1WFWA

Solution structure of sh3 domain of mouse kalirin-9a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of SH3 domain of mouse Kalirin-9a protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Kalirin-9a
total genus 6
structure length 74
sequence length 74
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wfwA00
2A37A 4RTTA 4J9CA 2M51A 3O5ZA 2LZ6B 1SHFA 1XOVA 3ZL7C 4AG1C 2CH4A 2J6OA 3VS4A 2EVRA 4CC4B 1M8MA 2GTJA 1HD3A 2LP5A 1QKXA 4WCIA 1S1NA 1UDLA 1WXTA 1GFDA 4F17A 1UE9A 2J06A 2PTKA 2D0NA 2EGAA 1OPLA 1X2KA 3NGPA 1NLOC 2BZ8A 1W70A 2C0IA 3M0RA 3A98A 2O9VA 2FEIA 1QLYA 2L0AA 1ZSGA 1RUWA 2DL7A 2KYBA 1BBZA 2LQNA 2F2WA 3TSWA 2J6FA 3I5SA 3LH5A 5FW9A 4AG2C 1WFWA 2DRKA 3EG0A 1I07A 2YDLA 1NEGA 2JM8A 3H0FA 4LE9A 4JPBW 1Z9QA 4ZNXA 1AZGB 1ZUUA 3H41A 1UJ0A 2DMOA 1M3AA 1K4US 1KIKA 4IIMA 2EKHA 1WYXA 1JXMA 4CC2A 3I5RA 1FMKA 4RTWA 1M3BA 1SPKA 2KNBB 5GJWB 4X1VA 1OV3A 1WLPB 2D1XA 2DL8A 5EC7A 2LJ1A 4Y92A 1HSQA 2AKLA 4HVUA 3M0SA 2MIOA 2EQIA 3I9QA 2DRMA 2FPFA 2V1RA 1UTIA 3M0QA 3C0CA 5IHKA 2LNHB 2KRMA 3NPFA 4JJDA 3U23A 2C0TA 2LX7A 3H0IA 2PZ1A 2BTTA 2V1QA 2ED1A 4AFSC 1VYUA 2KR3A 1WA7A 1T3LA 1PKTA 1CSKA 2K2MA 1UUEA 1YWPA 2RF0A 1QKWA 2P4RA 2LQWA 2HEQA 2EGEA 1K0XA 2L2PA 1UJYA 1PHTA 2YUPA 1ZX6A 4OMPA 4OMNA 5I11A 3VS2A 1W6XA 1ZUYA 2CUBA 1UFFA 1PWTA 1ABQA 2AZSA 2RPNA 3GBQA 2LJ0A 2A36A 2O88A 1Z9ZA 1E6HA 1T0HA 2FRWA 2KT1A 4AFQC 2DBKA 1PNJA 4CC7A 1Y57A 1CKBA 2GGRA 2FO0A 1M30A 1UHCA 1W1FA 2EW3A 4RUGA 1YP5A 2JXBA 2RQTA 2F2XA 4LUDA 3M0TA 2CSIA 2KROA 1GRIA 2RQVA 1RLQC 4HXJA 2X3WD 1AEYA 3REBB 2NUZA 1KFZA 1NYGA 1QWFA 2KEAA 1KSWA 2DYBA 1NEBA 2EBPA 4LNPA 2GBQA 2H8HA 1T3SA 4E6RA 1EFNA 1SSHA 2JTEA 1VYVA 1NG2A 1LCKA 4AFZC 1PRLC 1UG1A 1JXOA 4J9IA 2AKKA 2FPEA 1U5SA 2FG0A 1JU5C 2RN8A 1G83A 1U06A 1IO6A 2F2VA 3ULRB 3VS0A 4OMOA 1GCQC 4K11A 2KXCA 1WI7A 4J9GA 2KE9A 2DLPA 3VS7A 5IXBA 1ABOA 2E5KA 2KXDA 1X69A 1WXUA 5IXFA 3EGUA 4RTXA 2LCSA 1Y0MA 1X27A 2B86A 2KYMA 1QCFA 1NYFA 1M3CA 1GL5A 2DL5A 3THKA 2EYXA 3NMZC 1UGVA 4JJBA 2DE0X 5HCKA 5IH2A 2CH4W 1SRMA 1K0SA 2JS2A 2KGTA 2AK5A 1H8KA 2KRSA 3JV3A 1AVZC 2LJ3A 1NLPC 1M27C 4CC3A 1UECA 1BU1A 2AZVA 3CQTA 1RLPC 3R6NA 1X2QA 5I22A 4KRTA 2J7IA 3VRYA 1E7OA 2HBWA 1AZEA 2GQIA 2G6FX 2ROTA 2SEMA 2I0NA 2DBMA 2EYWA 4GLMA 1J3TA 1SHGA 1X43A 1OEBA 2J05A 2MOXA 1YNZA 4M4ZA 1ZUKA 5IHNA 2EPDA 4D8KA 3H0HA 4F14A 5FWCA 2KRNA 4OMMA 2YUQA 2DILA 2ROLA 2DL3A 3QWYA 1U3OA 2BZXA 2VWFA 1GFCA 2HSPA 3REAB 3EHRA 1QWEA 1V1CA 4J9EA 4QT7A 4JJCA 1GCQA 2K79A 4GBQA 2YT6A 3QWXX 1TG0A 1GBQA 2DNUA 2MCNA 2XMFA 2CT3A 1X6GA 1X6BA 1E6GA 2EYYA 2JT4A 3I35A 5FWBA 1I0CA 2C0OA 2CT4A 1OOTA 4LUEA 1K9AA 1TUDA 1AWWA 1WIEA 2JM9A 2K6DA 2JS0A 3TSZA 2L3PA 4D8DA 3PE0A 2D8HA 2CREA 4J9FA 3VS3A 2ESWA 2CUDA 4IIOA 2K9GA 4Z8AA 1GBRA 2L3SA 4Z88A 3VS6A 3M0PA 1ZBJA 2W0ZA 1A0NB 1ARKA 2DA9A 3M0UA 2EYZA 2DVJA 2GTOA 4RTZA 1AWXA 1MV0B 2BZYA 4OMLA 5L23A 1H3HA 2ED0A 2M0YA 2RNAA 2SRCA 2RMOA 1NM7A 2RQWA 1B07A 2CDTA 1CKAA 3EG2A 2A28A 1FYNA 4DEXA 2L3QA 2DM1A 2PNIA 1SRLA 3FJ5A 2DX1A 1UHFA 1ZLMA 3VRZA 2D8JA 1BK2A 2KT8A 1MV3A 2YSQA 4FSSA 1VYTA 2DJQA 2RQUA 2ABLA 3EG3A 1JQQA 4R0KA 2X3XD 3SEMA 2JMCA 2O9SA 3TVTA 4HCKA 2ECZA 2W10A 2ENMA 2J6KA 1OPKA 1WXBA 2GNCA 2K3BA 2K7AA 2CSQA 3RBBB 3KFVA 2DL4A 4EIKA 1YCSB 2DF6A 4HVWA 2NWMA 1AWJA 2A08A 3NHNA 4A63B 1JO8A 2YUOA 2JW4A 5IHIA 2VVKA 1KJWA 2OI3A 1AWOA 1JEGA 3VS1A 1I1JA 2HDAA 3EG1A 4LN2A 4ORZA 1SEMA 1K1ZA 2LMJA 2EGCA 1WX6A 2JMAA 2FPDA 1H92A 1B3QA 3UA6A 4ESRA 1RI9A 4AFUC 2FRYA 1T0JA 4RTVA 4DEYA 4JZ3A 2O31A 4HVVA 4JZ4A 3PVQA 2QDLA 5ECAA 1N5ZA 4RTUA 3SHWA 3RNJA 2YUNA 1MUZA 2OJ2A 3VS5A 2HCKA 2O2OA 4F16A 3UA7A 1AD5A 1GCPA 3IQLA 1K76A 2VKNA 1G2BA 4Z89A 4J9BA 2IIMA 1BB9A 2KBTA 4OMQA 1WDXA 3UF4A 2OAWA 3PVLA 4J9HA 5GJVB 1VA7A 3EHQA 4RTYA 2RQRA 4J9DA 1PKSA 1YWOA 1TUCA 3UATA 1AOJA 1PRMC 1YN8A 1HJDA
chains in the Genus database with same CATH superfamily
4DBRA 5GANf 3O5ZA 2LZ6B 4KGZB 2LC4A 1XOVA 3ZL7C 2J6OA 3VS4A 1VQ6A 5HK3A 2EVRA 2CZ0B 4EMKC 1VQPT 2GTJA 1HD3A 2GF7A 2QYZA 4JDSA 3D7SB 4KH0B 3EH2A 4RCBA 5KYUA 2J06A 2XG8D 2D0NA 4HA8A 4NS5A 3CCRA 3RUXA 5CKDA 3CC4T 3LGLA 2BZ8A 3QHSA 1RADB 3AHUA 4Q5WA 2C0IA 2O9VA 4A53A 2FEIA 1K73C 2QEXA 2BKDN 3RR6A 1ZA1B 2DL7A 2XU8A 3TSWA 2J6FA 3LH5A 1IB8A 2DRKA 4J6XA 1D3BB 1R77A 4M7DC 4N0AC 1YITQ 3JB9D 2P4TA 4JPBW 1WHGA 1Z9QA 3OS5A 4FL6A 2DMOA 2KK4A 4IIMA 2EKHA 2DJZA 2HQXA 3OYHA 1FMKA 4XU3A 3HRSA 3BDLA 3M58A 1OV3A 3EGDA 3QJYA 3CBOA 4A4KA 4ANJA 1LOJA 1K73R 1WLPB 1K9MR 2DL8A 2COWA 3GLXA 1HSQA 4HVUA 2EQIA 3CMET 3I9QA 2V1RA 2LX9A 2DD4A 4C0GA 2A0FB 1IHWA 1D1BA 3NPFA 3U23A 4BD3A 2RI2A 2RJFA 2DXTA 1YWPA 1QKWA 2EGEA 1QCNA 5GAN7 1ZX6A 4OMNA 4EMGA 2E64A 1W6XA 3P8DA 1RABB 2IVWA 2DVEA 2KVQG 2QASA 5EG2A 3RERA 5LJ3g 2HNIA 2OTLA 1YHQT 1E6HA 1T0HA 5LJ5j 2DBKA 1CKBA 1IXDA 1PSFA 2RHUA 2RQTA 4ZGJB 3H6ZA 4M75A 2XK0A 4E7LA 5GAMd 2E1HA 4O6JA 5C0MA 3X25B 2KEAA 3M5AA 1KSWA 3RMSA 2WACA 2HKQB 1V29B 4LNPA 1VQ8A 2QK0A 3OY9A 2GBQA 2H8HA 1T3SA 3OW2P 4IUVA 2PVDB 4PJOA 4AFZC 1PRLC 4C92F 1YJ9Q 1HXDA 1KQ2A 1JU5C 2RN8A 3M59A 3LH0A 1IO6A 4XK8E 1GCQC 2FZCB 1BIBA 1JBMA 1RI0A 4V2SA 5GMKh 1IHVA 1MGQA 5KYYB 2DTHA 3M55A 3FIFA 4EMHA 5FRNA 5KH6A 5LJ5e 3CCEQ 1VOMA 3CCMA 1NYFA 1M3CA 1GL5A 5KYXA 3NMZC 4JJBA 3CPWP 3HKSA 1SRMA 2JS2A 8ATCB 1Q86R 1YIJA 2KGTA 1H8KA 2KRSA 4QQ6A 2YRCA 1Y7XA 3CQTA 4JJNK 3L2QA 4MZMA 4BB7A 4KRTA 1DJ7B 3CC4A 2J7IA 1B34A 2DTIA 4YTLA 3VRYA 1M1KC 2X35A 4J7IA 1QP3A 2I0NA 2EYWA 3ZEHA 1J3TA 2RM4A 5J39A 2DXBA 3JCMQ 1M1KU 4M7DF 2MOXA 4BACA 4HCCA 1MMAA 5IHNA 1VQLT 2COZA 4PJJA 1YBYA 4JRKA 4Z02A 2MF2A 2DIGA 1SKUB 3DLMA 4C8QF 2QGFB 5GMKj 1LNXA 4J9EA 2DETA 1XNIA 3META 4QQGA 2KMTA 1ACMB 1TS9A 1WJRA 2BIVA 3RKXA 4PFOA 2K2VA 1QCOA 2JJ9A 3AT1B 4QQDA 4J8OA 1X6GA 5A2QE 5GMKi 1Q81U 3CCLA 1KG1A 4CRIA 4BE1A 5DM7R 1TUDA 1WIEA 2JM9A 3GIBA 3A8LB 2DFUA 4MZTA 4E7SA 2VGNA 2Y4XA 3PE0A 2CUDA 4M75F 5LL6S 3GF5A 2RD1A 2QA4A 3SFMA 3OYDA 2QQAA 2COYA 4R55A 2L3SA 2ATCB 2JVVA 1VQOT 4X9DA 2K4YA 5I21A 1A0NB 1YI2A 5CCAA 1G8XA 4RTZA 3OW2A 1AWXA 2C06A 1KC8R 5IT9E 1MV0B 4OMLA 1HK9A 4F7UE 2M0YA 2RNAA 2SRCA 1QVFP 2RMOA 4HT9A 1B07A 2OTJQ 2O4XA 2A28A 1P92A 1KD1U 4M77G 1RAEB 2D0QB 1ZLMA 3VRZA 1BK2A 1WZOA 4FCYA 3CC2T 3OW2S 2YRDA 1MV3A 2JTMA 4M7DE 3G1JA 1JRIA 1YHQQ 2E6NA 4FIBA 2ABLA 3EG3A 1VQ9A 5CKHA 1M2OA 2IG0A 1W2BP 4R0KA 2PU9B 3SWNA 1U1TA 3UDCA 1XJWB 3HP9A 2K7AA 2CSQA 3C12A 1B34B 1D1AA 2DF6A 3G71Q 4HVWA 4KH1B 3CCUT 2RO0A 2YUOA 4JLIA 4OP0A 3UWNA 3I56T 2JW4A 2QQRA 5D6YA 1KJWA 2OI3A 3E2UA 1O75A 5CKEA 3OBWA 3QUIA 2HDAA 3KUFA 3EG1A 1Q7YR 4ORZA 1QVFS 4E47A 2FPDA 1B3QA 1AHJB 2YRVA 1RAHB 2QA4Q 2FRYA 1T0JA 2E3HA 1K9MC 3G6EQ 4DEYA 4DBQA 4HVVA 1WQ7A 2RHIA 5ECAA 2HZYA 1IGUA 5LJ5d 3CCVA 4RTUA 2I2LA 2EQKA 2V8IA 5LJ3f 1Q7YU 3MEVA 1Y71A 1R0BG 3C95A 3OYEA 3OYLA 1G2BA 3CBPA 1BB9A 3LW5E 1WDXA 1R0CB 5GAOq 4PJOB 4J9DA 1ZBXA 1EX4A 4IURA 3UATA 4M7DA 1WHKA 2D6FA 2A37A 3QZ5B 2QGGA 2M51A 1VQOA 3UT1A 2R5AA 2XICA 4XU0A 3CMEA 1IRXA 1U1SA 5GMKe 1M8MA 3FB9A 1UDLA 1WXTA 1GFDA 2VXEA 4M75B 2PTKA 1PD1A 1X2KA 1NLOC 2DERA 1W70A 4C8QC 3L2RA 2IPOB 3HL8A 3V8LA 2MK5A 3L2UA 2RJDA 3OS2A 5GAN3 4OB2B 3T9NA 2KYBA 2F2WA 4M78A 3CCSQ 5FW9A 2DK3A 5GAN5 4XU2A 3JCMc 1VIEA 3EG0A 1VQKA 4KGXB 1YHQA 1I07A 2VASA 2H3JA 2YDLA 3ZFJA 2D9TA 3CCMQ 2JM8A 3H0FA 4M78F 1I5LA 1VQ9Q 1I5OB 1ZQ1A 2VXFA 1Y96B 1KIKA 3EFSA 4RCCA 5KYXB 4CC2A 2XI9A 2E41A 4FYYB 2D1XA 1LJOA 5EC7A 3EFRA 1QMCA 2KI7A 2LJ1A 1YJWA 5KE3A 4X34A 3M0SA 1Q81R 2MIOA 5CO7A 2XDPA 1PD0A 1VQOQ 1QVFA 2FVUA 3C0CA 2BE7D 3C4SA 1VQNA 3X28B 4C92D 3M56A 2YWWA 1ZSZC 2BTTA 3ER0A 2V1QA 4AFSC 1SG5A 1V76A 2KR3A 1WA7A 2CP2A 2RH2A 1T3LA 5D6WA 5LJ5f 2K2MA 1UUEA 3OA6A 2ZGWA 2OTJT 2LT4A 2L2PA 2FL7A 1UJYA 1PHTA 5I11A 3HFOA 2WSEE 4IUPA 5L8RE 4C8QB 4RG2A 3CC2Q 2LT1A 2RPNA 1YJNQ 2A36A 3NFCA 2FRWA 1TOVA 2E6ZA 1PNJA 4N4HA 3OYJA 4RMOA 2GGRA 1VQ4Q 1PC0A 2X51A 3QO3A 2CSIA 2F5KA 1GRIA 2RQVA 1X75C 1RLQC 4HXJA 1Q82U 3M57A 1G3TA 2X3WD 1KFZA 1NYGA 2EWNA 2CGHA 2A3LA 4VUBA 1NEBA 3BW1A 3S3OA 4M78E 4ELZC 4E6RA 1EFNA 2HD0A 3CXCP 4JRPA 1NE8A 1VYVA 2VV5A 1OZ2A 1LCKA 1UG1A 4MDXA 4QW2A 1OULA 3OYMA 2QA4T 1U5SA 3G6ET 1MMGA 1G83A 3QIIA 4F7UG 1U06A 2F2VA 3ULRB 3VS0A 4OMOA 2MI6A 4M7AD 2M0OA 3L2ZA 2QQSA 4J9GA 3CPWS 3O8VA 3E9GA 1ABOA 3CCEA 3E1SA 1X69A 3I55Q 4MDWA 1KHCA 2NYSA 2LCSA 1Y0MA 4L6V5 5DLQE 4E2FB 4N4GA 4OB0B 2EYXA 3SDZA 3RMQA 3NTKA 4PJOD 5GAMf 5IH2A 2CH4W 4J6WA 1AVZC 1VQ7A 1M27C 1YJ9A 3VV0A 3EH1A 4C0FA 1UECA 5GAOp 3JB9H 5M9OA 1RLPC 1VQPQ 2GQVA 2FZKB 1FMWA 3CCQA 2EAYA 5FU6C 3MO8A 2G6FX 3TU4K 3JCMf 2SEMA 4GLMA 1S72Q 1OYXA 2DKGA 3MP8A 5CIUA 4OGCA 2J05A 2DIQA 1D09B 5I2SA 1WHMA 1Q81C 1C6VX 5FWCA 3MKDA 4OMMA 1WHLA 2HSEB 2DL3A 3CCQT 2BZXA 3TQ7P 4C0DC 1GFCA 4HKEA 1QWEA 1V1CA 4QT7A 1AOJA 2RI5A 3HTRA 3WVDB 4II1A 1VQ7Q 5CR2A 2LCLA 1YITT 5GAN2 4GBQA 2P0PA 4JRQA 3QWXX 2DNUA 2XMFA 1VQ9T 2P84A 1RACB 4C8QA 1JJ2P 1NJIC 2EYYA 2JT4A 5FWBA 4C92B 2MAMA 2CT4A 4LUEA 1K9AA 1AWWA 2K6DA 3X26B 4JRIA 4D8DA 4BDZA 4M77A 2D8HA 3VS3A 2O4XB 4OMFB 2E5QA 3QKJA 5FU6B 1VQNT 3X24B 4Z88A 4M75D 2HBPA 3VS6A 1ZBJA 2EYZA 2LRQA 2QQBA 3JCMP 4BE2A 1PSEA 4C8QG 1KQSP 5L23A 3PIOA 5HKCA 1H3HA 2X4JA 2CP3A 2RQWA 1UGPB 4MMKA 2L3QA 4A4FA 4F7UF 3CPWA 1GXIE 4C8QD 1UHFA 3VU3C 2PVGB 4BE0A 4MMLA 5IAYA 1VYTA 1VUBA 2DO3A 4C92G 2NUTA 1I81A 2WSCE 2RQUA 5CK9A 2X3XD 1UEBA 1RAIB 5CVIA 2J6KA 3L42A 5GAMj 1F1BB 2PVOB 2ZCFB 4J83A 3RBBB 1YCSB 3CD6Q 1R8OB 1AWJA 2A08A 4MZPA 4A63B 1JO8A 3JCMb 3OYAA 2EQUA 2M16A 4J5YA 4BI8B 5IHIA 2VVKA 3CCRQ 1QP2A 2YLCA 3VS1A 1I1JA 2RHYA 1K8AU 2L3RA 5LJ3j 4QVDA 2YLBA 3QJ6A 2LMJA 1ZSZB 2JMAA 3CBMA 2FZGB 1XTDA 3UA6A 3V7CA 5LJ5g 1RI9A 3RESA 3J80E 3S3MA 2EYQA 3CMAQ 3CCJA 1XQHA 4DOWA 4LDXA 1VQ6Q 3PVQA 4NL2A 5GMKl 5GAOm 1EZZB 2RI3A 2CP6A 2Y90A 1YI2T 1N5ZA 6AT1B 3SHWA 4FW1A 4DBFA 2EQJA 4M77E 3VS5A 2HCKA 2O2OA 4F16A 3TREA 1Q82R 3I55T 1G5VA 1AD5A 1LPLA 1VQMA 2DXCA 4M75C 4J9BA 2KBTA 3SB2A 2MYSA 4FYVB 1M9SA 4RTYA 1I8FA 3QXEB 2X9HA 1D0YA 4D6WA 1KK7A 1VQ5A 3SWNC 1PRMC 3VUBA 1MMDA 4RTTA 4J9CA 2RHXA 5I2MA 2XHCA 3DB4A 1K8AC 5GMKm 1Y07A 4B9XA 1QKXA 1UE9A 1WPYA 1BIAA 3HFNA 3TCJA 2DYIA 1TH7A 3NGPA 1S72T 2F5TX 4J6YA 2K3XA 3ASKA 1QQJA 3M0RA 3A98A 4BI3A 2ZZDA 3EG9A 2QAZA 4WF2A 1VQLQ 2EFIA 3GP8A 1QLYA 2L0AA 1ZSGA 5LJ3e 1ZSZA 1YIJT 1VQ5Q 2LQNA 1N9RA 3I5SA 1NZ9A 1WFWA 1BI2A 3JAME 1FMVA 1HYOA 4JLGA 1VQ4A 1NEGA 4LE9A 2M9UA 3H41A 1TXQA 3RKWA 3G4SQ 5J3BA 1K4US 1WGSA 1YJNA 4E7KA 1JXMA 2ZPIB 1QVGP 3I5RA 4RTWA 1M3BA 1SPKA 4XTUA 4X1VA 1D1CA 3PT9A 2XKOC 2K57A 1EIFA 5FRMA 1N27A 1AT1B 2NUTB 4BUGA 4M78G 3CMAA 2F69A 1VQNQ 3EAEA 2FB7A 7AT1B 3VUZA 1SF9A 1UGRB 3OYYA 4A4EA 5IHKA 3MEWA 1O9SA 2KRMA 4JJDA 4EMKB 3JB9G 2LX7A 2PZ1A 3OMCA 2ED1A 4HT8A 3PIPA 1PCXA 2V26A 1PKTA 4PFZA 5LJ3d 3A8HB 5GAN8 2RF0A 3I56A 2P4RA 4PJOF 2HEQA 4FT4A 4EDUA 2ZPHB 3LLRA 4PJOC 1M90R 1ZA2B 1RAFB 2XDDA 1M1GA 4X9CA 1ZUYA 2CUBA 1UFFA 1TU0B 1PWTA 4XQ3A 4M77C 2AZSA 3KBGA 3JCMW 3R6OA 2O88A 2JOYA 1Z9ZA 2CZ1B 1W2BA 3M9QA 4LDVA 1JJ2A 4AFQC 3CCSA 4CC7A 1BI3A 2DPPB 1Y57A 3N5BB 2FO0A 1M30A 1UHCA 2EIFA 1W1FA 2BUDA 4RUGA 2JXBA 4KT0E 4C92A 4LUDA 3M0TA 2KROA 3G71T 3WXMB 4JS5A 3CD6T 3CCUQ 2NUZA 1QWFA 4LDYA 1OZ3A 4E7HA 2CZ6B 4ZTJA 4BY6C 2EBPA 3A8GB 1BI0A 4NOYA 3MJXA 3LYIA 2K3YA 3MHXA 4M7DD 2ZPBB 4J9IA 2AKKA 2EJFA 2MWOA 5J26A 3EFOA 5GANe 1K73U 2DEUA 3J81E 2K5IA 1VQ6T 1IZ6A 5CAIA 1YI2Q 4K11A 3HSBA 3P8BB 3JB9I 2KXCA 1WI7A 2KE9A 2DLPA 3VS7A 5IXBA 1G3SA 3FDRA 2E5KA 1W4SA 2KXDA 4C92C 4E7ZA 5IXFA 2AT1B 2CP5A 5HK0A 2KYMA 3EFOB 4QVZA 2EJ9A 1UGVA 3HRUA 5C6SA 3MCAB 5HCKA 5GAMg 4KULA 1N8RC 4XTVA 1KQSS 4O5VA 4F7UA 1NPRA 4C0DB 3JV3A 1C1AA 2LJ3A 5KCOA 1N8RU 4CC3A 2L5QA 1BU1A 1MMNA 2AZVA 3OS0A 3LGFA 3VKIA 3PNWC 4L59A 3BFMA 4LDWA 4PJOG 1AZEA 2O01E 4FYXB 4F04B 1VQLA 2ROTA 3EGXA 3A5ZB 1SHGA 4LXCA 3G4SA 1OEBA 1KHIA 4HCBA 2H3EB 1BCMA 3CC7Q 2EPDA 4D8KA 2QTVA 3H0HA 4F14A 1KD1C 5LJ3h 2YUQA 1D0XA 2ROLA 1U3OA 2V8KA 1VIFA 4DOVA 5GANg 1I4K1 5KYNA 5FLXE 2HSPA 3REAB 4ZN1A 2FYKA 3EHRA 3CCST 3JCMd 1JB0E 1TTHB 5GAN4 2RA2A 2NUPA 3CEYA 4ZGEB 2HQHA 2LVMA 1TG0A 1IREB 2MCNA 1KC8U 3I55A 3NTIA 4Y28E 2CT3A 3A8MB 1X6BA 4BY6B 1E6GA 2DZCA 4DQ2A 2OTLT 3I35A 2C0OA 1OOTA 2XIDA 1KC8C 2JS0A 3M54A 4LDUA 3G7ZA 3RKYA 5GANd 1N6AA 3INZA 1VQMQ 4J9FA 4IIOA 4XTXA 3BDUA 4AMCA 3FLGA 1YITA 1GBRA 4P5NA 3Q1JA 1IGQA 1RL2A 1H3ZA 2WSFE 2CS7A 2DA9A 3M0UA 2DVJA 4DA4A 2GTOA 4OB3B 2HQEA 4M7AG 2QEXQ 1FX7A 3CC7A 4XAXB 3CC2A 4WTOB 4RKUE 3GPLA 4DEXA 2DAQA 2PNIA 3GNFB 1M1FA 2DX1A 2RJEA 3JCMe 1Q7YC 4FSSA 4KBMB 1JQQA 2VGMA 3CD6A 2AIRB 3SEMA 2R58A 3DKMA 5FROA 3OB9A 4HCKA 5DLOA 1Q86U 3JB9F 2ENMA 1VQ4T 5AT1B 4EPCA 2X4YA 2P0KA 3CCVQ 1C0MA 3C94A 3KFVA 3PTAA 2DL4A 2KAFA 4EIKA 3JB9J 2DZ9A 2NWMA 3NHNA 4PLIA 2LQKA 1MNEA 5GAN6 1WJQA 3P8HA 1UGQB 2QQ9A 1JEGA 4ZGDB 1FXXA 3V7SA 4JUVA 1M90U 4Y91A 2XDBA 2QG9B 1K1ZA 2JTFA 2EGCA 3MEAA 1M90C 1BCOA 1M8VA 4AFUC 4A54A 2LTOA 2NUPB 3URGA 4JZ3A 2O31A 3OSVA 2QDLA 2E65A 3L1AA 2X4XA 2OX7A 2DD5A 3RNJA 2YUNA 2L8DA 4AT1B 1MUZA 2OJ2A 3HHTB 5IN1A 2EJGA 1G3WA 1D3BA 3GNGA 2DTOA 3IQLA 2CP7A 3DB3A 4LD6A 2IIMA 4OMQA 2A7YA 4B9WA 2OAWA 3PVLA 4J9HA 1VA7A 3CCUA 4M7DB 2RQRA 5GAMh 1YWOA 1TUCA 1M4ZA 5A0DA 4M7AB 1KQ1A 1Q95G 2AHJB 3KXTA 3JCMJ 1MNDA 3EGDB 2RB6A 1SHFA 4AG1C 5KYWA 2CH4A 3SWNB 1MHNA 2E3IA 4M7AC 4F7UB 4CC4B 4OGEA 2M1HA 2LP5A 5FU7C 2VB6A 4WCIA 1S1NA 3L2WA 4F17A 2V8JA 4OVAA 1TUGB 2EGAA 1OPLA 3M4GA 2HL5C 4PFPA 2ZPEB 1KD1R 2DEQA 5GAOr 1NPPA 5FU7B 2ZPFB 3V8JA 3CC7T 2CKKA 2Z0WA 2PQWA 1VQKT 3CCLQ 3RIRA 1OU8A 3CCQQ 4E7IA 4PJOE 1RUWA 1OQKA 1BBZA 5D7UA 3WVEB 3TEEA 4AG2C 1RAAB 2RJCA 4M78D 3JCMg 3V8KA 2K5LA 2LCCA 1VQ7T 3SD4A 4QVCA 3OYKA 4ZNXA 1AZGB 1ZUUA 2ZAEA 2FHDA 5KYUB 3DLLA 3JSCA 1UJ0A 1M3AA 1WYXA 2OTLQ 5GAOn 1TWBA 4ELYC 3VYGA 4C5EA 3H8ZA 3A1PA 2KNBB 3MEUA 5GJWB 3QBYA 4OF1A 2PUKB 4A4HA 4M7AE 2QXFA 4C5GA 1VQMT 3X20B 5CKBA 4Y92A 4FU6A 4C0ZA 3G71A 3PMIA 2Y4YA 2AKLA 3FEOA 4PNOA 2DRMA 2FPFA 1WHJA 1UTIA 3HPWA 5A0GA 1N8RR 2LDMA 2B8AA 3M0QA 5GAMe 5A0LA 3BE3A 2LNHB 1UGSB 1M2VA 2C0TA 4C5HA 3OYNA 3H0IA 2XD0A 2QEXT 9ATCB 1VYUA 4DBHA 1CSKA 2LQWA 3CPFA 1K0XA 3HRTA 1OX8A 4KGVB 4OMPA 2YUPA 3VS2A 5KYWB 4PLLA 1YCYA 3OYCA 3OS1A 2OTJA 1ABQA 3S6WA 3PMTA 3GBQA 4BI4A 2LJ0A 5AYFA 2KY9A 4E7JA 2GFUA 2KT1A 1OI1A 2E10A 3J7AF 4GY5A 5KE2A 4M75E 3OQ5A 2EW3A 4N0AA 1NJIU 3CCVT 1YP5A 3OYIA 2F2XA 2PUOB 4KUIA 3E19A 3QYHB 1OX9A 2VUBA 4XTZA 3REBB 4B6MA 1AEYA 1PM3A 3I56Q 2DYBA 1D0ZA 3CCRT 2QTXA 1SSHA 5DY9A 2JTEA 1FWZA 8AT1B 1NG2A 5KYYA 2R5MA 1U8RA 1VQ8Q 1B7TA 1JXOA 4M77D 2FPEA 4IUTA 4A4GA 5CKFA 3GOXA 3CMAT 4C8QE 2FG0A 4M77F 3ME9A 1M1KR 3QDRB 2JN0A 3LWIA 3CCJQ 1OU9A 4L5GA 4EMKA 5GANj 1ZHIA 3QPHA 4M7AA 3MP1A 5HY6A 1YJWQ 1WXUA 2F1LA 4M7DG 3EGUA 4RTXA 4XTWA 3NTHA 4KUDK 1X27A 2B86A 1QCFA 2DL5A 3E9FA 3THKA 4ZTFA 4BDYA 1K9MU 2DE0X 2RK1A 4M75G 3V7RA 5CQXA 3L2VA 3UPUA 1K0SA 4RG8A 3MPUB 3JRZA 3QZ9B 2AK5A 2P0QA 1Q82C 1X01A 1NLPC 5GAOl 2QI2A 3FRNA 4J7FA 2CP0A 2JZ2A 3FC3A 2KDSA 3R6NA 1X2QA 5I22A 2RK2A 2JNGA 4IUUA 1E7OA 4HCZA 3H9NA 2HBWA 2GQIA 3EG9B 2BE9B 2DBMA 2EQMA 3CC4Q 1X43A 1K8AR 4TVRA 4PL6A 3QYGB 1YNZA 4XU1A 4M4ZA 1ZUKA 4PK4A 2KRNA 1VQKQ 3CCLT 3LWHA 2DILA 4IKFA 3VJPA 3QWYA 5KCHA 1YIJQ 1VQ5T 2VWFA 3OYFA 4C92E 1X6OA 4ME7A 2JUFA 4JJCA 1GCQA 3QSUA 3A8OB 4M78B 2K79A 3OBYA 4FT2A 4XTYA 2VC8A 1UB4A 3CCMT 3OMGA 2YT6A 5GANh 2GCXA 1GBQA 2E12A 3OYBA 2YHTA 3G4ST 1PG5B 1I0CA 3BY7A 2GFAA 3TSZA 1M5Q1 2L3PA 3QG1A 3JCMV 4M7AF 2X4WA 4FW2A 4FYWB 3CXCS 1KQSA 4N4IA 1LVKA 2CREA 2MWPA 2VYTA 2ESWA 3QDFA 2L89A 2LNVA 2K9GA 4C5IA 1S72A 4PKCC 2CYZB 4ZN3A 3CMEQ 1Q86C 3PFSA 4Z8AA 1M2VB 3M0PA 5D6XA 2W0ZA 2G3RA 1ARKA 4M78C 2E70A 1VQPA 1BYMA 3CXCA 2BZYA 1Y96A 2ED0A 2EKOA 2LQ8A 1NM7A 5CQYA 2CDTA 1CKAA 3EG2A 1FYNA 3ZBDA 2DM1A 3LX7A 3VYHB 3JCMX 4UC4A 1G3YA 1NBEB 1SRLA 3FJ5A 1WQWA 2D8JA 3MP6A 2KT8A 1WHHA 2YSQA 4PJNA 1YFNA 1YJNT 1QVGA 2RHZA 2DJQA 4CI0C 1QVPA 4PJLA 3G6EA 2JMCA 4FSXA 2O9SA 3TVTA 3M53A 1BKBA 2ECZA 2W10A 3OSSC 1OPKA 1WXBA 2R57A 2GNCA 3S3NA 2K3BA 1BI1A 4ATOA 2KQWA 1WNLA 4GLKA 3FJPA 2NLUA 1QVGS 4R56A 4LD9K 1W2BS 1JJ2S 3OYGA 1AWOA 1N9SA 2QDYB 2HL3A 4FM4B 4LN2A 3EGXB 1SEMA 4OB1B 1WX6A 1VQ8T 1SSFA 1H92A 4QKUA 4ESRA 2MMPA 3F70A 1YJ9T 3M4YA 4NL3A 4RTVA 4JZ4A 2M02A 2HMAA 3PGGA 3CCJT 2KSSA 2HKNA 2YXYA 2ZPGB 2E4HA 1QW1A 1NJIR 2OAUA 3RDVA 2MPXC 2DXUA 3UA7A 1YJWT 1GCPA 4M77B 4IUQA 3JCMh 3CCET 1K76A 5LJ5h 2VKNA 4PJMA 4Z89A 4JS4A 3UF4A 5GJVB 1WJSA 2K5FA 3EHQA 1PKSA 1RAGB 1TSFA 1H641 2CZ7B 2HAXA 1YN8A 1HJDA
chains in the Genus database with same CATH topology
2A37A 4RTTA 4J9CA 2M51A 3O5ZA 2LZ6B 1SHFA 1XOVA 3ZL7C 4AG1C 2CH4A 2J6OA 3VS4A 2EVRA 4CC4B 1M8MA 2GTJA 1HD3A 2LP5A 1QKXA 4WCIA 1S1NA 1UDLA 1WXTA 1GFDA 4F17A 1UE9A 2J06A 2PTKA 2D0NA 2EGAA 1OPLA 1X2KA 3NGPA 1NLOC 2BZ8A 1W70A 2C0IA 3M0RA 3A98A 2O9VA 2FEIA 1QLYA 2L0AA 1ZSGA 1RUWA 2DL7A 2KYBA 1BBZA 2LQNA 2F2WA 3TSWA 2J6FA 3I5SA 3LH5A 5FW9A 4AG2C 1WFWA 2DRKA 3EG0A 1I07A 2YDLA 1NEGA 2JM8A 3H0FA 4LE9A 4JPBW 1Z9QA 4ZNXA 1AZGB 1ZUUA 3H41A 1UJ0A 2DMOA 1M3AA 1K4US 1KIKA 4IIMA 2EKHA 1WYXA 1JXMA 4CC2A 3I5RA 1FMKA 4RTWA 1M3BA 1SPKA 2KNBB 5GJWB 4X1VA 1OV3A 1WLPB 2D1XA 2DL8A 5EC7A 2LJ1A 4Y92A 1HSQA 2AKLA 4HVUA 3M0SA 2MIOA 2EQIA 3I9QA 2DRMA 2FPFA 2V1RA 1UTIA 3M0QA 3C0CA 5IHKA 2LNHB 2KRMA 3NPFA 4JJDA 3U23A 2C0TA 2LX7A 3H0IA 2PZ1A 2BTTA 2V1QA 2ED1A 4AFSC 1VYUA 2KR3A 1WA7A 1T3LA 1PKTA 1CSKA 2K2MA 1UUEA 1YWPA 2RF0A 1QKWA 2P4RA 2LQWA 2HEQA 2EGEA 1K0XA 2L2PA 1UJYA 1PHTA 2YUPA 1ZX6A 4OMPA 4OMNA 5I11A 3VS2A 1W6XA 1ZUYA 2CUBA 1UFFA 1PWTA 1ABQA 2AZSA 2RPNA 3GBQA 2LJ0A 2A36A 2O88A 1Z9ZA 1E6HA 1T0HA 2FRWA 2KT1A 4AFQC 2DBKA 1PNJA 4CC7A 1Y57A 1CKBA 2GGRA 2FO0A 1M30A 1UHCA 1W1FA 2EW3A 4RUGA 1YP5A 2JXBA 2RQTA 2F2XA 4LUDA 3M0TA 2CSIA 2KROA 1GRIA 2RQVA 1RLQC 4HXJA 2X3WD 1AEYA 3REBB 2NUZA 1KFZA 1NYGA 1QWFA 2KEAA 1KSWA 2DYBA 1NEBA 2EBPA 4LNPA 2GBQA 2H8HA 1T3SA 4E6RA 1EFNA 1SSHA 2JTEA 1VYVA 1NG2A 1LCKA 4AFZC 1PRLC 1UG1A 1JXOA 4J9IA 2AKKA 2FPEA 1U5SA 2FG0A 1JU5C 2RN8A 1G83A 1U06A 1IO6A 2F2VA 3ULRB 3VS0A 4OMOA 1GCQC 4K11A 2KXCA 1WI7A 4J9GA 2KE9A 2DLPA 3VS7A 5IXBA 1ABOA 2E5KA 2KXDA 1X69A 1WXUA 5IXFA 3EGUA 4RTXA 2LCSA 1Y0MA 1X27A 2B86A 2KYMA 1QCFA 1NYFA 1M3CA 1GL5A 2DL5A 3THKA 2EYXA 3NMZC 1UGVA 4JJBA 2DE0X 5HCKA 5IH2A 2CH4W 1SRMA 1K0SA 2JS2A 2KGTA 2AK5A 1H8KA 2KRSA 3JV3A 1AVZC 2LJ3A 1NLPC 1M27C 4CC3A 1UECA 1BU1A 2AZVA 3CQTA 1RLPC 3R6NA 1X2QA 5I22A 4KRTA 2J7IA 3VRYA 1E7OA 2HBWA 1AZEA 2GQIA 2G6FX 2ROTA 2SEMA 2I0NA 2DBMA 2EYWA 4GLMA 1J3TA 1SHGA 1X43A 1OEBA 2J05A 2MOXA 1YNZA 4M4ZA 1ZUKA 5IHNA 2EPDA 4D8KA 3H0HA 4F14A 5FWCA 2KRNA 4OMMA 2YUQA 2DILA 2ROLA 2DL3A 3QWYA 1U3OA 2BZXA 2VWFA 1GFCA 2HSPA 3REAB 3EHRA 1QWEA 1V1CA 4J9EA 4QT7A 4JJCA 1GCQA 2K79A 4GBQA 2YT6A 3QWXX 1TG0A 1GBQA 2DNUA 2MCNA 2XMFA 2CT3A 1X6GA 1X6BA 1E6GA 2EYYA 2JT4A 3I35A 5FWBA 1I0CA 2C0OA 2CT4A 1OOTA 4LUEA 1K9AA 1TUDA 1AWWA 1WIEA 2JM9A 2K6DA 2JS0A 3TSZA 2L3PA 4D8DA 3PE0A 2D8HA 2CREA 4J9FA 3VS3A 2ESWA 2CUDA 4IIOA 2K9GA 4Z8AA 1GBRA 2L3SA 4Z88A 3VS6A 3M0PA 1ZBJA 2W0ZA 1A0NB 1ARKA 2DA9A 3M0UA 2EYZA 2DVJA 2GTOA 4RTZA 1AWXA 1MV0B 2BZYA 4OMLA 5L23A 1H3HA 2ED0A 2M0YA 2RNAA 2SRCA 2RMOA 1NM7A 2RQWA 1B07A 2CDTA 1CKAA 3EG2A 2A28A 1FYNA 4DEXA 2L3QA 2DM1A 2PNIA 1SRLA 3FJ5A 2DX1A 1UHFA 1ZLMA 3VRZA 2D8JA 1BK2A 2KT8A 1MV3A 2YSQA 4FSSA 1VYTA 2DJQA 2RQUA 2ABLA 3EG3A 1JQQA 4R0KA 2X3XD 3SEMA 2JMCA 2O9SA 3TVTA 4HCKA 2ECZA 2W10A 2ENMA 2J6KA 1OPKA 1WXBA 2GNCA 2K3BA 2K7AA 2CSQA 3RBBB 3KFVA 2DL4A 4EIKA 1YCSB 2DF6A 4HVWA 2NWMA 1AWJA 2A08A 3NHNA 4A63B 1JO8A 2YUOA 2JW4A 5IHIA 2VVKA 1KJWA 2OI3A 1AWOA 1JEGA 3VS1A 1I1JA 2HDAA 3EG1A 4LN2A 4ORZA 1SEMA 1K1ZA 2LMJA 2EGCA 1WX6A 2JMAA 2FPDA 1H92A 1B3QA 3UA6A 4ESRA 1RI9A 4AFUC 2FRYA 1T0JA 4RTVA 4DEYA 4JZ3A 2O31A 4HVVA 4JZ4A 3PVQA 2QDLA 5ECAA 1N5ZA 4RTUA 3SHWA 3RNJA 2YUNA 1MUZA 2OJ2A 3VS5A 2HCKA 2O2OA 4F16A 3UA7A 1AD5A 1GCPA 3IQLA 1K76A 2VKNA 1G2BA 4Z89A 4J9BA 2IIMA 1BB9A 2KBTA 4OMQA 1WDXA 3UF4A 2OAWA 3PVLA 4J9HA 5GJVB 1VA7A 3EHQA 4RTYA 2RQRA 4J9DA 1PKSA 1YWOA 1TUCA 3UATA 1AOJA 1PRMC 1YN8A 1HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A37 A;  4RTT A;  4J9C A;  2M51 A;  3O5Z A;  2LZ6 B;  1SHF A;  1XOV A;  3ZL7 C;  4AG1 C;  2CH4 A;  2J6O A;  3VS4 A;  2EVR A;  4CC4 B;  1M8M A;  2GTJ A;  1HD3 A;  2LP5 A;  1QKX A;  4WCI A;  1S1N A;  1UDL A;  1WXT A;  1GFD A;  4F17 A;  1UE9 A;  2J06 A;  2PTK A;  2D0N A;  2EGA A;  1OPL A;  1X2K A;  3NGP A;  1NLO C;  2BZ8 A;  1W70 A;  2C0I A;  3M0R A;  3A98 A;  2O9V A;  2FEI A;  1QLY A;  2L0A A;  1ZSG A;  1RUW A;  2DL7 A;  2KYB A;  1BBZ A;  2LQN A;  2F2W A;  3TSW A;  2J6F A;  3I5S A;  3LH5 A;  5FW9 A;  4AG2 C;  1WFW A;  2DRK A;  3EG0 A;  1I07 A;  2YDL A;  1NEG A;  2JM8 A;  3H0F A;  4LE9 A;  4JPB W;  1Z9Q A;  4ZNX A;  1AZG B;  1ZUU A;  3H41 A;  1UJ0 A;  2DMO A;  1M3A A;  1K4U S;  1KIK A;  4IIM A;  2EKH A;  1WYX A;  1JXM A;  4CC2 A;  3I5R A;  1FMK A;  4RTW A;  1M3B A;  1SPK A;  2KNB B;  5GJW B;  4X1V A;  1OV3 A;  1WLP B;  2D1X A;  2DL8 A;  5EC7 A;  2LJ1 A;  4Y92 A;  1HSQ A;  2AKL A;  4HVU A;  3M0S A;  2MIO A;  2EQI A;  3I9Q A;  2DRM A;  2FPF A;  2V1R A;  1UTI A;  3M0Q A;  3C0C A;  5IHK A;  2LNH B;  2KRM A;  3NPF A;  4JJD A;  3U23 A;  2C0T A;  2LX7 A;  3H0I A;  2PZ1 A;  2BTT A;  2V1Q A;  2ED1 A;  4AFS C;  1VYU A;  2KR3 A;  1WA7 A;  1T3L A;  1PKT A;  1CSK A;  2K2M A;  1UUE A;  1YWP A;  2RF0 A;  1QKW A;  2P4R A;  2LQW A;  2HEQ A;  2EGE A;  1K0X A;  2L2P A;  1UJY A;  1PHT A;  2YUP A;  1ZX6 A;  4OMP A;  4OMN A;  5I11 A;  3VS2 A;  1W6X A;  1ZUY A;  2CUB A;  1UFF A;  1PWT A;  1ABQ A;  2AZS A;  2RPN A;  3GBQ A;  2LJ0 A;  2A36 A;  2O88 A;  1Z9Z A;  1E6H A;  1T0H A;  2FRW A;  2KT1 A;  4AFQ C;  2DBK A;  1PNJ A;  4CC7 A;  1Y57 A;  1CKB A;  2GGR A;  2FO0 A;  1M30 A;  1UHC A;  1W1F A;  2EW3 A;  4RUG A;  1YP5 A;  2JXB A;  2RQT A;  2F2X A;  4LUD A;  3M0T A;  2CSI A;  2KRO A;  1GRI A;  2RQV A;  1RLQ C;  4HXJ A;  2X3W D;  1AEY A;  3REB B;  2NUZ A;  1KFZ A;  1NYG A;  1QWF A;  2KEA A;  1KSW A;  2DYB A;  1NEB A;  2EBP A;  4LNP A;  2GBQ A;  2H8H A;  1T3S A;  4E6R A;  1EFN A;  1SSH A;  2JTE A;  1VYV A;  1NG2 A;  1LCK A;  4AFZ C;  1PRL C;  1UG1 A;  1JXO A;  4J9I A;  2AKK A;  2FPE A;  1U5S A;  2FG0 A;  1JU5 C;  2RN8 A;  1G83 A;  1U06 A;  1IO6 A;  2F2V A;  3ULR B;  3VS0 A;  4OMO A;  1GCQ C;  4K11 A;  2KXC A;  1WI7 A;  4J9G A;  2KE9 A;  2DLP A;  3VS7 A;  5IXB A;  1ABO A;  2E5K A;  2KXD A;  1X69 A;  1WXU A;  5IXF A;  3EGU A;  4RTX A;  2LCS A;  1Y0M A;  1X27 A;  2B86 A;  2KYM A;  1QCF A;  1NYF A;  1M3C A;  1GL5 A;  2DL5 A;  3THK A;  2EYX A;  3NMZ C;  1UGV A;  4JJB A;  2DE0 X;  5HCK A;  5IH2 A;  2CH4 W;  1SRM A;  1K0S A;  2JS2 A;  2KGT A;  2AK5 A;  1H8K A;  2KRS A;  3JV3 A;  1AVZ C;  2LJ3 A;  1NLP C;  1M27 C;  4CC3 A;  1UEC A;  1BU1 A;  2AZV A;  3CQT A;  1RLP C;  3R6N A;  1X2Q A;  5I22 A;  4KRT A;  2J7I A;  3VRY A;  1E7O A;  2HBW A;  1AZE A;  2GQI A;  2G6F X;  2ROT A;  2SEM A;  2I0N A;  2DBM A;  2EYW A;  4GLM A;  1J3T A;  1SHG A;  1X43 A;  1OEB A;  2J05 A;  2MOX A;  1YNZ A;  4M4Z A;  1ZUK A;  5IHN A;  2EPD A;  4D8K A;  3H0H A;  4F14 A;  5FWC A;  2KRN A;  4OMM A;  2YUQ A;  2DIL A;  2ROL A;  2DL3 A;  3QWY A;  1U3O A;  2BZX A;  2VWF A;  1GFC A;  2HSP A;  3REA B;  3EHR A;  1QWE A;  1V1C A;  4J9E A;  4QT7 A;  4JJC A;  1GCQ A;  2K79 A;  4GBQ A;  2YT6 A;  3QWX X;  1TG0 A;  1GBQ A;  2DNU A;  2MCN A;  2XMF A;  2CT3 A;  1X6G A;  1X6B A;  1E6G A;  2EYY A;  2JT4 A;  3I35 A;  5FWB A;  1I0C A;  2C0O A;  2CT4 A;  1OOT A;  4LUE A;  1K9A A;  1TUD A;  1AWW A;  1WIE A;  2JM9 A;  2K6D A;  2JS0 A;  3TSZ A;  2L3P A;  4D8D A;  3PE0 A;  2D8H A;  2CRE A;  4J9F A;  3VS3 A;  2ESW A;  2CUD A;  4IIO A;  2K9G A;  4Z8A A;  1GBR A;  2L3S A;  4Z88 A;  3VS6 A;  3M0P A;  1ZBJ A;  2W0Z A;  1A0N B;  1ARK A;  2DA9 A;  3M0U A;  2EYZ A;  2DVJ A;  2GTO A;  4RTZ A;  1AWX A;  1MV0 B;  2BZY A;  4OML A;  5L23 A;  1H3H A;  2ED0 A;  2M0Y A;  2RNA A;  2SRC A;  2RMO A;  1NM7 A;  2RQW A;  1B07 A;  2CDT A;  1CKA A;  3EG2 A;  2A28 A;  1FYN A;  4DEX A;  2L3Q A;  2DM1 A;  2PNI A;  1SRL A;  3FJ5 A;  2DX1 A;  1UHF A;  1ZLM A;  3VRZ A;  2D8J A;  1BK2 A;  2KT8 A;  1MV3 A;  2YSQ A;  4FSS A;  1VYT A;  2DJQ A;  2RQU A;  2ABL A;  3EG3 A;  1JQQ A;  4R0K A;  2X3X D;  3SEM A;  2JMC A;  2O9S A;  3TVT A;  4HCK A;  2ECZ A;  2W10 A;  2ENM A;  2J6K A;  1OPK A;  1WXB A;  2GNC A;  2K3B A;  2K7A A;  2CSQ A;  3RBB B;  3KFV A;  2DL4 A;  4EIK A;  1YCS B;  2DF6 A;  4HVW A;  2NWM A;  1AWJ A;  2A08 A;  3NHN A;  4A63 B;  1JO8 A;  2YUO A;  2JW4 A;  5IHI A;  2VVK A;  1KJW A;  2OI3 A;  1AWO A;  1JEG A;  3VS1 A;  1I1J A;  2HDA A;  3EG1 A;  4LN2 A;  4ORZ A;  1SEM A;  1K1Z A;  2LMJ A;  2EGC A;  1WX6 A;  2JMA A;  2FPD A;  1H92 A;  1B3Q A;  3UA6 A;  4ESR A;  1RI9 A;  4AFU C;  2FRY A;  1T0J A;  4RTV A;  4DEY A;  4JZ3 A;  2O31 A;  4HVV A;  4JZ4 A;  3PVQ A;  2QDL A;  5ECA A;  1N5Z A;  4RTU A;  3SHW A;  3RNJ A;  2YUN A;  1MUZ A;  2OJ2 A;  3VS5 A;  2HCK A;  2O2O A;  4F16 A;  3UA7 A;  1AD5 A;  1GCP A;  3IQL A;  1K76 A;  2VKN A;  1G2B A;  4Z89 A;  4J9B A;  2IIM A;  1BB9 A;  2KBT A;  4OMQ A;  1WDX A;  3UF4 A;  2OAW A;  3PVL A;  4J9H A;  5GJV B;  1VA7 A;  3EHQ A;  4RTY A;  2RQR A;  4J9D A;  1PKS A;  1YWO A;  1TUC A;  3UAT A;  1AOJ A;  1PRM C;  1YN8 A;  1HJD A; 
#chains in the Genus database with same CATH topology
 4DBR A;  5GAN f;  3O5Z A;  2LZ6 B;  4KGZ B;  2LC4 A;  1XOV A;  3ZL7 C;  2J6O A;  3VS4 A;  1VQ6 A;  5HK3 A;  2EVR A;  2CZ0 B;  4EMK C;  1VQP T;  2GTJ A;  1HD3 A;  2GF7 A;  2QYZ A;  4JDS A;  3D7S B;  4KH0 B;  3EH2 A;  4RCB A;  5KYU A;  2J06 A;  2XG8 D;  2D0N A;  4HA8 A;  4NS5 A;  3CCR A;  3RUX A;  5CKD A;  3CC4 T;  3LGL A;  2BZ8 A;  3QHS A;  1RAD B;  3AHU A;  4Q5W A;  2C0I A;  2O9V A;  4A53 A;  2FEI A;  1K73 C;  2QEX A;  2BKD N;  3RR6 A;  1ZA1 B;  2DL7 A;  2XU8 A;  3TSW A;  2J6F A;  3LH5 A;  1IB8 A;  2DRK A;  4J6X A;  1D3B B;  1R77 A;  4M7D C;  4N0A C;  1YIT Q;  3JB9 D;  2P4T A;  4JPB W;  1WHG A;  1Z9Q A;  3OS5 A;  4FL6 A;  2DMO A;  2KK4 A;  4IIM A;  2EKH A;  2DJZ A;  2HQX A;  3OYH A;  1FMK A;  4XU3 A;  3HRS A;  3BDL A;  3M58 A;  1OV3 A;  3EGD A;  3QJY A;  3CBO A;  4A4K A;  4ANJ A;  1LOJ A;  1K73 R;  1WLP B;  1K9M R;  2DL8 A;  2COW A;  3GLX A;  1HSQ A;  4HVU A;  2EQI A;  3CME T;  3I9Q A;  2V1R A;  2LX9 A;  2DD4 A;  4C0G A;  2A0F B;  1IHW A;  1D1B A;  3NPF A;  3U23 A;  4BD3 A;  2RI2 A;  2RJF A;  2DXT A;  1YWP A;  1QKW A;  2EGE A;  1QCN A;  5GAN 7;  1ZX6 A;  4OMN A;  4EMG A;  2E64 A;  1W6X A;  3P8D A;  1RAB B;  2IVW A;  2DVE A;  2KVQ G;  2QAS A;  5EG2 A;  3RER A;  5LJ3 g;  2HNI A;  2OTL A;  1YHQ T;  1E6H A;  1T0H A;  5LJ5 j;  2DBK A;  1CKB A;  1IXD A;  1PSF A;  2RHU A;  2RQT A;  4ZGJ B;  3H6Z A;  4M75 A;  2XK0 A;  4E7L A;  5GAM d;  2E1H A;  4O6J A;  5C0M A;  3X25 B;  2KEA A;  3M5A A;  1KSW A;  3RMS A;  2WAC A;  2HKQ B;  1V29 B;  4LNP A;  1VQ8 A;  2QK0 A;  3OY9 A;  2GBQ A;  2H8H A;  1T3S A;  3OW2 P;  4IUV A;  2PVD B;  4PJO A;  4AFZ C;  1PRL C;  4C92 F;  1YJ9 Q;  1HXD A;  1KQ2 A;  1JU5 C;  2RN8 A;  3M59 A;  3LH0 A;  1IO6 A;  4XK8 E;  1GCQ C;  2FZC B;  1BIB A;  1JBM A;  1RI0 A;  4V2S A;  5GMK h;  1IHV A;  1MGQ A;  5KYY B;  2DTH A;  3M55 A;  3FIF A;  4EMH A;  5FRN A;  5KH6 A;  5LJ5 e;  3CCE Q;  1VOM A;  3CCM A;  1NYF A;  1M3C A;  1GL5 A;  5KYX A;  3NMZ C;  4JJB A;  3CPW P;  3HKS A;  1SRM A;  2JS2 A;  8ATC B;  1Q86 R;  1YIJ A;  2KGT A;  1H8K A;  2KRS A;  4QQ6 A;  2YRC A;  1Y7X A;  3CQT A;  4JJN K;  3L2Q A;  4MZM A;  4BB7 A;  4KRT A;  1DJ7 B;  3CC4 A;  2J7I A;  1B34 A;  2DTI A;  4YTL A;  3VRY A;  1M1K C;  2X35 A;  4J7I A;  1QP3 A;  2I0N A;  2EYW A;  3ZEH A;  1J3T A;  2RM4 A;  5J39 A;  2DXB A;  3JCM Q;  1M1K U;  4M7D F;  2MOX A;  4BAC A;  4HCC A;  1MMA A;  5IHN A;  1VQL T;  2COZ A;  4PJJ A;  1YBY A;  4JRK A;  4Z02 A;  2MF2 A;  2DIG A;  1SKU B;  3DLM A;  4C8Q F;  2QGF B;  5GMK j;  1LNX A;  4J9E A;  2DET A;  1XNI A;  3MET A;  4QQG A;  2KMT A;  1ACM B;  1TS9 A;  1WJR A;  2BIV A;  3RKX A;  4PFO A;  2K2V A;  1QCO A;  2JJ9 A;  3AT1 B;  4QQD A;  4J8O A;  1X6G A;  5A2Q E;  5GMK i;  1Q81 U;  3CCL A;  1KG1 A;  4CRI A;  4BE1 A;  5DM7 R;  1TUD A;  1WIE A;  2JM9 A;  3GIB A;  3A8L B;  2DFU A;  4MZT A;  4E7S A;  2VGN A;  2Y4X A;  3PE0 A;  2CUD A;  4M75 F;  5LL6 S;  3GF5 A;  2RD1 A;  2QA4 A;  3SFM A;  3OYD A;  2QQA A;  2COY A;  4R55 A;  2L3S A;  2ATC B;  2JVV A;  1VQO T;  4X9D A;  2K4Y A;  5I21 A;  1A0N B;  1YI2 A;  5CCA A;  1G8X A;  4RTZ A;  3OW2 A;  1AWX A;  2C06 A;  1KC8 R;  5IT9 E;  1MV0 B;  4OML A;  1HK9 A;  4F7U E;  2M0Y A;  2RNA A;  2SRC A;  1QVF P;  2RMO A;  4HT9 A;  1B07 A;  2OTJ Q;  2O4X A;  2A28 A;  1P92 A;  1KD1 U;  4M77 G;  1RAE B;  2D0Q B;  1ZLM A;  3VRZ A;  1BK2 A;  1WZO A;  4FCY A;  3CC2 T;  3OW2 S;  2YRD A;  1MV3 A;  2JTM A;  4M7D E;  3G1J A;  1JRI A;  1YHQ Q;  2E6N A;  4FIB A;  2ABL A;  3EG3 A;  1VQ9 A;  5CKH A;  1M2O A;  2IG0 A;  1W2B P;  4R0K A;  2PU9 B;  3SWN A;  1U1T A;  3UDC A;  1XJW B;  3HP9 A;  2K7A A;  2CSQ A;  3C12 A;  1B34 B;  1D1A A;  2DF6 A;  3G71 Q;  4HVW A;  4KH1 B;  3CCU T;  2RO0 A;  2YUO A;  4JLI A;  4OP0 A;  3UWN A;  3I56 T;  2JW4 A;  2QQR A;  5D6Y A;  1KJW A;  2OI3 A;  3E2U A;  1O75 A;  5CKE A;  3OBW A;  3QUI A;  2HDA A;  3KUF A;  3EG1 A;  1Q7Y R;  4ORZ A;  1QVF S;  4E47 A;  2FPD A;  1B3Q A;  1AHJ B;  2YRV A;  1RAH B;  2QA4 Q;  2FRY A;  1T0J A;  2E3H A;  1K9M C;  3G6E Q;  4DEY A;  4DBQ A;  4HVV A;  1WQ7 A;  2RHI A;  5ECA A;  2HZY A;  1IGU A;  5LJ5 d;  3CCV A;  4RTU A;  2I2L A;  2EQK A;  2V8I A;  5LJ3 f;  1Q7Y U;  3MEV A;  1Y71 A;  1R0B G;  3C95 A;  3OYE A;  3OYL A;  1G2B A;  3CBP A;  1BB9 A;  3LW5 E;  1WDX A;  1R0C B;  5GAO q;  4PJO B;  4J9D A;  1ZBX A;  1EX4 A;  4IUR A;  3UAT A;  4M7D A;  1WHK A;  2D6F A;  2A37 A;  3QZ5 B;  2QGG A;  2M51 A;  1VQO A;  3UT1 A;  2R5A A;  2XIC A;  4XU0 A;  3CME A;  1IRX A;  1U1S A;  5GMK e;  1M8M A;  3FB9 A;  1UDL A;  1WXT A;  1GFD A;  2VXE A;  4M75 B;  2PTK A;  1PD1 A;  1X2K A;  1NLO C;  2DER A;  1W70 A;  4C8Q C;  3L2R A;  2IPO B;  3HL8 A;  3V8L A;  2MK5 A;  3L2U A;  2RJD A;  3OS2 A;  5GAN 3;  4OB2 B;  3T9N A;  2KYB A;  2F2W A;  4M78 A;  3CCS Q;  5FW9 A;  2DK3 A;  5GAN 5;  4XU2 A;  3JCM c;  1VIE A;  3EG0 A;  1VQK A;  4KGX B;  1YHQ A;  1I07 A;  2VAS A;  2H3J A;  2YDL A;  3ZFJ A;  2D9T A;  3CCM Q;  2JM8 A;  3H0F A;  4M78 F;  1I5L A;  1VQ9 Q;  1I5O B;  1ZQ1 A;  2VXF A;  1Y96 B;  1KIK A;  3EFS A;  4RCC A;  5KYX B;  4CC2 A;  2XI9 A;  2E41 A;  4FYY B;  2D1X A;  1LJO A;  5EC7 A;  3EFR A;  1QMC A;  2KI7 A;  2LJ1 A;  1YJW A;  5KE3 A;  4X34 A;  3M0S A;  1Q81 R;  2MIO A;  5CO7 A;  2XDP A;  1PD0 A;  1VQO Q;  1QVF A;  2FVU A;  3C0C A;  2BE7 D;  3C4S A;  1VQN A;  3X28 B;  4C92 D;  3M56 A;  2YWW A;  1ZSZ C;  2BTT A;  3ER0 A;  2V1Q A;  4AFS C;  1SG5 A;  1V76 A;  2KR3 A;  1WA7 A;  2CP2 A;  2RH2 A;  1T3L A;  5D6W A;  5LJ5 f;  2K2M A;  1UUE A;  3OA6 A;  2ZGW A;  2OTJ T;  2LT4 A;  2L2P A;  2FL7 A;  1UJY A;  1PHT A;  5I11 A;  3HFO A;  2WSE E;  4IUP A;  5L8R E;  4C8Q B;  4RG2 A;  3CC2 Q;  2LT1 A;  2RPN A;  1YJN Q;  2A36 A;  3NFC A;  2FRW A;  1TOV A;  2E6Z A;  1PNJ A;  4N4H A;  3OYJ A;  4RMO A;  2GGR A;  1VQ4 Q;  1PC0 A;  2X51 A;  3QO3 A;  2CSI A;  2F5K A;  1GRI A;  2RQV A;  1X75 C;  1RLQ C;  4HXJ A;  1Q82 U;  3M57 A;  1G3T A;  2X3W D;  1KFZ A;  1NYG A;  2EWN A;  2CGH A;  2A3L A;  4VUB A;  1NEB A;  3BW1 A;  3S3O A;  4M78 E;  4ELZ C;  4E6R A;  1EFN A;  2HD0 A;  3CXC P;  4JRP A;  1NE8 A;  1VYV A;  2VV5 A;  1OZ2 A;  1LCK A;  1UG1 A;  4MDX A;  4QW2 A;  1OUL A;  3OYM A;  2QA4 T;  1U5S A;  3G6E T;  1MMG A;  1G83 A;  3QII A;  4F7U G;  1U06 A;  2F2V A;  3ULR B;  3VS0 A;  4OMO A;  2MI6 A;  4M7A D;  2M0O A;  3L2Z A;  2QQS A;  4J9G A;  3CPW S;  3O8V A;  3E9G A;  1ABO A;  3CCE A;  3E1S A;  1X69 A;  3I55 Q;  4MDW A;  1KHC A;  2NYS A;  2LCS A;  1Y0M A;  4L6V 5;  5DLQ E;  4E2F B;  4N4G A;  4OB0 B;  2EYX A;  3SDZ A;  3RMQ A;  3NTK A;  4PJO D;  5GAM f;  5IH2 A;  2CH4 W;  4J6W A;  1AVZ C;  1VQ7 A;  1M27 C;  1YJ9 A;  3VV0 A;  3EH1 A;  4C0F A;  1UEC A;  5GAO p;  3JB9 H;  5M9O A;  1RLP C;  1VQP Q;  2GQV A;  2FZK B;  1FMW A;  3CCQ A;  2EAY A;  5FU6 C;  3MO8 A;  2G6F X;  3TU4 K;  3JCM f;  2SEM A;  4GLM A;  1S72 Q;  1OYX A;  2DKG A;  3MP8 A;  5CIU A;  4OGC A;  2J05 A;  2DIQ A;  1D09 B;  5I2S A;  1WHM A;  1Q81 C;  1C6V X;  5FWC A;  3MKD A;  4OMM A;  1WHL A;  2HSE B;  2DL3 A;  3CCQ T;  2BZX A;  3TQ7 P;  4C0D C;  1GFC A;  4HKE A;  1QWE A;  1V1C A;  4QT7 A;  1AOJ A;  2RI5 A;  3HTR A;  3WVD B;  4II1 A;  1VQ7 Q;  5CR2 A;  2LCL A;  1YIT T;  5GAN 2;  4GBQ A;  2P0P A;  4JRQ A;  3QWX X;  2DNU A;  2XMF A;  1VQ9 T;  2P84 A;  1RAC B;  4C8Q A;  1JJ2 P;  1NJI C;  2EYY A;  2JT4 A;  5FWB A;  4C92 B;  2MAM A;  2CT4 A;  4LUE A;  1K9A A;  1AWW A;  2K6D A;  3X26 B;  4JRI A;  4D8D A;  4BDZ A;  4M77 A;  2D8H A;  3VS3 A;  2O4X B;  4OMF B;  2E5Q A;  3QKJ A;  5FU6 B;  1VQN T;  3X24 B;  4Z88 A;  4M75 D;  2HBP A;  3VS6 A;  1ZBJ A;  2EYZ A;  2LRQ A;  2QQB A;  3JCM P;  4BE2 A;  1PSE A;  4C8Q G;  1KQS P;  5L23 A;  3PIO A;  5HKC A;  1H3H A;  2X4J A;  2CP3 A;  2RQW A;  1UGP B;  4MMK A;  2L3Q A;  4A4F A;  4F7U F;  3CPW A;  1GXI E;  4C8Q D;  1UHF A;  3VU3 C;  2PVG B;  4BE0 A;  4MML A;  5IAY A;  1VYT A;  1VUB A;  2DO3 A;  4C92 G;  2NUT A;  1I81 A;  2WSC E;  2RQU A;  5CK9 A;  2X3X D;  1UEB A;  1RAI B;  5CVI A;  2J6K A;  3L42 A;  5GAM j;  1F1B B;  2PVO B;  2ZCF B;  4J83 A;  3RBB B;  1YCS B;  3CD6 Q;  1R8O B;  1AWJ A;  2A08 A;  4MZP A;  4A63 B;  1JO8 A;  3JCM b;  3OYA A;  2EQU A;  2M16 A;  4J5Y A;  4BI8 B;  5IHI A;  2VVK A;  3CCR Q;  1QP2 A;  2YLC A;  3VS1 A;  1I1J A;  2RHY A;  1K8A U;  2L3R A;  5LJ3 j;  4QVD A;  2YLB A;  3QJ6 A;  2LMJ A;  1ZSZ B;  2JMA A;  3CBM A;  2FZG B;  1XTD A;  3UA6 A;  3V7C A;  5LJ5 g;  1RI9 A;  3RES A;  3J80 E;  3S3M A;  2EYQ A;  3CMA Q;  3CCJ A;  1XQH A;  4DOW A;  4LDX A;  1VQ6 Q;  3PVQ A;  4NL2 A;  5GMK l;  5GAO m;  1EZZ B;  2RI3 A;  2CP6 A;  2Y90 A;  1YI2 T;  1N5Z A;  6AT1 B;  3SHW A;  4FW1 A;  4DBF A;  2EQJ A;  4M77 E;  3VS5 A;  2HCK A;  2O2O A;  4F16 A;  3TRE A;  1Q82 R;  3I55 T;  1G5V A;  1AD5 A;  1LPL A;  1VQM A;  2DXC A;  4M75 C;  4J9B A;  2KBT A;  3SB2 A;  2MYS A;  4FYV B;  1M9S A;  4RTY A;  1I8F A;  3QXE B;  2X9H A;  1D0Y A;  4D6W A;  1KK7 A;  1VQ5 A;  3SWN C;  1PRM C;  3VUB A;  1MMD A;  4RTT A;  4J9C A;  2RHX A;  5I2M A;  2XHC A;  3DB4 A;  1K8A C;  5GMK m;  1Y07 A;  4B9X A;  1QKX A;  1UE9 A;  1WPY A;  1BIA A;  3HFN A;  3TCJ A;  2DYI A;  1TH7 A;  3NGP A;  1S72 T;  2F5T X;  4J6Y A;  2K3X A;  3ASK A;  1QQJ A;  3M0R A;  3A98 A;  4BI3 A;  2ZZD A;  3EG9 A;  2QAZ A;  4WF2 A;  1VQL Q;  2EFI A;  3GP8 A;  1QLY A;  2L0A A;  1ZSG A;  5LJ3 e;  1ZSZ A;  1YIJ T;  1VQ5 Q;  2LQN A;  1N9R A;  3I5S A;  1NZ9 A;  1WFW A;  1BI2 A;  3JAM E;  1FMV A;  1HYO A;  4JLG A;  1VQ4 A;  1NEG A;  4LE9 A;  2M9U A;  3H41 A;  1TXQ A;  3RKW A;  3G4S Q;  5J3B A;  1K4U S;  1WGS A;  1YJN A;  4E7K A;  1JXM A;  2ZPI B;  1QVG P;  3I5R A;  4RTW A;  1M3B A;  1SPK A;  4XTU A;  4X1V A;  1D1C A;  3PT9 A;  2XKO C;  2K57 A;  1EIF A;  5FRM A;  1N27 A;  1AT1 B;  2NUT B;  4BUG A;  4M78 G;  3CMA A;  2F69 A;  1VQN Q;  3EAE A;  2FB7 A;  7AT1 B;  3VUZ A;  1SF9 A;  1UGR B;  3OYY A;  4A4E A;  5IHK A;  3MEW A;  1O9S A;  2KRM A;  4JJD A;  4EMK B;  3JB9 G;  2LX7 A;  2PZ1 A;  3OMC A;  2ED1 A;  4HT8 A;  3PIP A;  1PCX A;  2V26 A;  1PKT A;  4PFZ A;  5LJ3 d;  3A8H B;  5GAN 8;  2RF0 A;  3I56 A;  2P4R A;  4PJO F;  2HEQ A;  4FT4 A;  4EDU A;  2ZPH B;  3LLR A;  4PJO C;  1M90 R;  1ZA2 B;  1RAF B;  2XDD A;  1M1G A;  4X9C A;  1ZUY A;  2CUB A;  1UFF A;  1TU0 B;  1PWT A;  4XQ3 A;  4M77 C;  2AZS A;  3KBG A;  3JCM W;  3R6O A;  2O88 A;  2JOY A;  1Z9Z A;  2CZ1 B;  1W2B A;  3M9Q A;  4LDV A;  1JJ2 A;  4AFQ C;  3CCS A;  4CC7 A;  1BI3 A;  2DPP B;  1Y57 A;  3N5B B;  2FO0 A;  1M30 A;  1UHC A;  2EIF A;  1W1F A;  2BUD A;  4RUG A;  2JXB A;  4KT0 E;  4C92 A;  4LUD A;  3M0T A;  2KRO A;  3G71 T;  3WXM B;  4JS5 A;  3CD6 T;  3CCU Q;  2NUZ A;  1QWF A;  4LDY A;  1OZ3 A;  4E7H A;  2CZ6 B;  4ZTJ A;  4BY6 C;  2EBP A;  3A8G B;  1BI0 A;  4NOY A;  3MJX A;  3LYI A;  2K3Y A;  3MHX A;  4M7D D;  2ZPB B;  4J9I A;  2AKK A;  2EJF A;  2MWO A;  5J26 A;  3EFO A;  5GAN e;  1K73 U;  2DEU A;  3J81 E;  2K5I A;  1VQ6 T;  1IZ6 A;  5CAI A;  1YI2 Q;  4K11 A;  3HSB A;  3P8B B;  3JB9 I;  2KXC A;  1WI7 A;  2KE9 A;  2DLP A;  3VS7 A;  5IXB A;  1G3S A;  3FDR A;  2E5K A;  1W4S A;  2KXD A;  4C92 C;  4E7Z A;  5IXF A;  2AT1 B;  2CP5 A;  5HK0 A;  2KYM A;  3EFO B;  4QVZ A;  2EJ9 A;  1UGV A;  3HRU A;  5C6S A;  3MCA B;  5HCK A;  5GAM g;  4KUL A;  1N8R C;  4XTV A;  1KQS S;  4O5V A;  4F7U A;  1NPR A;  4C0D B;  3JV3 A;  1C1A A;  2LJ3 A;  5KCO A;  1N8R U;  4CC3 A;  2L5Q A;  1BU1 A;  1MMN A;  2AZV A;  3OS0 A;  3LGF A;  3VKI A;  3PNW C;  4L59 A;  3BFM A;  4LDW A;  4PJO G;  1AZE A;  2O01 E;  4FYX B;  4F04 B;  1VQL A;  2ROT A;  3EGX A;  3A5Z B;  1SHG A;  4LXC A;  3G4S A;  1OEB A;  1KHI A;  4HCB A;  2H3E B;  1BCM A;  3CC7 Q;  2EPD A;  4D8K A;  2QTV A;  3H0H A;  4F14 A;  1KD1 C;  5LJ3 h;  2YUQ A;  1D0X A;  2ROL A;  1U3O A;  2V8K A;  1VIF A;  4DOV A;  5GAN g;  1I4K 1;  5KYN A;  5FLX E;  2HSP A;  3REA B;  4ZN1 A;  2FYK A;  3EHR A;  3CCS T;  3JCM d;  1JB0 E;  1TTH B;  5GAN 4;  2RA2 A;  2NUP A;  3CEY A;  4ZGE B;  2HQH A;  2LVM A;  1TG0 A;  1IRE B;  2MCN A;  1KC8 U;  3I55 A;  3NTI A;  4Y28 E;  2CT3 A;  3A8M B;  1X6B A;  4BY6 B;  1E6G A;  2DZC A;  4DQ2 A;  2OTL T;  3I35 A;  2C0O A;  1OOT A;  2XID A;  1KC8 C;  2JS0 A;  3M54 A;  4LDU A;  3G7Z A;  3RKY A;  5GAN d;  1N6A A;  3INZ A;  1VQM Q;  4J9F A;  4IIO A;  4XTX A;  3BDU A;  4AMC A;  3FLG A;  1YIT A;  1GBR A;  4P5N A;  3Q1J A;  1IGQ A;  1RL2 A;  1H3Z A;  2WSF E;  2CS7 A;  2DA9 A;  3M0U A;  2DVJ A;  4DA4 A;  2GTO A;  4OB3 B;  2HQE A;  4M7A G;  2QEX Q;  1FX7 A;  3CC7 A;  4XAX B;  3CC2 A;  4WTO B;  4RKU E;  3GPL A;  4DEX A;  2DAQ A;  2PNI A;  3GNF B;  1M1F A;  2DX1 A;  2RJE A;  3JCM e;  1Q7Y C;  4FSS A;  4KBM B;  1JQQ A;  2VGM A;  3CD6 A;  2AIR B;  3SEM A;  2R58 A;  3DKM A;  5FRO A;  3OB9 A;  4HCK A;  5DLO A;  1Q86 U;  3JB9 F;  2ENM A;  1VQ4 T;  5AT1 B;  4EPC A;  2X4Y A;  2P0K A;  3CCV Q;  1C0M A;  3C94 A;  3KFV A;  3PTA A;  2DL4 A;  2KAF A;  4EIK A;  3JB9 J;  2DZ9 A;  2NWM A;  3NHN A;  4PLI A;  2LQK A;  1MNE A;  5GAN 6;  1WJQ A;  3P8H A;  1UGQ B;  2QQ9 A;  1JEG A;  4ZGD B;  1FXX A;  3V7S A;  4JUV A;  1M90 U;  4Y91 A;  2XDB A;  2QG9 B;  1K1Z A;  2JTF A;  2EGC A;  3MEA A;  1M90 C;  1BCO A;  1M8V A;  4AFU C;  4A54 A;  2LTO A;  2NUP B;  3URG A;  4JZ3 A;  2O31 A;  3OSV A;  2QDL A;  2E65 A;  3L1A A;  2X4X A;  2OX7 A;  2DD5 A;  3RNJ A;  2YUN A;  2L8D A;  4AT1 B;  1MUZ A;  2OJ2 A;  3HHT B;  5IN1 A;  2EJG A;  1G3W A;  1D3B A;  3GNG A;  2DTO A;  3IQL A;  2CP7 A;  3DB3 A;  4LD6 A;  2IIM A;  4OMQ A;  2A7Y A;  4B9W A;  2OAW A;  3PVL A;  4J9H A;  1VA7 A;  3CCU A;  4M7D B;  2RQR A;  5GAM h;  1YWO A;  1TUC A;  1M4Z A;  5A0D A;  4M7A B;  1KQ1 A;  1Q95 G;  2AHJ B;  3KXT A;  3JCM J;  1MND A;  3EGD B;  2RB6 A;  1SHF A;  4AG1 C;  5KYW A;  2CH4 A;  3SWN B;  1MHN A;  2E3I A;  4M7A C;  4F7U B;  4CC4 B;  4OGE A;  2M1H A;  2LP5 A;  5FU7 C;  2VB6 A;  4WCI A;  1S1N A;  3L2W A;  4F17 A;  2V8J A;  4OVA A;  1TUG B;  2EGA A;  1OPL A;  3M4G A;  2HL5 C;  4PFP A;  2ZPE B;  1KD1 R;  2DEQ A;  5GAO r;  1NPP A;  5FU7 B;  2ZPF B;  3V8J A;  3CC7 T;  2CKK A;  2Z0W A;  2PQW A;  1VQK T;  3CCL Q;  3RIR A;  1OU8 A;  3CCQ Q;  4E7I A;  4PJO E;  1RUW A;  1OQK A;  1BBZ A;  5D7U A;  3WVE B;  3TEE A;  4AG2 C;  1RAA B;  2RJC A;  4M78 D;  3JCM g;  3V8K A;  2K5L A;  2LCC A;  1VQ7 T;  3SD4 A;  4QVC A;  3OYK A;  4ZNX A;  1AZG B;  1ZUU A;  2ZAE A;  2FHD A;  5KYU B;  3DLL A;  3JSC A;  1UJ0 A;  1M3A A;  1WYX A;  2OTL Q;  5GAO n;  1TWB A;  4ELY C;  3VYG A;  4C5E A;  3H8Z A;  3A1P A;  2KNB B;  3MEU A;  5GJW B;  3QBY A;  4OF1 A;  2PUK B;  4A4H A;  4M7A E;  2QXF A;  4C5G A;  1VQM T;  3X20 B;  5CKB A;  4Y92 A;  4FU6 A;  4C0Z A;  3G71 A;  3PMI A;  2Y4Y A;  2AKL A;  3FEO A;  4PNO A;  2DRM A;  2FPF A;  1WHJ A;  1UTI A;  3HPW A;  5A0G A;  1N8R R;  2LDM A;  2B8A A;  3M0Q A;  5GAM e;  5A0L A;  3BE3 A;  2LNH B;  1UGS B;  1M2V A;  2C0T A;  4C5H A;  3OYN A;  3H0I A;  2XD0 A;  2QEX T;  9ATC B;  1VYU A;  4DBH A;  1CSK A;  2LQW A;  3CPF A;  1K0X A;  3HRT A;  1OX8 A;  4KGV B;  4OMP A;  2YUP A;  3VS2 A;  5KYW B;  4PLL A;  1YCY A;  3OYC A;  3OS1 A;  2OTJ A;  1ABQ A;  3S6W A;  3PMT A;  3GBQ A;  4BI4 A;  2LJ0 A;  5AYF A;  2KY9 A;  4E7J A;  2GFU A;  2KT1 A;  1OI1 A;  2E10 A;  3J7A F;  4GY5 A;  5KE2 A;  4M75 E;  3OQ5 A;  2EW3 A;  4N0A A;  1NJI U;  3CCV T;  1YP5 A;  3OYI A;  2F2X A;  2PUO B;  4KUI A;  3E19 A;  3QYH B;  1OX9 A;  2VUB A;  4XTZ A;  3REB B;  4B6M A;  1AEY A;  1PM3 A;  3I56 Q;  2DYB A;  1D0Z A;  3CCR T;  2QTX A;  1SSH A;  5DY9 A;  2JTE A;  1FWZ A;  8AT1 B;  1NG2 A;  5KYY A;  2R5M A;  1U8R A;  1VQ8 Q;  1B7T A;  1JXO A;  4M77 D;  2FPE A;  4IUT A;  4A4G A;  5CKF A;  3GOX A;  3CMA T;  4C8Q E;  2FG0 A;  4M77 F;  3ME9 A;  1M1K R;  3QDR B;  2JN0 A;  3LWI A;  3CCJ Q;  1OU9 A;  4L5G A;  4EMK A;  5GAN j;  1ZHI A;  3QPH A;  4M7A A;  3MP1 A;  5HY6 A;  1YJW Q;  1WXU A;  2F1L A;  4M7D G;  3EGU A;  4RTX A;  4XTW A;  3NTH A;  4KUD K;  1X27 A;  2B86 A;  1QCF A;  2DL5 A;  3E9F A;  3THK A;  4ZTF A;  4BDY A;  1K9M U;  2DE0 X;  2RK1 A;  4M75 G;  3V7R A;  5CQX A;  3L2V A;  3UPU A;  1K0S A;  4RG8 A;  3MPU B;  3JRZ A;  3QZ9 B;  2AK5 A;  2P0Q A;  1Q82 C;  1X01 A;  1NLP C;  5GAO l;  2QI2 A;  3FRN A;  4J7F A;  2CP0 A;  2JZ2 A;  3FC3 A;  2KDS A;  3R6N A;  1X2Q A;  5I22 A;  2RK2 A;  2JNG A;  4IUU A;  1E7O A;  4HCZ A;  3H9N A;  2HBW A;  2GQI A;  3EG9 B;  2BE9 B;  2DBM A;  2EQM A;  3CC4 Q;  1X43 A;  1K8A R;  4TVR A;  4PL6 A;  3QYG B;  1YNZ A;  4XU1 A;  4M4Z A;  1ZUK A;  4PK4 A;  2KRN A;  1VQK Q;  3CCL T;  3LWH A;  2DIL A;  4IKF A;  3VJP A;  3QWY A;  5KCH A;  1YIJ Q;  1VQ5 T;  2VWF A;  3OYF A;  4C92 E;  1X6O A;  4ME7 A;  2JUF A;  4JJC A;  1GCQ A;  3QSU A;  3A8O B;  4M78 B;  2K79 A;  3OBY A;  4FT2 A;  4XTY A;  2VC8 A;  1UB4 A;  3CCM T;  3OMG A;  2YT6 A;  5GAN h;  2GCX A;  1GBQ A;  2E12 A;  3OYB A;  2YHT A;  3G4S T;  1PG5 B;  1I0C A;  3BY7 A;  2GFA A;  3TSZ A;  1M5Q 1;  2L3P A;  3QG1 A;  3JCM V;  4M7A F;  2X4W A;  4FW2 A;  4FYW B;  3CXC S;  1KQS A;  4N4I A;  1LVK A;  2CRE A;  2MWP A;  2VYT A;  2ESW A;  3QDF A;  2L89 A;  2LNV A;  2K9G A;  4C5I A;  1S72 A;  4PKC C;  2CYZ B;  4ZN3 A;  3CME Q;  1Q86 C;  3PFS A;  4Z8A A;  1M2V B;  3M0P A;  5D6X A;  2W0Z A;  2G3R A;  1ARK A;  4M78 C;  2E70 A;  1VQP A;  1BYM A;  3CXC A;  2BZY A;  1Y96 A;  2ED0 A;  2EKO A;  2LQ8 A;  1NM7 A;  5CQY A;  2CDT A;  1CKA A;  3EG2 A;  1FYN A;  3ZBD A;  2DM1 A;  3LX7 A;  3VYH B;  3JCM X;  4UC4 A;  1G3Y A;  1NBE B;  1SRL A;  3FJ5 A;  1WQW A;  2D8J A;  3MP6 A;  2KT8 A;  1WHH A;  2YSQ A;  4PJN A;  1YFN A;  1YJN T;  1QVG A;  2RHZ A;  2DJQ A;  4CI0 C;  1QVP A;  4PJL A;  3G6E A;  2JMC A;  4FSX A;  2O9S A;  3TVT A;  3M53 A;  1BKB A;  2ECZ A;  2W10 A;  3OSS C;  1OPK A;  1WXB A;  2R57 A;  2GNC A;  3S3N A;  2K3B A;  1BI1 A;  4ATO A;  2KQW A;  1WNL A;  4GLK A;  3FJP A;  2NLU A;  1QVG S;  4R56 A;  4LD9 K;  1W2B S;  1JJ2 S;  3OYG A;  1AWO A;  1N9S A;  2QDY B;  2HL3 A;  4FM4 B;  4LN2 A;  3EGX B;  1SEM A;  4OB1 B;  1WX6 A;  1VQ8 T;  1SSF A;  1H92 A;  4QKU A;  4ESR A;  2MMP A;  3F70 A;  1YJ9 T;  3M4Y A;  4NL3 A;  4RTV A;  4JZ4 A;  2M02 A;  2HMA A;  3PGG A;  3CCJ T;  2KSS A;  2HKN A;  2YXY A;  2ZPG B;  2E4H A;  1QW1 A;  1NJI R;  2OAU A;  3RDV A;  2MPX C;  2DXU A;  3UA7 A;  1YJW T;  1GCP A;  4M77 B;  4IUQ A;  3JCM h;  3CCE T;  1K76 A;  5LJ5 h;  2VKN A;  4PJM A;  4Z89 A;  4JS4 A;  3UF4 A;  5GJV B;  1WJS A;  2K5F A;  3EHQ A;  1PKS A;  1RAG B;  1TSF A;  1H64 1;  2CZ7 B;  2HAX A;  1YN8 A;  1HJD A; 
#chains in the Genus database with same CATH homology
 2A37 A;  4RTT A;  4J9C A;  2M51 A;  3O5Z A;  2LZ6 B;  1SHF A;  1XOV A;  3ZL7 C;  4AG1 C;  2CH4 A;  2J6O A;  3VS4 A;  2EVR A;  4CC4 B;  1M8M A;  2GTJ A;  1HD3 A;  2LP5 A;  1QKX A;  4WCI A;  1S1N A;  1UDL A;  1WXT A;  1GFD A;  4F17 A;  1UE9 A;  2J06 A;  2PTK A;  2D0N A;  2EGA A;  1OPL A;  1X2K A;  3NGP A;  1NLO C;  2BZ8 A;  1W70 A;  2C0I A;  3M0R A;  3A98 A;  2O9V A;  2FEI A;  1QLY A;  2L0A A;  1ZSG A;  1RUW A;  2DL7 A;  2KYB A;  1BBZ A;  2LQN A;  2F2W A;  3TSW A;  2J6F A;  3I5S A;  3LH5 A;  5FW9 A;  4AG2 C;  1WFW A;  2DRK A;  3EG0 A;  1I07 A;  2YDL A;  1NEG A;  2JM8 A;  3H0F A;  4LE9 A;  4JPB W;  1Z9Q A;  4ZNX A;  1AZG B;  1ZUU A;  3H41 A;  1UJ0 A;  2DMO A;  1M3A A;  1K4U S;  1KIK A;  4IIM A;  2EKH A;  1WYX A;  1JXM A;  4CC2 A;  3I5R A;  1FMK A;  4RTW A;  1M3B A;  1SPK A;  2KNB B;  5GJW B;  4X1V A;  1OV3 A;  1WLP B;  2D1X A;  2DL8 A;  5EC7 A;  2LJ1 A;  4Y92 A;  1HSQ A;  2AKL A;  4HVU A;  3M0S A;  2MIO A;  2EQI A;  3I9Q A;  2DRM A;  2FPF A;  2V1R A;  1UTI A;  3M0Q A;  3C0C A;  5IHK A;  2LNH B;  2KRM A;  3NPF A;  4JJD A;  3U23 A;  2C0T A;  2LX7 A;  3H0I A;  2PZ1 A;  2BTT A;  2V1Q A;  2ED1 A;  4AFS C;  1VYU A;  2KR3 A;  1WA7 A;  1T3L A;  1PKT A;  1CSK A;  2K2M A;  1UUE A;  1YWP A;  2RF0 A;  1QKW A;  2P4R A;  2LQW A;  2HEQ A;  2EGE A;  1K0X A;  2L2P A;  1UJY A;  1PHT A;  2YUP A;  1ZX6 A;  4OMP A;  4OMN A;  5I11 A;  3VS2 A;  1W6X A;  1ZUY A;  2CUB A;  1UFF A;  1PWT A;  1ABQ A;  2AZS A;  2RPN A;  3GBQ A;  2LJ0 A;  2A36 A;  2O88 A;  1Z9Z A;  1E6H A;  1T0H A;  2FRW A;  2KT1 A;  4AFQ C;  2DBK A;  1PNJ A;  4CC7 A;  1Y57 A;  1CKB A;  2GGR A;  2FO0 A;  1M30 A;  1UHC A;  1W1F A;  2EW3 A;  4RUG A;  1YP5 A;  2JXB A;  2RQT A;  2F2X A;  4LUD A;  3M0T A;  2CSI A;  2KRO A;  1GRI A;  2RQV A;  1RLQ C;  4HXJ A;  2X3W D;  1AEY A;  3REB B;  2NUZ A;  1KFZ A;  1NYG A;  1QWF A;  2KEA A;  1KSW A;  2DYB A;  1NEB A;  2EBP A;  4LNP A;  2GBQ A;  2H8H A;  1T3S A;  4E6R A;  1EFN A;  1SSH A;  2JTE A;  1VYV A;  1NG2 A;  1LCK A;  4AFZ C;  1PRL C;  1UG1 A;  1JXO A;  4J9I A;  2AKK A;  2FPE A;  1U5S A;  2FG0 A;  1JU5 C;  2RN8 A;  1G83 A;  1U06 A;  1IO6 A;  2F2V A;  3ULR B;  3VS0 A;  4OMO A;  1GCQ C;  4K11 A;  2KXC A;  1WI7 A;  4J9G A;  2KE9 A;  2DLP A;  3VS7 A;  5IXB A;  1ABO A;  2E5K A;  2KXD A;  1X69 A;  1WXU A;  5IXF A;  3EGU A;  4RTX A;  2LCS A;  1Y0M A;  1X27 A;  2B86 A;  2KYM A;  1QCF A;  1NYF A;  1M3C A;  1GL5 A;  2DL5 A;  3THK A;  2EYX A;  3NMZ C;  1UGV A;  4JJB A;  2DE0 X;  5HCK A;  5IH2 A;  2CH4 W;  1SRM A;  1K0S A;  2JS2 A;  2KGT A;  2AK5 A;  1H8K A;  2KRS A;  3JV3 A;  1AVZ C;  2LJ3 A;  1NLP C;  1M27 C;  4CC3 A;  1UEC A;  1BU1 A;  2AZV A;  3CQT A;  1RLP C;  3R6N A;  1X2Q A;  5I22 A;  4KRT A;  2J7I A;  3VRY A;  1E7O A;  2HBW A;  1AZE A;  2GQI A;  2G6F X;  2ROT A;  2SEM A;  2I0N A;  2DBM A;  2EYW A;  4GLM A;  1J3T A;  1SHG A;  1X43 A;  1OEB A;  2J05 A;  2MOX A;  1YNZ A;  4M4Z A;  1ZUK A;  5IHN A;  2EPD A;  4D8K A;  3H0H A;  4F14 A;  5FWC A;  2KRN A;  4OMM A;  2YUQ A;  2DIL A;  2ROL A;  2DL3 A;  3QWY A;  1U3O A;  2BZX A;  2VWF A;  1GFC A;  2HSP A;  3REA B;  3EHR A;  1QWE A;  1V1C A;  4J9E A;  4QT7 A;  4JJC A;  1GCQ A;  2K79 A;  4GBQ A;  2YT6 A;  3QWX X;  1TG0 A;  1GBQ A;  2DNU A;  2MCN A;  2XMF A;  2CT3 A;  1X6G A;  1X6B A;  1E6G A;  2EYY A;  2JT4 A;  3I35 A;  5FWB A;  1I0C A;  2C0O A;  2CT4 A;  1OOT A;  4LUE A;  1K9A A;  1TUD A;  1AWW A;  1WIE A;  2JM9 A;  2K6D A;  2JS0 A;  3TSZ A;  2L3P A;  4D8D A;  3PE0 A;  2D8H A;  2CRE A;  4J9F A;  3VS3 A;  2ESW A;  2CUD A;  4IIO A;  2K9G A;  4Z8A A;  1GBR A;  2L3S A;  4Z88 A;  3VS6 A;  3M0P A;  1ZBJ A;  2W0Z A;  1A0N B;  1ARK A;  2DA9 A;  3M0U A;  2EYZ A;  2DVJ A;  2GTO A;  4RTZ A;  1AWX A;  1MV0 B;  2BZY A;  4OML A;  5L23 A;  1H3H A;  2ED0 A;  2M0Y A;  2RNA A;  2SRC A;  2RMO A;  1NM7 A;  2RQW A;  1B07 A;  2CDT A;  1CKA A;  3EG2 A;  2A28 A;  1FYN A;  4DEX A;  2L3Q A;  2DM1 A;  2PNI A;  1SRL A;  3FJ5 A;  2DX1 A;  1UHF A;  1ZLM A;  3VRZ A;  2D8J A;  1BK2 A;  2KT8 A;  1MV3 A;  2YSQ A;  4FSS A;  1VYT A;  2DJQ A;  2RQU A;  2ABL A;  3EG3 A;  1JQQ A;  4R0K A;  2X3X D;  3SEM A;  2JMC A;  2O9S A;  3TVT A;  4HCK A;  2ECZ A;  2W10 A;  2ENM A;  2J6K A;  1OPK A;  1WXB A;  2GNC A;  2K3B A;  2K7A A;  2CSQ A;  3RBB B;  3KFV A;  2DL4 A;  4EIK A;  1YCS B;  2DF6 A;  4HVW A;  2NWM A;  1AWJ A;  2A08 A;  3NHN A;  4A63 B;  1JO8 A;  2YUO A;  2JW4 A;  5IHI A;  2VVK A;  1KJW A;  2OI3 A;  1AWO A;  1JEG A;  3VS1 A;  1I1J A;  2HDA A;  3EG1 A;  4LN2 A;  4ORZ A;  1SEM A;  1K1Z A;  2LMJ A;  2EGC A;  1WX6 A;  2JMA A;  2FPD A;  1H92 A;  1B3Q A;  3UA6 A;  4ESR A;  1RI9 A;  4AFU C;  2FRY A;  1T0J A;  4RTV A;  4DEY A;  4JZ3 A;  2O31 A;  4HVV A;  4JZ4 A;  3PVQ A;  2QDL A;  5ECA A;  1N5Z A;  4RTU A;  3SHW A;  3RNJ A;  2YUN A;  1MUZ A;  2OJ2 A;  3VS5 A;  2HCK A;  2O2O A;  4F16 A;  3UA7 A;  1AD5 A;  1GCP A;  3IQL A;  1K76 A;  2VKN A;  1G2B A;  4Z89 A;  4J9B A;  2IIM A;  1BB9 A;  2KBT A;  4OMQ A;  1WDX A;  3UF4 A;  2OAW A;  3PVL A;  4J9H A;  5GJV B;  1VA7 A;  3EHQ A;  4RTY A;  2RQR A;  4J9D A;  1PKS A;  1YWO A;  1TUC A;  3UAT A;  1AOJ A;  1PRM C;  1YN8 A;  1HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...