1WFWA

Solution structure of sh3 domain of mouse kalirin-9a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kalirin-9a
publication title Solution structure of SH3 domain of mouse Kalirin-9a protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 6
structure length 74
sequence length 74
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wfwA00
5L23A 3ULRB 1B3QA 4DEXA 1OOTA 2RQUA 3VS2A 1GCPA 2DLPA 3M0QA 3EG0A 3EG3A 1UJYA 2RNAA 2OJ2A 1S1NA 3EHQA 3VS4A 4GBQA 3PE0A 2FRYA 2KT8A 1JEGA 2DYBA 2OI3A 3I9QA 4X1VA 2DL5A 1UHCA 4IIOA 2AKLA 3NPFA 3GBQA 4DEYA 5I11A 4RTXA 1GRIA 2JS0A 2M0YA 1G2BA 1LCKA 2DM1A 3NMZC 3PVQA 1H3HA 2O31A 1K9AA 2CSIA 2GQIA 2FO0A 1PWTA 5FWCA 1I1JA 2D1XA 3EHRA 3NGPA 4Z88A 2ED1A 2EYZA 2QDLA 3U23A 1UUEA 1AWWA 1QCFA 2ENMA 2OAWA 4LN2A 2F2VA 4HVVA 2C0IA 4D8DA 1WXBA 2F2XA 2YUQA 2EGEA 1V1CA 1GFDA 1HD3A 2YSQA 4CC2A 4IIMA 2W0ZA 2LJ3A 4J9CA 4OMMA 4K11A 1YWPA 1MV3A 2KE9A 1SPKA 1FMKA 1WXTA 1J3TA 2JTEA 2RPNA 5GJWB 2EKHA 1AD5A 2K9GA 3LH5A 4RTTA 4RTZA 5EC7A 2F2WA 2MCNA 2DBMA 3QWXX 1Z9ZA 4Z89A 3VRZA 1Y0MA 1QKWA 2A08A 1T0JA 1NLPC 4JZ4A 1H92A 1XOVA 5IXFA 1U06A 3ZL7C 1A0NB 1GL5A 4AFSC 1AZEA 3UF4A 1AVZC 2FG0A 1T3LA 3M0RA 2MIOA 2H8HA 1SRLA 4JJDA 2CH4W 1JXMA 4CC4B 4RTWA 2GTJA 3R6NA 1K0SA 2CT3A 1CSKA 2GBQA 1KSWA 2PNIA 2KXCA 5FW9A 3VS6A 2M51A 2ED0A 1SHFA 1E6GA 1UDLA 1ZUUA 2KGTA 4R0KA 2KYMA 4WCIA 2BTTA 4ZNXA 3FJ5A 1UECA 2NWMA 1W70A 4KRTA 3I35A 2EYYA 2C0OA 3CQTA 1K76A 1U5SA 1UGVA 5I22A 2LJ1A 2VWFA 2KRSA 2IIMA 1W1FA 1YNZA 2LZ6B 1BU1A 2BZXA 2G6FX 2BZ8A 1VA7A 1N5ZA 2DMOA 4HVWA 1WX6A 1ABQA 2EGAA 1ZLMA 4HXJA 2L3QA 1GFCA 1Y57A 4AFUC 1B07A 1M3CA 4JJBA 1MV0B 4E6RA 2FPEA 1BB9A 3EGUA 1ZUKA 2A36A 2W10A 1QWFA 2KEAA 1WLPB 2KRNA 4J9IA 1WA7A 3H0IA 1AWXA 1E6HA 1SSHA 2ABLA 2V1RA 2X3WD 5IHNA 2E5KA 2EVRA 1NLOC 4OMQA 2CH4A 2RQWA 1NEGA 1ZBJA 2DL7A 2DX1A 4RTYA 1CKBA 2L0AA 2NUZA 2YUNA 3H41A 3UA6A 2FPFA 1FYNA 4ORZA 2AZVA 1TUDA 1SEMA 4OMOA 1M30A 3M0SA 1PKSA 2SEMA 2CREA 3M0PA 2CDTA 2KXDA 2D8JA 2I0NA 2KNBB 2J7IA 4OMPA 1X2KA 1GCQC 2EYXA 2K3BA 1X69A 2DBKA 4HVUA 2MOXA 1PHTA 3REAB 4J9EA 1GBRA 1WFWA 4M4ZA 4RTUA 2DE0X 4ESRA 2HCKA 1PRMC 3UA7A 2ECZA 1ZSGA 3I5RA 1ABOA 2K7AA 2DL8A 1G83A 2BZYA 1TG0A 2PTKA 4CC3A 4EIKA 2JXBA 2GNCA 3M0UA 1JO8A 4F17A 1WXUA 3O5ZA 2DA9A 2O2OA 1E7OA 2J6KA 3RNJA 1YCSB 3EG2A 2EGCA 4JJCA 1NG2A 2CUDA 2LX7A 3SEMA 1QLYA 4J9HA 1VYTA 1NYGA 3M0TA 2O9SA 1WIEA 1JQQA 1KJWA 2EYWA 4JZ3A 4J9DA 3VS1A 4CC7A 4Z8AA 2RQRA 2XMFA 2EBPA 1Z9QA 1SHGA 4AFQC 2LQWA 1AEYA 1X6BA 2CT4A 1K0XA 4LE9A 3PVLA 2KT1A 2DILA 3H0HA 2HEQA 5IXBA 2HSPA 2VKNA 1YN8A 2HBWA 4FSSA 1AZGB 4D8KA 1PNJA 1WI7A 2GTOA 2RQTA 3VS3A 4F14A 2DVJA 4LUDA 5ECAA 3JV3A 2B86A 2JM8A 2LCSA 2O88A 3RBBB 3C0CA 4Y92A 1VYUA 4JPBW 2JM9A 2D0NA 1T3SA 2DRKA 2DJQA 2ESWA 1RLPC 2J6FA 1PKTA 3TSZA 2KBTA 2JS2A 2D8HA 2RF0A 2K6DA 2A28A 1YP5A 2C0TA 1IO6A 1X6GA 1W6XA 2JMCA 1ZX6A 2DL3A 2LNHB 1UG1A 2A37A 4AFZC 1NEBA 2KYBA 4AG2C 2V1QA 2J6OA 2L3SA 1NM7A 5HCKA 4GLMA 2L2PA 1K4US 2VVKA 2K2MA 1X27A 1ZUYA 2GGRA 1M3AA 1AWOA 1UHFA 1RLQC 2LJ0A 1ARKA 3I5SA 3VS5A 3VS7A 1M8MA 1WYXA 3TVTA 1UTIA 2JT4A 2ROTA 2YUPA 2LP5A 1GCQA 2KR3A 3VS0A 2CSQA 2RQVA 4HCKA 4F16A 1BBZA 3VRYA 1I07A 1K1ZA 3H0FA 3IQLA 1H8KA 1X2QA 2O9VA 2EQIA 3KFVA 4LNPA 2DNUA 1UFFA 1WDXA 2X3XD 4A63B 2FPDA 1OV3A 2L3PA 4J9BA 1KIKA 1EFNA 3THKA 1VYVA 2AZSA 2CUBA 1UJ0A 4OMNA 2JW4A 1PRLC 4RUGA 2LQNA 2YT6A 1MUZA 2AK5A 1NYFA 2FRWA 2DL4A 3TSWA 1M3BA 1GBQA 1TUCA 5FWBA 1YWOA 1BK2A 4RTVA 2JMAA 2ROLA 1OPLA 2DF6A 2J06A 2YDLA 4OMLA 3SHWA 2FEIA 4J9GA 1I0CA 3QWYA 2HDAA 1X43A 1AOJA 1OPKA 2P4RA 2EPDA 5IHKA 1HJDA 2RN8A 5IHIA 2K79A 2AKKA 3REBB 1SRMA 2PZ1A 3EG1A 1M27C 1RI9A 2KROA 2SRCA 1RUWA 1T0HA 2J05A 1JXOA 1CKAA 1UE9A 3NHNA 2DRMA 2KRMA 4J9FA 1QWEA 1QKXA 1HSQA 4LUEA 1AWJA 5IH2A 3A98A 3UATA 2RMOA 2EW3A 1OEBA 4QT7A 2LMJA 1KFZA 1JU5C 2YUOA 1U3OA 5GJVB 4AG1C
chains in the Genus database with same CATH superfamily
2BKDN 2RQUA 3TU4K 4ZTJA 2DLPA 3EG3A 5KYUA 2AIRB 1GXIE 1S1NA 4L6V5 2I2LA 1VQ6A 1NJIR 2CZ1B 4KUIA 4EMKC 3CCMA 2OI3A 5KYNA 1G3YA 4C0DB 2DL5A 1UHCA 4BI3A 4VUBA 4DEYA 5I11A 2JS0A 1KQSP 3LW5E 1G2BA 1K8AR 1LCKA 1ZBXA 1H3HA 2GQIA 3CPWP 2D1XA 1W2BS 1VQ7A 2OTJQ 3CD6T 2DD4A 1YITA 4A4KA 1TH7A 4FT4A 2EYZA 3CC2Q 2QDLA 4C8QD 2WSFE 2ENMA 1SKUB 2DFUA 1S72Q 2OAWA 3MCAB 2C0IA 4D8DA 4IUPA 3S3NA 2EGEA 3CMEQ 3EFOB 1XQHA 1TS9A 4J5YA 2W0ZA 4J9CA 4OMMA 1MV3A 1SPKA 1WXTA 5LJ5g 2QEXQ 5KCOA 2RPNA 1QCNA 2EKHA 1LPLA 4RTTA 3HRSA 2VB6A 4RTZA 4ZN1A 3OYJA 3LWIA 1YI2T 5C0MA 3OYCA 4XTXA 2GF7A 2LDMA 3SDZA 4Z89A 3VRZA 3OYNA 1HXDA 3FLGA 2ZPGB 5EG2A 4MDWA 3GOXA 1A0NB 1AZEA 3UF4A 1EIFA 1AVZC 2FG0A 5GANj 2MIOA 1PD1A 4ANJA 3E2UA 5AYFA 1N9SA 1ZSZA 2EQMA 3RMSA 3OS1A 4CC4B 3DLMA 2EJGA 5GMKj 2JVVA 1KD1C 4M75G 5FLXE 3JCMQ 4PJOF 2CT3A 4C8QA 4PJOE 3A8HB 2PNIA 5LJ3h 1YJ9T 2M51A 4BE1A 2CGHA 3OBWA 1DJ7B 5HY6A 2M9UA 4QQDA 4BD3A 1TSFA 3EH2A 4XU0A 3J81E 3FJ5A 1M1FA 5LJ3d 1W70A 3A8LB 1YJNQ 3OYDA 2MYSA 2LRQA 5A2QE 3J80E 4JRPA 3D7SB 4E7HA 3CD6A 4JRQA 2LCLA 3CQTA 2LTOA 1K76A 1U5SA 5I22A 2VWFA 1W1FA 1D1BA 3X20B 5KYUB 3QBYA 1N9RA 5GAN7 4BI4A 2BZXA 2G6FX 1WX6A 2YLCA 2DYIA 4HXJA 1W2BA 4AFUC 1OZ2A 3BE3A 3MJXA 1VQ9Q 4E6RA 5CKBA 5GAMe 3I55T 3QYHB 3JRZA 2DXBA 2ZAEA 4LXCA 3TREA 1P92A 2KRNA 3LLRA 3H0IA 2Y4XA 1AWXA 2E5KA 1IHVA 1IHWA 1YI2A 4M7DF 4M7DE 1NEGA 1VQ8Q 2F1LA 2L0AA 2NUZA 1NPPA 4NS5A 3UA6A 4KT0E 3OYHA 3OQ5A 1VQPQ 2CDTA 1KD1R 1N6AA 3EGDA 2XDPA 1M90U 2OTLT 4O5VA 3WVDB 5LJ5f 1X69A 2DBKA 2HL3A 4M7AD 4KULA 3HRTA 3REAB 1IZ6A 3JB9D 1YJ9A 1PRMC 2C06A 5CKDA 4JLGA 4PJMA 3CBOA 2DVEA 3S3OA 3OY9A 3H8ZA 4F17A 2DERA 2RHXA 1G3WA 1E7OA 3CCLT 1H641 1U8RA 2HMAA 4FW1A 3RNJA 3M55A 3X26B 2EGCA 8AT1B 3M0TA 1ZSZB 4CRIA 2XD0A 1WIEA 2CZ0B 4EMHA 4CC7A 4R55A 2RJEA 2QQ9A 2XMFA 4C8QB 3V8KA 1K0XA 2CT4A 2RHIA 3I55A 5IXBA 1K73U 4BY6C 3CEYA 4Y91A 2HBWA 2AT1B 1K9MU 4D8KA 2BE9B 4B9WA 1RI0A 4F14A 3N5BB 1Q86C 4LUDA 5ECAA 3JV3A 2JM8A 4OB3B 2FZCB 2D0NA 1T3SA 1M1GA 4M78A 2DJQA 3HL8A 2J6FA 4QVCA 4FYXB 2KBTA 3M4YA 2PQWA 3CXCS 2C0TA 2OTLA 3OYGA 4F7UB 4PFPA 4EMGA 2V8JA 4ZGJB 1Q7YU 1ZA2B 2LNHB 2VV5A 1UG1A 2KYBA 2KI7A 5M9OA 4UC4A 1BI1A 3DLLA 2L3SA 5HCKA 4B6MA 1K4US 2JTFA 1PSFA 1PC0A 3TQ7P 2GGRA 5GAMh 1M3AA 5D6XA 4C92A 3HKSA 2LJ0A 4MZMA 3NTHA 2JT4A 5GANe 3CCLA 2YUPA 2LP5A 3S3MA 2P0KA 2X51A 1VQMQ 5GAOn 2CSQA 5GAMd 5GMKe 2QA4Q 4M77A 3JCMX 4LDYA 4HCKA 1YHQQ 2M1HA 4PJJA 4PFZA 1X2QA 2O9VA 4XU2A 3JCMf 3CCRA 1Y96A 1BI2A 2DTHA 4A63B 1Q86R 1OQKA 1YJWT 4B9XA 2P0PA 1QQJA 3PNWC 2RJFA 2F5TX 2L3RA 3M4GA 4DBRA 4F7UF 4F7UE 2CUBA 2NUTB 4FYVB 4DQ2A 3VUBA 1RAAB 4IKFA 2FRWA 2HSEB 2KK4A 3FDRA 4RCCA 1YWOA 3OW2S 1YFNA 2QAZA 4RTVA 2JMAA 3RERA 2DF6A 2YDLA 4OMLA 4XAXB 2FEIA 3QWYA 1TWBA 5AT1B 1EZZB 3EG9B 3NTIA 1HJDA 2RN8A 5IHIA 2K57A 3CCJT 5FU7C 2RB6A 2K79A 4BDZA 1QVFS 1UGPB 2E6ZA 3M57A 2AKKA 2GFAA 2MAMA 4X9DA 3REBB 2CZ6B 1M27C 4M7AB 4PJOD 2X4XA 3CXCA 1T0HA 1JXOA 1CKAA 2EYQA 1TU0B 3ZFJA 5GMKm 4RG2A 3ZEHA 2KRMA 1QKXA 1HSQA 1AWJA 3L1AA 2RMOA 3SB2A 4QT7A 2LMJA 1JU5C 5GJVB 3BDLA 4RMOA 4DEXA 3PGGA 1GCPA 3META 3OYAA 3QKJA 3L2VA 3PE0A 3L2UA 1JEGA 4M78C 3SWNB 2FB7A 2K4YA 5C6SA 3I9QA 4E47A 4X1VA 3VYGA 3CC7T 4IIOA 5KCHA 5D7UA 2AKLA 3NPFA 1YJWA 1GRIA 2H3EB 1BIAA 3T9NA 3NMZC 3PVQA 4QQ6A 1JBMA 1TOVA 4J6WA 2FO0A 4PJOA 3EHRA 4BE0A 4HCBA 1M8VA 2DIQA 4M7DD 4M7AF 3QZ5B 2PUKB 3MEWA 4XU3A 2ZPHB 2YRDA 5LJ5j 2ZGWA 3A8GB 1NPRA 2M02A 3JB9F 4C92C 4E7KA 2Y90A 3OMGA 1FMWA 3EFOA 5GANh 1WXBA 2F2XA 1V1CA 1HD3A 2YSQA 3CCJA 5GMKh 3FRNA 2A0FB 3CMAQ 3CC4T 1YWPA 3OW2A 2DEQA 2KE9A 4M77C 1UGQB 1OX8A 2JZ2A 5GANd 1AD5A 3ZBDA 4ME7A 2MCNA 2V26A 3QWXX 1Z9ZA 4M78G 1QVFA 1Y0MA 1QKWA 4LDVA 1XOVA 2F5KA 2RHZA 2X4WA 4II1A 2NYSA 4FM4B 1G3TA 4JUVA 4JJDA 2CH4W 2R5MA 3QYGB 4M7DA 4V2SA 4OB1B 2K3YA 1CSKA 1KSWA 4A4FA 1V29B 3VJPA 3NTKA 2ED0A 2K5LA 3CC7A 1SHFA 3E1SA 1E6GA 1ZA1B 4C92G 1UDLA 1VQ9T 4KH0B 4R0KA 2KYMA 3FEOA 3I56T 1UB4A 5FRMA 3LGLA 1X01A 3QUIA 4OGEA 4E7IA 2BTTA 4ZNXA 1WHHA 2P0QA 2JUFA 1UECA 4M77G 1X75C 3JCMP 2HAXA 1YNZA 1N27A 3MP6A 4PNOA 2HKQB 4A54A 3PIPA 5LL6S 1EX4A 3QPHA 3M56A 2EGAA 2LQ8A 1VQPT 2G3RA 4DBFA 1YIJQ 1MV0B 3CC4A 2FPEA 1BB9A 2A36A 1LVKA 1M2VA 2AHJB 4E7ZA 4OGCA 1SSHA 2ABLA 1D1AA 2X3WD 1M9SA 2CP5A 4JRIA 1QVGP 2ZPBB 1NLOC 2CH4A 2EQUA 5LJ3f 2QK0A 3OA6A 4PJOB 1ZBJA 2E1HA 2DL7A 4C0DC 2XDDA 5KH6A 2HQEA 2AZVA 1TUDA 5KYWB 3G6EQ 4OMOA 3QJYA 4FCYA 3O8VA 3CCST 1N8RC 2SEMA 2CREA 1V76A 2DKGA 3M0PA 2KXDA 4JJNK 2CKKA 4PKCC 5D6WA 4X34A 2J7IA 4OMPA 1X2KA 1GCQC 1VQOT 1Q82U 2K3BA 4IURA 4C0FA 1PHTA 4EDUA 3P8HA 1BIBA 5GMKi 1Y7XA 2XDBA 2WACA 3JB9J 2YWWA 1ZSGA 2QTXA 3L2ZA 4C0ZA 1VQ9A 1VQ5T 3I56A 1OZ3A 1ABOA 3INZA 4J7IA 2JNGA 1G83A 2BZYA 1XJWB 2VYTA 1TXQA 3R6OA 1HK9A 3M0UA 1JO8A 2D6FA 1VQLQ 3O5ZA 4KGVB 1ACMB 3RKXA 5FRNA 4D6WA 1YCSB 4JJCA 2LX7A 4J83A 4J9HA 1VYTA 4M75F 1RAEB 4M75E 3ER0A 3URGA 4JZ3A 1KJWA 2EYWA 2IVWA 3C12A 4J9DA 3VS1A 4M7DB 1VQ6Q 2BE7D 2EBPA 1Z9QA 4AFQC 1VQPA 3CCMQ 2V8IA 2VASA 3CBPA 4LE9A 3JSCA 1WHJA 1YN8A 3CCQT 5HK3A 2QDYB 4ATOA 2X9HA 4FSSA 1PNJA 1WI7A 4N4GA 3VS3A 3DB4A 3G71Q 4L59A 4M7DC 5GAOm 3EGXB 2B86A 1M2OA 1VQ7Q 1YCYA 5LJ5e 2MPXC 4Y92A 1WNLA 1YITQ 2JM9A 1N8RR 4AMCA 2VGMA 1VIEA 4C5IA 4OP0A 3CCSA 4P5NA 2RF0A 5A0DA 3RDVA 3M53A 4F7UA 5CIUA 4L5GA 3OSVA 1X6GA 1VQOA 1VQMT 1ZX6A 2L8DA 1VQ4T 2A37A 5GAN4 4AFZC 1NEBA 2RM4A 1M2VB 3J7AF 4A4EA 4RKUE 2CZ7B 3LWHA 2V1QA 4QQGA 4PJNA 2L2PA 5FU6B 1IB8A 2VVKA 3QZ9B 4N0AA 1VQ5A 1X27A 3E9GA 1ARKA 3VS5A 1M8MA 3RKYA 2P84A 3TVTA 3A5ZB 1XNIA 4LD6A 4OF1A 3VS0A 2LCCA 2VXEA 1RADB 5KYXB 3PT9A 1NBEB 3PMIA 4CI0C 4F16A 1FXXA 2LX9A 1H8KA 1IRXA 2QYZA 3KFVA 1I8FA 1JRIA 4LNPA 3JCMg 1MMNA 2QGFB 1WDXA 3SFMA 2XI9A 4C5EA 3CCQA 2L3PA 3L2WA 4J9BA 1EFNA 3F70A 3THKA 4OB2B 2NUTA 2AZSA 2R58A 4RG8A 3EFRA 2JW4A 4RUGA 3CD6Q 3QDRB 2AK5A 4A4GA 4DOWA 1M3BA 5GAMf 1UGRB 2ROLA 3RR6A 2PVDB 3CPFA 4XTZA 3V7SA 3CCRT 1I0CA 3EG9A 3JAME 2Z0WA 1M90C 1AOJA 1VQMA 1MMDA 5IHKA 4LDUA 1VQ4A 4TVRA 1ZSZC 4M7AA 3FC3A 5IT9E 3UWNA 4E2FB 3LYIA 2SRCA 4AT1B 2IG0A 4C8QC 4FYWB 1PSEA 2QQSA 3VKIA 2J05A 1YI2Q 2VC8A 3CCUT 5A0LA 3NHNA 4C5HA 2D0QB 1VQKT 4J9FA 1QP3A 3RMQA 4GY5A 4BE2A 2OX7A 1OEBA 3HFOA 2FZKB 2COWA 3V8JA 3RESA 5L23A 3ULRB 1B3QA 1ZQ1A 1RABB 3M0QA 1UJYA 1OU9A 1VOMA 1I5LA 2RNAA 2OJ2A 2XHCA 3VS4A 4KH1B 1X6OA 3SWNA 2PVOB 4GBQA 2FRYA 2DYBA 5KYYA 1YJ9Q 4E7JA 1AHJB 1D0ZA 4FL6A 4ELZC 3MEUA 4GLKA 2K2VA 5LJ5d 1K73C 4A53A 1K9MC 3OS2A 2KY9A 2M0YA 1C1AA 2DM1A 2OAUA 2O31A 1PWTA 5FWCA 1I1JA 3NGPA 4XU1A 3U23A 1AWWA 4N0AC 4N4HA 4C8QG 3LX7A 1M90R 3KXTA 4LN2A 2F2VA 4HVVA 3V7RA 2YRVA 1GFDA 3L2QA 5GAOp 3I55Q 3H6ZA 4CC2A 4K11A 1Q7YC 4J6YA 1FMKA 3M9QA 4ZGEB 1J3TA 1IXDA 3JB9I 1G3SA 5GJWB 2DAQA 3ME9A 3CCEQ 3LH5A 5EC7A 4IUVA 3CCUA 2F2WA 1IGQA 1VQKA 2DBMA 1WPYA 2A08A 1U1SA 2ZPIB 3EH1A 1NLPC 1H92A 5IXFA 1U06A 3ZL7C 3MEAA 1Y71A 4F7UG 2PVGB 1VUBA 2HD0A 1T3LA 3X28B 4HT9A 2OTLQ 3PIOA 1KG1A 1JXMA 2M16A 1JJ2P 1OULA 1RAIB 3DKMA 4M75D 1K0SA 1IREB 3JCMJ 2E3HA 1K73R 4FYYB 2X4YA 2LQKA 3CXCP 2GBQA 2KXCA 5FW9A 1K9MR 5GANf 4PK4A 1KC8U 2HQHA 2KGTA 5GAOr 2E4HA 2WSEE 1U1TA 2F69A 3ASKA 1G5VA 2NWMA 4M7AC 1MMGA 4MZPA 2EYYA 2DO3A 4C0GA 2C0OA 2OTJT 1PM3A 4MMKA 3SD4A 2RI3A 1UGVA 2LJ1A 4KUDK 3CC2T 5L8RE 1QVPA 2EKOA 2LZ6B 5CKFA 3JCMb 2LNVA 1S72T 1BU1A 3G6ET 3AHUA 2BZ8A 1VA7A 1N5ZA 1Q7YR 3QO3A 1ZLMA 4JDSA 2L3QA 1Y57A 2LT4A 1M3CA 5KYYB 4JJBA 3CMET 5CAIA 3C94A 2QQRA 3M5AA 1NJIU 1ZUKA 2W10A 2KEAA 3QHSA 5CK9A 4J9IA 2QEXT 1WA7A 4M75A 2D9TA 3TCJA 3P8DA 4E7LA 5GAN2 3SWNC 2MF2A 5J39A 3A8OB 1KC8C 2RHYA 2DX1A 5HK0A 5LJ3g 1K8AU 1KHCA 2YUNA 5I2MA 5KYWA 3GLXA 2FPFA 1WJRA 2RA2A 4F04B 4JS4A 1TUGB 2K5IA 1M30A 4Z02A 1WHKA 1PKSA 1OU8A 2KNBB 2RI2A 4O6JA 3JCMV 2EYXA 2XU8A 2JOYA 4M7AG 1GBRA 5J3BA 4M4ZA 4ESRA 2QXFA 2VUBA 2HCKA 1KQSS 2QTVA 3JB9G 3OYKA 1BCOA 3UA7A 3I5RA 1QVGS 3CPWS 1UGSB 1QVFP 2K7AA 3KUFA 2DL8A 2ZCFB 1VQNQ 5GAN5 4CC3A 4EIKA 2JXBA 2GNCA 3G71T 3JCMW 2DA9A 3G4SQ 1FWZA 2O2OA 3JB9H 1YJNT 2CYZB 2J6KA 2OTJA 2O01E 4WTOB 3LGFA 3SEMA 3HTRA 1QLYA 3WVEB 3CC2A 1NYGA 3PMTA 4DOVA 2O9SA 2O4XB 4NOYA 3M58A 1S72A 1ZHIA 1XTDA 3G6EA 3QJ6A 1R8OB 4Z8AA 3WXMB 2RQRA 3MHXA 2DPPB 1C0MA 5DLOA 1X6BA 3CMEA 3AT1B 4C92E 3PVLA 2KT1A 2DILA 2QEXA 3EGXA 2GTOA 5A0GA 1UEBA 1Q81U 2DVJA 2LCSA 1SF9A 2DZ9A 2L89A 1VQ8T 1VYUA 5GAOq 3H9NA 1IGUA 3LH0A 2DRKA 2RK1A 2RO0A 2ESWA 1PKTA 4XTYA 1SG5A 1B34B 4PFOA 2A28A 4LDWA 2E10A 1QMCA 1OI1A 5CR2A 2FVUA 1IO6A 3CCJQ 2JMCA 1R0BG 4NL2A 1LNXA 2H3JA 3CCVQ 4M75B 2COZA 4PLIA 1NM7A 4GLMA 2K2MA 3VV0A 2EWNA 1RLQC 3I5SA 5CCAA 2DTOA 2L5QA 3GPLA 2QG9B 3GNGA 3G71A 1KQSA 1UTIA 1Q81C 4YTLA 3HHTB 3BDUA 1YJNA 1M1KU 2KVQG 2HL5C 5KYXA 5FROA 4M75C 1QVGA 3CPWA 2E5QA 4PJOC 2FHDA 3TEEA 2QQAA 1MNDA 1BYMA 1BBZA 2JN0A 1I07A 3H0FA 1KD1U 2DJZA 3IQLA 5GMKl 1H3ZA 1D3BB 2X3XD 3CC7Q 2FPDA 1OV3A 1WJQA 4OVAA 2KDSA 2QGGA 5GAN8 2GFUA 1VYVA 5J26A 1M4ZA 1B7TA 2EQJA 2X4JA 4BI8B 4OMNA 3HRUA 1PRLC 2LQNA 1VQ8A 1MUZA 4OB0B 1NYFA 2MWOA 4HCCA 2NUPA 1JB0E 3TSWA 5FWBA 2MI6A 4JS5A 5GAMg 2PUOB 3OB9A 4JLIA 1OPLA 1PD0A 2J06A 1M1KC 5KE3A 3SHWA 4J9GA 4HT8A 1OPKA 5IAYA 2P4RA 3BFMA 1Q82C 3CC4Q 1FMVA 4DBHA 3BW1A 1M5Q1 1WQWA 4Q5WA 1SRMA 4PL6A 3OS0A 2PZ1A 3EG1A 1RI9A 4PJOG 3X25B 4A4HA 1RUWA 1WHGA 1UE9A 1Q81R 2DRMA 1RAHB 1QWEA 5CQYA 2E70A 4LUEA 3UATA 2KMTA 1MMAA 5CO7A 1W2BP 2YUOA 1U3OA 2R57A 1G8XA 2KAFA 1OOTA 3VS2A 3OYEA 2QA4T 2E65A 2RD1A 3VYHB 2E3IA 1KK7A 3C95A 3EG0A 2EAYA 3QSUA 4Y28E 3EHQA 1I4K1 1YHQT 3L2RA 2ZZDA 2EQKA 5CVIA 2KT8A 3G1JA 4XTWA 2XIDA 3G7ZA 1PCXA 3E9FA 1QW1A 2EJFA 1C6VX 2E64A 3GBQA 3I56Q 4RTXA 2DXUA 3GF5A 3QDFA 1WZOA 5D6YA 1K9AA 2CSIA 4J6XA 3CCET 2CP6A 2E41A 3C4SA 5FU6C 1WQ7A 4M7DG 4ZN3A 2E12A 2ED1A 4Z88A 1M1KR 1UUEA 1QCFA 2CP0A 1Q82R 2HKNA 1RAFB 1OYXA 2YUQA 4KGZB 4IIMA 4J8OA 4DBQA 2LJ3A 2YLBA 3E19A 2JTEA 4OMFB 1Q86U 2K9GA 1KQ2A 3P8BB 2P4TA 4M78D 2NUPB 1T0JA 4JZ4A 2CS7A 2RHUA 3CCSQ 1GL5A 2RI5A 4AFSC 3M0RA 2VGNA 2H8HA 2DZCA 1SRLA 4FW2A 2EIFA 2QA4A 4BY6B 1VQOQ 3OSSC 1BCMA 3A1PA 4XTVA 3PFSA 4MDXA 4E7SA 2DETA 4RTWA 1YHQA 2GTJA 3R6NA 2RJDA 3MP1A 1MNEA 3VS6A 4FT2A 2LC4A 5GAN3 3V7CA 5GANg 4PJLA 1VQ5Q 4C92D 1ZUUA 2CP2A 1RACB 4IUUA 1W4SA 2KSSA 4WCIA 2V8KA 3JCMe 4HA8A 1HYOA 1D0YA 3CCEA 4KRTA 3I35A 4M77D 2YXYA 5LJ5h 3GNFB 3UDCA 2KRSA 2DXCA 2IIMA 1JJ2S 2JJ9A 3JCMc 2XICA 4HVWA 2DMOA 1ABQA 3OYIA 1GFCA 1B07A 5LJ3j 1NZ9A 2B8AA 4ZGDB 2K5FA 3CCQQ 3EGUA 3CMAT 5DM7R 4BDYA 3OYLA 1QWFA 2WSCE 3RUXA 1WLPB 4QVZA 3GIBA 1E6HA 2V1RA 5IHNA 5DY9A 3RIRA 2XG8D 4OMQA 1OX9A 2EVRA 2A7YA 1BI0A 2FYKA 2RQWA 7AT1B 4IUQA 2A3LA 2HNIA 3L42A 4ZTFA 1MHNA 1CKBA 4J7FA 4RTYA 1WHMA 4C8QE 4C8QF 3M59A 3H41A 1O75A 1FYNA 1VQNT 4ORZA 4XTUA 4DA4A 1SEMA 4KBMB 3M0SA 3MPUB 2D8JA 2NLUA 2I0NA 3G4ST 3GP8A 1TTHB 3EAEA 5GAOl 4EPCA 3EGDB 1VQ4Q 2LT1A 4HVUA 4XK8E 2MOXA 1WGSA 3Q1JA 4J9EA 1WFWA 4RTUA 2DE0X 2LVMA 4PLLA 3NFCA 2CP7A 4ELYC 2ATCB 2ECZA 5CKHA 1NE8A 3V8LA 4BACA 3S6WA 2RK2A 1TG0A 2PTKA 2PU9B 4X9CA 3MKDA 3M54A 1WXUA 3OYMA 1YBYA 2X35A 1MGQA 3EG2A 5FU7B 1NG2A 4N4IA 2CUDA 3OYBA 2O4XA 1VIFA 3QIIA 3X24B 1JQQA 2CP3A 2HZYA 2BUDA 2K3XA 1SHGA 3HP9A 2LQWA 1AEYA 4C5GA 5CKEA 2GCXA 1YIJT 3VU3C 3H0HA 2HEQA 3CMAA 2HSPA 2IPOB 2VKNA 2E6NA 3CBMA 2HQXA 3OMCA 1JJ2A 1AZGB 2QASA 4HCZA 2RQTA 2MK5A 5HKCA 2DTIA 4LDXA 1D1CA 1BI3A 3CCLQ 3CCVT 1QCOA 2O88A 2R5AA 2XKOC 2Y4YA 1Q95G 3DB3A 3OBYA 3RBBB 2ZPFB 1RL2A 2DD5A 3C0CA 4JPBW 2RH2A 4BUGA 2KQWA 2MMPA 5CQXA 1VQNA 1B34A 4EMKA 1RLPC 3TSZA 3JCMh 2JS2A 4M78B 3HSBA 2D8HA 1I5OB 4WF2A 1R0CB 2DK3A 3CCRQ 3G4SA 2K6DA 3MEVA 2QQBA 1YP5A 3QG1A 2BIVA 2COYA 1W6XA 2FL7A 1PG5B 2DL3A 1O9SA 4QVDA 3JCMd 4AG2C 1SSFA 2J6OA 1Y07A 1D0XA 4MZTA 4BB7A 2QI2A 3CCUQ 3BY7A 1ZUYA 8ATCB 1VQKQ 1AWOA 1UHFA 4FIBA 3VS7A 1WYXA 1D09B 4C92B 5I21A 2DIGA 1VQLT 2ROTA 3MO8A 3KBGA 3MP8A 4LD9K 1GCQA 2VXFA 2KR3A 1FX7A 5IN1A 4IUTA 3UPUA 1KQ1A 3OW2P 2RQVA 1KHIA 1R77A 1LOJA 4M7AE 2GQVA 2RJCA 4M77B 3VRYA 1K1ZA 4QW2A 1D3BA 1VQ6T 2MWPA 2EQIA 2DXTA 4QKUA 3CCMT 2DNUA 1YIJA 3FIFA 1UFFA 2YRCA 1I81A 4M78F 1Y96B 1BKBA 4M78E 1NJIC 4JRKA 5GAN6 4NL3A 4FSXA 5DLQE 5GAMj 1KIKA 3VUZA 3PTAA 2YHTA 4R56A 3CCVA 1UJ0A 3RKWA 2YT6A 1K8AC 1VQ7T 3EFSA 2EJ9A 1YITT 2DL4A 1WHLA 1GBQA 1TUCA 1BK2A 1QP2A 4KGXB 3FJPA 3OS5A 3QXEB 6AT1B 2HBPA 1F1BB 5LJ3e 4C92F 5KE2A 2HDAA 1X43A 2EPDA 1LJOA 3UT1A 9ATCB 4MMLA 1YJWQ 2DEUA 3A8MB 4FU6A 1KC8R 2FZGB 3HPWA 3OYYA 4XQ3A 2KROA 4M77F 4M77E 2JTMA 3HFNA 2XK0A 4RCBA 1WJSA 5I2SA 5IH2A 3A98A 2M0OA 3FB9A 4EMKB 1VQLA 3OYFA 2ZPEB 1RAGB 2EW3A 4HKEA 1N8RU 1AT1B 1KFZA 2EFIA 4AG1C
chains in the Genus database with same CATH topology
5L23A 3ULRB 1B3QA 4DEXA 1OOTA 2RQUA 3VS2A 1GCPA 2DLPA 3M0QA 3EG0A 3EG3A 1UJYA 2RNAA 2OJ2A 1S1NA 3EHQA 3VS4A 4GBQA 3PE0A 2FRYA 2KT8A 1JEGA 2DYBA 2OI3A 3I9QA 4X1VA 2DL5A 1UHCA 4IIOA 2AKLA 3NPFA 3GBQA 4DEYA 5I11A 4RTXA 1GRIA 2JS0A 2M0YA 1G2BA 1LCKA 2DM1A 3NMZC 3PVQA 1H3HA 2O31A 1K9AA 2CSIA 2GQIA 2FO0A 1PWTA 5FWCA 1I1JA 2D1XA 3EHRA 3NGPA 4Z88A 2ED1A 2EYZA 2QDLA 3U23A 1UUEA 1AWWA 1QCFA 2ENMA 2OAWA 4LN2A 2F2VA 4HVVA 2C0IA 4D8DA 1WXBA 2F2XA 2YUQA 2EGEA 1V1CA 1GFDA 1HD3A 2YSQA 4CC2A 4IIMA 2W0ZA 2LJ3A 4J9CA 4OMMA 4K11A 1YWPA 1MV3A 2KE9A 1SPKA 1FMKA 1WXTA 1J3TA 2JTEA 2RPNA 5GJWB 2EKHA 1AD5A 2K9GA 3LH5A 4RTTA 4RTZA 5EC7A 2F2WA 2MCNA 2DBMA 3QWXX 1Z9ZA 4Z89A 3VRZA 1Y0MA 1QKWA 2A08A 1T0JA 1NLPC 4JZ4A 1H92A 1XOVA 5IXFA 1U06A 3ZL7C 1A0NB 1GL5A 4AFSC 1AZEA 3UF4A 1AVZC 2FG0A 1T3LA 3M0RA 2MIOA 2H8HA 1SRLA 4JJDA 2CH4W 1JXMA 4CC4B 4RTWA 2GTJA 3R6NA 1K0SA 2CT3A 1CSKA 2GBQA 1KSWA 2PNIA 2KXCA 5FW9A 3VS6A 2M51A 2ED0A 1SHFA 1E6GA 1UDLA 1ZUUA 2KGTA 4R0KA 2KYMA 4WCIA 2BTTA 4ZNXA 3FJ5A 1UECA 2NWMA 1W70A 4KRTA 3I35A 2EYYA 2C0OA 3CQTA 1K76A 1U5SA 1UGVA 5I22A 2LJ1A 2VWFA 2KRSA 2IIMA 1W1FA 1YNZA 2LZ6B 1BU1A 2BZXA 2G6FX 2BZ8A 1VA7A 1N5ZA 2DMOA 4HVWA 1WX6A 1ABQA 2EGAA 1ZLMA 4HXJA 2L3QA 1GFCA 1Y57A 4AFUC 1B07A 1M3CA 4JJBA 1MV0B 4E6RA 2FPEA 1BB9A 3EGUA 1ZUKA 2A36A 2W10A 1QWFA 2KEAA 1WLPB 2KRNA 4J9IA 1WA7A 3H0IA 1AWXA 1E6HA 1SSHA 2ABLA 2V1RA 2X3WD 5IHNA 2E5KA 2EVRA 1NLOC 4OMQA 2CH4A 2RQWA 1NEGA 1ZBJA 2DL7A 2DX1A 4RTYA 1CKBA 2L0AA 2NUZA 2YUNA 3H41A 3UA6A 2FPFA 1FYNA 4ORZA 2AZVA 1TUDA 1SEMA 4OMOA 1M30A 3M0SA 1PKSA 2SEMA 2CREA 3M0PA 2CDTA 2KXDA 2D8JA 2I0NA 2KNBB 2J7IA 4OMPA 1X2KA 1GCQC 2EYXA 2K3BA 1X69A 2DBKA 4HVUA 2MOXA 1PHTA 3REAB 4J9EA 1GBRA 1WFWA 4M4ZA 4RTUA 2DE0X 4ESRA 2HCKA 1PRMC 3UA7A 2ECZA 1ZSGA 3I5RA 1ABOA 2K7AA 2DL8A 1G83A 2BZYA 1TG0A 2PTKA 4CC3A 4EIKA 2JXBA 2GNCA 3M0UA 1JO8A 4F17A 1WXUA 3O5ZA 2DA9A 2O2OA 1E7OA 2J6KA 3RNJA 1YCSB 3EG2A 2EGCA 4JJCA 1NG2A 2CUDA 2LX7A 3SEMA 1QLYA 4J9HA 1VYTA 1NYGA 3M0TA 2O9SA 1WIEA 1JQQA 1KJWA 2EYWA 4JZ3A 4J9DA 3VS1A 4CC7A 4Z8AA 2RQRA 2XMFA 2EBPA 1Z9QA 1SHGA 4AFQC 2LQWA 1AEYA 1X6BA 2CT4A 1K0XA 4LE9A 3PVLA 2KT1A 2DILA 3H0HA 2HEQA 5IXBA 2HSPA 2VKNA 1YN8A 2HBWA 4FSSA 1AZGB 4D8KA 1PNJA 1WI7A 2GTOA 2RQTA 3VS3A 4F14A 2DVJA 4LUDA 5ECAA 3JV3A 2B86A 2JM8A 2LCSA 2O88A 3RBBB 3C0CA 4Y92A 1VYUA 4JPBW 2JM9A 2D0NA 1T3SA 2DRKA 2DJQA 2ESWA 1RLPC 2J6FA 1PKTA 3TSZA 2KBTA 2JS2A 2D8HA 2RF0A 2K6DA 2A28A 1YP5A 2C0TA 1IO6A 1X6GA 1W6XA 2JMCA 1ZX6A 2DL3A 2LNHB 1UG1A 2A37A 4AFZC 1NEBA 2KYBA 4AG2C 2V1QA 2J6OA 2L3SA 1NM7A 5HCKA 4GLMA 2L2PA 1K4US 2VVKA 2K2MA 1X27A 1ZUYA 2GGRA 1M3AA 1AWOA 1UHFA 1RLQC 2LJ0A 1ARKA 3I5SA 3VS5A 3VS7A 1M8MA 1WYXA 3TVTA 1UTIA 2JT4A 2ROTA 2YUPA 2LP5A 1GCQA 2KR3A 3VS0A 2CSQA 2RQVA 4HCKA 4F16A 1BBZA 3VRYA 1I07A 1K1ZA 3H0FA 3IQLA 1H8KA 1X2QA 2O9VA 2EQIA 3KFVA 4LNPA 2DNUA 1UFFA 1WDXA 2X3XD 4A63B 2FPDA 1OV3A 2L3PA 4J9BA 1KIKA 1EFNA 3THKA 1VYVA 2AZSA 2CUBA 1UJ0A 4OMNA 2JW4A 1PRLC 4RUGA 2LQNA 2YT6A 1MUZA 2AK5A 1NYFA 2FRWA 2DL4A 3TSWA 1M3BA 1GBQA 1TUCA 5FWBA 1YWOA 1BK2A 4RTVA 2JMAA 2ROLA 1OPLA 2DF6A 2J06A 2YDLA 4OMLA 3SHWA 2FEIA 4J9GA 1I0CA 3QWYA 2HDAA 1X43A 1AOJA 1OPKA 2P4RA 2EPDA 5IHKA 1HJDA 2RN8A 5IHIA 2K79A 2AKKA 3REBB 1SRMA 2PZ1A 3EG1A 1M27C 1RI9A 2KROA 2SRCA 1RUWA 1T0HA 2J05A 1JXOA 1CKAA 1UE9A 3NHNA 2DRMA 2KRMA 4J9FA 1QWEA 1QKXA 1HSQA 4LUEA 1AWJA 5IH2A 3A98A 3UATA 2RMOA 2EW3A 1OEBA 4QT7A 2LMJA 1KFZA 1JU5C 2YUOA 1U3OA 5GJVB 4AG1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L23 A;  3ULR B;  1B3Q A;  4DEX A;  1OOT A;  2RQU A;  3VS2 A;  1GCP A;  2DLP A;  3M0Q A;  3EG0 A;  3EG3 A;  1UJY A;  2RNA A;  2OJ2 A;  1S1N A;  3EHQ A;  3VS4 A;  4GBQ A;  3PE0 A;  2FRY A;  2KT8 A;  1JEG A;  2DYB A;  2OI3 A;  3I9Q A;  4X1V A;  2DL5 A;  1UHC A;  4IIO A;  2AKL A;  3NPF A;  3GBQ A;  4DEY A;  5I11 A;  4RTX A;  1GRI A;  2JS0 A;  2M0Y A;  1G2B A;  1LCK A;  2DM1 A;  3NMZ C;  3PVQ A;  1H3H A;  2O31 A;  1K9A A;  2CSI A;  2GQI A;  2FO0 A;  1PWT A;  5FWC A;  1I1J A;  2D1X A;  3EHR A;  3NGP A;  4Z88 A;  2ED1 A;  2EYZ A;  2QDL A;  3U23 A;  1UUE A;  1AWW A;  1QCF A;  2ENM A;  2OAW A;  4LN2 A;  2F2V A;  4HVV A;  2C0I A;  4D8D A;  1WXB A;  2F2X A;  2YUQ A;  2EGE A;  1V1C A;  1GFD A;  1HD3 A;  2YSQ A;  4CC2 A;  4IIM A;  2W0Z A;  2LJ3 A;  4J9C A;  4OMM A;  4K11 A;  1YWP A;  1MV3 A;  2KE9 A;  1SPK A;  1FMK A;  1WXT A;  1J3T A;  2JTE A;  2RPN A;  5GJW B;  2EKH A;  1AD5 A;  2K9G A;  3LH5 A;  4RTT A;  4RTZ A;  5EC7 A;  2F2W A;  2MCN A;  2DBM A;  3QWX X;  1Z9Z A;  4Z89 A;  3VRZ A;  1Y0M A;  1QKW A;  2A08 A;  1T0J A;  1NLP C;  4JZ4 A;  1H92 A;  1XOV A;  5IXF A;  1U06 A;  3ZL7 C;  1A0N B;  1GL5 A;  4AFS C;  1AZE A;  3UF4 A;  1AVZ C;  2FG0 A;  1T3L A;  3M0R A;  2MIO A;  2H8H A;  1SRL A;  4JJD A;  2CH4 W;  1JXM A;  4CC4 B;  4RTW A;  2GTJ A;  3R6N A;  1K0S A;  2CT3 A;  1CSK A;  2GBQ A;  1KSW A;  2PNI A;  2KXC A;  5FW9 A;  3VS6 A;  2M51 A;  2ED0 A;  1SHF A;  1E6G A;  1UDL A;  1ZUU A;  2KGT A;  4R0K A;  2KYM A;  4WCI A;  2BTT A;  4ZNX A;  3FJ5 A;  1UEC A;  2NWM A;  1W70 A;  4KRT A;  3I35 A;  2EYY A;  2C0O A;  3CQT A;  1K76 A;  1U5S A;  1UGV A;  5I22 A;  2LJ1 A;  2VWF A;  2KRS A;  2IIM A;  1W1F A;  1YNZ A;  2LZ6 B;  1BU1 A;  2BZX A;  2G6F X;  2BZ8 A;  1VA7 A;  1N5Z A;  2DMO A;  4HVW A;  1WX6 A;  1ABQ A;  2EGA A;  1ZLM A;  4HXJ A;  2L3Q A;  1GFC A;  1Y57 A;  4AFU C;  1B07 A;  1M3C A;  4JJB A;  1MV0 B;  4E6R A;  2FPE A;  1BB9 A;  3EGU A;  1ZUK A;  2A36 A;  2W10 A;  1QWF A;  2KEA A;  1WLP B;  2KRN A;  4J9I A;  1WA7 A;  3H0I A;  1AWX A;  1E6H A;  1SSH A;  2ABL A;  2V1R A;  2X3W D;  5IHN A;  2E5K A;  2EVR A;  1NLO C;  4OMQ A;  2CH4 A;  2RQW A;  1NEG A;  1ZBJ A;  2DL7 A;  2DX1 A;  4RTY A;  1CKB A;  2L0A A;  2NUZ A;  2YUN A;  3H41 A;  3UA6 A;  2FPF A;  1FYN A;  4ORZ A;  2AZV A;  1TUD A;  1SEM A;  4OMO A;  1M30 A;  3M0S A;  1PKS A;  2SEM A;  2CRE A;  3M0P A;  2CDT A;  2KXD A;  2D8J A;  2I0N A;  2KNB B;  2J7I A;  4OMP A;  1X2K A;  1GCQ C;  2EYX A;  2K3B A;  1X69 A;  2DBK A;  4HVU A;  2MOX A;  1PHT A;  3REA B;  4J9E A;  1GBR A;  1WFW A;  4M4Z A;  4RTU A;  2DE0 X;  4ESR A;  2HCK A;  1PRM C;  3UA7 A;  2ECZ A;  1ZSG A;  3I5R A;  1ABO A;  2K7A A;  2DL8 A;  1G83 A;  2BZY A;  1TG0 A;  2PTK A;  4CC3 A;  4EIK A;  2JXB A;  2GNC A;  3M0U A;  1JO8 A;  4F17 A;  1WXU A;  3O5Z A;  2DA9 A;  2O2O A;  1E7O A;  2J6K A;  3RNJ A;  1YCS B;  3EG2 A;  2EGC A;  4JJC A;  1NG2 A;  2CUD A;  2LX7 A;  3SEM A;  1QLY A;  4J9H A;  1VYT A;  1NYG A;  3M0T A;  2O9S A;  1WIE A;  1JQQ A;  1KJW A;  2EYW A;  4JZ3 A;  4J9D A;  3VS1 A;  4CC7 A;  4Z8A A;  2RQR A;  2XMF A;  2EBP A;  1Z9Q A;  1SHG A;  4AFQ C;  2LQW A;  1AEY A;  1X6B A;  2CT4 A;  1K0X A;  4LE9 A;  3PVL A;  2KT1 A;  2DIL A;  3H0H A;  2HEQ A;  5IXB A;  2HSP A;  2VKN A;  1YN8 A;  2HBW A;  4FSS A;  1AZG B;  4D8K A;  1PNJ A;  1WI7 A;  2GTO A;  2RQT A;  3VS3 A;  4F14 A;  2DVJ A;  4LUD A;  5ECA A;  3JV3 A;  2B86 A;  2JM8 A;  2LCS A;  2O88 A;  3RBB B;  3C0C A;  4Y92 A;  1VYU A;  4JPB W;  2JM9 A;  2D0N A;  1T3S A;  2DRK A;  2DJQ A;  2ESW A;  1RLP C;  2J6F A;  1PKT A;  3TSZ A;  2KBT A;  2JS2 A;  2D8H A;  2RF0 A;  2K6D A;  2A28 A;  1YP5 A;  2C0T A;  1IO6 A;  1X6G A;  1W6X A;  2JMC A;  1ZX6 A;  2DL3 A;  2LNH B;  1UG1 A;  2A37 A;  4AFZ C;  1NEB A;  2KYB A;  4AG2 C;  2V1Q A;  2J6O A;  2L3S A;  1NM7 A;  5HCK A;  4GLM A;  2L2P A;  1K4U S;  2VVK A;  2K2M A;  1X27 A;  1ZUY A;  2GGR A;  1M3A A;  1AWO A;  1UHF A;  1RLQ C;  2LJ0 A;  1ARK A;  3I5S A;  3VS5 A;  3VS7 A;  1M8M A;  1WYX A;  3TVT A;  1UTI A;  2JT4 A;  2ROT A;  2YUP A;  2LP5 A;  1GCQ A;  2KR3 A;  3VS0 A;  2CSQ A;  2RQV A;  4HCK A;  4F16 A;  1BBZ A;  3VRY A;  1I07 A;  1K1Z A;  3H0F A;  3IQL A;  1H8K A;  1X2Q A;  2O9V A;  2EQI A;  3KFV A;  4LNP A;  2DNU A;  1UFF A;  1WDX A;  2X3X D;  4A63 B;  2FPD A;  1OV3 A;  2L3P A;  4J9B A;  1KIK A;  1EFN A;  3THK A;  1VYV A;  2AZS A;  2CUB A;  1UJ0 A;  4OMN A;  2JW4 A;  1PRL C;  4RUG A;  2LQN A;  2YT6 A;  1MUZ A;  2AK5 A;  1NYF A;  2FRW A;  2DL4 A;  3TSW A;  1M3B A;  1GBQ A;  1TUC A;  5FWB A;  1YWO A;  1BK2 A;  4RTV A;  2JMA A;  2ROL A;  1OPL A;  2DF6 A;  2J06 A;  2YDL A;  4OML A;  3SHW A;  2FEI A;  4J9G A;  1I0C A;  3QWY A;  2HDA A;  1X43 A;  1AOJ A;  1OPK A;  2P4R A;  2EPD A;  5IHK A;  1HJD A;  2RN8 A;  5IHI A;  2K79 A;  2AKK A;  3REB B;  1SRM A;  2PZ1 A;  3EG1 A;  1M27 C;  1RI9 A;  2KRO A;  2SRC A;  1RUW A;  1T0H A;  2J05 A;  1JXO A;  1CKA A;  1UE9 A;  3NHN A;  2DRM A;  2KRM A;  4J9F A;  1QWE A;  1QKX A;  1HSQ A;  4LUE A;  1AWJ A;  5IH2 A;  3A98 A;  3UAT A;  2RMO A;  2EW3 A;  1OEB A;  4QT7 A;  2LMJ A;  1KFZ A;  1JU5 C;  2YUO A;  1U3O A;  5GJV B;  4AG1 C; 
#chains in the Genus database with same CATH topology
 2BKD N;  2RQU A;  3TU4 K;  4ZTJ A;  2DLP A;  3EG3 A;  5KYU A;  2AIR B;  1GXI E;  1S1N A;  4L6V 5;  2I2L A;  1VQ6 A;  1NJI R;  2CZ1 B;  4KUI A;  4EMK C;  3CCM A;  2OI3 A;  5KYN A;  1G3Y A;  4C0D B;  2DL5 A;  1UHC A;  4BI3 A;  4VUB A;  4DEY A;  5I11 A;  2JS0 A;  1KQS P;  3LW5 E;  1G2B A;  1K8A R;  1LCK A;  1ZBX A;  1H3H A;  2GQI A;  3CPW P;  2D1X A;  1W2B S;  1VQ7 A;  2OTJ Q;  3CD6 T;  2DD4 A;  1YIT A;  4A4K A;  1TH7 A;  4FT4 A;  2EYZ A;  3CC2 Q;  2QDL A;  4C8Q D;  2WSF E;  2ENM A;  1SKU B;  2DFU A;  1S72 Q;  2OAW A;  3MCA B;  2C0I A;  4D8D A;  4IUP A;  3S3N A;  2EGE A;  3CME Q;  3EFO B;  1XQH A;  1TS9 A;  4J5Y A;  2W0Z A;  4J9C A;  4OMM A;  1MV3 A;  1SPK A;  1WXT A;  5LJ5 g;  2QEX Q;  5KCO A;  2RPN A;  1QCN A;  2EKH A;  1LPL A;  4RTT A;  3HRS A;  2VB6 A;  4RTZ A;  4ZN1 A;  3OYJ A;  3LWI A;  1YI2 T;  5C0M A;  3OYC A;  4XTX A;  2GF7 A;  2LDM A;  3SDZ A;  4Z89 A;  3VRZ A;  3OYN A;  1HXD A;  3FLG A;  2ZPG B;  5EG2 A;  4MDW A;  3GOX A;  1A0N B;  1AZE A;  3UF4 A;  1EIF A;  1AVZ C;  2FG0 A;  5GAN j;  2MIO A;  1PD1 A;  4ANJ A;  3E2U A;  5AYF A;  1N9S A;  1ZSZ A;  2EQM A;  3RMS A;  3OS1 A;  4CC4 B;  3DLM A;  2EJG A;  5GMK j;  2JVV A;  1KD1 C;  4M75 G;  5FLX E;  3JCM Q;  4PJO F;  2CT3 A;  4C8Q A;  4PJO E;  3A8H B;  2PNI A;  5LJ3 h;  1YJ9 T;  2M51 A;  4BE1 A;  2CGH A;  3OBW A;  1DJ7 B;  5HY6 A;  2M9U A;  4QQD A;  4BD3 A;  1TSF A;  3EH2 A;  4XU0 A;  3J81 E;  3FJ5 A;  1M1F A;  5LJ3 d;  1W70 A;  3A8L B;  1YJN Q;  3OYD A;  2MYS A;  2LRQ A;  5A2Q E;  3J80 E;  4JRP A;  3D7S B;  4E7H A;  3CD6 A;  4JRQ A;  2LCL A;  3CQT A;  2LTO A;  1K76 A;  1U5S A;  5I22 A;  2VWF A;  1W1F A;  1D1B A;  3X20 B;  5KYU B;  3QBY A;  1N9R A;  5GAN 7;  4BI4 A;  2BZX A;  2G6F X;  1WX6 A;  2YLC A;  2DYI A;  4HXJ A;  1W2B A;  4AFU C;  1OZ2 A;  3BE3 A;  3MJX A;  1VQ9 Q;  4E6R A;  5CKB A;  5GAM e;  3I55 T;  3QYH B;  3JRZ A;  2DXB A;  2ZAE A;  4LXC A;  3TRE A;  1P92 A;  2KRN A;  3LLR A;  3H0I A;  2Y4X A;  1AWX A;  2E5K A;  1IHV A;  1IHW A;  1YI2 A;  4M7D F;  4M7D E;  1NEG A;  1VQ8 Q;  2F1L A;  2L0A A;  2NUZ A;  1NPP A;  4NS5 A;  3UA6 A;  4KT0 E;  3OYH A;  3OQ5 A;  1VQP Q;  2CDT A;  1KD1 R;  1N6A A;  3EGD A;  2XDP A;  1M90 U;  2OTL T;  4O5V A;  3WVD B;  5LJ5 f;  1X69 A;  2DBK A;  2HL3 A;  4M7A D;  4KUL A;  3HRT A;  3REA B;  1IZ6 A;  3JB9 D;  1YJ9 A;  1PRM C;  2C06 A;  5CKD A;  4JLG A;  4PJM A;  3CBO A;  2DVE A;  3S3O A;  3OY9 A;  3H8Z A;  4F17 A;  2DER A;  2RHX A;  1G3W A;  1E7O A;  3CCL T;  1H64 1;  1U8R A;  2HMA A;  4FW1 A;  3RNJ A;  3M55 A;  3X26 B;  2EGC A;  8AT1 B;  3M0T A;  1ZSZ B;  4CRI A;  2XD0 A;  1WIE A;  2CZ0 B;  4EMH A;  4CC7 A;  4R55 A;  2RJE A;  2QQ9 A;  2XMF A;  4C8Q B;  3V8K A;  1K0X A;  2CT4 A;  2RHI A;  3I55 A;  5IXB A;  1K73 U;  4BY6 C;  3CEY A;  4Y91 A;  2HBW A;  2AT1 B;  1K9M U;  4D8K A;  2BE9 B;  4B9W A;  1RI0 A;  4F14 A;  3N5B B;  1Q86 C;  4LUD A;  5ECA A;  3JV3 A;  2JM8 A;  4OB3 B;  2FZC B;  2D0N A;  1T3S A;  1M1G A;  4M78 A;  2DJQ A;  3HL8 A;  2J6F A;  4QVC A;  4FYX B;  2KBT A;  3M4Y A;  2PQW A;  3CXC S;  2C0T A;  2OTL A;  3OYG A;  4F7U B;  4PFP A;  4EMG A;  2V8J A;  4ZGJ B;  1Q7Y U;  1ZA2 B;  2LNH B;  2VV5 A;  1UG1 A;  2KYB A;  2KI7 A;  5M9O A;  4UC4 A;  1BI1 A;  3DLL A;  2L3S A;  5HCK A;  4B6M A;  1K4U S;  2JTF A;  1PSF A;  1PC0 A;  3TQ7 P;  2GGR A;  5GAM h;  1M3A A;  5D6X A;  4C92 A;  3HKS A;  2LJ0 A;  4MZM A;  3NTH A;  2JT4 A;  5GAN e;  3CCL A;  2YUP A;  2LP5 A;  3S3M A;  2P0K A;  2X51 A;  1VQM Q;  5GAO n;  2CSQ A;  5GAM d;  5GMK e;  2QA4 Q;  4M77 A;  3JCM X;  4LDY A;  4HCK A;  1YHQ Q;  2M1H A;  4PJJ A;  4PFZ A;  1X2Q A;  2O9V A;  4XU2 A;  3JCM f;  3CCR A;  1Y96 A;  1BI2 A;  2DTH A;  4A63 B;  1Q86 R;  1OQK A;  1YJW T;  4B9X A;  2P0P A;  1QQJ A;  3PNW C;  2RJF A;  2F5T X;  2L3R A;  3M4G A;  4DBR A;  4F7U F;  4F7U E;  2CUB A;  2NUT B;  4FYV B;  4DQ2 A;  3VUB A;  1RAA B;  4IKF A;  2FRW A;  2HSE B;  2KK4 A;  3FDR A;  4RCC A;  1YWO A;  3OW2 S;  1YFN A;  2QAZ A;  4RTV A;  2JMA A;  3RER A;  2DF6 A;  2YDL A;  4OML A;  4XAX B;  2FEI A;  3QWY A;  1TWB A;  5AT1 B;  1EZZ B;  3EG9 B;  3NTI A;  1HJD A;  2RN8 A;  5IHI A;  2K57 A;  3CCJ T;  5FU7 C;  2RB6 A;  2K79 A;  4BDZ A;  1QVF S;  1UGP B;  2E6Z A;  3M57 A;  2AKK A;  2GFA A;  2MAM A;  4X9D A;  3REB B;  2CZ6 B;  1M27 C;  4M7A B;  4PJO D;  2X4X A;  3CXC A;  1T0H A;  1JXO A;  1CKA A;  2EYQ A;  1TU0 B;  3ZFJ A;  5GMK m;  4RG2 A;  3ZEH A;  2KRM A;  1QKX A;  1HSQ A;  1AWJ A;  3L1A A;  2RMO A;  3SB2 A;  4QT7 A;  2LMJ A;  1JU5 C;  5GJV B;  3BDL A;  4RMO A;  4DEX A;  3PGG A;  1GCP A;  3MET A;  3OYA A;  3QKJ A;  3L2V A;  3PE0 A;  3L2U A;  1JEG A;  4M78 C;  3SWN B;  2FB7 A;  2K4Y A;  5C6S A;  3I9Q A;  4E47 A;  4X1V A;  3VYG A;  3CC7 T;  4IIO A;  5KCH A;  5D7U A;  2AKL A;  3NPF A;  1YJW A;  1GRI A;  2H3E B;  1BIA A;  3T9N A;  3NMZ C;  3PVQ A;  4QQ6 A;  1JBM A;  1TOV A;  4J6W A;  2FO0 A;  4PJO A;  3EHR A;  4BE0 A;  4HCB A;  1M8V A;  2DIQ A;  4M7D D;  4M7A F;  3QZ5 B;  2PUK B;  3MEW A;  4XU3 A;  2ZPH B;  2YRD A;  5LJ5 j;  2ZGW A;  3A8G B;  1NPR A;  2M02 A;  3JB9 F;  4C92 C;  4E7K A;  2Y90 A;  3OMG A;  1FMW A;  3EFO A;  5GAN h;  1WXB A;  2F2X A;  1V1C A;  1HD3 A;  2YSQ A;  3CCJ A;  5GMK h;  3FRN A;  2A0F B;  3CMA Q;  3CC4 T;  1YWP A;  3OW2 A;  2DEQ A;  2KE9 A;  4M77 C;  1UGQ B;  1OX8 A;  2JZ2 A;  5GAN d;  1AD5 A;  3ZBD A;  4ME7 A;  2MCN A;  2V26 A;  3QWX X;  1Z9Z A;  4M78 G;  1QVF A;  1Y0M A;  1QKW A;  4LDV A;  1XOV A;  2F5K A;  2RHZ A;  2X4W A;  4II1 A;  2NYS A;  4FM4 B;  1G3T A;  4JUV A;  4JJD A;  2CH4 W;  2R5M A;  3QYG B;  4M7D A;  4V2S A;  4OB1 B;  2K3Y A;  1CSK A;  1KSW A;  4A4F A;  1V29 B;  3VJP A;  3NTK A;  2ED0 A;  2K5L A;  3CC7 A;  1SHF A;  3E1S A;  1E6G A;  1ZA1 B;  4C92 G;  1UDL A;  1VQ9 T;  4KH0 B;  4R0K A;  2KYM A;  3FEO A;  3I56 T;  1UB4 A;  5FRM A;  3LGL A;  1X01 A;  3QUI A;  4OGE A;  4E7I A;  2BTT A;  4ZNX A;  1WHH A;  2P0Q A;  2JUF A;  1UEC A;  4M77 G;  1X75 C;  3JCM P;  2HAX A;  1YNZ A;  1N27 A;  3MP6 A;  4PNO A;  2HKQ B;  4A54 A;  3PIP A;  5LL6 S;  1EX4 A;  3QPH A;  3M56 A;  2EGA A;  2LQ8 A;  1VQP T;  2G3R A;  4DBF A;  1YIJ Q;  1MV0 B;  3CC4 A;  2FPE A;  1BB9 A;  2A36 A;  1LVK A;  1M2V A;  2AHJ B;  4E7Z A;  4OGC A;  1SSH A;  2ABL A;  1D1A A;  2X3W D;  1M9S A;  2CP5 A;  4JRI A;  1QVG P;  2ZPB B;  1NLO C;  2CH4 A;  2EQU A;  5LJ3 f;  2QK0 A;  3OA6 A;  4PJO B;  1ZBJ A;  2E1H A;  2DL7 A;  4C0D C;  2XDD A;  5KH6 A;  2HQE A;  2AZV A;  1TUD A;  5KYW B;  3G6E Q;  4OMO A;  3QJY A;  4FCY A;  3O8V A;  3CCS T;  1N8R C;  2SEM A;  2CRE A;  1V76 A;  2DKG A;  3M0P A;  2KXD A;  4JJN K;  2CKK A;  4PKC C;  5D6W A;  4X34 A;  2J7I A;  4OMP A;  1X2K A;  1GCQ C;  1VQO T;  1Q82 U;  2K3B A;  4IUR A;  4C0F A;  1PHT A;  4EDU A;  3P8H A;  1BIB A;  5GMK i;  1Y7X A;  2XDB A;  2WAC A;  3JB9 J;  2YWW A;  1ZSG A;  2QTX A;  3L2Z A;  4C0Z A;  1VQ9 A;  1VQ5 T;  3I56 A;  1OZ3 A;  1ABO A;  3INZ A;  4J7I A;  2JNG A;  1G83 A;  2BZY A;  1XJW B;  2VYT A;  1TXQ A;  3R6O A;  1HK9 A;  3M0U A;  1JO8 A;  2D6F A;  1VQL Q;  3O5Z A;  4KGV B;  1ACM B;  3RKX A;  5FRN A;  4D6W A;  1YCS B;  4JJC A;  2LX7 A;  4J83 A;  4J9H A;  1VYT A;  4M75 F;  1RAE B;  4M75 E;  3ER0 A;  3URG A;  4JZ3 A;  1KJW A;  2EYW A;  2IVW A;  3C12 A;  4J9D A;  3VS1 A;  4M7D B;  1VQ6 Q;  2BE7 D;  2EBP A;  1Z9Q A;  4AFQ C;  1VQP A;  3CCM Q;  2V8I A;  2VAS A;  3CBP A;  4LE9 A;  3JSC A;  1WHJ A;  1YN8 A;  3CCQ T;  5HK3 A;  2QDY B;  4ATO A;  2X9H A;  4FSS A;  1PNJ A;  1WI7 A;  4N4G A;  3VS3 A;  3DB4 A;  3G71 Q;  4L59 A;  4M7D C;  5GAO m;  3EGX B;  2B86 A;  1M2O A;  1VQ7 Q;  1YCY A;  5LJ5 e;  2MPX C;  4Y92 A;  1WNL A;  1YIT Q;  2JM9 A;  1N8R R;  4AMC A;  2VGM A;  1VIE A;  4C5I A;  4OP0 A;  3CCS A;  4P5N A;  2RF0 A;  5A0D A;  3RDV A;  3M53 A;  4F7U A;  5CIU A;  4L5G A;  3OSV A;  1X6G A;  1VQO A;  1VQM T;  1ZX6 A;  2L8D A;  1VQ4 T;  2A37 A;  5GAN 4;  4AFZ C;  1NEB A;  2RM4 A;  1M2V B;  3J7A F;  4A4E A;  4RKU E;  2CZ7 B;  3LWH A;  2V1Q A;  4QQG A;  4PJN A;  2L2P A;  5FU6 B;  1IB8 A;  2VVK A;  3QZ9 B;  4N0A A;  1VQ5 A;  1X27 A;  3E9G A;  1ARK A;  3VS5 A;  1M8M A;  3RKY A;  2P84 A;  3TVT A;  3A5Z B;  1XNI A;  4LD6 A;  4OF1 A;  3VS0 A;  2LCC A;  2VXE A;  1RAD B;  5KYX B;  3PT9 A;  1NBE B;  3PMI A;  4CI0 C;  4F16 A;  1FXX A;  2LX9 A;  1H8K A;  1IRX A;  2QYZ A;  3KFV A;  1I8F A;  1JRI A;  4LNP A;  3JCM g;  1MMN A;  2QGF B;  1WDX A;  3SFM A;  2XI9 A;  4C5E A;  3CCQ A;  2L3P A;  3L2W A;  4J9B A;  1EFN A;  3F70 A;  3THK A;  4OB2 B;  2NUT A;  2AZS A;  2R58 A;  4RG8 A;  3EFR A;  2JW4 A;  4RUG A;  3CD6 Q;  3QDR B;  2AK5 A;  4A4G A;  4DOW A;  1M3B A;  5GAM f;  1UGR B;  2ROL A;  3RR6 A;  2PVD B;  3CPF A;  4XTZ A;  3V7S A;  3CCR T;  1I0C A;  3EG9 A;  3JAM E;  2Z0W A;  1M90 C;  1AOJ A;  1VQM A;  1MMD A;  5IHK A;  4LDU A;  1VQ4 A;  4TVR A;  1ZSZ C;  4M7A A;  3FC3 A;  5IT9 E;  3UWN A;  4E2F B;  3LYI A;  2SRC A;  4AT1 B;  2IG0 A;  4C8Q C;  4FYW B;  1PSE A;  2QQS A;  3VKI A;  2J05 A;  1YI2 Q;  2VC8 A;  3CCU T;  5A0L A;  3NHN A;  4C5H A;  2D0Q B;  1VQK T;  4J9F A;  1QP3 A;  3RMQ A;  4GY5 A;  4BE2 A;  2OX7 A;  1OEB A;  3HFO A;  2FZK B;  2COW A;  3V8J A;  3RES A;  5L23 A;  3ULR B;  1B3Q A;  1ZQ1 A;  1RAB B;  3M0Q A;  1UJY A;  1OU9 A;  1VOM A;  1I5L A;  2RNA A;  2OJ2 A;  2XHC A;  3VS4 A;  4KH1 B;  1X6O A;  3SWN A;  2PVO B;  4GBQ A;  2FRY A;  2DYB A;  5KYY A;  1YJ9 Q;  4E7J A;  1AHJ B;  1D0Z A;  4FL6 A;  4ELZ C;  3MEU A;  4GLK A;  2K2V A;  5LJ5 d;  1K73 C;  4A53 A;  1K9M C;  3OS2 A;  2KY9 A;  2M0Y A;  1C1A A;  2DM1 A;  2OAU A;  2O31 A;  1PWT A;  5FWC A;  1I1J A;  3NGP A;  4XU1 A;  3U23 A;  1AWW A;  4N0A C;  4N4H A;  4C8Q G;  3LX7 A;  1M90 R;  3KXT A;  4LN2 A;  2F2V A;  4HVV A;  3V7R A;  2YRV A;  1GFD A;  3L2Q A;  5GAO p;  3I55 Q;  3H6Z A;  4CC2 A;  4K11 A;  1Q7Y C;  4J6Y A;  1FMK A;  3M9Q A;  4ZGE B;  1J3T A;  1IXD A;  3JB9 I;  1G3S A;  5GJW B;  2DAQ A;  3ME9 A;  3CCE Q;  3LH5 A;  5EC7 A;  4IUV A;  3CCU A;  2F2W A;  1IGQ A;  1VQK A;  2DBM A;  1WPY A;  2A08 A;  1U1S A;  2ZPI B;  3EH1 A;  1NLP C;  1H92 A;  5IXF A;  1U06 A;  3ZL7 C;  3MEA A;  1Y71 A;  4F7U G;  2PVG B;  1VUB A;  2HD0 A;  1T3L A;  3X28 B;  4HT9 A;  2OTL Q;  3PIO A;  1KG1 A;  1JXM A;  2M16 A;  1JJ2 P;  1OUL A;  1RAI B;  3DKM A;  4M75 D;  1K0S A;  1IRE B;  3JCM J;  2E3H A;  1K73 R;  4FYY B;  2X4Y A;  2LQK A;  3CXC P;  2GBQ A;  2KXC A;  5FW9 A;  1K9M R;  5GAN f;  4PK4 A;  1KC8 U;  2HQH A;  2KGT A;  5GAO r;  2E4H A;  2WSE E;  1U1T A;  2F69 A;  3ASK A;  1G5V A;  2NWM A;  4M7A C;  1MMG A;  4MZP A;  2EYY A;  2DO3 A;  4C0G A;  2C0O A;  2OTJ T;  1PM3 A;  4MMK A;  3SD4 A;  2RI3 A;  1UGV A;  2LJ1 A;  4KUD K;  3CC2 T;  5L8R E;  1QVP A;  2EKO A;  2LZ6 B;  5CKF A;  3JCM b;  2LNV A;  1S72 T;  1BU1 A;  3G6E T;  3AHU A;  2BZ8 A;  1VA7 A;  1N5Z A;  1Q7Y R;  3QO3 A;  1ZLM A;  4JDS A;  2L3Q A;  1Y57 A;  2LT4 A;  1M3C A;  5KYY B;  4JJB A;  3CME T;  5CAI A;  3C94 A;  2QQR A;  3M5A A;  1NJI U;  1ZUK A;  2W10 A;  2KEA A;  3QHS A;  5CK9 A;  4J9I A;  2QEX T;  1WA7 A;  4M75 A;  2D9T A;  3TCJ A;  3P8D A;  4E7L A;  5GAN 2;  3SWN C;  2MF2 A;  5J39 A;  3A8O B;  1KC8 C;  2RHY A;  2DX1 A;  5HK0 A;  5LJ3 g;  1K8A U;  1KHC A;  2YUN A;  5I2M A;  5KYW A;  3GLX A;  2FPF A;  1WJR A;  2RA2 A;  4F04 B;  4JS4 A;  1TUG B;  2K5I A;  1M30 A;  4Z02 A;  1WHK A;  1PKS A;  1OU8 A;  2KNB B;  2RI2 A;  4O6J A;  3JCM V;  2EYX A;  2XU8 A;  2JOY A;  4M7A G;  1GBR A;  5J3B A;  4M4Z A;  4ESR A;  2QXF A;  2VUB A;  2HCK A;  1KQS S;  2QTV A;  3JB9 G;  3OYK A;  1BCO A;  3UA7 A;  3I5R A;  1QVG S;  3CPW S;  1UGS B;  1QVF P;  2K7A A;  3KUF A;  2DL8 A;  2ZCF B;  1VQN Q;  5GAN 5;  4CC3 A;  4EIK A;  2JXB A;  2GNC A;  3G71 T;  3JCM W;  2DA9 A;  3G4S Q;  1FWZ A;  2O2O A;  3JB9 H;  1YJN T;  2CYZ B;  2J6K A;  2OTJ A;  2O01 E;  4WTO B;  3LGF A;  3SEM A;  3HTR A;  1QLY A;  3WVE B;  3CC2 A;  1NYG A;  3PMT A;  4DOV A;  2O9S A;  2O4X B;  4NOY A;  3M58 A;  1S72 A;  1ZHI A;  1XTD A;  3G6E A;  3QJ6 A;  1R8O B;  4Z8A A;  3WXM B;  2RQR A;  3MHX A;  2DPP B;  1C0M A;  5DLO A;  1X6B A;  3CME A;  3AT1 B;  4C92 E;  3PVL A;  2KT1 A;  2DIL A;  2QEX A;  3EGX A;  2GTO A;  5A0G A;  1UEB A;  1Q81 U;  2DVJ A;  2LCS A;  1SF9 A;  2DZ9 A;  2L89 A;  1VQ8 T;  1VYU A;  5GAO q;  3H9N A;  1IGU A;  3LH0 A;  2DRK A;  2RK1 A;  2RO0 A;  2ESW A;  1PKT A;  4XTY A;  1SG5 A;  1B34 B;  4PFO A;  2A28 A;  4LDW A;  2E10 A;  1QMC A;  1OI1 A;  5CR2 A;  2FVU A;  1IO6 A;  3CCJ Q;  2JMC A;  1R0B G;  4NL2 A;  1LNX A;  2H3J A;  3CCV Q;  4M75 B;  2COZ A;  4PLI A;  1NM7 A;  4GLM A;  2K2M A;  3VV0 A;  2EWN A;  1RLQ C;  3I5S A;  5CCA A;  2DTO A;  2L5Q A;  3GPL A;  2QG9 B;  3GNG A;  3G71 A;  1KQS A;  1UTI A;  1Q81 C;  4YTL A;  3HHT B;  3BDU A;  1YJN A;  1M1K U;  2KVQ G;  2HL5 C;  5KYX A;  5FRO A;  4M75 C;  1QVG A;  3CPW A;  2E5Q A;  4PJO C;  2FHD A;  3TEE A;  2QQA A;  1MND A;  1BYM A;  1BBZ A;  2JN0 A;  1I07 A;  3H0F A;  1KD1 U;  2DJZ A;  3IQL A;  5GMK l;  1H3Z A;  1D3B B;  2X3X D;  3CC7 Q;  2FPD A;  1OV3 A;  1WJQ A;  4OVA A;  2KDS A;  2QGG A;  5GAN 8;  2GFU A;  1VYV A;  5J26 A;  1M4Z A;  1B7T A;  2EQJ A;  2X4J A;  4BI8 B;  4OMN A;  3HRU A;  1PRL C;  2LQN A;  1VQ8 A;  1MUZ A;  4OB0 B;  1NYF A;  2MWO A;  4HCC A;  2NUP A;  1JB0 E;  3TSW A;  5FWB A;  2MI6 A;  4JS5 A;  5GAM g;  2PUO B;  3OB9 A;  4JLI A;  1OPL A;  1PD0 A;  2J06 A;  1M1K C;  5KE3 A;  3SHW A;  4J9G A;  4HT8 A;  1OPK A;  5IAY A;  2P4R A;  3BFM A;  1Q82 C;  3CC4 Q;  1FMV A;  4DBH A;  3BW1 A;  1M5Q 1;  1WQW A;  4Q5W A;  1SRM A;  4PL6 A;  3OS0 A;  2PZ1 A;  3EG1 A;  1RI9 A;  4PJO G;  3X25 B;  4A4H A;  1RUW A;  1WHG A;  1UE9 A;  1Q81 R;  2DRM A;  1RAH B;  1QWE A;  5CQY A;  2E70 A;  4LUE A;  3UAT A;  2KMT A;  1MMA A;  5CO7 A;  1W2B P;  2YUO A;  1U3O A;  2R57 A;  1G8X A;  2KAF A;  1OOT A;  3VS2 A;  3OYE A;  2QA4 T;  2E65 A;  2RD1 A;  3VYH B;  2E3I A;  1KK7 A;  3C95 A;  3EG0 A;  2EAY A;  3QSU A;  4Y28 E;  3EHQ A;  1I4K 1;  1YHQ T;  3L2R A;  2ZZD A;  2EQK A;  5CVI A;  2KT8 A;  3G1J A;  4XTW A;  2XID A;  3G7Z A;  1PCX A;  3E9F A;  1QW1 A;  2EJF A;  1C6V X;  2E64 A;  3GBQ A;  3I56 Q;  4RTX A;  2DXU A;  3GF5 A;  3QDF A;  1WZO A;  5D6Y A;  1K9A A;  2CSI A;  4J6X A;  3CCE T;  2CP6 A;  2E41 A;  3C4S A;  5FU6 C;  1WQ7 A;  4M7D G;  4ZN3 A;  2E12 A;  2ED1 A;  4Z88 A;  1M1K R;  1UUE A;  1QCF A;  2CP0 A;  1Q82 R;  2HKN A;  1RAF B;  1OYX A;  2YUQ A;  4KGZ B;  4IIM A;  4J8O A;  4DBQ A;  2LJ3 A;  2YLB A;  3E19 A;  2JTE A;  4OMF B;  1Q86 U;  2K9G A;  1KQ2 A;  3P8B B;  2P4T A;  4M78 D;  2NUP B;  1T0J A;  4JZ4 A;  2CS7 A;  2RHU A;  3CCS Q;  1GL5 A;  2RI5 A;  4AFS C;  3M0R A;  2VGN A;  2H8H A;  2DZC A;  1SRL A;  4FW2 A;  2EIF A;  2QA4 A;  4BY6 B;  1VQO Q;  3OSS C;  1BCM A;  3A1P A;  4XTV A;  3PFS A;  4MDX A;  4E7S A;  2DET A;  4RTW A;  1YHQ A;  2GTJ A;  3R6N A;  2RJD A;  3MP1 A;  1MNE A;  3VS6 A;  4FT2 A;  2LC4 A;  5GAN 3;  3V7C A;  5GAN g;  4PJL A;  1VQ5 Q;  4C92 D;  1ZUU A;  2CP2 A;  1RAC B;  4IUU A;  1W4S A;  2KSS A;  4WCI A;  2V8K A;  3JCM e;  4HA8 A;  1HYO A;  1D0Y A;  3CCE A;  4KRT A;  3I35 A;  4M77 D;  2YXY A;  5LJ5 h;  3GNF B;  3UDC A;  2KRS A;  2DXC A;  2IIM A;  1JJ2 S;  2JJ9 A;  3JCM c;  2XIC A;  4HVW A;  2DMO A;  1ABQ A;  3OYI A;  1GFC A;  1B07 A;  5LJ3 j;  1NZ9 A;  2B8A A;  4ZGD B;  2K5F A;  3CCQ Q;  3EGU A;  3CMA T;  5DM7 R;  4BDY A;  3OYL A;  1QWF A;  2WSC E;  3RUX A;  1WLP B;  4QVZ A;  3GIB A;  1E6H A;  2V1R A;  5IHN A;  5DY9 A;  3RIR A;  2XG8 D;  4OMQ A;  1OX9 A;  2EVR A;  2A7Y A;  1BI0 A;  2FYK A;  2RQW A;  7AT1 B;  4IUQ A;  2A3L A;  2HNI A;  3L42 A;  4ZTF A;  1MHN A;  1CKB A;  4J7F A;  4RTY A;  1WHM A;  4C8Q E;  4C8Q F;  3M59 A;  3H41 A;  1O75 A;  1FYN A;  1VQN T;  4ORZ A;  4XTU A;  4DA4 A;  1SEM A;  4KBM B;  3M0S A;  3MPU B;  2D8J A;  2NLU A;  2I0N A;  3G4S T;  3GP8 A;  1TTH B;  3EAE A;  5GAO l;  4EPC A;  3EGD B;  1VQ4 Q;  2LT1 A;  4HVU A;  4XK8 E;  2MOX A;  1WGS A;  3Q1J A;  4J9E A;  1WFW A;  4RTU A;  2DE0 X;  2LVM A;  4PLL A;  3NFC A;  2CP7 A;  4ELY C;  2ATC B;  2ECZ A;  5CKH A;  1NE8 A;  3V8L A;  4BAC A;  3S6W A;  2RK2 A;  1TG0 A;  2PTK A;  2PU9 B;  4X9C A;  3MKD A;  3M54 A;  1WXU A;  3OYM A;  1YBY A;  2X35 A;  1MGQ A;  3EG2 A;  5FU7 B;  1NG2 A;  4N4I A;  2CUD A;  3OYB A;  2O4X A;  1VIF A;  3QII A;  3X24 B;  1JQQ A;  2CP3 A;  2HZY A;  2BUD A;  2K3X A;  1SHG A;  3HP9 A;  2LQW A;  1AEY A;  4C5G A;  5CKE A;  2GCX A;  1YIJ T;  3VU3 C;  3H0H A;  2HEQ A;  3CMA A;  2HSP A;  2IPO B;  2VKN A;  2E6N A;  3CBM A;  2HQX A;  3OMC A;  1JJ2 A;  1AZG B;  2QAS A;  4HCZ A;  2RQT A;  2MK5 A;  5HKC A;  2DTI A;  4LDX A;  1D1C A;  1BI3 A;  3CCL Q;  3CCV T;  1QCO A;  2O88 A;  2R5A A;  2XKO C;  2Y4Y A;  1Q95 G;  3DB3 A;  3OBY A;  3RBB B;  2ZPF B;  1RL2 A;  2DD5 A;  3C0C A;  4JPB W;  2RH2 A;  4BUG A;  2KQW A;  2MMP A;  5CQX A;  1VQN A;  1B34 A;  4EMK A;  1RLP C;  3TSZ A;  3JCM h;  2JS2 A;  4M78 B;  3HSB A;  2D8H A;  1I5O B;  4WF2 A;  1R0C B;  2DK3 A;  3CCR Q;  3G4S A;  2K6D A;  3MEV A;  2QQB A;  1YP5 A;  3QG1 A;  2BIV A;  2COY A;  1W6X A;  2FL7 A;  1PG5 B;  2DL3 A;  1O9S A;  4QVD A;  3JCM d;  4AG2 C;  1SSF A;  2J6O A;  1Y07 A;  1D0X A;  4MZT A;  4BB7 A;  2QI2 A;  3CCU Q;  3BY7 A;  1ZUY A;  8ATC B;  1VQK Q;  1AWO A;  1UHF A;  4FIB A;  3VS7 A;  1WYX A;  1D09 B;  4C92 B;  5I21 A;  2DIG A;  1VQL T;  2ROT A;  3MO8 A;  3KBG A;  3MP8 A;  4LD9 K;  1GCQ A;  2VXF A;  2KR3 A;  1FX7 A;  5IN1 A;  4IUT A;  3UPU A;  1KQ1 A;  3OW2 P;  2RQV A;  1KHI A;  1R77 A;  1LOJ A;  4M7A E;  2GQV A;  2RJC A;  4M77 B;  3VRY A;  1K1Z A;  4QW2 A;  1D3B A;  1VQ6 T;  2MWP A;  2EQI A;  2DXT A;  4QKU A;  3CCM T;  2DNU A;  1YIJ A;  3FIF A;  1UFF A;  2YRC A;  1I81 A;  4M78 F;  1Y96 B;  1BKB A;  4M78 E;  1NJI C;  4JRK A;  5GAN 6;  4NL3 A;  4FSX A;  5DLQ E;  5GAM j;  1KIK A;  3VUZ A;  3PTA A;  2YHT A;  4R56 A;  3CCV A;  1UJ0 A;  3RKW A;  2YT6 A;  1K8A C;  1VQ7 T;  3EFS A;  2EJ9 A;  1YIT T;  2DL4 A;  1WHL A;  1GBQ A;  1TUC A;  1BK2 A;  1QP2 A;  4KGX B;  3FJP A;  3OS5 A;  3QXE B;  6AT1 B;  2HBP A;  1F1B B;  5LJ3 e;  4C92 F;  5KE2 A;  2HDA A;  1X43 A;  2EPD A;  1LJO A;  3UT1 A;  9ATC B;  4MML A;  1YJW Q;  2DEU A;  3A8M B;  4FU6 A;  1KC8 R;  2FZG B;  3HPW A;  3OYY A;  4XQ3 A;  2KRO A;  4M77 F;  4M77 E;  2JTM A;  3HFN A;  2XK0 A;  4RCB A;  1WJS A;  5I2S A;  5IH2 A;  3A98 A;  2M0O A;  3FB9 A;  4EMK B;  1VQL A;  3OYF A;  2ZPE B;  1RAG B;  2EW3 A;  4HKE A;  1N8R U;  1AT1 B;  1KFZ A;  2EFI A;  4AG1 C; 
#chains in the Genus database with same CATH homology
 5L23 A;  3ULR B;  1B3Q A;  4DEX A;  1OOT A;  2RQU A;  3VS2 A;  1GCP A;  2DLP A;  3M0Q A;  3EG0 A;  3EG3 A;  1UJY A;  2RNA A;  2OJ2 A;  1S1N A;  3EHQ A;  3VS4 A;  4GBQ A;  3PE0 A;  2FRY A;  2KT8 A;  1JEG A;  2DYB A;  2OI3 A;  3I9Q A;  4X1V A;  2DL5 A;  1UHC A;  4IIO A;  2AKL A;  3NPF A;  3GBQ A;  4DEY A;  5I11 A;  4RTX A;  1GRI A;  2JS0 A;  2M0Y A;  1G2B A;  1LCK A;  2DM1 A;  3NMZ C;  3PVQ A;  1H3H A;  2O31 A;  1K9A A;  2CSI A;  2GQI A;  2FO0 A;  1PWT A;  5FWC A;  1I1J A;  2D1X A;  3EHR A;  3NGP A;  4Z88 A;  2ED1 A;  2EYZ A;  2QDL A;  3U23 A;  1UUE A;  1AWW A;  1QCF A;  2ENM A;  2OAW A;  4LN2 A;  2F2V A;  4HVV A;  2C0I A;  4D8D A;  1WXB A;  2F2X A;  2YUQ A;  2EGE A;  1V1C A;  1GFD A;  1HD3 A;  2YSQ A;  4CC2 A;  4IIM A;  2W0Z A;  2LJ3 A;  4J9C A;  4OMM A;  4K11 A;  1YWP A;  1MV3 A;  2KE9 A;  1SPK A;  1FMK A;  1WXT A;  1J3T A;  2JTE A;  2RPN A;  5GJW B;  2EKH A;  1AD5 A;  2K9G A;  3LH5 A;  4RTT A;  4RTZ A;  5EC7 A;  2F2W A;  2MCN A;  2DBM A;  3QWX X;  1Z9Z A;  4Z89 A;  3VRZ A;  1Y0M A;  1QKW A;  2A08 A;  1T0J A;  1NLP C;  4JZ4 A;  1H92 A;  1XOV A;  5IXF A;  1U06 A;  3ZL7 C;  1A0N B;  1GL5 A;  4AFS C;  1AZE A;  3UF4 A;  1AVZ C;  2FG0 A;  1T3L A;  3M0R A;  2MIO A;  2H8H A;  1SRL A;  4JJD A;  2CH4 W;  1JXM A;  4CC4 B;  4RTW A;  2GTJ A;  3R6N A;  1K0S A;  2CT3 A;  1CSK A;  2GBQ A;  1KSW A;  2PNI A;  2KXC A;  5FW9 A;  3VS6 A;  2M51 A;  2ED0 A;  1SHF A;  1E6G A;  1UDL A;  1ZUU A;  2KGT A;  4R0K A;  2KYM A;  4WCI A;  2BTT A;  4ZNX A;  3FJ5 A;  1UEC A;  2NWM A;  1W70 A;  4KRT A;  3I35 A;  2EYY A;  2C0O A;  3CQT A;  1K76 A;  1U5S A;  1UGV A;  5I22 A;  2LJ1 A;  2VWF A;  2KRS A;  2IIM A;  1W1F A;  1YNZ A;  2LZ6 B;  1BU1 A;  2BZX A;  2G6F X;  2BZ8 A;  1VA7 A;  1N5Z A;  2DMO A;  4HVW A;  1WX6 A;  1ABQ A;  2EGA A;  1ZLM A;  4HXJ A;  2L3Q A;  1GFC A;  1Y57 A;  4AFU C;  1B07 A;  1M3C A;  4JJB A;  1MV0 B;  4E6R A;  2FPE A;  1BB9 A;  3EGU A;  1ZUK A;  2A36 A;  2W10 A;  1QWF A;  2KEA A;  1WLP B;  2KRN A;  4J9I A;  1WA7 A;  3H0I A;  1AWX A;  1E6H A;  1SSH A;  2ABL A;  2V1R A;  2X3W D;  5IHN A;  2E5K A;  2EVR A;  1NLO C;  4OMQ A;  2CH4 A;  2RQW A;  1NEG A;  1ZBJ A;  2DL7 A;  2DX1 A;  4RTY A;  1CKB A;  2L0A A;  2NUZ A;  2YUN A;  3H41 A;  3UA6 A;  2FPF A;  1FYN A;  4ORZ A;  2AZV A;  1TUD A;  1SEM A;  4OMO A;  1M30 A;  3M0S A;  1PKS A;  2SEM A;  2CRE A;  3M0P A;  2CDT A;  2KXD A;  2D8J A;  2I0N A;  2KNB B;  2J7I A;  4OMP A;  1X2K A;  1GCQ C;  2EYX A;  2K3B A;  1X69 A;  2DBK A;  4HVU A;  2MOX A;  1PHT A;  3REA B;  4J9E A;  1GBR A;  1WFW A;  4M4Z A;  4RTU A;  2DE0 X;  4ESR A;  2HCK A;  1PRM C;  3UA7 A;  2ECZ A;  1ZSG A;  3I5R A;  1ABO A;  2K7A A;  2DL8 A;  1G83 A;  2BZY A;  1TG0 A;  2PTK A;  4CC3 A;  4EIK A;  2JXB A;  2GNC A;  3M0U A;  1JO8 A;  4F17 A;  1WXU A;  3O5Z A;  2DA9 A;  2O2O A;  1E7O A;  2J6K A;  3RNJ A;  1YCS B;  3EG2 A;  2EGC A;  4JJC A;  1NG2 A;  2CUD A;  2LX7 A;  3SEM A;  1QLY A;  4J9H A;  1VYT A;  1NYG A;  3M0T A;  2O9S A;  1WIE A;  1JQQ A;  1KJW A;  2EYW A;  4JZ3 A;  4J9D A;  3VS1 A;  4CC7 A;  4Z8A A;  2RQR A;  2XMF A;  2EBP A;  1Z9Q A;  1SHG A;  4AFQ C;  2LQW A;  1AEY A;  1X6B A;  2CT4 A;  1K0X A;  4LE9 A;  3PVL A;  2KT1 A;  2DIL A;  3H0H A;  2HEQ A;  5IXB A;  2HSP A;  2VKN A;  1YN8 A;  2HBW A;  4FSS A;  1AZG B;  4D8K A;  1PNJ A;  1WI7 A;  2GTO A;  2RQT A;  3VS3 A;  4F14 A;  2DVJ A;  4LUD A;  5ECA A;  3JV3 A;  2B86 A;  2JM8 A;  2LCS A;  2O88 A;  3RBB B;  3C0C A;  4Y92 A;  1VYU A;  4JPB W;  2JM9 A;  2D0N A;  1T3S A;  2DRK A;  2DJQ A;  2ESW A;  1RLP C;  2J6F A;  1PKT A;  3TSZ A;  2KBT A;  2JS2 A;  2D8H A;  2RF0 A;  2K6D A;  2A28 A;  1YP5 A;  2C0T A;  1IO6 A;  1X6G A;  1W6X A;  2JMC A;  1ZX6 A;  2DL3 A;  2LNH B;  1UG1 A;  2A37 A;  4AFZ C;  1NEB A;  2KYB A;  4AG2 C;  2V1Q A;  2J6O A;  2L3S A;  1NM7 A;  5HCK A;  4GLM A;  2L2P A;  1K4U S;  2VVK A;  2K2M A;  1X27 A;  1ZUY A;  2GGR A;  1M3A A;  1AWO A;  1UHF A;  1RLQ C;  2LJ0 A;  1ARK A;  3I5S A;  3VS5 A;  3VS7 A;  1M8M A;  1WYX A;  3TVT A;  1UTI A;  2JT4 A;  2ROT A;  2YUP A;  2LP5 A;  1GCQ A;  2KR3 A;  3VS0 A;  2CSQ A;  2RQV A;  4HCK A;  4F16 A;  1BBZ A;  3VRY A;  1I07 A;  1K1Z A;  3H0F A;  3IQL A;  1H8K A;  1X2Q A;  2O9V A;  2EQI A;  3KFV A;  4LNP A;  2DNU A;  1UFF A;  1WDX A;  2X3X D;  4A63 B;  2FPD A;  1OV3 A;  2L3P A;  4J9B A;  1KIK A;  1EFN A;  3THK A;  1VYV A;  2AZS A;  2CUB A;  1UJ0 A;  4OMN A;  2JW4 A;  1PRL C;  4RUG A;  2LQN A;  2YT6 A;  1MUZ A;  2AK5 A;  1NYF A;  2FRW A;  2DL4 A;  3TSW A;  1M3B A;  1GBQ A;  1TUC A;  5FWB A;  1YWO A;  1BK2 A;  4RTV A;  2JMA A;  2ROL A;  1OPL A;  2DF6 A;  2J06 A;  2YDL A;  4OML A;  3SHW A;  2FEI A;  4J9G A;  1I0C A;  3QWY A;  2HDA A;  1X43 A;  1AOJ A;  1OPK A;  2P4R A;  2EPD A;  5IHK A;  1HJD A;  2RN8 A;  5IHI A;  2K79 A;  2AKK A;  3REB B;  1SRM A;  2PZ1 A;  3EG1 A;  1M27 C;  1RI9 A;  2KRO A;  2SRC A;  1RUW A;  1T0H A;  2J05 A;  1JXO A;  1CKA A;  1UE9 A;  3NHN A;  2DRM A;  2KRM A;  4J9F A;  1QWE A;  1QKX A;  1HSQ A;  4LUE A;  1AWJ A;  5IH2 A;  3A98 A;  3UAT A;  2RMO A;  2EW3 A;  1OEB A;  4QT7 A;  2LMJ A;  1KFZ A;  1JU5 C;  2YUO A;  1U3O A;  5GJV B;  4AG1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...