAD B;  3H0I A;  4MDX A;  4C8Q B;  2OTJ A;  1SPK A;  1S72 A;  4AG1 C;  1OYX A;  3C94 A;  3KFV A;  4ME7 A;  3EFR A;  5GAO n;  2CP0 A;  2EYY A;  3M58 A;  3X20 B;  1BI3 A;  4KGV B;  4OGC A;  5GAN 5;  4BY6 B;  1VQN T;  1M8M A;  3CCJ Q;  5HCK A;  2DD4 A;  2QEX A;  4HCZ A;  1UGR B;  3QPH A;  4PJM A;  4WTO B;  3I5R A;  3JAM E;  3JRZ A;  2RN8 A;  1OZ3 A;  2ZPF B;  5ECA A;  4QQG A;  1LOJ A;  3ULR B;  3I5S A;  1S72 T;  4PL6 A;  2E4H A;  1NYF A;  2EBP A;  1IGU A;  3JB9 H;  5CQY A;  3JCM b;  4M75 E;  4II1 A;  4ELZ C;  1WFW A;  2RHZ A;  3CPW A;  2MI6 A;  2NUP B;  1SSH A;  4J9D A;  3G71 T;  3TEE A;  4EMH A;  3OYM A;  2D0N A;  4J9G A;  1VQL T;  3M56 A;  4L6V 5;  4FYW B;  1VQ4 Q;  1Q81 U;  4JJC A;  4B9X A;  4HVV A;  2RD1 A;  1KD1 C;  2OTJ Q;  2FPE A;  3H9N A;  2E64 A;  1KQS P;  3GF5 A;  1YJW T;  4M77 B;  1K1Z A;  3PVQ A;  1KJW A;  3CXC P;  2ESW A;  4F7U B;  5CK9 A;  1UE9 A;  4P5N A;  3QII A;  4OB2 B;  3HSB A;  1V1C A;  5I11 A;  5LJ5 g;  5CQX A;  2J6F A;  1KHC A;  1VQ7 T;  1KQ2 A;  3S6W A;  1SEM A;  3G4S T;  2OJ2 A;  3A8M B;  3JCM Q;  1TG0 A;  2R5A A;  1LNX A;  5AT1 B;  2YUQ A;  2VAS A;  4IUQ A;  1D3B A;  1UEC A;  3WXM B;  2XD0 A;  3P8H A;  1VIF A;  5GAN d;  1RAI B;  3LX7 A;  1O75 A;  1KQS S;  4M7D F;  1JQQ A;  4C92 G;  5IHK A;  2DJQ A;  3CC2 T;  2DBK A;  3DB3 A;  3OYC A;  4PFP A;  4A4K A;  3CC2 Q;  1YWO A;  3VYG A;  1X43 A;  5C0M A;  3QBY A;  3CCV Q;  2NUT B;  5LL6 S;  2K7A A;  2LNV A;  1K0X A;  1G3Y A;  4ESR A;  3L42 A;  1ZQ1 A;  2V8J A;  4ZN1 A;  1D1C A;  2DTH A;  2Y4X A;  1KC8 U;  2M9U A;  1OU8 A;  1FWZ A;  4ZNX A;  2IVW A;  4K11 A;  4LE9 A;  1XOV A;  3VU3 C;  4PLI A;  1QVF A;  1BYM A;  4M7D C;  2EQJ A;  3VV0 A;  1VQO T;  4IUT A;  1LPL A;  1VQK A;  1G3S A;  1BIB A;  3QJY A;  2J06 A;  2EQI A;  2HBW A;  3A98 A;  1R0B G;  3VS0 A;  1Z9Q A;  1VQ7 A;  1Y07 A;  3MCA B;  2QTV A;  1S72 Q;  4UC4 A;  3A5Z B;  2M0Y A;  3C12 A;  3EGX B;  1Q95 G;  2E3I A;  4JRP A;  2SEM A;  4E7S A;  4EMK C;  1KQ1 A;  2AIR B;  4BB7 A; 
#chains in the Genus database with same CATH homology
 4HVU A;  2GGR A;  2CUD A;  1WX6 A;  2CT3 A;  2L3P A;  3VS7 A;  4LUD A;  3EHQ A;  2KEA A;  2KYB A;  1QKX A;  3EG2 A;  2YUP A;  4OMP A;  3LH5 A;  2RQU A;  4D8D A;  2DRK A;  1LCK A;  4Z89 A;  1OEB A;  1N5Z A;  2GNC A;  2RQT A;  4LUE A;  3VS3 A;  1X6G A;  1J3T A;  1GCP A;  1M3B A;  2DYB A;  1A0N B;  1TUD A;  2B86 A;  1KFZ A;  1PNJ A;  3NMZ C;  1KSW A;  2PNI A;  2KR3 A;  2KRN A;  2DL3 A;  1AWJ A;  2C0O A;  2GBQ A;  1GFC A;  1GRI A;  1GCQ C;  4AFU C;  2EGE A;  4GBQ A;  1AWO A;  2LJ1 A;  2A28 A;  1RLP C;  1M3A A;  1SRM A;  2JMA A;  4RUG A;  3U23 A;  3ZL7 C;  2LJ3 A;  4CC3 A;  2JW4 A;  1WXU A;  1E6G A;  2RQV A;  1PKS A;  2ED0 A;  1BU1 A;  3QWY A;  5GJV B;  5EC7 A;  3QWX X;  1NEG A;  2C0I A;  1WYX A;  1AVZ C;  2M51 A;  1UHC A;  3UAT A;  4J9H A;  2G6F X;  1ZLM A;  4RTV A;  4DEX A;  4J9I A;  2LP5 A;  1M27 C;  2DE0 X;  2LQN A;  3M0S A;  2YUO A;  4RTZ A;  1K4U S;  1UDL A;  2D8J A;  1NLO C;  2BZY A;  2F2X A;  1I1J A;  1T3S A;  2O88 A;  2HCK A;  1ZSG A;  4ORZ A;  4J9F A;  2OI3 A;  1RI9 A;  1T0J A;  2KXD A;  5GJW B;  2FO0 A;  3C0C A;  1ARK A;  1K9A A;  4AFZ C;  2FG0 A;  2DBM A;  5I22 A;  4Y92 A;  2C0T A;  2V1R A;  3I35 A;  2QDL A;  2DL7 A;  1JO8 A;  3NHN A;  1K76 A;  1X69 A;  1UUE A;  2PTK A;  2BTT A;  1Z9Z A;  2CUB A;  1GCQ A;  1AZE A;  1YN8 A;  2AKK A;  2EYX A;  4OMQ A;  2CH4 W;  2W10 A;  2X3X D;  5IHI A;  2LX7 A;  1U06 A;  2MOX A;  1H3H A;  2DA9 A;  2E5K A;  2DLP A;  3UA7 A;  2A36 A;  1PHT A;  1T0H A;  2HSP A;  4KRT A;  2O2O A;  4F16 A;  1X6B A;  1B07 A;  3EHR A;  1UHF A;  2LZ6 B;  4M4Z A;  2AK5 A;  2K3B A;  4JZ3 A;  2LJ0 A;  1W1F A;  2HDA A;  5L23 A;  1GBQ A;  2LQW A;  2K9G A;  2EKH A;  2AZS A;  2DM1 A;  1WA7 A;  2JTE A;  2K6D A;  2V1Q A;  4Z8A A;  2W0Z A;  2FEI A;  2CRE A;  2GTJ A;  3M0Q A;  4JZ4 A;  1W6X A;  4E6R A;  2VWF A;  3TSZ A;  1AZG B;  1QWF A;  1H92 A;  2EYZ A;  1U5S A;  3EG0 A;  4IIM A;  1KIK A;  3CQT A;  1M30 A;  2RQW A;  2BZ8 A;  1NYG A;  2DL4 A;  2EYW A;  2K2M A;  4WCI A;  1SRL A;  2I0N A;  4J9B A;  3H41 A;  3R6N A;  4CC4 B;  3SHW A;  1JXO A;  1NM7 A;  1B3Q A;  1ABO A;  3REB B;  2AKL A;  3RNJ A;  1UGV A;  4AFS C;  1E7O A;  2EW3 A;  3M0R A;  1CKA A;  4Z88 A;  4IIO A;  2KT1 A;  2NUZ A;  3NPF A;  1QWE A;  4QT7 A;  1TUC A;  4R0K A;  1U3O A;  2A08 A;  2YSQ A;  1NEB A;  1AOJ A;  2D8H A;  3VS6 A;  1JXM A;  3M0P A;  2EGA A;  2ROT A;  1WXB A;  2KBT A;  3VS2 A;  2DX1 A;  1HJD A;  2YDL A;  4FSS A;  2A37 A;  2DIL A;  2DVJ A;  2JM9 A;  1WI7 A;  3M0T A;  1JU5 C;  4HXJ A;  4RTU A;  2FRY A;  1GL5 A;  2FRW A;  5FWB A;  1UTI A;  5FW9 A;  4JPB W;  4JJB A;  4CC2 A;  1WLP B;  2O9V A;  4GLM A;  2LMJ A;  3RBB B;  1G83 A;  1VYV A;  4RTW A;  2VKN A;  1UFF A;  1I07 A;  2KNB B;  2YT6 A;  1YNZ A;  3VS4 A;  3O5Z A;  2K79 A;  2DL8 A;  2KRS A;  3SEM A;  1AEY A;  1RLQ C;  1X2Q A;  2O31 A;  1UG1 A;  1Y0M A;  3H0I A;  2L0A A;  2EVR A;  3UA6 A;  2KE9 A;  2KRO A;  3VS1 A;  1SPK A;  2F2W A;  2J05 A;  2CH4 A;  2RNA A;  4AG1 C;  3TVT A;  4LNP A;  3KFV A;  3H0F A;  1VYU A;  1HD3 A;  1QCF A;  2BZX A;  2EYY A;  2L2P A;  2MCN A;  3FJ5 A;  1MUZ A;  1YP5 A;  2H8H A;  2DF6 A;  4LN2 A;  2EPD A;  4RTY A;  1IO6 A;  2ENM A;  1EFN A;  1M8M A;  1AD5 A;  4F14 A;  1ZUK A;  5HCK A;  3PVL A;  4OMN A;  2OAW A;  4RTX A;  2ABL A;  2O9S A;  1OPK A;  4HVW A;  1PWT A;  3NGP A;  4F17 A;  4AFQ C;  3I5R A;  2CT4 A;  2RN8 A;  1ZUU A;  5ECA A;  1M3C A;  1X2K A;  1T3L A;  3I5S A;  3ULR B;  1OOT A;  2VVK A;  1VYT A;  4D8K A;  2ROL A;  3M0U A;  5IXB A;  1NYF A;  1NLP C;  1YCS B;  1OV3 A;  2EBP A;  2JS0 A;  3EG3 A;  4EIK A;  1NG2 A;  1MV0 B;  2GQI A;  4JJD A;  1RUW A;  1WFW A;  1YWP A;  3JV3 A;  2L3Q A;  2DNU A;  2KGT A;  1QKW A;  5IXF A;  1SSH A;  4J9D A;  1H8K A;  1S1N A;  1OPL A;  3H0H A;  3PE0 A;  1SHF A;  2CSQ A;  1GBR A;  1AWW A;  4OML A;  1Y57 A;  2D0N A;  4J9G A;  3IQL A;  3VRY A;  2P4R A;  1UJ0 A;  2JS2 A;  1GFD A;  1K0S A;  4JJC A;  2FPD A;  4HVV A;  2KT8 A;  2JT4 A;  2FPE A;  2DL5 A;  3VRZ A;  1PRM C;  1FMK A;  1I0C A;  4OMM A;  1CKB A;  2EGC A;  5IHN A;  4CC7 A;  1K1Z A;  1WIE A;  1KJW A;  3PVQ A;  2ESW A;  1QLY A;  1JEG A;  1UE9 A;  3EG1 A;  1V1C A;  5I11 A;  2J6F A;  1G2B A;  2PZ1 A;  2MIO A;  2J6K A;  1SHG A;  1SEM A;  1BBZ A;  1ZBJ A;  2ED1 A;  2OJ2 A;  1HSQ A;  2J7I A;  1TG0 A;  2JM8 A;  2YUQ A;  1UEC A;  2JXB A;  5IH2 A;  1FYN A;  2XMF A;  3TSW A;  2DRM A;  1VA7 A;  1JQQ A;  5IHK A;  5FWC A;  3EGU A;  1ZX6 A;  2YUN A;  2DJQ A;  2DBK A;  2NWM A;  1MV3 A;  2FPF A;  2DMO A;  3I9Q A;  1BK2 A;  2HEQ A;  4OMO A;  1YWO A;  2CDT A;  2RMO A;  2SRC A;  1X43 A;  3VS5 A;  2K7A A;  1K0X A;  2GTO A;  2X3W D;  4ESR A;  1ZUY A;  4DEY A;  1E6H A;  1PRL C;  4A63 B;  4J9E A;  1PKT A;  2ECZ A;  2LCS A;  1W70 A;  4ZNX A;  4K11 A;  1UJY A;  2RQR A;  4HCK A;  4LE9 A;  4RTT A;  4X1V A;  3REA B;  1XOV A;  1AWX A;  2RF0 A;  2J6O A;  3GBQ A;  2AZV A;  2KRM A;  1X27 A;  2L3S A;  1CSK A;  2D1X A;  1ABQ A;  2RPN A;  2IIM A;  2J06 A;  2EQI A;  2HBW A;  4J9C A;  3A98 A;  2F2V A;  3VS0 A;  1Z9Q A;  1BB9 A;  2CSI A;  3UF4 A;  1WXT A;  2LNH B;  3THK A;  2KYM A;  2M0Y A;  2JMC A;  1WDX A;  2SEM A;  4AG2 C;  2KXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...