1WFWA

Solution structure of sh3 domain of mouse kalirin-9a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kalirin-9a
publication title Solution structure of SH3 domain of mouse Kalirin-9a protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 6
structure length 74
sequence length 74
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wfwA00
4AFZC 1YNZA 2FPFA 2VWFA 2RN8A 2RQVA 5L23A 4RTZA 4Z88A 2L3SA 1WYXA 2J6KA 4F16A 1NM7A 2B86A 1QKXA 2KRMA 1JQQA 2DJQA 1KIKA 1T3LA 3KFVA 1WDXA 2CT4A 2EYWA 2LMJA 1X6GA 1MUZA 4X1VA 2QDLA 1E6GA 3NHNA 2GQIA 1PKTA 4WCIA 3UATA 5IXFA 2ROTA 1OOTA 2L3PA 3I5RA 2DYBA 2JS0A 3PVQA 3EG0A 2K79A 1WIEA 4RTTA 2SRCA 5IH2A 1K1ZA 2GTOA 3NMZC 2O88A 2LCSA 4F17A 4OMPA 1X2QA 2O31A 2O2OA 4LE9A 1UDLA 4M4ZA 1K0SA 3U23A 3LH5A 2L3QA 3M0QA 1W6XA 1JO8A 2K6DA 1XOVA 3UA7A 2LX7A 4HVUA 4KRTA 3FJ5A 1U5SA 5EC7A 2EKHA 5FWBA 2HEQA 2YSQA 1JU5C 3VS5A 1W70A 2CUDA 1AZGB 1NEGA 2FG0A 2W0ZA 3I35A 2DL3A 1CSKA 2RQUA 1ZUUA 4AFQC 3IQLA 2DMOA 4A63B 1K0XA 2LJ1A 2V1QA 1VYTA 5IHNA 3VS1A 4HVWA 2ESWA 1AEYA 3R6NA 4RTWA 2BZ8A 2YT6A 1HSQA 4LN2A 1VYVA 2KXDA 1ARKA 1M27C 3QWYA 1U3OA 1CKAA 2K9GA 4IIOA 1TUCA 1JXOA 2C0TA 3EHRA 1Y0MA 1K9AA 2DILA 4ESRA 2CSIA 3I5SA 4HVVA 2DRMA 3M0TA 2DNUA 2ENMA 3M0PA 4JZ4A 1UECA 3ULRB 2EVRA 1E7OA 1ZX6A 2LP5A 4J9HA 2YUOA 4FSSA 2KROA 4DEYA 1KSWA 2HSPA 2CREA 1RLQC 2YUNA 1PNJA 1ZSGA 2KGTA 5IXBA 2DL4A 4J9DA 1AWWA 1JEGA 4D8DA 4D8KA 2ECZA 2AZSA 2YDLA 3EHQA 2A08A 2KR3A 2EGAA 2F2VA 4J9GA 2JM8A 2HCKA 1AZEA 1ZUYA 2L2PA 2JM9A 5IHKA 2I0NA 2M0YA 2OAWA 1BU1A 3CQTA 1UHFA 2D8HA 1Z9ZA 2RQWA 1E6HA 1WA7A 2LNHB 2DF6A 2LZ6B 4GBQA 3ZL7C 2DL7A 3UA6A 4AFSC 5GJWB 1V1CA 3O5ZA 3VRZA 1RI9A 3M0UA 4E6RA 1WLPB 4LUEA 2RQRA 2RMOA 1T0JA 4JPBW 1ZBJA 1T0HA 1X69A 2GNCA 4AG1C 4J9IA 4CC2A 3TSWA 2L0AA 2JW4A 3THKA 1M30A 2F2XA 1W1FA 2KT8A 2CT3A 3VRYA 1NLPC 4RUGA 2MIOA 3VS2A 1GCPA 2D1XA 2FRWA 5ECAA 3EG1A 2ED0A 5I22A 1GCQA 1M3AA 1JXMA 1PWTA 1Z9QA 1S1NA 1Y57A 1WXBA 2A36A 1ZUKA 1GRIA 1SSHA 1GFDA 4EIKA 1NG2A 4J9FA 2KT1A 2KRNA 2K7AA 1UFFA 1QWEA 1UJ0A 1G2BA 4OMNA 1LCKA 5IHIA 1SRLA 3EG3A 1BB9A 2ROLA 3PVLA 1BBZA 2NUZA 4CC4B 2OI3A 2DM1A 1PRMC 3H0IA 2H8HA 2DE0X 2K3BA 3H41A 1UHCA 5FWCA 3M0RA 2K2MA 2VKNA 2EYXA 2CH4A 4HCKA 3SHWA 2BTTA 2KNBB 5GJVB 4Y92A 2CSQA 1U06A 2DRKA 2HDAA 1BK2A 1GBQA 1MV3A 1M3BA 1FYNA 1X2KA 2CUBA 2DBKA 2O9SA 1X43A 4RTVA 2EBPA 2G6FX 4CC7A 1CKBA 1YN8A 2BZXA 3VS3A 1VA7A 1M3CA 5HCKA 1UG1A 1ZLMA 2M51A 2EPDA 2PZ1A 1SHFA 2A37A 2J6OA 1QWFA 1K4US 2O9VA 1KJWA 4OMMA 1I1JA 1HJDA 1RUWA 4LNPA 2FPEA 1UE9A 4JJDA 2P4RA 3VS7A 2J6FA 4RTYA 1NLOC 2OJ2A 1NEBA 1PHTA 4J9CA 3I9QA 2EYZA 1AWXA 1PKSA 2YUPA 1T3SA 1NYFA 2IIMA 2RQTA 1UTIA 3VS6A 3VS4A 2VVKA 1SRMA 4OMLA 1M8MA 1WXTA 1K76A 3M0SA 4K11A 2D8JA 4Z89A 5I11A 4JJBA 2JS2A 2JXBA 1IO6A 1WX6A 4RTUA 1QCFA 3TSZA 3NPFA 4AG2C 1I0CA 1RLPC 1OPKA 2JMCA 1UJYA 1AWJA 2YUQA 1WI7A 1SHGA 2KYBA 1B3QA 4GLMA 3RBBB 1H3HA 2KBTA 4IIMA 2DVJA 2FO0A 2CH4W 1YWOA 4CC3A 2C0OA 3UF4A 2DLPA 2D0NA 1H8KA 2AK5A 2JT4A 2GBQA 2XMFA 1AOJA 2LQWA 4F14A 3EGUA 1A0NB 1QLYA 1OPLA 1X27A 4QT7A 2FEIA 4R0KA 3QWXX 2JTEA 2A28A 2DX1A 1B07A 1I07A 2DL5A 3H0HA 1SEMA 2AKKA 2J06A 1J3TA 1GFCA 3VS0A 5FW9A 2KEAA 1QKWA 2GTJA 4DEXA 1PRLC 2EGEA 1EFNA 1WFWA 2AKLA 1OEBA 1OV3A 2NWMA 1ABQA 2JMAA 1HD3A 2KXCA 4Z8AA 4JZ3A 2PTKA 2SEMA 1GBRA 4AFUC 3REBB 4JJCA 2BZYA 1KFZA 2J05A 3GBQA 1WXUA 4OMOA 3REAB 1SPKA 2RNAA 1GL5A 4HXJA 2MOXA 3SEMA 1H92A 1NYGA 2AZVA 2ED1A 3PE0A 1UGVA 2C0IA 1TUDA 3H0FA 2W10A 2RPNA 2DA9A 2KYMA 3TVTA 1AWOA 1GCQC 4OMQA 2J7IA 1AVZC 4J9BA 2CDTA 2GGRA 1VYUA 2DBMA 2KE9A 2EYYA 1TG0A 1FMKA 4LUDA 2EQIA 2X3XD 2FRYA 2LJ3A 4ORZA 4ZNXA 4J9EA 2EW3A 3A98A 1YCSB 2DL8A 2EGCA 3EG2A 2E5KA 3NGPA 1MV0B 1AD5A 3C0CA 2LJ0A 2LQNA 2KRSA 2ABLA 2PNIA 1G83A 2HBWA 2X3WD 3JV3A 2MCNA 1YWPA 2RF0A 2V1RA 1UUEA 2FPDA 3RNJA 1ABOA 1X6BA 2F2WA 1YP5A 4RTXA 1N5ZA
chains in the Genus database with same CATH superfamily
4AFZC 5IAYA 1ZSZC 1YNZA 5AT1B 2LNVA 2CP6A 2OX7A 3A8MB 3H9NA 3OQ5A 3UT1A 2B86A 2KRMA 4OB1B 1JQQA 1ZHIA 1ZQ1A 1T3LA 2EYWA 3PFSA 1C0MA 1O75A 1ZA2B 1IREB 4M7AF 3MO8A 4WCIA 1ACMB 1RAAB 3UATA 2JJ9A 1OZ2A 2WSCE 3RKYA 1RI0A 3SD4A 2DYBA 2JS0A 3VV0A 3EG0A 3OYHA 2JN0A 1P92A 3OYBA 3V8JA 2EFIA 4PLIA 4FT2A 1K1ZA 2HSEB 2GTOA 2QEXQ 3CEYA 4F17A 1IRXA 4LE9A 5J26A 2M9UA 3U23A 4M77B 2XU8A 2L3QA 3M0QA 1R0CB 1XOVA 5EC7A 3TCJA 1N8RR 1JU5C 4BE0A 2JVVA 1BCMA 1WJRA 3VKIA 1QMCA 1KD1C 4AFQC 1LOJA 2DMOA 4XU2A 4A63B 1K0XA 1MGQA 3MJXA 5AYFA 4LDWA 3M54A 3P8BB 1M1KU 5KYYB 1VQ5Q 5IHNA 4PJOG 2ZCFB 2ESWA 3LWIA 1S72A 2YT6A 1WNLA 3QJ6A 3CMAT 4LN2A 4KUDK 1VYVA 1M27C 3QWYA 3J80E 1G3SA 4IIOA 2RD1A 1TUCA 5LJ5f 4NOYA 3EHRA 1Y0MA 4QVCA 3DKMA 1YJ9Q 4BI8B 4ELYC 1K8AU 1QP3A 5CVIA 2RH2A 2F1LA 3DB4A 4E7JA 3M0PA 4JZ4A 3A8GB 2QYZA 1B7TA 3CCSQ 3JCMg 2EVRA 1PC0A 2EQMA 4E7SA 3L2ZA 4XTXA 2YUOA 4FSSA 2KROA 4M7AA 2RI3A 1KSWA 2YUNA 1PNJA 3CCQQ 5IXBA 1OU8A 3CPFA 2K5LA 2PVOB 2K2VA 2LT1A 1YI2T 2MWPA 2YDLA 2X9HA 3EHQA 1VQ8Q 2EGAA 2JTFA 2I2LA 3OS0A 1AZEA 2YRDA 4BDZA 2I0NA 2M0YA 2A0FB 1UHFA 2V8IA 1WHMA 3CCET 1XQHA 4PJOE 5DLQE 4PJNA 1G5VA 4E7LA 4OF1A 4LUEA 3G4SQ 4GLKA 5GAOp 1T0JA 4JPBW 4XU3A 1M30A 4OB0B 7AT1B 4FM4B 2E10A 4M77C 3VRYA 3CMET 3RUXA 3CCMT 2QQBA 2D1XA 4DOVA 2KY9A 1Q86C 1GCQA 1VQOQ 1PWTA 1Z9QA 1BKBA 2PVDB 5I2SA 4F7UF 1WXBA 3MHXA 2CZ1B 4MMKA 4MDXA 1I81A 1SSHA 3R6OA 1UFFA 1KC8C 1UJ0A 3FB9A 1UB4A 4M77D 2RHYA 1MMNA 1YI2A 4M78B 3BDUA 2E5QA 5D6YA 1YIJT 2H8HA 3QBYA 3QDRB 3H41A 4FYWB 5FWCA 2E4HA 3C94A 3Q1JA 4ATOA 3CC4A 1Y96A 2CH4A 2BTTA 1UGSB 3NFCA 2QQ9A 3CCEA 3MCAB 1SF9A 2DPPB 3H8ZA 3OA6A 3CCUT 4ZN3A 3L2QA 1X2KA 2DBKA 2Y90A 1YJNQ 1X43A 2CZ7B 4BACA 1M3CA 3BE3A 3KUFA 1H3ZA 4DA4A 2A37A 4QQDA 2J6OA 1I1JA 4C0DB 2YLCA 1TSFA 4X9DA 1RUWA 3CMEA 1X01A 1I8FA 2HNIA 5GMKm 3PMIA 2LCLA 3VS7A 5FU6B 1NLOC 2OJ2A 1C1AA 3GP8A 2E64A 3QO3A 1K9MR 3JB9F 1NYFA 2XDPA 5GAN6 2RQTA 5C0MA 2X35A 3OS1A 4XTZA 3VS4A 3INZA 2WSEE 5KCOA 2LCCA 4QQ6A 3OYIA 1Y96B 1SRMA 4OMLA 1NJIR 3M0SA 2D8JA 4Z89A 5I11A 2FZGB 2JXBA 3SB2A 1M9SA 3VYHB 4F7UA 4RTUA 1QCFA 4A4EA 4AG2C 1I0CA 1RLPC 1AWJA 1YIJA 5LJ5g 4M7AC 1WI7A 1SHGA 1YITT 1EX4A 1M1KC 2L3RA 4GLMA 1TOVA 4XK8E 2NUPB 2OTLQ 4MMLA 2C0OA 3UF4A 5GAOq 1H8KA 4J7FA 1N6AA 3CCUA 2HAXA 2M02A 3EGUA 1QLYA 2QQSA 5CAIA 3VUZA 2QQRA 3JB9J 3LWHA 2JTEA 3PMTA 1QP2A 3EFSA 3CCRT 2HQXA 3RESA 2D6FA 1K8AC 2RI5A 1QKWA 3QPHA 2GTJA 1JBMA 1ABQA 4F7UB 4JZ3A 4C92F 2SEMA 4J6WA 2E41A 2BZYA 1KFZA 3ZBDA 1Q81U 3GBQA 3OYMA 4JRIA 1SPKA 2RNAA 2DXTA 4HXJA 1BI1A 3I55T 2HMAA 1NYGA 4V2SA 3PE0A 1UGVA 2C0IA 4ZTFA 1TUDA 2RPNA 2QGFB 3BY7A 1U1SA 4M75F 1KHIA 1BI0A 1VQ6Q 1GCQC 4PNOA 4OMQA 5LJ3e 3QDFA 2K4YA 4J9BA 4M78D 3FC3A 3GF5A 2DBMA 4JRPA 2XI9A 4XTWA 3QYHB 2IG0A 1FMKA 1YITA 1I5OB 2VGMA 1QVGA 3PTAA 1SSFA 2HKNA 3L2UA 3I56Q 3P8HA 1VQLT 5KYUA 3EG2A 3OMCA 3GOXA 1HK9A 2KRSA 4ZTJA 1G83A 2HBWA 4J6XA 2X3WD 2MCNA 2ZPBB 5HK0A 3CCRA 1WQ7A 1X6BA 1O9SA 1NBEB 3MKDA 4X9CA 1AHJB 1YHQQ 2VWFA 3ASKA 1ZSZB 2RN8A 2CS7A 3SWNA 5KE3A 2QTXA 3G7ZA 4RTZA 5GAMe 4E7ZA 2EWNA 4QKUA 1NM7A 1BI3A 4E7IA 1OULA 3KFVA 2LTOA 5D6XA 3LX7A 4ZGDB 1MUZA 4X1VA 2OTJQ 3I55A 1M5Q1 2QEXT 1PKTA 3CCVQ 4C92A 2QXFA 5KYUB 2L3PA 3G6ET 4M77G 1YJWT 4NL3A 3MP6A 2P0PA 3HPWA 2K79A 1WIEA 1N27A 3M5AA 2DXCA 1OQKA 3HL8A 1QVGS 3NMZC 4L59A 2LQKA 1MMGA 1G3YA 4OMPA 3V8KA 1K73R 2O2OA 3HP9A 4M75A 4M4ZA 4Z02A 2DVEA 1WZOA 1TTHB 4JJNK 2VASA 2ZPIB 4KRTA 4NL2A 2EKHA 4EDUA 5FWBA 5GAOn 1W70A 1VQ5T 2CUDA 2PUKB 2AIRB 1QCOA 1QVGP 3I35A 1RACB 1CSKA 3IQLA 2L5QA 2E3IA 5FROA 2H3JA 3O8VA 2GCXA 2JOYA 3FIFA 5GAN2 2KDSA 2DTOA 2QQAA 3JCMQ 6AT1B 3VS1A 4HVWA 4C92B 3R6NA 4RTWA 3C4SA 4E47A 1D0ZA 2B8AA 1BI2A 5GAN7 1U3OA 3F70A 3CCST 2JUFA 1JXOA 1PSEA 2C0TA 2GF7A 2HQEA 3T9NA 3KXTA 2DILA 3VYGA 4FSXA 4M75B 2CSIA 2RJDA 4HVVA 3E2UA 3RMSA 1VQ4T 1VQ7Q 2PU9B 4M77E 5FU7B 4BY6C 3CCJA 3MEAA 4OP0A 4ELZC 1ZX6A 3G6EA 4LD6A 2HBPA 1YJWA 2YRVA 3MEUA 4MZMA 4KBMB 2QGGA 2HSPA 1VQ8T 5GANf 3OW2A 1V76A 2DL4A 1JJ2A 3JCMe 2BIVA 2AZSA 2EJ9A 3M55A 3S3MA 1Q82U 1VIFA 4FL6A 2A08A 4KH0B 2KR3A 2C06A 2HCKA 4DBRA 3G4ST 3A5ZB 1ZUYA 2L2PA 2IPOB 3DLLA 2OAWA 1W4SA 3CQTA 2D8HA 1ZBXA 2RQWA 1WA7A 1WHGA 2LZ6B 3EGXA 3UA6A 4AFSC 2FB7A 5GJWB 2KSSA 4C5IA 3O5ZA 3CC7Q 3VRZA 2QA4T 4PJJA 1RI9A 1VQPQ 3M0UA 1WLPB 5LJ3h 2RMOA 1M90C 2LT4A 1ZBJA 5LJ3d 1T0HA 1Q81C 3JB9D 1NPRA 4LD9K 4FIBA 4DQ2A 3MEWA 3TSWA 2L0AA 2E6NA 4JS5A 1WHKA 1VQOT 2RK2A 2EQUA 2F2XA 2E3HA 3OMGA 2D0QB 2X51A 4RUGA 1VQ4A 2RJEA 3SWNC 4EMKA 4OMFB 5ECAA 5CKBA 3C12A 1M3AA 1JXMA 4XU1A 1D1CA 1KHCA 3PIPA 1TXQA 1Q7YU 4B9WA 5DM7R 2A3LA 4RKUE 1VQMT 2A36A 3A8LB 4LXCA 5LL6S 1FMWA 4M78G 4FYYB 2FZKB 2PQWA 4JUVA 4RG2A 2DKGA 1NG2A 3CBMA 3EH2A 4E2FB 2Y4YA 3EGXB 4OMNA 2GFUA 5IHIA 4C92C 2VB6A 4QQGA 1BB9A 2RB6A 4KULA 3ZFJA 1BBZA 2NUZA 5GAMh 3C95A 5GAMd 2F5TX 3CXCA 1PRMC 3H0IA 3CPWA 1UHCA 2VXEA 1JJ2P 5FRNA 2BKDN 2K2MA 5GJVB 4M75C 2MWOA 1BK2A 4PJOF 1KQSA 4IKFA 5FU7C 2QA4A 4EMKB 2L89A 1RAHB 2O9SA 5HY6A 4C92D 2EBPA 1QVPA 4CC7A 2BZXA 3VS3A 5HCKA 1UG1A 2COYA 2Z0WA 3GLXA 3TEEA 4BUGA 1SHFA 1VQ9T 1G8XA 3LYIA 1AT1B 2COWA 5CR2A 3OY9A 2F69A 4OMMA 1HJDA 1Q86R 2FPEA 1UE9A 4AT1B 3HFOA 5I21A 4ME7A 1WHHA 3OBWA 3QG1A 4A4HA 2J6FA 3EH1A 2G3RA 2EAYA 2KAFA 4M7DF 2HZYA 2EYZA 2P0KA 2YUPA 4M78E 4KT0E 4E7KA 1VQMA 4A4FA 3JCMc 1KC8R 2CP0A 1M8MA 1RADB 1UGQB 1IO6A 3BW1A 2LVMA 4DBFA 2DXUA 1WX6A 5GAOr 2OTLT 2RHUA 3NPFA 3CMAA 1EIFA 1OPKA 5CQXA 2JMCA 2RM4A 3UDCA 2LRQA 1F1BB 4M7AB 1UGPB 3M9QA 1S72Q 1B3QA 3JCMb 4FW2A 5DLOA 3RBBB 2ZPGB 4IIMA 2DVJA 2FO0A 3FRNA 2CP2A 2CP7A 4UC4A 3OBYA 1X75C 4JRQA 2XMFA 1AOJA 3CPWP 4F14A 3UWNA 5LJ5e 4HA8A 1A0NB 2Y4XA 3RERA 2NUTA 2DL5A 3FDRA 2AKKA 4PJOA 1KQSP 3QHSA 4F7UG 5GANg 1VQ9A 2E1HA 5FW9A 3PNWC 3JCMh 4DEXA 3CD6T 3JCMd 1EFNA 2DETA 4IUPA 2AKLA 5LJ3j 1OV3A 1C6VX 4FW1A 3FJPA 1QW1A 2JMAA 2KXCA 4FT4A 2XHCA 3EGDA 1VQNT 1TU0B 4IUTA 1GBRA 4AFUC 1BCOA 3REBB 2DIGA 2J05A 3S6WA 2VYTA 3JCMW 2DAQA 4NS5A 4C0ZA 4C8QF 2EQKA 1Y71A 1Q82C 4M7DA 1BYMA 3PIOA 2DA9A 3TVTA 3MEVA 4EMKC 3OS2A 4IURA 1AVZC 1OZ3A 1M1KR 2NUTB 1YCYA 4N0AA 1D09B 2E70A 4IUVA 3DLMA 4BD3A 2X3XD 4MZPA 5GAN4 1VQKT 2XIDA 2FRYA 4ZNXA 4ORZA 5GAOm 5GAMj 1MMDA 1W2BA 2DL8A 2EGCA 3CCMA 4J6YA 3NGPA 2LQ8A 3C0CA 2LQNA 3EGDB 4F7UE 4DBHA 4F04B 3JB9G 1K8AR 4LDYA 8ATCB 4CI0C 5CK9A 2E65A 2DZCA 2R5AA 2EIFA 2FPDA 1ABOA 3AHUA 1N9RA 2O01E 9ATCB 1YP5A 1J3TA 1N5ZA 3RMQA 4E7HA 2FPFA 4M7DB 3CD6A 3ZEHA 5GAN3 2DO3A 1Y07A 1Q7YC 1U1TA 4OGCA 4Z88A 5L23A 2J6KA 3CCVT 4F16A 1HXDA 2DJQA 5KYWA 1VQNA 1KIKA 2CT4A 3G1JA 1X6GA 3HHTB 3VJPA 1E6GA 1YI2Q 3NHNA 5J3BA 3J81E 1WJSA 3GIBA 1WQWA 5D6WA 4KGXB 1PD1A 4PJMA 1K73U 3OSSC 1IB8A 3CC4Q 2BUDA 2HQHA 3LGLA 1PCXA 2SRCA 3CCEQ 4C8QA 2LCSA 2EJGA 2MI6A 1X2QA 4M7AD 1FXXA 3VU3C 4B6MA 1VQKA 1JO8A 3UA7A 4HVUA 3FJ5A 3OYNA 2V8JA 3BDLA 1AZGB 1NEGA 3OSVA 4C92G 4DBQA 5CCAA 1M90U 1RAGB 1N9SA 3WVEB 1VUBA 3CC2T 2RA2A 3CMEQ 1OU9A 3EAEA 1W2BP 1DJ7B 1M1FA 2V1QA 3CCLT 3P8DA 1VYTA 3MPUB 4M75G 5J39A 3G71T 4A53A 1QVFA 1D3BA 1WHLA 3OYJA 4PJOC 2HL5C 4C8QB 1XJWB 4TVRA 1PG5B 2QDYB 2HL3A 4ZGJB 2DD5A 4ESRA 1FMVA 3I5SA 2DRMA 2DNUA 2ENMA 1YIJQ 1PD0A 3L1AA 2DD4A 3FEOA 3PT9A 4BY6B 5LJ5h 2LP5A 5LJ5d 4J9HA 3RKXA 8AT1B 3MP8A 4ZGEB 3RR6A 3M56A 2CREA 3GNFB 3H6ZA 3CCUQ 1ZA1B 1ZSGA 1M2VA 3ME9A 4M7DC 1JEGA 4D8DA 4C92E 1I4K1 3CC7T 2F2VA 1VQPT 1MNDA 2ZPFB 2DZ9A 4N0AC 2JM9A 3CC2A 3GNGA 1Z9ZA 3X20B 4BI3A 4JDSA 2DL7A 3HRTA 3ZL7C 3CCLA 2E12A 3L2RA 1V1CA 4M75E 3A1PA 3V7CA 4M7DD 4OGEA 1TWBA 1X69A 2GNCA 2X4YA 4OB2B 4AG1C 4J9IA 4CC2A 2ZZDA 3G71A 3VUBA 2JW4A 3THKA 1N8RU 3D7SB 1UGRB 1W1FA 2YLBA 2KT8A 3M58A 2CT3A 3RKWA 3VS2A 1H641 3CBPA 4MZTA 3SWNB 1VQLA 1M1GA 1YITQ 2K57A 2WSFE 2ZPHB 1Y57A 2R57A 3LW5E 2EQJA 2KVQG 1R0BG 3M4YA 1GRIA 1GFDA 4EIKA 4J9FA 2KT1A 3UPUA 1QWEA 4BDYA 1G2BA 1SRLA 3PVLA 1YJ9T 2MPXC 2OI3A 2HD0A 3CCRQ 5IN1A 3HRSA 3RIRA 4C8QC 2DYIA 3M0RA 3BFMA 3SHWA 4IUUA 4LDXA 4B9XA 1U06A 4HT9A 2DRKA 3OS5A 5CKDA 3J7AF 2QEXA 4HKEA 1KK7A 1MV3A 1Q81R 1M3BA 3QKJA 5D7UA 3CCQT 1FYNA 4PLLA 3JSCA 1CKBA 5GMKe 1YN8A 4A4GA 5EG2A 2NYSA 3I55Q 1ZLMA 4A4KA 4YTLA 2M51A 4J8OA 3QIIA 4BB7A 1G3WA 1K4US 2O9VA 1KJWA 4C8QD 2FHDA 5KYXA 1K73C 4BE1A 4HCCA 4JJDA 4GY5A 2DERA 2CP5A 2R5MA 4RTYA 3X28B 5A0GA 1PHTA 3I9QA 5L8RE 1KD1R 1PKSA 5KH6A 1VQ5A 2IIMA 1WJQA 1UTIA 3V8LA 3VS6A 2DJZA 4EMHA 1WXTA 4K11A 4JJBA 1S72T 2JS2A 4M7AG 3A8OB 1M8VA 4JLIA 5LJ5j 1YJ9A 1RL2A 3RDVA 3WVDB 1QCNA 4BI4A 1NPPA 1SKUB 3M53A 3CCSA 3JCMV 4FYXB 2KYBA 4Q5WA 5DY9A 4AMCA 1H3HA 2KBTA 2CH4W 4BE2A 5KYYA 5KYXB 4XU0A 4CC3A 3S3OA 2YRCA 2DXBA 2D0NA 1RAFB 2CZ6B 4ANJA 3AT1B 3CCQA 1OPLA 1X27A 2ZAEA 2FEIA 3OYYA 1SG5A 2CKKA 2PVGB 3QWXX 4PKCC 2A28A 2CZ0B 2DX1A 3H0HA 2J06A 3OW2S 2E6ZA 4HT8A 3QYGB 1GFCA 3VS0A 3CCJQ 1VQ8A 2KEAA 1JJ2S 3G6EQ 1PRLC 1YJWQ 1UEBA 2DTIA 1WFWA 2FZCB 1OI1A 4OB3B 4P5NA 1OEBA 3V7RA 5M9OA 2GQVA 1HD3A 4Z8AA 3TREA 4FU6A 4J5YA 2PTKA 5GANe 3OW2P 4JJCA 3SFMA 1PSFA 3OYLA 4M78F 3REAB 1YJNT 3G4SA 2O4XA 2L8DA 4M7AE 2AZVA 2P0QA 2RHZA 3H0FA 4XAXB 2W10A 3L2VA 1AWOA 2RI2A 1IGQA 2J7IA 2VXFA 2AHJB 2CDTA 2GGRA 3HFNA 4IUQA 2YHTA 1VYUA 2CYZB 3OYKA 2EYYA 3QZ5B 1VQOA 2EQIA 2FVUA 3OYGA 1K9MU 4J9EA 4M75D 2EW3A 3A98A 5A0LA 1JRIA 5KCHA 3X25B 2E5KA 3OYDA 1MV0B 2JTMA 1AD5A 2LJ0A 1NJIU 2XICA 4M7DG 4XTUA 2ABLA 1N8RC 1LJOA 2D9TA 2PNIA 2DIQA 4C0GA 3JV3A 1I5LA 2ZPEB 4PFZA 1VQ4Q 2V1RA 1UUEA 2QI2A 3RNJA 2O4XB 2M16A 2F2WA 1NZ9A 2QASA 2KQWA 2BE7D 1M2OA 3JB9H 1WGSA 2RQVA 3CBOA 2XK0A 3CXCS 2L3SA 1WYXA 2KK4A 2K3YA 1MHNA 1QKXA 4KGZB 3URGA 3CPWS 1WHJA 1WDXA 3CC4T 2LMJA 4PFPA 1YJNA 1IGUA 4HCZA 2QAZA 5CKHA 1Q82R 5GAN5 2QDLA 3L42A 2A7YA 1M4ZA 3NTHA 1KQSS 3E1SA 2GQIA 2RJCA 2IVWA 4ZN1A 3CXCP 1VIEA 4D6WA 5IXFA 4J7IA 2ROTA 1TS9A 4J83A 1OOTA 2MAMA 4M78A 3I5RA 5GMKh 3M57A 3PVQA 4QVDA 4XQ3A 4RTTA 5IH2A 2LX9A 3OYCA 3X24B 2O88A 4PL6A 4L5GA 2QA4Q 2O31A 1UDLA 1K0SA 3OYFA 3QSUA 1Y7XA 3LH5A 2V26A 1W6XA 2K6DA 2LX7A 3E19A 1U5SA 2HEQA 2YSQA 4M7DE 3VS5A 5GAOl 4C0FA 1EZZB 2LC4A 5GMKl 2RJFA 2FG0A 2W0ZA 5CKEA 2DL3A 2RQUA 1ZUUA 3JRZA 1VQ6T 5HKCA 2X4WA 3FLGA 1FWZA 1R77A 2X4JA 2LDMA 1Q7YR 2LJ1A 3M4GA 1WPYA 4C8QG 1AEYA 2YXYA 4C5GA 2BZ8A 4WTOB 1D1AA 1VQMQ 1HSQA 3OB9A 4RCBA 1IHWA 2KXDA 5GMKi 1ARKA 4QVZA 3TU4K 1OYXA 2OTLA 1CKAA 2JZ2A 3I56T 2K9GA 3WXMB 3LGFA 1GXIE 5KYNA 5FRMA 4PJOB 1K9AA 4HCBA 3JB9I 3CMAQ 2VV5A 4R56A 3M0TA 1UECA 3ULRB 1E7OA 3OYAA 1JB0E 3EFRA 1YHQT 2RO0A 4DEYA 3HSBA 2K5IA 3EG9A 3X26B 1RLQC 1RAIB 4Y28E 1IXDA 2M0OA 2HKQB 2KGTA 2NUPA 4J9DA 2DFUA 4Y91A 1NE8A 1AWWA 4D8KA 4C5EA 1YBYA 3META 2ECZA 5CQYA 3QUIA 2OTJT 1VQ9Q 1BIAA 5GANh 2XDDA 2X4XA 4J9GA 1RABB 2JM8A 5GANd 5LJ3f 2XKOC 4KGVB 5IHKA 1VQ6A 1BU1A 1G3TA 5CO7A 3E9FA 4C8QE 1E6HA 2LNHB 2DF6A 4GBQA 2GFAA 5IT9E 2R58A 2RHIA 4RG8A 3QJYA 3LLRA 2YWWA 3OYEA 4E6RA 2RQRA 3TQ7P 1Q95G 4C5HA 4QW2A 2XDBA 2BE9B 1B34A 3I56A 1V29B 3EG9B 2KMTA 3GPLA 4PFOA 1TUGB 1NLPC 3EFOA 4JS4A 2VUBA 1MNEA 1W2BS 4WF2A 2MIOA 1GCPA 2FRWA 1IHVA 3EG1A 1OX8A 2ED0A 5I22A 4KUIA 1YHQA 1S1NA 3NTKA 5GAMf 2ZGWA 1KG1A 4VUBA 5KYWB 1ZUKA 1K9MC 2JNGA 3CCMQ 2H3EB 3M59A 2K7AA 2KRNA 5A2QE 4O6JA 1LCKA 3EG3A 2ROLA 1D1BA 2DEUA 1NJIC 5GMKj 4CC4B 4M78C 5C6SA 2OTJA 5HK3A 2VGNA 3NTIA 2DM1A 1VQ7T 3CCVA 1FX7A 4KH1B 2DE0X 1B34B 2K3BA 3CD6Q 3JAME 3E9GA 2VKNA 2DTHA 2EYXA 4HCKA 1VOMA 3JCMJ 2KNBB 4Y92A 5CKFA 2CSQA 1OX9A 3V7SA 2HDAA 2EYQA 1GBQA 1ZSZA 3EFOB 1VQNQ 1PM3A 2CGHA 2DEQA 1X6OA 4RMOA 2CUBA 3MP1A 4RTVA 4LDUA 2G6FX 1TH7A 1VA7A 2COZA 1D0YA 1QQJA 2V8KA 4LDVA 2EPDA 2PZ1A 4C0DC 1QWFA 1KD1U 4PJOD 4LNPA 3SDZA 5FU6C 2MK5A 3S3NA 3DB3A 2P4RA 4FYVB 1NEBA 2K5FA 4J9CA 4XTYA 3PGGA 1XNIA 4EPCA 1AWXA 4FCYA 1T3SA 1VQKQ 1D3BB 4A54A 4DOWA 3HRUA 5CIUA 2XD0A 2VVKA 2FL7A 1BIBA 4RCCA 1K76A 4JLGA 4O5VA 2MYSA 4II1A 4OVAA 4CRIA 2CP3A 3TSZA 1KQ2A 4R55A 1QVFS 1VQ7A 4N4GA 1UJYA 2YUQA 4PJLA 5FLXE 1R8OB 4MDWA 1M2VB 1YWOA 2P84A 5A0DA 2DLPA 3CCJT 3QZ9B 2OAUA 2AK5A 2JT4A 2GBQA 2EJFA 1QVFP 2LQWA 2KI7A 4M77F 3JCMf 5GANj 1HYOA 2QK0A 2RHXA 1D0XA 1LPLA 4QT7A 3HTRA 4R0KA 4JRKA 2EKOA 1B07A 1I07A 1SEMA 2AT1B 5GAN8 2VC8A 4N4HA 3QXEB 1XTDA 2EGEA 2P4TA 2NWMA 4EMGA 2K3XA 2QTVA 2PUOB 1IZ6A 1RAEB 2MF2A 3CC7A 2F5KA 2RK1A 5LJ3g 1VQPA 1WXUA 4OMOA 1GL5A 4X34A 2MOXA 2WACA 3SEMA 1H92A 2ED1A 1LVKA 2KYMA 1M90R 3KBGA 3JCMP 3CC2Q 1U8RA 3L2WA 1LNXA 1Q86U 2KE9A 3CCLQ 1KQ1A 1TG0A 3HKSA 4N4IA 3ER0A 4LUDA 2MMPA 2FYKA 4PK4A 1MMAA 3JCMX 4L6V5 2LJ3A 2XG8D 4XTVA 5KE2A 3G71Q 3A8HB 1YCSB 1KC8U 1YFNA 2DK3A 5I2MA 5GAMg 3N5BB 2QG9B 2ATCB 2M1HA 1YWPA 2RF0A 2NLUA 3LH0A 1VQLQ 4M77A 4RTXA
chains in the Genus database with same CATH topology
4AFZC 1YNZA 2FPFA 2VWFA 2RN8A 2RQVA 5L23A 4RTZA 4Z88A 2L3SA 1WYXA 2J6KA 4F16A 1NM7A 2B86A 1QKXA 2KRMA 1JQQA 2DJQA 1KIKA 1T3LA 3KFVA 1WDXA 2CT4A 2EYWA 2LMJA 1X6GA 1MUZA 4X1VA 2QDLA 1E6GA 3NHNA 2GQIA 1PKTA 4WCIA 3UATA 5IXFA 2ROTA 1OOTA 2L3PA 3I5RA 2DYBA 2JS0A 3PVQA 3EG0A 2K79A 1WIEA 4RTTA 2SRCA 5IH2A 1K1ZA 2GTOA 3NMZC 2O88A 2LCSA 4F17A 4OMPA 1X2QA 2O31A 2O2OA 4LE9A 1UDLA 4M4ZA 1K0SA 3U23A 3LH5A 2L3QA 3M0QA 1W6XA 1JO8A 2K6DA 1XOVA 3UA7A 2LX7A 4HVUA 4KRTA 3FJ5A 1U5SA 5EC7A 2EKHA 5FWBA 2HEQA 2YSQA 1JU5C 3VS5A 1W70A 2CUDA 1AZGB 1NEGA 2FG0A 2W0ZA 3I35A 2DL3A 1CSKA 2RQUA 1ZUUA 4AFQC 3IQLA 2DMOA 4A63B 1K0XA 2LJ1A 2V1QA 1VYTA 5IHNA 3VS1A 4HVWA 2ESWA 1AEYA 3R6NA 4RTWA 2BZ8A 2YT6A 1HSQA 4LN2A 1VYVA 2KXDA 1ARKA 1M27C 3QWYA 1U3OA 1CKAA 2K9GA 4IIOA 1TUCA 1JXOA 2C0TA 3EHRA 1Y0MA 1K9AA 2DILA 4ESRA 2CSIA 3I5SA 4HVVA 2DRMA 3M0TA 2DNUA 2ENMA 3M0PA 4JZ4A 1UECA 3ULRB 2EVRA 1E7OA 1ZX6A 2LP5A 4J9HA 2YUOA 4FSSA 2KROA 4DEYA 1KSWA 2HSPA 2CREA 1RLQC 2YUNA 1PNJA 1ZSGA 2KGTA 5IXBA 2DL4A 4J9DA 1AWWA 1JEGA 4D8DA 4D8KA 2ECZA 2AZSA 2YDLA 3EHQA 2A08A 2KR3A 2EGAA 2F2VA 4J9GA 2JM8A 2HCKA 1AZEA 1ZUYA 2L2PA 2JM9A 5IHKA 2I0NA 2M0YA 2OAWA 1BU1A 3CQTA 1UHFA 2D8HA 1Z9ZA 2RQWA 1E6HA 1WA7A 2LNHB 2DF6A 2LZ6B 4GBQA 3ZL7C 2DL7A 3UA6A 4AFSC 5GJWB 1V1CA 3O5ZA 3VRZA 1RI9A 3M0UA 4E6RA 1WLPB 4LUEA 2RQRA 2RMOA 1T0JA 4JPBW 1ZBJA 1T0HA 1X69A 2GNCA 4AG1C 4J9IA 4CC2A 3TSWA 2L0AA 2JW4A 3THKA 1M30A 2F2XA 1W1FA 2KT8A 2CT3A 3VRYA 1NLPC 4RUGA 2MIOA 3VS2A 1GCPA 2D1XA 2FRWA 5ECAA 3EG1A 2ED0A 5I22A 1GCQA 1M3AA 1JXMA 1PWTA 1Z9QA 1S1NA 1Y57A 1WXBA 2A36A 1ZUKA 1GRIA 1SSHA 1GFDA 4EIKA 1NG2A 4J9FA 2KT1A 2KRNA 2K7AA 1UFFA 1QWEA 1UJ0A 1G2BA 4OMNA 1LCKA 5IHIA 1SRLA 3EG3A 1BB9A 2ROLA 3PVLA 1BBZA 2NUZA 4CC4B 2OI3A 2DM1A 1PRMC 3H0IA 2H8HA 2DE0X 2K3BA 3H41A 1UHCA 5FWCA 3M0RA 2K2MA 2VKNA 2EYXA 2CH4A 4HCKA 3SHWA 2BTTA 2KNBB 5GJVB 4Y92A 2CSQA 1U06A 2DRKA 2HDAA 1BK2A 1GBQA 1MV3A 1M3BA 1FYNA 1X2KA 2CUBA 2DBKA 2O9SA 1X43A 4RTVA 2EBPA 2G6FX 4CC7A 1CKBA 1YN8A 2BZXA 3VS3A 1VA7A 1M3CA 5HCKA 1UG1A 1ZLMA 2M51A 2EPDA 2PZ1A 1SHFA 2A37A 2J6OA 1QWFA 1K4US 2O9VA 1KJWA 4OMMA 1I1JA 1HJDA 1RUWA 4LNPA 2FPEA 1UE9A 4JJDA 2P4RA 3VS7A 2J6FA 4RTYA 1NLOC 2OJ2A 1NEBA 1PHTA 4J9CA 3I9QA 2EYZA 1AWXA 1PKSA 2YUPA 1T3SA 1NYFA 2IIMA 2RQTA 1UTIA 3VS6A 3VS4A 2VVKA 1SRMA 4OMLA 1M8MA 1WXTA 1K76A 3M0SA 4K11A 2D8JA 4Z89A 5I11A 4JJBA 2JS2A 2JXBA 1IO6A 1WX6A 4RTUA 1QCFA 3TSZA 3NPFA 4AG2C 1I0CA 1RLPC 1OPKA 2JMCA 1UJYA 1AWJA 2YUQA 1WI7A 1SHGA 2KYBA 1B3QA 4GLMA 3RBBB 1H3HA 2KBTA 4IIMA 2DVJA 2FO0A 2CH4W 1YWOA 4CC3A 2C0OA 3UF4A 2DLPA 2D0NA 1H8KA 2AK5A 2JT4A 2GBQA 2XMFA 1AOJA 2LQWA 4F14A 3EGUA 1A0NB 1QLYA 1OPLA 1X27A 4QT7A 2FEIA 4R0KA 3QWXX 2JTEA 2A28A 2DX1A 1B07A 1I07A 2DL5A 3H0HA 1SEMA 2AKKA 2J06A 1J3TA 1GFCA 3VS0A 5FW9A 2KEAA 1QKWA 2GTJA 4DEXA 1PRLC 2EGEA 1EFNA 1WFWA 2AKLA 1OEBA 1OV3A 2NWMA 1ABQA 2JMAA 1HD3A 2KXCA 4Z8AA 4JZ3A 2PTKA 2SEMA 1GBRA 4AFUC 3REBB 4JJCA 2BZYA 1KFZA 2J05A 3GBQA 1WXUA 4OMOA 3REAB 1SPKA 2RNAA 1GL5A 4HXJA 2MOXA 3SEMA 1H92A 1NYGA 2AZVA 2ED1A 3PE0A 1UGVA 2C0IA 1TUDA 3H0FA 2W10A 2RPNA 2DA9A 2KYMA 3TVTA 1AWOA 1GCQC 4OMQA 2J7IA 1AVZC 4J9BA 2CDTA 2GGRA 1VYUA 2DBMA 2KE9A 2EYYA 1TG0A 1FMKA 4LUDA 2EQIA 2X3XD 2FRYA 2LJ3A 4ORZA 4ZNXA 4J9EA 2EW3A 3A98A 1YCSB 2DL8A 2EGCA 3EG2A 2E5KA 3NGPA 1MV0B 1AD5A 3C0CA 2LJ0A 2LQNA 2KRSA 2ABLA 2PNIA 1G83A 2HBWA 2X3WD 3JV3A 2MCNA 1YWPA 2RF0A 2V1RA 1UUEA 2FPDA 3RNJA 1ABOA 1X6BA 2F2WA 1YP5A 4RTXA 1N5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFZ C;  1YNZ A;  2FPF A;  2VWF A;  2RN8 A;  2RQV A;  5L23 A;  4RTZ A;  4Z88 A;  2L3S A;  1WYX A;  2J6K A;  4F16 A;  1NM7 A;  2B86 A;  1QKX A;  2KRM A;  1JQQ A;  2DJQ A;  1KIK A;  1T3L A;  3KFV A;  1WDX A;  2CT4 A;  2EYW A;  2LMJ A;  1X6G A;  1MUZ A;  4X1V A;  2QDL A;  1E6G A;  3NHN A;  2GQI A;  1PKT A;  4WCI A;  3UAT A;  5IXF A;  2ROT A;  1OOT A;  2L3P A;  3I5R A;  2DYB A;  2JS0 A;  3PVQ A;  3EG0 A;  2K79 A;  1WIE A;  4RTT A;  2SRC A;  5IH2 A;  1K1Z A;  2GTO A;  3NMZ C;  2O88 A;  2LCS A;  4F17 A;  4OMP A;  1X2Q A;  2O31 A;  2O2O A;  4LE9 A;  1UDL A;  4M4Z A;  1K0S A;  3U23 A;  3LH5 A;  2L3Q A;  3M0Q A;  1W6X A;  1JO8 A;  2K6D A;  1XOV A;  3UA7 A;  2LX7 A;  4HVU A;  4KRT A;  3FJ5 A;  1U5S A;  5EC7 A;  2EKH A;  5FWB A;  2HEQ A;  2YSQ A;  1JU5 C;  3VS5 A;  1W70 A;  2CUD A;  1AZG B;  1NEG A;  2FG0 A;  2W0Z A;  3I35 A;  2DL3 A;  1CSK A;  2RQU A;  1ZUU A;  4AFQ C;  3IQL A;  2DMO A;  4A63 B;  1K0X A;  2LJ1 A;  2V1Q A;  1VYT A;  5IHN A;  3VS1 A;  4HVW A;  2ESW A;  1AEY A;  3R6N A;  4RTW A;  2BZ8 A;  2YT6 A;  1HSQ A;  4LN2 A;  1VYV A;  2KXD A;  1ARK A;  1M27 C;  3QWY A;  1U3O A;  1CKA A;  2K9G A;  4IIO A;  1TUC A;  1JXO A;  2C0T A;  3EHR A;  1Y0M A;  1K9A A;  2DIL A;  4ESR A;  2CSI A;  3I5S A;  4HVV A;  2DRM A;  3M0T A;  2DNU A;  2ENM A;  3M0P A;  4JZ4 A;  1UEC A;  3ULR B;  2EVR A;  1E7O A;  1ZX6 A;  2LP5 A;  4J9H A;  2YUO A;  4FSS A;  2KRO A;  4DEY A;  1KSW A;  2HSP A;  2CRE A;  1RLQ C;  2YUN A;  1PNJ A;  1ZSG A;  2KGT A;  5IXB A;  2DL4 A;  4J9D A;  1AWW A;  1JEG A;  4D8D A;  4D8K A;  2ECZ A;  2AZS A;  2YDL A;  3EHQ A;  2A08 A;  2KR3 A;  2EGA A;  2F2V A;  4J9G A;  2JM8 A;  2HCK A;  1AZE A;  1ZUY A;  2L2P A;  2JM9 A;  5IHK A;  2I0N A;  2M0Y A;  2OAW A;  1BU1 A;  3CQT A;  1UHF A;  2D8H A;  1Z9Z A;  2RQW A;  1E6H A;  1WA7 A;  2LNH B;  2DF6 A;  2LZ6 B;  4GBQ A;  3ZL7 C;  2DL7 A;  3UA6 A;  4AFS C;  5GJW B;  1V1C A;  3O5Z A;  3VRZ A;  1RI9 A;  3M0U A;  4E6R A;  1WLP B;  4LUE A;  2RQR A;  2RMO A;  1T0J A;  4JPB W;  1ZBJ A;  1T0H A;  1X69 A;  2GNC A;  4AG1 C;  4J9I A;  4CC2 A;  3TSW A;  2L0A A;  2JW4 A;  3THK A;  1M30 A;  2F2X A;  1W1F A;  2KT8 A;  2CT3 A;  3VRY A;  1NLP C;  4RUG A;  2MIO A;  3VS2 A;  1GCP A;  2D1X A;  2FRW A;  5ECA A;  3EG1 A;  2ED0 A;  5I22 A;  1GCQ A;  1M3A A;  1JXM A;  1PWT A;  1Z9Q A;  1S1N A;  1Y57 A;  1WXB A;  2A36 A;  1ZUK A;  1GRI A;  1SSH A;  1GFD A;  4EIK A;  1NG2 A;  4J9F A;  2KT1 A;  2KRN A;  2K7A A;  1UFF A;  1QWE A;  1UJ0 A;  1G2B A;  4OMN A;  1LCK A;  5IHI A;  1SRL A;  3EG3 A;  1BB9 A;  2ROL A;  3PVL A;  1BBZ A;  2NUZ A;  4CC4 B;  2OI3 A;  2DM1 A;  1PRM C;  3H0I A;  2H8H A;  2DE0 X;  2K3B A;  3H41 A;  1UHC A;  5FWC A;  3M0R A;  2K2M A;  2VKN A;  2EYX A;  2CH4 A;  4HCK A;  3SHW A;  2BTT A;  2KNB B;  5GJV B;  4Y92 A;  2CSQ A;  1U06 A;  2DRK A;  2HDA A;  1BK2 A;  1GBQ A;  1MV3 A;  1M3B A;  1FYN A;  1X2K A;  2CUB A;  2DBK A;  2O9S A;  1X43 A;  4RTV A;  2EBP A;  2G6F X;  4CC7 A;  1CKB A;  1YN8 A;  2BZX A;  3VS3 A;  1VA7 A;  1M3C A;  5HCK A;  1UG1 A;  1ZLM A;  2M51 A;  2EPD A;  2PZ1 A;  1SHF A;  2A37 A;  2J6O A;  1QWF A;  1K4U S;  2O9V A;  1KJW A;  4OMM A;  1I1J A;  1HJD A;  1RUW A;  4LNP A;  2FPE A;  1UE9 A;  4JJD A;  2P4R A;  3VS7 A;  2J6F A;  4RTY A;  1NLO C;  2OJ2 A;  1NEB A;  1PHT A;  4J9C A;  3I9Q A;  2EYZ A;  1AWX A;  1PKS A;  2YUP A;  1T3S A;  1NYF A;  2IIM A;  2RQT A;  1UTI A;  3VS6 A;  3VS4 A;  2VVK A;  1SRM A;  4OML A;  1M8M A;  1WXT A;  1K76 A;  3M0S A;  4K11 A;  2D8J A;  4Z89 A;  5I11 A;  4JJB A;  2JS2 A;  2JXB A;  1IO6 A;  1WX6 A;  4RTU A;  1QCF A;  3TSZ A;  3NPF A;  4AG2 C;  1I0C A;  1RLP C;  1OPK A;  2JMC A;  1UJY A;  1AWJ A;  2YUQ A;  1WI7 A;  1SHG A;  2KYB A;  1B3Q A;  4GLM A;  3RBB B;  1H3H A;  2KBT A;  4IIM A;  2DVJ A;  2FO0 A;  2CH4 W;  1YWO A;  4CC3 A;  2C0O A;  3UF4 A;  2DLP A;  2D0N A;  1H8K A;  2AK5 A;  2JT4 A;  2GBQ A;  2XMF A;  1AOJ A;  2LQW A;  4F14 A;  3EGU A;  1A0N B;  1QLY A;  1OPL A;  1X27 A;  4QT7 A;  2FEI A;  4R0K A;  3QWX X;  2JTE A;  2A28 A;  2DX1 A;  1B07 A;  1I07 A;  2DL5 A;  3H0H A;  1SEM A;  2AKK A;  2J06 A;  1J3T A;  1GFC A;  3VS0 A;  5FW9 A;  2KEA A;  1QKW A;  2GTJ A;  4DEX A;  1PRL C;  2EGE A;  1EFN A;  1WFW A;  2AKL A;  1OEB A;  1OV3 A;  2NWM A;  1ABQ A;  2JMA A;  1HD3 A;  2KXC A;  4Z8A A;  4JZ3 A;  2PTK A;  2SEM A;  1GBR A;  4AFU C;  3REB B;  4JJC A;  2BZY A;  1KFZ A;  2J05 A;  3GBQ A;  1WXU A;  4OMO A;  3REA B;  1SPK A;  2RNA A;  1GL5 A;  4HXJ A;  2MOX A;  3SEM A;  1H92 A;  1NYG A;  2AZV A;  2ED1 A;  3PE0 A;  1UGV A;  2C0I A;  1TUD A;  3H0F A;  2W10 A;  2RPN A;  2DA9 A;  2KYM A;  3TVT A;  1AWO A;  1GCQ C;  4OMQ A;  2J7I A;  1AVZ C;  4J9B A;  2CDT A;  2GGR A;  1VYU A;  2DBM A;  2KE9 A;  2EYY A;  1TG0 A;  1FMK A;  4LUD A;  2EQI A;  2X3X D;  2FRY A;  2LJ3 A;  4ORZ A;  4ZNX A;  4J9E A;  2EW3 A;  3A98 A;  1YCS B;  2DL8 A;  2EGC A;  3EG2 A;  2E5K A;  3NGP A;  1MV0 B;  1AD5 A;  3C0C A;  2LJ0 A;  2LQN A;  2KRS A;  2ABL A;  2PNI A;  1G83 A;  2HBW A;  2X3W D;  3JV3 A;  2MCN A;  1YWP A;  2RF0 A;  2V1R A;  1UUE A;  2FPD A;  3RNJ A;  1ABO A;  1X6B A;  2F2W A;  1YP5 A;  4RTX A;  1N5Z A; 
#chains in the Genus database with same CATH topology
 4AFZ C;  5IAY A;  1ZSZ C;  1YNZ A;  5AT1 B;  2LNV A;  2CP6 A;  2OX7 A;  3A8M B;  3H9N A;  3OQ5 A;  3UT1 A;  2B86 A;  2KRM A;  4OB1 B;  1JQQ A;  1ZHI A;  1ZQ1 A;  1T3L A;  2EYW A;  3PFS A;  1C0M A;  1O75 A;  1ZA2 B;  1IRE B;  4M7A F;  3MO8 A;  4WCI A;  1ACM B;  1RAA B;  3UAT A;  2JJ9 A;  1OZ2 A;  2WSC E;  3RKY A;  1RI0 A;  3SD4 A;  2DYB A;  2JS0 A;  3VV0 A;  3EG0 A;  3OYH A;  2JN0 A;  1P92 A;  3OYB A;  3V8J A;  2EFI A;  4PLI A;  4FT2 A;  1K1Z A;  2HSE B;  2GTO A;  2QEX Q;  3CEY A;  4F17 A;  1IRX A;  4LE9 A;  5J26 A;  2M9U A;  3U23 A;  4M77 B;  2XU8 A;  2L3Q A;  3M0Q A;  1R0C B;  1XOV A;  5EC7 A;  3TCJ A;  1N8R R;  1JU5 C;  4BE0 A;  2JVV A;  1BCM A;  1WJR A;  3VKI A;  1QMC A;  1KD1 C;  4AFQ C;  1LOJ A;  2DMO A;  4XU2 A;  4A63 B;  1K0X A;  1MGQ A;  3MJX A;  5AYF A;  4LDW A;  3M54 A;  3P8B B;  1M1K U;  5KYY B;  1VQ5 Q;  5IHN A;  4PJO G;  2ZCF B;  2ESW A;  3LWI A;  1S72 A;  2YT6 A;  1WNL A;  3QJ6 A;  3CMA T;  4LN2 A;  4KUD K;  1VYV A;  1M27 C;  3QWY A;  3J80 E;  1G3S A;  4IIO A;  2RD1 A;  1TUC A;  5LJ5 f;  4NOY A;  3EHR A;  1Y0M A;  4QVC A;  3DKM A;  1YJ9 Q;  4BI8 B;  4ELY C;  1K8A U;  1QP3 A;  5CVI A;  2RH2 A;  2F1L A;  3DB4 A;  4E7J A;  3M0P A;  4JZ4 A;  3A8G B;  2QYZ A;  1B7T A;  3CCS Q;  3JCM g;  2EVR A;  1PC0 A;  2EQM A;  4E7S A;  3L2Z A;  4XTX A;  2YUO A;  4FSS A;  2KRO A;  4M7A A;  2RI3 A;  1KSW A;  2YUN A;  1PNJ A;  3CCQ Q;  5IXB A;  1OU8 A;  3CPF A;  2K5L A;  2PVO B;  2K2V A;  2LT1 A;  1YI2 T;  2MWP A;  2YDL A;  2X9H A;  3EHQ A;  1VQ8 Q;  2EGA A;  2JTF A;  2I2L A;  3OS0 A;  1AZE A;  2YRD A;  4BDZ A;  2I0N A;  2M0Y A;  2A0F B;  1UHF A;  2V8I A;  1WHM A;  3CCE T;  1XQH A;  4PJO E;  5DLQ E;  4PJN A;  1G5V A;  4E7L A;  4OF1 A;  4LUE A;  3G4S Q;  4GLK A;  5GAO p;  1T0J A;  4JPB W;  4XU3 A;  1M30 A;  4OB0 B;  7AT1 B;  4FM4 B;  2E10 A;  4M77 C;  3VRY A;  3CME T;  3RUX A;  3CCM T;  2QQB A;  2D1X A;  4DOV A;  2KY9 A;  1Q86 C;  1GCQ A;  1VQO Q;  1PWT A;  1Z9Q A;  1BKB A;  2PVD B;  5I2S A;  4F7U F;  1WXB A;  3MHX A;  2CZ1 B;  4MMK A;  4MDX A;  1I81 A;  1SSH A;  3R6O A;  1UFF A;  1KC8 C;  1UJ0 A;  3FB9 A;  1UB4 A;  4M77 D;  2RHY A;  1MMN A;  1YI2 A;  4M78 B;  3BDU A;  2E5Q A;  5D6Y A;  1YIJ T;  2H8H A;  3QBY A;  3QDR B;  3H41 A;  4FYW B;  5FWC A;  2E4H A;  3C94 A;  3Q1J A;  4ATO A;  3CC4 A;  1Y96 A;  2CH4 A;  2BTT A;  1UGS B;  3NFC A;  2QQ9 A;  3CCE A;  3MCA B;  1SF9 A;  2DPP B;  3H8Z A;  3OA6 A;  3CCU T;  4ZN3 A;  3L2Q A;  1X2K A;  2DBK A;  2Y90 A;  1YJN Q;  1X43 A;  2CZ7 B;  4BAC A;  1M3C A;  3BE3 A;  3KUF A;  1H3Z A;  4DA4 A;  2A37 A;  4QQD A;  2J6O A;  1I1J A;  4C0D B;  2YLC A;  1TSF A;  4X9D A;  1RUW A;  3CME A;  1X01 A;  1I8F A;  2HNI A;  5GMK m;  3PMI A;  2LCL A;  3VS7 A;  5FU6 B;  1NLO C;  2OJ2 A;  1C1A A;  3GP8 A;  2E64 A;  3QO3 A;  1K9M R;  3JB9 F;  1NYF A;  2XDP A;  5GAN 6;  2RQT A;  5C0M A;  2X35 A;  3OS1 A;  4XTZ A;  3VS4 A;  3INZ A;  2WSE E;  5KCO A;  2LCC A;  4QQ6 A;  3OYI A;  1Y96 B;  1SRM A;  4OML A;  1NJI R;  3M0S A;  2D8J A;  4Z89 A;  5I11 A;  2FZG B;  2JXB A;  3SB2 A;  1M9S A;  3VYH B;  4F7U A;  4RTU A;  1QCF A;  4A4E A;  4AG2 C;  1I0C A;  1RLP C;  1AWJ A;  1YIJ A;  5LJ5 g;  4M7A C;  1WI7 A;  1SHG A;  1YIT T;  1EX4 A;  1M1K C;  2L3R A;  4GLM A;  1TOV A;  4XK8 E;  2NUP B;  2OTL Q;  4MML A;  2C0O A;  3UF4 A;  5GAO q;  1H8K A;  4J7F A;  1N6A A;  3CCU A;  2HAX A;  2M02 A;  3EGU A;  1QLY A;  2QQS A;  5CAI A;  3VUZ A;  2QQR A;  3JB9 J;  3LWH A;  2JTE A;  3PMT A;  1QP2 A;  3EFS A;  3CCR T;  2HQX A;  3RES A;  2D6F A;  1K8A C;  2RI5 A;  1QKW A;  3QPH A;  2GTJ A;  1JBM A;  1ABQ A;  4F7U B;  4JZ3 A;  4C92 F;  2SEM A;  4J6W A;  2E41 A;  2BZY A;  1KFZ A;  3ZBD A;  1Q81 U;  3GBQ A;  3OYM A;  4JRI A;  1SPK A;  2RNA A;  2DXT A;  4HXJ A;  1BI1 A;  3I55 T;  2HMA A;  1NYG A;  4V2S A;  3PE0 A;  1UGV A;  2C0I A;  4ZTF A;  1TUD A;  2RPN A;  2QGF B;  3BY7 A;  1U1S A;  4M75 F;  1KHI A;  1BI0 A;  1VQ6 Q;  1GCQ C;  4PNO A;  4OMQ A;  5LJ3 e;  3QDF A;  2K4Y A;  4J9B A;  4M78 D;  3FC3 A;  3GF5 A;  2DBM A;  4JRP A;  2XI9 A;  4XTW A;  3QYH B;  2IG0 A;  1FMK A;  1YIT A;  1I5O B;  2VGM A;  1QVG A;  3PTA A;  1SSF A;  2HKN A;  3L2U A;  3I56 Q;  3P8H A;  1VQL T;  5KYU A;  3EG2 A;  3OMC A;  3GOX A;  1HK9 A;  2KRS A;  4ZTJ A;  1G83 A;  2HBW A;  4J6X A;  2X3W D;  2MCN A;  2ZPB B;  5HK0 A;  3CCR A;  1WQ7 A;  1X6B A;  1O9S A;  1NBE B;  3MKD A;  4X9C A;  1AHJ B;  1YHQ Q;  2VWF A;  3ASK A;  1ZSZ B;  2RN8 A;  2CS7 A;  3SWN A;  5KE3 A;  2QTX A;  3G7Z A;  4RTZ A;  5GAM e;  4E7Z A;  2EWN A;  4QKU A;  1NM7 A;  1BI3 A;  4E7I A;  1OUL A;  3KFV A;  2LTO A;  5D6X A;  3LX7 A;  4ZGD B;  1MUZ A;  4X1V A;  2OTJ Q;  3I55 A;  1M5Q 1;  2QEX T;  1PKT A;  3CCV Q;  4C92 A;  2QXF A;  5KYU B;  2L3P A;  3G6E T;  4M77 G;  1YJW T;  4NL3 A;  3MP6 A;  2P0P A;  3HPW A;  2K79 A;  1WIE A;  1N27 A;  3M5A A;  2DXC A;  1OQK A;  3HL8 A;  1QVG S;  3NMZ C;  4L59 A;  2LQK A;  1MMG A;  1G3Y A;  4OMP A;  3V8K A;  1K73 R;  2O2O A;  3HP9 A;  4M75 A;  4M4Z A;  4Z02 A;  2DVE A;  1WZO A;  1TTH B;  4JJN K;  2VAS A;  2ZPI B;  4KRT A;  4NL2 A;  2EKH A;  4EDU A;  5FWB A;  5GAO n;  1W70 A;  1VQ5 T;  2CUD A;  2PUK B;  2AIR B;  1QCO A;  1QVG P;  3I35 A;  1RAC B;  1CSK A;  3IQL A;  2L5Q A;  2E3I A;  5FRO A;  2H3J A;  3O8V A;  2GCX A;  2JOY A;  3FIF A;  5GAN 2;  2KDS A;  2DTO A;  2QQA A;  3JCM Q;  6AT1 B;  3VS1 A;  4HVW A;  4C92 B;  3R6N A;  4RTW A;  3C4S A;  4E47 A;  1D0Z A;  2B8A A;  1BI2 A;  5GAN 7;  1U3O A;  3F70 A;  3CCS T;  2JUF A;  1JXO A;  1PSE A;  2C0T A;  2GF7 A;  2HQE A;  3T9N A;  3KXT A;  2DIL A;  3VYG A;  4FSX A;  4M75 B;  2CSI A;  2RJD A;  4HVV A;  3E2U A;  3RMS A;  1VQ4 T;  1VQ7 Q;  2PU9 B;  4M77 E;  5FU7 B;  4BY6 C;  3CCJ A;  3MEA A;  4OP0 A;  4ELZ C;  1ZX6 A;  3G6E A;  4LD6 A;  2HBP A;  1YJW A;  2YRV A;  3MEU A;  4MZM A;  4KBM B;  2QGG A;  2HSP A;  1VQ8 T;  5GAN f;  3OW2 A;  1V76 A;  2DL4 A;  1JJ2 A;  3JCM e;  2BIV A;  2AZS A;  2EJ9 A;  3M55 A;  3S3M A;  1Q82 U;  1VIF A;  4FL6 A;  2A08 A;  4KH0 B;  2KR3 A;  2C06 A;  2HCK A;  4DBR A;  3G4S T;  3A5Z B;  1ZUY A;  2L2P A;  2IPO B;  3DLL A;  2OAW A;  1W4S A;  3CQT A;  2D8H A;  1ZBX A;  2RQW A;  1WA7 A;  1WHG A;  2LZ6 B;  3EGX A;  3UA6 A;  4AFS C;  2FB7 A;  5GJW B;  2KSS A;  4C5I A;  3O5Z A;  3CC7 Q;  3VRZ A;  2QA4 T;  4PJJ A;  1RI9 A;  1VQP Q;  3M0U A;  1WLP B;  5LJ3 h;  2RMO A;  1M90 C;  2LT4 A;  1ZBJ A;  5LJ3 d;  1T0H A;  1Q81 C;  3JB9 D;  1NPR A;  4LD9 K;  4FIB A;  4DQ2 A;  3MEW A;  3TSW A;  2L0A A;  2E6N A;  4JS5 A;  1WHK A;  1VQO T;  2RK2 A;  2EQU A;  2F2X A;  2E3H A;  3OMG A;  2D0Q B;  2X51 A;  4RUG A;  1VQ4 A;  2RJE A;  3SWN C;  4EMK A;  4OMF B;  5ECA A;  5CKB A;  3C12 A;  1M3A A;  1JXM A;  4XU1 A;  1D1C A;  1KHC A;  3PIP A;  1TXQ A;  1Q7Y U;  4B9W A;  5DM7 R;  2A3L A;  4RKU E;  1VQM T;  2A36 A;  3A8L B;  4LXC A;  5LL6 S;  1FMW A;  4M78 G;  4FYY B;  2FZK B;  2PQW A;  4JUV A;  4RG2 A;  2DKG A;  1NG2 A;  3CBM A;  3EH2 A;  4E2F B;  2Y4Y A;  3EGX B;  4OMN A;  2GFU A;  5IHI A;  4C92 C;  2VB6 A;  4QQG A;  1BB9 A;  2RB6 A;  4KUL A;  3ZFJ A;  1BBZ A;  2NUZ A;  5GAM h;  3C95 A;  5GAM d;  2F5T X;  3CXC A;  1PRM C;  3H0I A;  3CPW A;  1UHC A;  2VXE A;  1JJ2 P;  5FRN A;  2BKD N;  2K2M A;  5GJV B;  4M75 C;  2MWO A;  1BK2 A;  4PJO F;  1KQS A;  4IKF A;  5FU7 C;  2QA4 A;  4EMK B;  2L89 A;  1RAH B;  2O9S A;  5HY6 A;  4C92 D;  2EBP A;  1QVP A;  4CC7 A;  2BZX A;  3VS3 A;  5HCK A;  1UG1 A;  2COY A;  2Z0W A;  3GLX A;  3TEE A;  4BUG A;  1SHF A;  1VQ9 T;  1G8X A;  3LYI A;  1AT1 B;  2COW A;  5CR2 A;  3OY9 A;  2F69 A;  4OMM A;  1HJD A;  1Q86 R;  2FPE A;  1UE9 A;  4AT1 B;  3HFO A;  5I21 A;  4ME7 A;  1WHH A;  3OBW A;  3QG1 A;  4A4H A;  2J6F A;  3EH1 A;  2G3R A;  2EAY A;  2KAF A;  4M7D F;  2HZY A;  2EYZ A;  2P0K A;  2YUP A;  4M78 E;  4KT0 E;  4E7K A;  1VQM A;  4A4F A;  3JCM c;  1KC8 R;  2CP0 A;  1M8M A;  1RAD B;  1UGQ B;  1IO6 A;  3BW1 A;  2LVM A;  4DBF A;  2DXU A;  1WX6 A;  5GAO r;  2OTL T;  2RHU A;  3NPF A;  3CMA A;  1EIF A;  1OPK A;  5CQX A;  2JMC A;  2RM4 A;  3UDC A;  2LRQ A;  1F1B B;  4M7A B;  1UGP B;  3M9Q A;  1S72 Q;  1B3Q A;  3JCM b;  4FW2 A;  5DLO A;  3RBB B;  2ZPG B;  4IIM A;  2DVJ A;  2FO0 A;  3FRN A;  2CP2 A;  2CP7 A;  4UC4 A;  3OBY A;  1X75 C;  4JRQ A;  2XMF A;  1AOJ A;  3CPW P;  4F14 A;  3UWN A;  5LJ5 e;  4HA8 A;  1A0N B;  2Y4X A;  3RER A;  2NUT A;  2DL5 A;  3FDR A;  2AKK A;  4PJO A;  1KQS P;  3QHS A;  4F7U G;  5GAN g;  1VQ9 A;  2E1H A;  5FW9 A;  3PNW C;  3JCM h;  4DEX A;  3CD6 T;  3JCM d;  1EFN A;  2DET A;  4IUP A;  2AKL A;  5LJ3 j;  1OV3 A;  1C6V X;  4FW1 A;  3FJP A;  1QW1 A;  2JMA A;  2KXC A;  4FT4 A;  2XHC A;  3EGD A;  1VQN T;  1TU0 B;  4IUT A;  1GBR A;  4AFU C;  1BCO A;  3REB B;  2DIG A;  2J05 A;  3S6W A;  2VYT A;  3JCM W;  2DAQ A;  4NS5 A;  4C0Z A;  4C8Q F;  2EQK A;  1Y71 A;  1Q82 C;  4M7D A;  1BYM A;  3PIO A;  2DA9 A;  3TVT A;  3MEV A;  4EMK C;  3OS2 A;  4IUR A;  1AVZ C;  1OZ3 A;  1M1K R;  2NUT B;  1YCY A;  4N0A A;  1D09 B;  2E70 A;  4IUV A;  3DLM A;  4BD3 A;  2X3X D;  4MZP A;  5GAN 4;  1VQK T;  2XID A;  2FRY A;  4ZNX A;  4ORZ A;  5GAO m;  5GAM j;  1MMD A;  1W2B A;  2DL8 A;  2EGC A;  3CCM A;  4J6Y A;  3NGP A;  2LQ8 A;  3C0C A;  2LQN A;  3EGD B;  4F7U E;  4DBH A;  4F04 B;  3JB9 G;  1K8A R;  4LDY A;  8ATC B;  4CI0 C;  5CK9 A;  2E65 A;  2DZC A;  2R5A A;  2EIF A;  2FPD A;  1ABO A;  3AHU A;  1N9R A;  2O01 E;  9ATC B;  1YP5 A;  1J3T A;  1N5Z A;  3RMQ A;  4E7H A;  2FPF A;  4M7D B;  3CD6 A;  3ZEH A;  5GAN 3;  2DO3 A;  1Y07 A;  1Q7Y C;  1U1T A;  4OGC A;  4Z88 A;  5L23 A;  2J6K A;  3CCV T;  4F16 A;  1HXD A;  2DJQ A;  5KYW A;  1VQN A;  1KIK A;  2CT4 A;  3G1J A;  1X6G A;  3HHT B;  3VJP A;  1E6G A;  1YI2 Q;  3NHN A;  5J3B A;  3J81 E;  1WJS A;  3GIB A;  1WQW A;  5D6W A;  4KGX B;  1PD1 A;  4PJM A;  1K73 U;  3OSS C;  1IB8 A;  3CC4 Q;  2BUD A;  2HQH A;  3LGL A;  1PCX A;  2SRC A;  3CCE Q;  4C8Q A;  2LCS A;  2EJG A;  2MI6 A;  1X2Q A;  4M7A D;  1FXX A;  3VU3 C;  4B6M A;  1VQK A;  1JO8 A;  3UA7 A;  4HVU A;  3FJ5 A;  3OYN A;  2V8J A;  3BDL A;  1AZG B;  1NEG A;  3OSV A;  4C92 G;  4DBQ A;  5CCA A;  1M90 U;  1RAG B;  1N9S A;  3WVE B;  1VUB A;  3CC2 T;  2RA2 A;  3CME Q;  1OU9 A;  3EAE A;  1W2B P;  1DJ7 B;  1M1F A;  2V1Q A;  3CCL T;  3P8D A;  1VYT A;  3MPU B;  4M75 G;  5J39 A;  3G71 T;  4A53 A;  1QVF A;  1D3B A;  1WHL A;  3OYJ A;  4PJO C;  2HL5 C;  4C8Q B;  1XJW B;  4TVR A;  1PG5 B;  2QDY B;  2HL3 A;  4ZGJ B;  2DD5 A;  4ESR A;  1FMV A;  3I5S A;  2DRM A;  2DNU A;  2ENM A;  1YIJ Q;  1PD0 A;  3L1A A;  2DD4 A;  3FEO A;  3PT9 A;  4BY6 B;  5LJ5 h;  2LP5 A;  5LJ5 d;  4J9H A;  3RKX A;  8AT1 B;  3MP8 A;  4ZGE B;  3RR6 A;  3M56 A;  2CRE A;  3GNF B;  3H6Z A;  3CCU Q;  1ZA1 B;  1ZSG A;  1M2V A;  3ME9 A;  4M7D C;  1JEG A;  4D8D A;  4C92 E;  1I4K 1;  3CC7 T;  2F2V A;  1VQP T;  1MND A;  2ZPF B;  2DZ9 A;  4N0A C;  2JM9 A;  3CC2 A;  3GNG A;  1Z9Z A;  3X20 B;  4BI3 A;  4JDS A;  2DL7 A;  3HRT A;  3ZL7 C;  3CCL A;  2E12 A;  3L2R A;  1V1C A;  4M75 E;  3A1P A;  3V7C A;  4M7D D;  4OGE A;  1TWB A;  1X69 A;  2GNC A;  2X4Y A;  4OB2 B;  4AG1 C;  4J9I A;  4CC2 A;  2ZZD A;  3G71 A;  3VUB A;  2JW4 A;  3THK A;  1N8R U;  3D7S B;  1UGR B;  1W1F A;  2YLB A;  2KT8 A;  3M58 A;  2CT3 A;  3RKW A;  3VS2 A;  1H64 1;  3CBP A;  4MZT A;  3SWN B;  1VQL A;  1M1G A;  1YIT Q;  2K57 A;  2WSF E;  2ZPH B;  1Y57 A;  2R57 A;  3LW5 E;  2EQJ A;  2KVQ G;  1R0B G;  3M4Y A;  1GRI A;  1GFD A;  4EIK A;  4J9F A;  2KT1 A;  3UPU A;  1QWE A;  4BDY A;  1G2B A;  1SRL A;  3PVL A;  1YJ9 T;  2MPX C;  2OI3 A;  2HD0 A;  3CCR Q;  5IN1 A;  3HRS A;  3RIR A;  4C8Q C;  2DYI A;  3M0R A;  3BFM A;  3SHW A;  4IUU A;  4LDX A;  4B9X A;  1U06 A;  4HT9 A;  2DRK A;  3OS5 A;  5CKD A;  3J7A F;  2QEX A;  4HKE A;  1KK7 A;  1MV3 A;  1Q81 R;  1M3B A;  3QKJ A;  5D7U A;  3CCQ T;  1FYN A;  4PLL A;  3JSC A;  1CKB A;  5GMK e;  1YN8 A;  4A4G A;  5EG2 A;  2NYS A;  3I55 Q;  1ZLM A;  4A4K A;  4YTL A;  2M51 A;  4J8O A;  3QII A;  4BB7 A;  1G3W A;  1K4U S;  2O9V A;  1KJW A;  4C8Q D;  2FHD A;  5KYX A;  1K73 C;  4BE1 A;  4HCC A;  4JJD A;  4GY5 A;  2DER A;  2CP5 A;  2R5M A;  4RTY A;  3X28 B;  5A0G A;  1PHT A;  3I9Q A;  5L8R E;  1KD1 R;  1PKS A;  5KH6 A;  1VQ5 A;  2IIM A;  1WJQ A;  1UTI A;  3V8L A;  3VS6 A;  2DJZ A;  4EMH A;  1WXT A;  4K11 A;  4JJB A;  1S72 T;  2JS2 A;  4M7A G;  3A8O B;  1M8V A;  4JLI A;  5LJ5 j;  1YJ9 A;  1RL2 A;  3RDV A;  3WVD B;  1QCN A;  4BI4 A;  1NPP A;  1SKU B;  3M53 A;  3CCS A;  3JCM V;  4FYX B;  2KYB A;  4Q5W A;  5DY9 A;  4AMC A;  1H3H A;  2KBT A;  2CH4 W;  4BE2 A;  5KYY A;  5KYX B;  4XU0 A;  4CC3 A;  3S3O A;  2YRC A;  2DXB A;  2D0N A;  1RAF B;  2CZ6 B;  4ANJ A;  3AT1 B;  3CCQ A;  1OPL A;  1X27 A;  2ZAE A;  2FEI A;  3OYY A;  1SG5 A;  2CKK A;  2PVG B;  3QWX X;  4PKC C;  2A28 A;  2CZ0 B;  2DX1 A;  3H0H A;  2J06 A;  3OW2 S;  2E6Z A;  4HT8 A;  3QYG B;  1GFC A;  3VS0 A;  3CCJ Q;  1VQ8 A;  2KEA A;  1JJ2 S;  3G6E Q;  1PRL C;  1YJW Q;  1UEB A;  2DTI A;  1WFW A;  2FZC B;  1OI1 A;  4OB3 B;  4P5N A;  1OEB A;  3V7R A;  5M9O A;  2GQV A;  1HD3 A;  4Z8A A;  3TRE A;  4FU6 A;  4J5Y A;  2PTK A;  5GAN e;  3OW2 P;  4JJC A;  3SFM A;  1PSF A;  3OYL A;  4M78 F;  3REA B;  1YJN T;  3G4S A;  2O4X A;  2L8D A;  4M7A E;  2AZV A;  2P0Q A;  2RHZ A;  3H0F A;  4XAX B;  2W10 A;  3L2V A;  1AWO A;  2RI2 A;  1IGQ A;  2J7I A;  2VXF A;  2AHJ B;  2CDT A;  2GGR A;  3HFN A;  4IUQ A;  2YHT A;  1VYU A;  2CYZ B;  3OYK A;  2EYY A;  3QZ5 B;  1VQO A;  2EQI A;  2FVU A;  3OYG A;  1K9M U;  4J9E A;  4M75 D;  2EW3 A;  3A98 A;  5A0L A;  1JRI A;  5KCH A;  3X25 B;  2E5K A;  3OYD A;  1MV0 B;  2JTM A;  1AD5 A;  2LJ0 A;  1NJI U;  2XIC A;  4M7D G;  4XTU A;  2ABL A;  1N8R C;  1LJO A;  2D9T A;  2PNI A;  2DIQ A;  4C0G A;  3JV3 A;  1I5L A;  2ZPE B;  4PFZ A;  1VQ4 Q;  2V1R A;  1UUE A;  2QI2 A;  3RNJ A;  2O4X B;  2M16 A;  2F2W A;  1NZ9 A;  2QAS A;  2KQW A;  2BE7 D;  1M2O A;  3JB9 H;  1WGS A;  2RQV A;  3CBO A;  2XK0 A;  3CXC S;  2L3S A;  1WYX A;  2KK4 A;  2K3Y A;  1MHN A;  1QKX A;  4KGZ B;  3URG A;  3CPW S;  1WHJ A;  1WDX A;  3CC4 T;  2LMJ A;  4PFP A;  1YJN A;  1IGU A;  4HCZ A;  2QAZ A;  5CKH A;  1Q82 R;  5GAN 5;  2QDL A;  3L42 A;  2A7Y A;  1M4Z A;  3NTH A;  1KQS S;  3E1S A;  2GQI A;  2RJC A;  2IVW A;  4ZN1 A;  3CXC P;  1VIE A;  4D6W A;  5IXF A;  4J7I A;  2ROT A;  1TS9 A;  4J83 A;  1OOT A;  2MAM A;  4M78 A;  3I5R A;  5GMK h;  3M57 A;  3PVQ A;  4QVD A;  4XQ3 A;  4RTT A;  5IH2 A;  2LX9 A;  3OYC A;  3X24 B;  2O88 A;  4PL6 A;  4L5G A;  2QA4 Q;  2O31 A;  1UDL A;  1K0S A;  3OYF A;  3QSU A;  1Y7X A;  3LH5 A;  2V26 A;  1W6X A;  2K6D A;  2LX7 A;  3E19 A;  1U5S A;  2HEQ A;  2YSQ A;  4M7D E;  3VS5 A;  5GAO l;  4C0F A;  1EZZ B;  2LC4 A;  5GMK l;  2RJF A;  2FG0 A;  2W0Z A;  5CKE A;  2DL3 A;  2RQU A;  1ZUU A;  3JRZ A;  1VQ6 T;  5HKC A;  2X4W A;  3FLG A;  1FWZ A;  1R77 A;  2X4J A;  2LDM A;  1Q7Y R;  2LJ1 A;  3M4G A;  1WPY A;  4C8Q G;  1AEY A;  2YXY A;  4C5G A;  2BZ8 A;  4WTO B;  1D1A A;  1VQM Q;  1HSQ A;  3OB9 A;  4RCB A;  1IHW A;  2KXD A;  5GMK i;  1ARK A;  4QVZ A;  3TU4 K;  1OYX A;  2OTL A;  1CKA A;  2JZ2 A;  3I56 T;  2K9G A;  3WXM B;  3LGF A;  1GXI E;  5KYN A;  5FRM A;  4PJO B;  1K9A A;  4HCB A;  3JB9 I;  3CMA Q;  2VV5 A;  4R56 A;  3M0T A;  1UEC A;  3ULR B;  1E7O A;  3OYA A;  1JB0 E;  3EFR A;  1YHQ T;  2RO0 A;  4DEY A;  3HSB A;  2K5I A;  3EG9 A;  3X26 B;  1RLQ C;  1RAI B;  4Y28 E;  1IXD A;  2M0O A;  2HKQ B;  2KGT A;  2NUP A;  4J9D A;  2DFU A;  4Y91 A;  1NE8 A;  1AWW A;  4D8K A;  4C5E A;  1YBY A;  3MET A;  2ECZ A;  5CQY A;  3QUI A;  2OTJ T;  1VQ9 Q;  1BIA A;  5GAN h;  2XDD A;  2X4X A;  4J9G A;  1RAB B;  2JM8 A;  5GAN d;  5LJ3 f;  2XKO C;  4KGV B;  5IHK A;  1VQ6 A;  1BU1 A;  1G3T A;  5CO7 A;  3E9F A;  4C8Q E;  1E6H A;  2LNH B;  2DF6 A;  4GBQ A;  2GFA A;  5IT9 E;  2R58 A;  2RHI A;  4RG8 A;  3QJY A;  3LLR A;  2YWW A;  3OYE A;  4E6R A;  2RQR A;  3TQ7 P;  1Q95 G;  4C5H A;  4QW2 A;  2XDB A;  2BE9 B;  1B34 A;  3I56 A;  1V29 B;  3EG9 B;  2KMT A;  3GPL A;  4PFO A;  1TUG B;  1NLP C;  3EFO A;  4JS4 A;  2VUB A;  1MNE A;  1W2B S;  4WF2 A;  2MIO A;  1GCP A;  2FRW A;  1IHV A;  3EG1 A;  1OX8 A;  2ED0 A;  5I22 A;  4KUI A;  1YHQ A;  1S1N A;  3NTK A;  5GAM f;  2ZGW A;  1KG1 A;  4VUB A;  5KYW B;  1ZUK A;  1K9M C;  2JNG A;  3CCM Q;  2H3E B;  3M59 A;  2K7A A;  2KRN A;  5A2Q E;  4O6J A;  1LCK A;  3EG3 A;  2ROL A;  1D1B A;  2DEU A;  1NJI C;  5GMK j;  4CC4 B;  4M78 C;  5C6S A;  2OTJ A;  5HK3 A;  2VGN A;  3NTI A;  2DM1 A;  1VQ7 T;  3CCV A;  1FX7 A;  4KH1 B;  2DE0 X;  1B34 B;  2K3B A;  3CD6 Q;  3JAM E;  3E9G A;  2VKN A;  2DTH A;  2EYX A;  4HCK A;  1VOM A;  3JCM J;  2KNB B;  4Y92 A;  5CKF A;  2CSQ A;  1OX9 A;  3V7S A;  2HDA A;  2EYQ A;  1GBQ A;  1ZSZ A;  3EFO B;  1VQN Q;  1PM3 A;  2CGH A;  2DEQ A;  1X6O A;  4RMO A;  2CUB A;  3MP1 A;  4RTV A;  4LDU A;  2G6F X;  1TH7 A;  1VA7 A;  2COZ A;  1D0Y A;  1QQJ A;  2V8K A;  4LDV A;  2EPD A;  2PZ1 A;  4C0D C;  1QWF A;  1KD1 U;  4PJO D;  4LNP A;  3SDZ A;  5FU6 C;  2MK5 A;  3S3N A;  3DB3 A;  2P4R A;  4FYV B;  1NEB A;  2K5F A;  4J9C A;  4XTY A;  3PGG A;  1XNI A;  4EPC A;  1AWX A;  4FCY A;  1T3S A;  1VQK Q;  1D3B B;  4A54 A;  4DOW A;  3HRU A;  5CIU A;  2XD0 A;  2VVK A;  2FL7 A;  1BIB A;  4RCC A;  1K76 A;  4JLG A;  4O5V A;  2MYS A;  4II1 A;  4OVA A;  4CRI A;  2CP3 A;  3TSZ A;  1KQ2 A;  4R55 A;  1QVF S;  1VQ7 A;  4N4G A;  1UJY A;  2YUQ A;  4PJL A;  5FLX E;  1R8O B;  4MDW A;  1M2V B;  1YWO A;  2P84 A;  5A0D A;  2DLP A;  3CCJ T;  3QZ9 B;  2OAU A;  2AK5 A;  2JT4 A;  2GBQ A;  2EJF A;  1QVF P;  2LQW A;  2KI7 A;  4M77 F;  3JCM f;  5GAN j;  1HYO A;  2QK0 A;  2RHX A;  1D0X A;  1LPL A;  4QT7 A;  3HTR A;  4R0K A;  4JRK A;  2EKO A;  1B07 A;  1I07 A;  1SEM A;  2AT1 B;  5GAN 8;  2VC8 A;  4N4H A;  3QXE B;  1XTD A;  2EGE A;  2P4T A;  2NWM A;  4EMG A;  2K3X A;  2QTV A;  2PUO B;  1IZ6 A;  1RAE B;  2MF2 A;  3CC7 A;  2F5K A;  2RK1 A;  5LJ3 g;  1VQP A;  1WXU A;  4OMO A;  1GL5 A;  4X34 A;  2MOX A;  2WAC A;  3SEM A;  1H92 A;  2ED1 A;  1LVK A;  2KYM A;  1M90 R;  3KBG A;  3JCM P;  3CC2 Q;  1U8R A;  3L2W A;  1LNX A;  1Q86 U;  2KE9 A;  3CCL Q;  1KQ1 A;  1TG0 A;  3HKS A;  4N4I A;  3ER0 A;  4LUD A;  2MMP A;  2FYK A;  4PK4 A;  1MMA A;  3JCM X;  4L6V 5;  2LJ3 A;  2XG8 D;  4XTV A;  5KE2 A;  3G71 Q;  3A8H B;  1YCS B;  1KC8 U;  1YFN A;  2DK3 A;  5I2M A;  5GAM g;  3N5B B;  2QG9 B;  2ATC B;  2M1H A;  1YWP A;  2RF0 A;  2NLU A;  3LH0 A;  1VQL Q;  4M77 A;  4RTX A; 
#chains in the Genus database with same CATH homology
 4AFZ C;  1YNZ A;  2FPF A;  2VWF A;  2RN8 A;  2RQV A;  5L23 A;  4RTZ A;  4Z88 A;  2L3S A;  1WYX A;  2J6K A;  4F16 A;  1NM7 A;  2B86 A;  1QKX A;  2KRM A;  1JQQ A;  2DJQ A;  1KIK A;  1T3L A;  3KFV A;  1WDX A;  2CT4 A;  2EYW A;  2LMJ A;  1X6G A;  1MUZ A;  4X1V A;  2QDL A;  1E6G A;  3NHN A;  2GQI A;  1PKT A;  4WCI A;  3UAT A;  5IXF A;  2ROT A;  1OOT A;  2L3P A;  3I5R A;  2DYB A;  2JS0 A;  3PVQ A;  3EG0 A;  2K79 A;  1WIE A;  4RTT A;  2SRC A;  5IH2 A;  1K1Z A;  2GTO A;  3NMZ C;  2O88 A;  2LCS A;  4F17 A;  4OMP A;  1X2Q A;  2O31 A;  2O2O A;  4LE9 A;  1UDL A;  4M4Z A;  1K0S A;  3U23 A;  3LH5 A;  2L3Q A;  3M0Q A;  1W6X A;  1JO8 A;  2K6D A;  1XOV A;  3UA7 A;  2LX7 A;  4HVU A;  4KRT A;  3FJ5 A;  1U5S A;  5EC7 A;  2EKH A;  5FWB A;  2HEQ A;  2YSQ A;  1JU5 C;  3VS5 A;  1W70 A;  2CUD A;  1AZG B;  1NEG A;  2FG0 A;  2W0Z A;  3I35 A;  2DL3 A;  1CSK A;  2RQU A;  1ZUU A;  4AFQ C;  3IQL A;  2DMO A;  4A63 B;  1K0X A;  2LJ1 A;  2V1Q A;  1VYT A;  5IHN A;  3VS1 A;  4HVW A;  2ESW A;  1AEY A;  3R6N A;  4RTW A;  2BZ8 A;  2YT6 A;  1HSQ A;  4LN2 A;  1VYV A;  2KXD A;  1ARK A;  1M27 C;  3QWY A;  1U3O A;  1CKA A;  2K9G A;  4IIO A;  1TUC A;  1JXO A;  2C0T A;  3EHR A;  1Y0M A;  1K9A A;  2DIL A;  4ESR A;  2CSI A;  3I5S A;  4HVV A;  2DRM A;  3M0T A;  2DNU A;  2ENM A;  3M0P A;  4JZ4 A;  1UEC A;  3ULR B;  2EVR A;  1E7O A;  1ZX6 A;  2LP5 A;  4J9H A;  2YUO A;  4FSS A;  2KRO A;  4DEY A;  1KSW A;  2HSP A;  2CRE A;  1RLQ C;  2YUN A;  1PNJ A;  1ZSG A;  2KGT A;  5IXB A;  2DL4 A;  4J9D A;  1AWW A;  1JEG A;  4D8D A;  4D8K A;  2ECZ A;  2AZS A;  2YDL A;  3EHQ A;  2A08 A;  2KR3 A;  2EGA A;  2F2V A;  4J9G A;  2JM8 A;  2HCK A;  1AZE A;  1ZUY A;  2L2P A;  2JM9 A;  5IHK A;  2I0N A;  2M0Y A;  2OAW A;  1BU1 A;  3CQT A;  1UHF A;  2D8H A;  1Z9Z A;  2RQW A;  1E6H A;  1WA7 A;  2LNH B;  2DF6 A;  2LZ6 B;  4GBQ A;  3ZL7 C;  2DL7 A;  3UA6 A;  4AFS C;  5GJW B;  1V1C A;  3O5Z A;  3VRZ A;  1RI9 A;  3M0U A;  4E6R A;  1WLP B;  4LUE A;  2RQR A;  2RMO A;  1T0J A;  4JPB W;  1ZBJ A;  1T0H A;  1X69 A;  2GNC A;  4AG1 C;  4J9I A;  4CC2 A;  3TSW A;  2L0A A;  2JW4 A;  3THK A;  1M30 A;  2F2X A;  1W1F A;  2KT8 A;  2CT3 A;  3VRY A;  1NLP C;  4RUG A;  2MIO A;  3VS2 A;  1GCP A;  2D1X A;  2FRW A;  5ECA A;  3EG1 A;  2ED0 A;  5I22 A;  1GCQ A;  1M3A A;  1JXM A;  1PWT A;  1Z9Q A;  1S1N A;  1Y57 A;  1WXB A;  2A36 A;  1ZUK A;  1GRI A;  1SSH A;  1GFD A;  4EIK A;  1NG2 A;  4J9F A;  2KT1 A;  2KRN A;  2K7A A;  1UFF A;  1QWE A;  1UJ0 A;  1G2B A;  4OMN A;  1LCK A;  5IHI A;  1SRL A;  3EG3 A;  1BB9 A;  2ROL A;  3PVL A;  1BBZ A;  2NUZ A;  4CC4 B;  2OI3 A;  2DM1 A;  1PRM C;  3H0I A;  2H8H A;  2DE0 X;  2K3B A;  3H41 A;  1UHC A;  5FWC A;  3M0R A;  2K2M A;  2VKN A;  2EYX A;  2CH4 A;  4HCK A;  3SHW A;  2BTT A;  2KNB B;  5GJV B;  4Y92 A;  2CSQ A;  1U06 A;  2DRK A;  2HDA A;  1BK2 A;  1GBQ A;  1MV3 A;  1M3B A;  1FYN A;  1X2K A;  2CUB A;  2DBK A;  2O9S A;  1X43 A;  4RTV A;  2EBP A;  2G6F X;  4CC7 A;  1CKB A;  1YN8 A;  2BZX A;  3VS3 A;  1VA7 A;  1M3C A;  5HCK A;  1UG1 A;  1ZLM A;  2M51 A;  2EPD A;  2PZ1 A;  1SHF A;  2A37 A;  2J6O A;  1QWF A;  1K4U S;  2O9V A;  1KJW A;  4OMM A;  1I1J A;  1HJD A;  1RUW A;  4LNP A;  2FPE A;  1UE9 A;  4JJD A;  2P4R A;  3VS7 A;  2J6F A;  4RTY A;  1NLO C;  2OJ2 A;  1NEB A;  1PHT A;  4J9C A;  3I9Q A;  2EYZ A;  1AWX A;  1PKS A;  2YUP A;  1T3S A;  1NYF A;  2IIM A;  2RQT A;  1UTI A;  3VS6 A;  3VS4 A;  2VVK A;  1SRM A;  4OML A;  1M8M A;  1WXT A;  1K76 A;  3M0S A;  4K11 A;  2D8J A;  4Z89 A;  5I11 A;  4JJB A;  2JS2 A;  2JXB A;  1IO6 A;  1WX6 A;  4RTU A;  1QCF A;  3TSZ A;  3NPF A;  4AG2 C;  1I0C A;  1RLP C;  1OPK A;  2JMC A;  1UJY A;  1AWJ A;  2YUQ A;  1WI7 A;  1SHG A;  2KYB A;  1B3Q A;  4GLM A;  3RBB B;  1H3H A;  2KBT A;  4IIM A;  2DVJ A;  2FO0 A;  2CH4 W;  1YWO A;  4CC3 A;  2C0O A;  3UF4 A;  2DLP A;  2D0N A;  1H8K A;  2AK5 A;  2JT4 A;  2GBQ A;  2XMF A;  1AOJ A;  2LQW A;  4F14 A;  3EGU A;  1A0N B;  1QLY A;  1OPL A;  1X27 A;  4QT7 A;  2FEI A;  4R0K A;  3QWX X;  2JTE A;  2A28 A;  2DX1 A;  1B07 A;  1I07 A;  2DL5 A;  3H0H A;  1SEM A;  2AKK A;  2J06 A;  1J3T A;  1GFC A;  3VS0 A;  5FW9 A;  2KEA A;  1QKW A;  2GTJ A;  4DEX A;  1PRL C;  2EGE A;  1EFN A;  1WFW A;  2AKL A;  1OEB A;  1OV3 A;  2NWM A;  1ABQ A;  2JMA A;  1HD3 A;  2KXC A;  4Z8A A;  4JZ3 A;  2PTK A;  2SEM A;  1GBR A;  4AFU C;  3REB B;  4JJC A;  2BZY A;  1KFZ A;  2J05 A;  3GBQ A;  1WXU A;  4OMO A;  3REA B;  1SPK A;  2RNA A;  1GL5 A;  4HXJ A;  2MOX A;  3SEM A;  1H92 A;  1NYG A;  2AZV A;  2ED1 A;  3PE0 A;  1UGV A;  2C0I A;  1TUD A;  3H0F A;  2W10 A;  2RPN A;  2DA9 A;  2KYM A;  3TVT A;  1AWO A;  1GCQ C;  4OMQ A;  2J7I A;  1AVZ C;  4J9B A;  2CDT A;  2GGR A;  1VYU A;  2DBM A;  2KE9 A;  2EYY A;  1TG0 A;  1FMK A;  4LUD A;  2EQI A;  2X3X D;  2FRY A;  2LJ3 A;  4ORZ A;  4ZNX A;  4J9E A;  2EW3 A;  3A98 A;  1YCS B;  2DL8 A;  2EGC A;  3EG2 A;  2E5K A;  3NGP A;  1MV0 B;  1AD5 A;  3C0C A;  2LJ0 A;  2LQN A;  2KRS A;  2ABL A;  2PNI A;  1G83 A;  2HBW A;  2X3W D;  3JV3 A;  2MCN A;  1YWP A;  2RF0 A;  2V1R A;  1UUE A;  2FPD A;  3RNJ A;  1ABO A;  1X6B A;  2F2W A;  1YP5 A;  4RTX A;  1N5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...