1WFYA

Solution structure of the ras-binding domain of mouse rgs14
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
GSSGSSGDQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGEKQPMDLENPVSSVASQTLVLDTPPDAKMSEARSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ras-binding domain of mouse RGS14
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords regulator of G-protein signaling 14; rap1/rap2 interacting p
total genus 10
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wfyA01
1UGMA 2BKRB 4BKGA 3LJ3A 4GXBA 4IWPA 3NS8A 3ZNGC 4NJ6A 4WAAA 3VTUA 4A20A 4EKUA 2CHXA 2J0JA 3JW0X 3NOBA 2KK8A 4ANXA 1VCBA 2KMAA 2VRRB 4IWQA 2FIDA 2IO0B 2LRUA 2DAJA 2AWTA 2FCQA 1AARA 4N9F4 4W9JA 4GDLA 3QHTA 3RT3B 4RMAA 4BBNF 3IBEA 3PTFC 2CU1A 2C7NB 2ZPNA 4IW0A 3DDCB 2MX2A 2RGFA 3L16A 3ZNHB 3BY4B 3DPDA 4TV3A 2O2VA 4RM8A 2GBNA 2Y5BB 3NZSA 5JHBA 2IO3B 3PZDA 1V81A 4LJPB 2ZCBA 1OQYA 1WX8A 1C1YB 2KN5A 1Q5WB 4MJSB 4EFOA 3EFUA 2ZZPB 4AJWA 1BT0A 1WXSA 2KWCA 1IPGA 1KLVA 4LCDE 4W9DA 1WXMA 3JYUA 4GIVA 4X57B 3TBLD 3KVFB 1WZ3A 1E90A 3CF6E 2N7EA 1U4AA 4HPMB 3SD5A 4URKA 4EUTA 1V80A 3B1LX 4I6LB 2WWZA 2O6VA 2ZVNA 2CKHB 3DBRI 4OVVA 3W1YA 2DYMA 1WX7A 3ML9A 5E6NA 3CMMB 3HM6X 1NI2A 1WIAA 2DYBA 2MP2B 4ANWA 3H1UA 1ZGUB 4FA6A 2GMIC 4F7ZA 3VQIA 1YX5B 3QC8B 3S2AA 3ZW3A 2K6DB 5KHQA 2J7QB 3OJ3A 3V6CB 2BYFA 1E8XA 2FIFA 1WM3A 3AULA 2N9XA 1WY8A 2KDBA 2LWPA 3GOEA 3Q3JA 4J6IA 5D2MB 3C0RB 2G45B 3OAWA 2AL3A 4JLCA 3KUZA 4WWPA 1K8RB 2LXCA 1ISNA 2JXXA 5CTRC 3TIXA 1XQQA 2L05A 4DHJB 3UQBA 2ZNVB 2KANA 5DCNA 4TQ0A 3WIMA 2KD0A 2EKEC 1WZ0A 4IM2A 4MGYE 4F8CB 2L0TA 2PEAA 2RPQA 2KVRA 4GSWA 1J19A 5DPTA 1F9JA 1LFDA 2FCNA 5KHOA 2GBJA 4TKNA 5JH5C 3ENEA 5C23A 3VH3B 3N3KB 4WJNA 3WAOA 3PVLA 3KUDB 2KFKA 4AJYB 1WGYA 4W9FA 3H9DA 3VTVA 2M8SA 2MRPA 3T9LA 2Z0DB 4XC2A 3EECA 2MSED 2C7HA 5CX3A 3APDA 3VDZA 1GJZA 2IBIB 1FXTB 1EF1A 3EHVA 1WE7A 2ZVOA 2XEWA 3Q3FA 5C1ZA 3APCA 5J18A 2JF5A 4PS3A 2NCNA 4NNJB 2KTRB 4AOFA 2JRIB 2Z59B 4EZKA 1TTNA 3UQAA 1P9DU 5JHAA 4ANUA 1WI0A 3RUIB 2D10A 2JWZA 3UGBB 5JZEB 2BGFA 4NQLB 2MBOA 5LLIA 4KSKC 4DWFA 3HIZA 1V5OA 4DHZE 1WFYA 1WJNA 2LVOA 1OTRB 2R2QA 2JVCA 2ZCCA 3H7PB 3IHPC 2AL6A 2N9EB 3RULA 4FHKA 2FUHB 2I1KA 5CHWA 2IY0B 4HDQA 4NAWA 3UINB 2KJ6A 3NZUA 2HD5B 4KV2A 2LGXA 1P98A 3CSFA 1OEYJ 2FCSA 3MJWA 4GU2A 2KX3A 2KZRA 4II2B 2G4DB 1Q0WB 1R4MI 1LM8B 4ICVA 1NBFC 3RZFA 2MCNB 2WX1A 4BOZB 1A5RA 3RD2A 1RFAA 2A5UA 3ZDMC 1R4NI 1I35A 4NJ7A 4E3CA 2CS4A 2ZJDA 4GOCA 3VHTC 2DZIA 2XBBC 1KOTA 3JVZX 1H8CA 4II3B 5EDSA 1E7UA 2L76A 3NHEB 1OGWA 3VVWB 4BFRA 2WYQA 2KDEB 3A9JA 4W9LA 3SDLC 3PPAA 1HE8A 3IFWB 2B3AA 4E71A 2WDTB 2LXAA 4ANVA 3QA8A 4G11A 4GDLB 2V4LA 1L7YA 1YIWA 4ZRIA 4FADA 2JRHA 4G50A 1EF5A 4MGZE 3R7RA 1WH3A 4LDTD 1WXAA 2KX0A 1E5WA 4HWIB 5FR6A 5GMVA 4P7IA 4HLEA 3IG3A 3QK0A 2IZVB 1UBIA 4I6NB 1GUAB 4PYUA 4GB9A 2GBRA 2KFJA 4NQKE 2NBVB 4AP4C 1V5TA 4PS8A 4XX5A 3PLUA 2REXA 3ZKJC 1WGDA 3DCGA 4A3PA 4DDGD 4HK2A 5D7GA 2G4SA 3P2BA 2L8JA 2PE6B 2QHOA 3UF8A 2KQ7A 3QIJA 4WJPA 3JSVA 4NY0A 4K81A 4WWNA 5J17A 3PLVA 3WAMA 1CMXB 1WYWB 2MP2A 4MDKE 3EC8A 2LJ5A 2XK5B 1ZKHA 2PE9A 3PGEA 5AZFA 4G3XB 3ZTCA 2ASQA 2K8CA 3AU5A 3NY5A 5DPSA 2KHWB 3V6EB 4MH0E 1WGRA 3O65B 3ZNID 1SIFA 3UIPB 1E7VA 2CR5A 2OJRA 2L00B 1WF9A 3DBSA 4IM0A 4KZCA 2Z0EB 1RLFA 5LXHA 4ZRKA 2XK5A 5DPRA 2DZJA 3ML8A 3RCZA 5HKHA 1RRBA 1NDDA 2NBUA 3A4SC 4AWJA 4DBGA 4KDIC 2EMTA 3DOWA 2LD9A 1JRUA 2DAFA 2J0KA 4NAWB 3JSVB 4NPNA 1I42A 4JL9A 3PRPB 4KZ0A 4HXDA 1X1MA 4MGIE 3ZVVA 1WJUA 2NR2A 2ZPYA 3D32A 3H7PA 2PJHA 4MSQB 4FBJB 3VFKA 1RAXA 3H6NA 4GGQA 4DDID 1MG8A 2KNBA 3PRMB 3M62B 3M95A 3A4RA 4E74A 1GC6A 3ZNZB 1KJTA 4BKSD 2LVQA 4RM9A 1WM2A 2DHZA 1WE6A 2DYOA 1YX6B 1TGZB 2HE7A 2D11A 2M0XA 2PPHA 1D3ZA 1SE9A 2FCMA 3HM3A 3U8ZA 2MLBA 4AUQC 2I1JA 2KDFB 3AU4A 3K9OB 3MHSD 4KDLB 4TQ1A 1E8YA 3HHMA 1XT9B 4DK5A 2KLCA 3I3TB 3V62A 1Z5SB 3TJPA 4BBNC 1TBEA 3QJZA 2V1YA 1XD3B 2KFKB 2NPTA 2KQSA 3PRZA 2N1VA 3A9JB 2MBBB 1WR6E 3SU8X 1Y8RC 1YJ1A 2D07B 3VAWA 5L83A 5G55A 1WJ4A 2GBMA 2MBEA 4LJOB 4PS7A 1EO6A 4CO7A 3PT2B 1OEYA 3T8MA 1GNUA 2K8BA 5AEKB 2KC1A 4MM3A 3L08A 2NBWB 4K1RB 2BYEA 1SGHA 2G3QB 2M4NA 2M1MA 3APFA 4FJVB 4M8MA 3V61A 5DPWA 5E6PA 2N7DA 4EEWA 3U7DA 4K7UA 3VH4B 1WXVA 3GZNI 4CHKA 2JT4B 3MTNB 2MBQA 4ZRJA 4JIOU 2DZMA 2K8HA 3PV1A 3VTWA 3X0WA 4ICUA 2MW5A 2MBHA 3TCAA 3OLMD 2RD0A 3R3MA 5CHFA 3PREA 4CYEA 4A3OA 4M0WB 2KWVB 4MEMA 4XZ4A 1GG3A 4ZDVA 2O6VB 1WMHA 3VUXA 3VUWA 4GDKB 3N30A 4B95A 1Z2MA 2C60A 1S1QB 4W9IA 1WGHA 3RZWC 4HPLB 4EZJA 2LASA 3A9KA 3KH0A 3L10B 4K7SA 3L0WB 2NS5A 3W1SC 1ZW7A 3VUYA 1IP9A 2ZNVC 3W1SA 3R7QA 2KTRA 1UBQA 3DBHI 4MJSA 2BWES 5BO4B 2MWSB 2BKFA 2J0MA 3IVFA 4FHJA 2EMSA 3KUCB 3ZUNA 1WX9A 2JZ3B 2JY6A 1P1AA 2O2VB 3PHXB 4DHZB 4K7WA 3ALBA 3QCAA 1UD7A 3U30A 3QWZB 2L0FA 3N32A 5AZGA 3QARA 2JUOA 3KW5B 1V9JA 4DXAB 2K1FA 2W9NA 3DBLI 2K25A 3WALA 2KKCA 2IO1B 3R66C 4KVGB 4EZLA 1J8CA 1S3SG 1TZ1A 3AI5A 2BPSA 3WAPA 3SHQA 4GMVA 3DVNU 2N1WA 4YL8A 3M63B 5G2NA 3PSEB 4I6PA 5IA7A 2DENB 2DX5B 4HCNB 2MQJA 5AZHA 1V6EA 2UWQA 4IM3A 5E6OA 4BVUC 2C5LC 3KYCD 4B6WA 4IUMB 4B9KA 4DHJD 2CHWA 1G6JA 2BWFA 3L54A 4FULA 4TUUA 5TR5A 3ZRFA 4HDOA 2LUEA 1Q1OA 2BYVE 1T0YA 2UYZB 4HJKA 1P0RA 2D3GA 3RYTA 2YVCA 4MGKE 2A4ZA 3ZLZA 2YLMA 1M94A 2D2QA 3PHWB 4MSMB 2BF8B 3HK0A 5LXIB 3A1QA 4FN2A 2C9WB 1GC7A 3B08A 1VD2A 2NPTB 4FJZA 1UH6A 2KO3A 4KSLC 3ZIMA 2L3ZA 1V86A 3DVNV 2RR9A 3M3JA 4WWOA 3WA0A 5IAAC 5CHVC 3B0AA 3WANA 3ZDTA 3AXCA 4FLHA 2KWUB 4JQWC 4WJOA 2GOWA 3L13A 5D6JB 1E8WA 1YQBA 3H7SA 4HCPB 1QZEA 2DZKA 4W9EA 1YD8U 5L95C 4W9CA 4W9GA 3LDZE 1L2NA 4EOYA 2KC2A 5J2RA 4HVBA 1P3QU 2KLGA 3A9KB 2LRWA 2JPHA 3A33B 3K9PB 4GDKA 3ZRCA 4W9HA 4IWOA 1WMHB 2AEHA 2LGDA 3ZTDA 2FNJB 1KM7A 3L17A 4JGHB 2RSUA 3ZO5B 4ZYNA 3V60A 3TMPB 4WQOB 2CHZA 1LXDA 1WJ6A 4IC7B 4PYZA 4OVUA 1UELA 4MELA 4IG7B 2IYDB 5D94A 3CSTA 4LDTB 2KTFA 2KXJA 2ZEQA 1E8ZA 2LGYA 3KYDD 4GN1A 1PQSA 4M8NA 2IO2B 2R2OA 4W9KA 2FAZA 1H4RA 4F1SA 2LI5A 1LQBA 2HTHA 1WR1A 4KIKB 1C3TA 2N9PC 2OOBB 3VXWA 2L7RA 1WGGA 4WJQA 2AYOB 3DVGY 3QAQA 2GBKA 3UIOB 3A1QB 3ECIA 4BKTA 2KMCA 2C7MB 2V3SA 3QX1A 4G0NB 2K39A 3OJ4B 2MA9B 2O6VD 1WRDB 2KJHB 4ASWC 2LVPA 1J0GA 2LZ6A 1UZXB 4FJYA 3DVGX 3DQVA 4BOSC 1V2YA 1EUVB 2KOXA 2WX0A 2KJRA 2JZZA 2HJ8A 1IYFA 1V49A 3BINA 2IY1B 3X23A 3TL5A 4BKSA 2NVUI 3PS6A 2KDIA 3ONSA 2M17A 4KIKA 3QQ8B 2N4FA 2K6QA
chains in the Genus database with same CATH superfamily
1VJKA 4NZLB 2VZKB 4BKGA 3I9V1 4GXBA 4Q2JA 4NJ6A 4WAAA 4A20A 1HEZE 4S0RA 1XLQA 3NOBA 4ANXA 1WYGA 1PGBA 1AARA 4W9JA 3PTFC 4QAYA 2ZPNA 4IW0A 1C9FA 5D3IB 1LGRA 2YEPB 4LJPB 5EE9A 4N58A 2INPE 1YQ4B 1WXSA 2KWCA 1ACCA 1IPGA 4D2KA 1KLVA 4W9DA 4GIVA 4X57B 3TBLD 4N6EB 3CF6E 2N7EA 1U4AA 4USAA 1N61A 2WWZA 3DBLB 2CKHB 2WXJA 4OVVA 3W1YA 2DYMA 1V1PA 3ML9A 5E6NA 1FCLA 4ZOHC 1NI2A 4ANWA 1C4AA 3H1UA 2HJ1A 4FA6A 2GMIC 4F7ZA 1YX5B 4GLSC 1L0VB 1ZPSA 2J52A 2LWPA 3Q3JA 2G45B 3OAWA 4YXDB 3KUZA 1C77A 3TIXA 4MM3B 3ZQ4A 2AX5A 2KANA 4TQ0A 2LJIA 3BVMA 2EKEC 1PDXA 1JWSD 1JQ4A 1N60A 3ZJUA 4XE0A 3Q8EA 1LFDA 2FCNA 5C23A 1YQ3B 3PVLA 2KDMA 3BK2A 1B9RA 3H9DA 3URYA 2M8SA 2GI9A 3T9LA 2Z0DB 3NVZA 4XC2A 3EECA 5CX3A 3LB8C 3MP9A 1P7FA 3EHVA 1EF1A 2JF5A 2E3TA 2JRIB 2LGIA 3GE3C 1D4BA 1TTNA 3UQAA 2WXQA 1P9DU 5JHAA 3TEZA 4KSKC 2FE8A 3MHZA 4DHZE 1WJNA 2R2QA 3RULA 1DOYA 3H7PB 2AL6A 4FHKA 5CHWA 2JYEA 2IY0B 4XWWA 1VLBA 2HD5B 1KLGD 1P98A 2JQRB 2WDRB 1A70A 1I4PA 3AEGB 1R4MI 4YWGG 2WX1A 1WSPA 1RFAA 2E6XA 3ZDMC 2TSSA 2ZJDA 3W5UB 2DZIA 2L76A 3RNCC 3DBHB 2QJLA 3IFWB 2AQ1B 1K51A 4FADA 4MGZE 1WH3A 1Q10A 1WXAA 1E5WA 5FR6A 2YEPF 4I6NB 5HHDG 1JALA 4MT5A 2GBRA 1TKGA 4NQKE 4AP4C 4PS8A 4XX5A 3DCGA 1FIQA 2PE6B 2RPVA 3WAMA 1SBBB 3HVZA 5E6JA 2MP2A 3SEBA 2LJ5A 2XK5B 1ZKHA 3AMZA 3ZTCA 2KHWB 3V6EB 2JSVX 1WGRA 4YSZB 3UIPB 2L00B 1VZ6A 1WF9A 2KAJA 3FC4A 4CQNA 3AEFB 4C00A 2EMTA 2LD9A 1XLPA 1T5XD 1QOFA 4KZ0A 4HXDA 1WJUA 2NR2A 3D32A 4MH8A 3H7PA 2PJHA 4US9A 1MG8A 3NUHB 1GC6A 1ET9A 4B0EA 1AW7A 1WE6A 2DYOA 1YX6B 1SE9A 2MLBA 2N9LA 1E8YA 1SJED 3HHMA 2LEKA 2R61A 1E0ZA 3V62A 1WWTA 1Z5SB 4RFBA 1FFVA 1TBEA 2D3CA 3QJZA 2KT7A 2XNAC 4XGAB 2ZW1A 4RF0A 1Y8RC 1YJ1A 2D07B 3VAWA 5L83A 1KTKA 1JWBD 1WJ4A 3J9CA 1YJIA 2GBMA 1ZUD2 2HTME 1FMAD 1GNUA 3AE8B 4DQOC 3L08A 1OQQA 1L4DB 4K1RB 4P1BC 5BMIA 1JROA 2G3QB 4JWUC 4M8MA 2BB5A 2JT4B 1QQRA 2MBQA 3RNEC 4JIOU 3PV1A 3VTWA 2MBHA 3R3MA 2RD0A 2JWUA 5CHFA 3PREA 4CYEA 1V1PB 2K3UA 4ZDVA 3AE3B 1WMHA 3ETRA 1R7SA 2W82A 4GDKB 4B95A 1Z2MA 1S1QB 3TSSA 4EZJA 3KH0A 2Y5PA 3VUYA 3R7QA 1UBQA 4LTUA 3BIID 3DBHI 3T3OA 5BO4B 3RMKC 2BKFA 2J0MA 2EMSA 3ZUNA 1NYQA 4M0WA 1T0QC 3QCAA 3U30A 3QARA 3NZ3A 4DXAB 1BUIC 2K25A 1RWSA 3R66C 3P4QB 2CJNA 2Y3AA 2OEDA 3BWUD 3WAPA 1I4GA 2WLBA 3M63B 2PLPA 4ZYSA 4I6PA 5IA7A 3Q8FA 1V6EA 4WURA 4IUMB 2BWFA 4OHJA 3DHGC 4JE3B 1UF0A 2BYVE 2UYZB 2BF8B 5BYQA 4FN2A 4LK0M 1N62A 3B08A 3ZIMA 3V3XA 2KO3A 2L3ZA 3P4SB 3M3JA 2RR9A 1L6VA 1FD6A 3AE5B 3B0AA 1YN3A 2KWUB 3T3NA 1ZOYB 2GOWA 5D6JB 5J2RA 4HVBA 2LRWA 1GB4A 4YT0B 3ZRCA 5BYSA 4W9HA 3IXSA 3HUIA 3L17A 4JGHB 1TKEA 1MFWA 3TMPB 2IGGA 4XWTA 3Q8AA 4IC7B 4PYZA 4OVUA 1UELA 3GZNB 5D94A 2N9KA 2ZEQA 2IO2B 2WNMA 2WXHA 2FAZA 1H4RA 2HTHA 1WR1A 1SE3A 1I4XA 2OOBB 3N20C 1XCTL 2GBKA 3A1QB 3Q8CA 2KJHB 4ASWC 1J0GA 1MHHE 1R4NB 4M00A 4MACA 2RDBC 2KJRA 4ARIA 1GB1A 1T0SC 3EA6A 2M17A 1WRIA 2J53A 2N4FA 1UGMA 4P6VF 2JU6X 1I4QA 2AQ2B 2GRIA 3ZNGC 3RNAC 3VTUA 2CHXA 2IO0B 2AWTA 4GDLA 4AS1A 2I38A 3QHTA 2WDVB 3RNBC 4RMAA 3C19A 2MX2A 3ZNHB 3DPDA 2O2VA 4RM8A 2GBNA 2Y5BB 1PGAA 2IO3B 3PZDA 2ZCBA 1WX8A 1C1YB 4MJSB 4EFOA 1BT0A 1ZP0B 3Q69A 1WXMA 4IDIA 3KVFB 1E90A 3AEDB 4J3OD 3DWMA 3DBRI 2DYBA 1WIAA 2MP2B 3S2AA 5KHQA 1C78A 1E8XA 1YJJA 4L23A 1WM3A 1CZPA 1WY8A 4RF1A 4J6IA 3C0RB 2WXMA 1IGCA 1LO5D 1STEA 5CTRC 4DHJB 2L05A 5BMHA 3AE1B 3L4PA 4MGYE 4BAXA 2J42A 1FEHA 2WS3B 2RPQA 2KVRA 4GSWA 5KHOA 2GBJA 5JXVA 3WAOA 3AM9A 3KUDB 2KFKA 3NVWA 4W9FA 1F1HA 3PO0A 2MRPA 3AH7A 4WAFA 2MSED 2C7HA 3VDZA 4B0MA 2IBIB 1FXTB 2KYWA 2W3SA 2ZVOA 5C1ZA 2XEWA 5J18A 3APCA 1FRRA 2WGSA 2BW2A 4ANUA 4DXGA 1IBXB 5LLIA 4DWFA 3HIZA 3SFDB 2LVOA 2M19A 2JVCA 2N9EB 2WHIA 2I1KA 4NAWA 3NZUA 2LGXA 1OEYJ 2FCSA 4BZAA 3TUOA 1L5PA 4II2B 4ZHPA 2JZPA 2MCNB 4H2AA 4BOZB 1A5RA 2EKIA 1R4NI 1I35A 1TY2A 1V1OA 3R2IA 3VHTC 2XBBC 1KOTA 3JVZX 4UDUC 1E7UA 3NHEB 3N9YC 1QILA 3VVWB 3A9JA 5HI1A 2Y5CA 3SDLC 1HE8A 2B3AA 3NG0A 2LXAA 4ANVA 3QA8A 4G11A 3VRBB 5EE1A 2JRHA 3NJTA 3R7RA 2QSDA 4HWIB 4HLEA 3QK0A 4GB9A 2SAKA 3I63C 2KFJA 2W54A 2NBVB 4US8A 1T3QA 4C4VA 1WGDA 1VZ8A 4A3PA 1XF5L 4HK2A 3P2BA 1FCCC 3UF8A 3P4PB 3JSVA 4WWNA 1SE2A 2HDEA 1TS3A 2BYTA 1FNVA 4MDKE 3BYYB 3PGEA 2PE9A 5AZFA 1J7BA 2ASQA 3DBRB 3KQ4A 3ZGZA 1YMHE 1JW9D 2CR5A 2OJRA 4PT5A 1RLFA 2XK5A 3ML8A 2NBUA 4AWJA 1JWAD 4DBGA 3DOWA 1JRUA 2PVGC 3W9CB 1IGDA 2WP9B 3BYTB 4FBJB 3H6NA 3RI7C 2VH2A 2KNBA 2RMMA 1HZ5A 1J7CA 4OW0A 4BKSD 1L4ZB 1F0ZA 4RM9A 1WM2A 1TGZB 4KX6B 4KDLB 1XT9B 4DK5A 3I3TB 1XD3B 2QILA 2NPTA 2KQSA 2N1VA 1WR6E 5G55A 1N5XA 3AEBB 2NTSA 2MBEA 4LJOB 2PIAA 5G5HA 1EO6A 1OEYA 3T8MA 2DWQA 2K8BA 2KC1A 2NBWB 1QKZA 1FNUA 2BYEA 4ITKA 3V61A 2N0SB 1MPEA 2N7DA 1XEEA 4LLGM 4K7UA 4EEWA 2K5PA 3GZNI 1TS2A 2GLSA 2B76B 2DZMA 3X0WA 4ICUA 3N1YC 3TCAA 4A3OA 4MEMA 2O6VB 3VUXA 3MC9A 1YN5A 2C60A 4W9IA 4HPLB 3A9KA 3L10B 1VR9A 3W1SC 3Q8BA 2ZNVC 3W1SA 1HXYD 1EU4A 2MWSB 1WX9A 2JY6A 1SIJA 2KACA 4RH6A 1TZOA 2L0FA 3N32A 5AZGA 1V9JA 4EZLA 4KVGB 1S3SG 1TZ1A 3AI5A 3SHQA 3DVNU 1F52A 4YL8A 4A8XC 3OG5A 1AN8A 5IO9A 4IM3A 1FXIA 2C5LC 4DHJD 1ROEA 5FKAC 1VZ7A 4FULA 4TUUA 1FM0D 5TR5A 2KQ4X 1FPYA 2LUEA 4HPPA 1MHXA 3ZXRA 1FXAA 4MSMB 3ABVB 1GC7A 4KSLC 2JXTA 4FJZA 2IGHA 3AN1A 3WA0A 2LMCA 3WANA 3I57A 4FLHA 1UGJA 4WIPA 1QZEA 1EM7A 2DZKA 1YD8U 1MG4A 3LDZE 2KC2A 4LNOA 1CK1A 1QOAA 4TMAB 2G1EA 1FRDA 4IWOA 2AEHA 2FNJB 3ZO5B 4ZYNA 3HVDA 4WQOB 2CHZA 1RYJA 2JYTA 4MELA 4IG7B 5H92C 1SEBD 1BMLC 1D5XC 3CSTA 4R3DA 4JPSA 1E8ZA 4GN1A 2R2OA 2J4XA 4F1SA 1LQBA 4KIKB 1C3TA 2N9PC 3VXWA 1HTQA 1WGGA 3QAQA 3UIOB 1ENFA 2QDFA 4BKTA 3QX1A 2K39A 3WCQA 4A90A 2LZ6A 3DVGX 4BOSC 2KOXA 2JZZA 2HJ8A 1IYFA 2KN4A 1ZXIA 2IY1B 3TL5A 4RGNA 2WXPA 2OJWA 4NJCA 4IWPA 2LUMA 3IT4B 2NTTA 4P1CC 2J0JA 2ACZB 3JW0X 2KK8A 4L2YA 1MVKA 2KMAA 2FIDA 3IBEA 2H89B 2QIEB 3DDCB 2RGFA 3L16A 3BY4B 3Q2AC 2WXOA 2LHDA 4C80A 3NZSA 2UU7A 5JHBA 1V81A 1C4CA 2KN5A 1Q5WB 1L0YB 3EFUA 1ET6A 4AJWA 4LCDE 3AE7B 3JYUA 2D5GA 4URKA 2V4IB 1WX7A 4YTPB 1K50A 3HM6X 2IGDA 2INDC 3AV8A 3QC8B 1E10A 2K6DB 2J7QB 3OJ3A 3V6CB 1SB3C 2V9HA 3AULA 2KDBA 3GOEA 2D3BA 4YTNB 5D2MB 2MJDA 3ZJTA 1KFYB 2SEBD 2VH1A 1K8RB 1SSNA 2LXCA 1ISNA 1ZDXA 2JXXA 3UQBA 1XQQA 4OZBA 2WQYB 2ZNVB 3KLSX 1WGKA 1IUEA 4F8CB 3I5JC 2PEAA 1DOXA 5C3JB 4RGMA 1F9JA 5JH5C 3ENEA 3N3KB 4WJNA 5EE0A 3TEYA 1N63A 4C7ZA 1ESFA 1GJZA 3Q3FA 1WE7A 2NCNA 2KTRB 4EZKA 3B2GA 1WI0A 4WWMA 3RUIB 4HKQA 1OFFA 3B2FA 2JWZA 3U52E 3ZXVA 5JZEB 2BGFA 2MBOA 5HFYA 4RCOA 1OTRB 3EUB2 2EELA 4HDQA 3UINB 4K3BA 3CSFA 4A6QA 3R2TA 2K22A 2M56B 2KX3A 2KZRA 2ICIA 1Y56A 2G4DB 3NVVA 4KKIA 4KKJA 1Q0WB 1TS4A 3MC8A 1LM8B 4ICVA 4O1NA 3RD2A 2A5UA 1L6UA 1C79A 2ZW0A 4GOCA 4M02A 3AB5A 5EDSA 1VDVA 1OGWA 2KDEB 4NAMA 3W5VB 3PPAA 1E9MA 1J7AA 3FILA 3RN9C 2WDTB 3RNFC 4XYCA 1EF5A 3MC0B 2X8XX 2KX0A 3IG3A 2IZVB 1HZ6A 4PYUA 1C76A 1V5TA 3PLUA 2REXA 2DLBA 1CJEA 4DDGD 2PMVA 3SFEB 2I2YA 1PYWD 2QHOA 2BTEA 2KQ7A 2QCZA 2KVZA 4NY0A 3LXFA 4K81A 3PLVA 2WXRA 1WYWB 3EC8A 3RNGC 2BBCA 4G3XB 3AU5A 3NY5A 2K9XA 2WXFA 3E9SA 3EFCA 1E7VA 3DWGC 4IM0A 2Z0EB 1NEKB 1CQVA 2GB1A 3RCZA 5HKHA 1NDDA 4FXCA 5MPOA 2DAFA 2J0KA 1AYFA 4NPNA 1I42A 4JL9A 3PRPB 4MGIE 2FBWB 2WU2B 4MSQB 3VFKA 4YSXB 5AUIA 2W55A 4GGQA 4DDID 4E74A 3IAM1 4LNFA 1KJTA 1IBXA 1ZE3D 2L1AA 1I4HA 2HE7A 2D11A 2M0XA 1NI3A 3AU4A 2KDFB 4TQ1A 5IP4D 1PFDA 3KWVA 4BBNC 3Q3OC 3PRZA 1D5ZC 2MBBB 3BK1A 4PS7A 4CO7A 4OVZA 3H8HA 1N5WA 2CJOA 1XO3A 4S17A 1SF0A 1SGHA 3P42A 2M4NA 2M1MA 1KRHA 5DPWA 3Q14C 3VH4B 4CHKA 1NENB 4ZRJA 2K8HA 1D6EC 1R4MB 3OLMD 1NYRA 4XZ4A 1GG3A 4A9AA 3N30A 1JCKB 3N1ZC 2LFIA 4RGOS 1WGHA 3L0WB 2NS5A 1ZW7A 3GP7A 2INCC 1IP9A 5FR3A 2WU5B 4MJSA 4HEA1 2JZ3B 2O2VB 4K7WA 3ALBA 1V8CA 5AUKA 3QWZB 5C2TB 1YN4A 2K1FA 4DXFA 3DBLI 1EWYC 2KKCA 1I7HA 3Q3MC 2V3NA 2BPSA 1EU3A 1SE4A 1TJEA 2DX5B 1E6EB 2MQJA 3GE8C 5E6OA 4BVUC 4B6WA 1TS5A 1GAQB 3ZRFA 2H88B 4HKZE 1Q1OA 1T0YA 4HJKA 1P0RA 3BZDB 2D3GA 3RYTA 2YVCA 2A4ZA 1M94A 2D2QA 1B1ZA 2WXIA 3B9JA 1T6BX 1VD2A 2NPTB 1UH6A 4RNAA 3AXCA 3AE6B 5IOIA 2WXNA 4JQWC 3L13A 1YQBA 4HCPB 4W9EA 5L95C 4W9GA 1L2NA 2KLGA 3A9KB 2JPHA 4LNKA 3K9PB 4KGSA 3ZYYX 3ZTDA 3VRAB 1L0XB 1T0RC 3NRZA 3V60A 2LHEA 1LXDA 1WJ6A 3HRDD 1JMLA 1D5MC 5BMGA 3U7ZA 1RM6C 2LI5A 5FK9C 1WXQA 3TEXA 1SXTA 4TSSA 4ZRQA 2L7RA 2RDGA 4WJQA 3DVGY 3ECIA 1JWUD 2V3SA 4G0NB 4WQMA 3OJ4B 2O6VD 1WRDB 2LVPA 5GXGB 2IPKD 4FJYA 3E56A 2WX0A 2MHJA 3BINA 3X23A 4JX1C 4BKSA 1TYGB 3PS6A 4KIKA 4KGRA 4ACFA 3LYYA 2BKRB 4M01A 1K53A 3LJ3A 4ZRPA 1YNTE 3NS8A 4XDDA 4EKUA 2OHFA 5BYRA 1VCBA 4IWQA 2VRRB 2LRUA 2DAJA 2FCQA 1ZDVA 4N9F4 2IDYA 3BVGA 3RT3B 4BBNF 3W2DA 2CU1A 2C7NB 4TV3A 2BQQA 1VRAB 1OQYA 1QLBB 2ZZPB 2G9HD 1F2RC 1OQRA 1NVID 1QF6A 1WZ3A 4HPMB 3SD5A 4EUTA 1V80A 3B1LX 4I6LB 2ZVNA 2O6VA 3CMMB 1JWMD 5IKCM 1ZGUB 3VQIA 3ZW3A 2BYFA 2D3AA 3NVYA 2FIFA 2N9XA 2WXKA 4YSYB 2W3RA 2AL3A 4JLCA 4WWPA 2AQ3B 2BS3B 3PZ7A 5DCNA 2CU3A 3WIMA 2KD0A 4KGTA 1WZ0A 4IM2A 2L0TA 5TSSA 1TIFA 3DHIC 1J19A 5DPTA 2ON8A 4TKNA 1XXGA 3VH3B 3FILB 4AJYB 1WGYA 2QMTA 3VTVA 3RFZB 4AQ7A 1ZXHA 3APDA 5IN7A 4REZA 5G5GA 4PS3A 4NNJB 4AOFA 2Z59B 3C8YA 3AECB 1KF6B 2Z8LA 2D10A 3UGBB 4NQLB 4YTMB 3O13A 1V5OA 1FNWA 1WFYA 3IHPC 2ZCCA 4OZAA 2FUHB 2KJ6A 1MI0A 4KV2A 4HRSA 2IJ0A 3MJWA 4GU2A 2N7JA 3AEAB 5LNK1 1NBFC 3RZFA 1GOZA 1BXTA 1QT9A 2K0PA 4NJ7A 4E3CA 2CS4A 1HQRD 1H8CA 4II3B 4BFRA 2WYQA 3AEEB 1I4RA 4W9LA 3EGRA 4E71A 5EE3A 4GDLB 2V4LA 1L7YA 1YIWA 4ZRIA 4C4VB 4G50A 1JRPA 2X38A 4LDTD 4C7YA 2RDHA 5GMVA 3GB1A 4P7IA 2BVCA 4EE2A 1UBIA 1GUAB 4OZCA 3MJ5A 1KLUD 1DYQA 1F77A 3Q6BA 3ZKJC 5D7GA 2G4SA 4LNIA 2PW9A 2L8JA 3QIJA 4N59A 4WJPA 3U2SC 2L83A 1EWCA 5J17A 1CMXB 2PKOA 2XN9C 2ONQA 2KMMA 1FFUA 2K8CA 5DPSA 1P7EA 3P4RB 1N6ZA 4MH0E 3O65B 3ZNID 1SIFA 2BT6A 3CWIA 3DBSA 4KZCA 5LXHA 4ZRKA 5DPRA 2DZJA 2INNE 1RRBA 4L1BA 3A4SC 4KDIC 1RFKA 3KWLA 4NAWB 3JSVB 3N1XC 4K3CA 1X1MA 3ZVVA 2ZPYA 4JWSC 1RAXA 1E7PB 3AE9B 3PRMB 3M62B 3M95A 3A4RA 1TY0A 2JX5A 3ZNZB 3R8BA 1TT5B 2LVQA 1FO4A 2DHZA 2Q5WD 3ZJVA 2PPHA 1D3ZA 2FCMA 3HM3A 3U8ZA 3AE2B 4AUQC 2I1JA 3K9OB 3MHSD 2KLCA 2M0AA 3PZ8A 5T8IA 3TJPA 1K52A 2V1YA 2KFKB 2PVOD 4RGTA 3A9JB 3SU8X 3Q3NC 4HJGE 3PT2B 5AEKB 4MM3A 5I4DA 2LGSA 3AE4B 1XLNA 3VR9B 3APFA 4FJVB 3MFGA 5E6PA 3U7DA 1UUPA 1WXVA 4IOIE 2PTLA 3MTNB 2MW5A 1XLOA 3IT6B 4M0WB 2KWVB 2KWDA 3VUWA 3V05A 3RZWC 2LASA 2DNFA 4K7SA 4C56C 5D3DA 2BS4B 2KTRA 3VR8B 2BWES 1HA5A 3IVFA 4FHJA 3KUCB 3SR6A 1P1AA 3PHXB 4DHZB 1UD7A 2JUOA 3KW5B 2W9NA 3WALA 2IO1B 1J8CA 3P1MA 2BB6A 4A55A 1QOGA 1AWDA 4WH4A 4GMVA 3GS2A 1C4PA 2N1WA 5G2NA 3PSEB 3IAS1 1TKYA 2DENB 4HCNB 3U4EG 4IKGA 5AZHA 2UWQA 3KYCD 4B9KA 2CHWA 1G6JA 3L54A 1KH0A 4HDOA 1PGXA 3TEWA 2WXGA 4MGKE 3ZLZA 2YLMA 5H8YE 5LXIB 3PHWB 3HK0A 3A1QA 2C9WB 3FAHA 1V86A 3DVNV 1DOIA 2BS2B 4WWOA 3UI3A 5IAAC 5CHVC 3ZDTA 4WJOA 1E8WA 2MEKA 3CIRB 3H7SA 1XCQL 4W9CA 4EOYA 1P3QU 2WDQB 3A33B 1UNSA 2VZKD 2QC8A 4GDKA 1WMHB 4XDCA 2LGDA 1KM7A 2FUG1 2RSUA 4HROA 2L52A 1DGJA 1UWXA 3BVZA 4PK1A 3FKYA 2IYDB 3P63A 4P16A 4ZHOA 3OWEB 3RPFC 2WXLA 4LDTB 3NS1A 2MH7A 2KTFA 2KXJA 2LGYA 3KYDD 4M8NA 1PQSA 4W9KA 1V97A 2NMQA 1UWMA 1GPXA 2MJ3A 2L32A 2QEJC 2V3PA 1MJDA 4ARCA 3DHHC 4LNNA 2AYOB 1M4VA 1QOBA 2KMCA 2MJEA 2C7MB 2DBYA 1PUTA 2MA9B 5HG2A 1UZXB 1YOVB 3DQVA 1HTOA 1EUVB 1F2RI 1V2YA 1V49A 2V0GA 1SJHD 2NVUI 2KDIA 3ONSA 3QQ8B 2K6QA
chains in the Genus database with same CATH topology
1UGMA 2BKRB 4BKGA 3LJ3A 4GXBA 4IWPA 3NS8A 3ZNGC 4NJ6A 4WAAA 3VTUA 4A20A 4EKUA 2CHXA 2J0JA 3JW0X 3NOBA 2KK8A 4ANXA 1VCBA 2KMAA 2VRRB 4IWQA 2FIDA 2IO0B 2LRUA 2DAJA 2AWTA 2FCQA 1AARA 4N9F4 4W9JA 4GDLA 3QHTA 3RT3B 4RMAA 4BBNF 3IBEA 3PTFC 2CU1A 2C7NB 2ZPNA 4IW0A 3DDCB 2MX2A 2RGFA 3L16A 3ZNHB 3BY4B 3DPDA 4TV3A 2O2VA 4RM8A 2GBNA 2Y5BB 3NZSA 5JHBA 2IO3B 3PZDA 1V81A 4LJPB 2ZCBA 1OQYA 1WX8A 1C1YB 2KN5A 1Q5WB 4MJSB 4EFOA 3EFUA 2ZZPB 4AJWA 1BT0A 1WXSA 2KWCA 1IPGA 1KLVA 4LCDE 4W9DA 1WXMA 3JYUA 4GIVA 4X57B 3TBLD 3KVFB 1WZ3A 1E90A 3CF6E 2N7EA 1U4AA 4HPMB 3SD5A 4URKA 4EUTA 1V80A 3B1LX 4I6LB 2WWZA 2O6VA 2ZVNA 2CKHB 3DBRI 4OVVA 3W1YA 2DYMA 1WX7A 3ML9A 5E6NA 3CMMB 3HM6X 1NI2A 1WIAA 2DYBA 2MP2B 4ANWA 3H1UA 1ZGUB 4FA6A 2GMIC 4F7ZA 3VQIA 1YX5B 3QC8B 3S2AA 3ZW3A 2K6DB 5KHQA 2J7QB 3OJ3A 3V6CB 2BYFA 1E8XA 2FIFA 1WM3A 3AULA 2N9XA 1WY8A 2KDBA 2LWPA 3GOEA 3Q3JA 4J6IA 5D2MB 3C0RB 2G45B 3OAWA 2AL3A 4JLCA 3KUZA 4WWPA 1K8RB 2LXCA 1ISNA 2JXXA 5CTRC 3TIXA 1XQQA 2L05A 4DHJB 3UQBA 2ZNVB 2KANA 5DCNA 4TQ0A 3WIMA 2KD0A 2EKEC 1WZ0A 4IM2A 4MGYE 4F8CB 2L0TA 2PEAA 2RPQA 2KVRA 4GSWA 1J19A 5DPTA 1F9JA 1LFDA 2FCNA 5KHOA 2GBJA 4TKNA 5JH5C 3ENEA 5C23A 3VH3B 3N3KB 4WJNA 3WAOA 3PVLA 3KUDB 2KFKA 4AJYB 1WGYA 4W9FA 3H9DA 3VTVA 2M8SA 2MRPA 3T9LA 2Z0DB 4XC2A 3EECA 2MSED 2C7HA 5CX3A 3APDA 3VDZA 1GJZA 2IBIB 1FXTB 1EF1A 3EHVA 1WE7A 2ZVOA 2XEWA 3Q3FA 5C1ZA 3APCA 5J18A 2JF5A 4PS3A 2NCNA 4NNJB 2KTRB 4AOFA 2JRIB 2Z59B 4EZKA 1TTNA 3UQAA 1P9DU 5JHAA 4ANUA 1WI0A 3RUIB 2D10A 2JWZA 3UGBB 5JZEB 2BGFA 4NQLB 2MBOA 5LLIA 4KSKC 4DWFA 3HIZA 1V5OA 4DHZE 1WFYA 1WJNA 2LVOA 1OTRB 2R2QA 2JVCA 2ZCCA 3H7PB 3IHPC 2AL6A 2N9EB 3RULA 4FHKA 2FUHB 2I1KA 5CHWA 2IY0B 4HDQA 4NAWA 3UINB 2KJ6A 3NZUA 2HD5B 4KV2A 2LGXA 1P98A 3CSFA 1OEYJ 2FCSA 3MJWA 4GU2A 2KX3A 2KZRA 4II2B 2G4DB 1Q0WB 1R4MI 1LM8B 4ICVA 1NBFC 3RZFA 2MCNB 2WX1A 4BOZB 1A5RA 3RD2A 1RFAA 2A5UA 3ZDMC 1R4NI 1I35A 4NJ7A 4E3CA 2CS4A 2ZJDA 4GOCA 3VHTC 2DZIA 2XBBC 1KOTA 3JVZX 1H8CA 4II3B 5EDSA 1E7UA 2L76A 3NHEB 1OGWA 3VVWB 4BFRA 2WYQA 2KDEB 3A9JA 4W9LA 3SDLC 3PPAA 1HE8A 3IFWB 2B3AA 4E71A 2WDTB 2LXAA 4ANVA 3QA8A 4G11A 4GDLB 2V4LA 1L7YA 1YIWA 4ZRIA 4FADA 2JRHA 4G50A 1EF5A 4MGZE 3R7RA 1WH3A 4LDTD 1WXAA 2KX0A 1E5WA 4HWIB 5FR6A 5GMVA 4P7IA 4HLEA 3IG3A 3QK0A 2IZVB 1UBIA 4I6NB 1GUAB 4PYUA 4GB9A 2GBRA 2KFJA 4NQKE 2NBVB 4AP4C 1V5TA 4PS8A 4XX5A 3PLUA 2REXA 3ZKJC 1WGDA 3DCGA 4A3PA 4DDGD 4HK2A 5D7GA 2G4SA 3P2BA 2L8JA 2PE6B 2QHOA 3UF8A 2KQ7A 3QIJA 4WJPA 3JSVA 4NY0A 4K81A 4WWNA 5J17A 3PLVA 3WAMA 1CMXB 1WYWB 2MP2A 4MDKE 3EC8A 2LJ5A 2XK5B 1ZKHA 2PE9A 3PGEA 5AZFA 4G3XB 3ZTCA 2ASQA 2K8CA 3AU5A 3NY5A 5DPSA 2KHWB 3V6EB 4MH0E 1WGRA 3O65B 3ZNID 1SIFA 3UIPB 1E7VA 2CR5A 2OJRA 2L00B 1WF9A 3DBSA 4IM0A 4KZCA 2Z0EB 1RLFA 5LXHA 4ZRKA 2XK5A 5DPRA 2DZJA 3ML8A 3RCZA 5HKHA 1RRBA 1NDDA 2NBUA 3A4SC 4AWJA 4DBGA 4KDIC 2EMTA 3DOWA 2LD9A 1JRUA 2DAFA 2J0KA 4NAWB 3JSVB 4NPNA 1I42A 4JL9A 3PRPB 4KZ0A 4HXDA 1X1MA 4MGIE 3ZVVA 1WJUA 2NR2A 2ZPYA 3D32A 3H7PA 2PJHA 4MSQB 4FBJB 3VFKA 1RAXA 3H6NA 4GGQA 4DDID 1MG8A 2KNBA 3PRMB 3M62B 3M95A 3A4RA 4E74A 1GC6A 3ZNZB 1KJTA 4BKSD 2LVQA 4RM9A 1WM2A 2DHZA 1WE6A 2DYOA 1YX6B 1TGZB 2HE7A 2D11A 2M0XA 2PPHA 1D3ZA 1SE9A 2FCMA 3HM3A 3U8ZA 2MLBA 4AUQC 2I1JA 2KDFB 3AU4A 3K9OB 3MHSD 4KDLB 4TQ1A 1E8YA 3HHMA 1XT9B 4DK5A 2KLCA 3I3TB 3V62A 1Z5SB 3TJPA 4BBNC 1TBEA 3QJZA 2V1YA 1XD3B 2KFKB 2NPTA 2KQSA 3PRZA 2N1VA 3A9JB 2MBBB 1WR6E 3SU8X 1Y8RC 1YJ1A 2D07B 3VAWA 5L83A 5G55A 1WJ4A 2GBMA 2MBEA 4LJOB 4PS7A 1EO6A 4CO7A 3PT2B 1OEYA 3T8MA 1GNUA 2K8BA 5AEKB 2KC1A 4MM3A 3L08A 2NBWB 4K1RB 2BYEA 1SGHA 2G3QB 2M4NA 2M1MA 3APFA 4FJVB 4M8MA 3V61A 5DPWA 5E6PA 2N7DA 4EEWA 3U7DA 4K7UA 3VH4B 1WXVA 3GZNI 4CHKA 2JT4B 3MTNB 2MBQA 4ZRJA 4JIOU 2DZMA 2K8HA 3PV1A 3VTWA 3X0WA 4ICUA 2MW5A 2MBHA 3TCAA 3OLMD 2RD0A 3R3MA 5CHFA 3PREA 4CYEA 4A3OA 4M0WB 2KWVB 4MEMA 4XZ4A 1GG3A 4ZDVA 2O6VB 1WMHA 3VUXA 3VUWA 4GDKB 3N30A 4B95A 1Z2MA 2C60A 1S1QB 4W9IA 1WGHA 3RZWC 4HPLB 4EZJA 2LASA 3A9KA 3KH0A 3L10B 4K7SA 3L0WB 2NS5A 3W1SC 1ZW7A 3VUYA 1IP9A 2ZNVC 3W1SA 3R7QA 2KTRA 1UBQA 3DBHI 4MJSA 2BWES 5BO4B 2MWSB 2BKFA 2J0MA 3IVFA 4FHJA 2EMSA 3KUCB 3ZUNA 1WX9A 2JZ3B 2JY6A 1P1AA 2O2VB 3PHXB 4DHZB 4K7WA 3ALBA 3QCAA 1UD7A 3U30A 3QWZB 2L0FA 3N32A 5AZGA 3QARA 2JUOA 3KW5B 1V9JA 4DXAB 2K1FA 2W9NA 3DBLI 2K25A 3WALA 2KKCA 2IO1B 3R66C 4KVGB 4EZLA 1J8CA 1S3SG 1TZ1A 3AI5A 2BPSA 3WAPA 3SHQA 4GMVA 3DVNU 2N1WA 4YL8A 3M63B 5G2NA 3PSEB 4I6PA 5IA7A 2DENB 2DX5B 4HCNB 2MQJA 5AZHA 1V6EA 2UWQA 4IM3A 5E6OA 4BVUC 2C5LC 3KYCD 4B6WA 4IUMB 4B9KA 4DHJD 2CHWA 1G6JA 2BWFA 3L54A 4FULA 4TUUA 5TR5A 3ZRFA 4HDOA 2LUEA 1Q1OA 2BYVE 1T0YA 2UYZB 4HJKA 1P0RA 2D3GA 3RYTA 2YVCA 4MGKE 2A4ZA 3ZLZA 2YLMA 1M94A 2D2QA 3PHWB 4MSMB 2BF8B 3HK0A 5LXIB 3A1QA 4FN2A 2C9WB 1GC7A 3B08A 1VD2A 2NPTB 4FJZA 1UH6A 2KO3A 4KSLC 3ZIMA 2L3ZA 1V86A 3DVNV 2RR9A 3M3JA 4WWOA 3WA0A 5IAAC 5CHVC 3B0AA 3WANA 3ZDTA 3AXCA 4FLHA 2KWUB 4JQWC 4WJOA 2GOWA 3L13A 5D6JB 1E8WA 1YQBA 3H7SA 4HCPB 1QZEA 2DZKA 4W9EA 1YD8U 5L95C 4W9CA 4W9GA 3LDZE 1L2NA 4EOYA 2KC2A 5J2RA 4HVBA 1P3QU 2KLGA 3A9KB 2LRWA 2JPHA 3A33B 3K9PB 4GDKA 3ZRCA 4W9HA 4IWOA 1WMHB 2AEHA 2LGDA 3ZTDA 2FNJB 1KM7A 3L17A 4JGHB 2RSUA 3ZO5B 4ZYNA 3V60A 3TMPB 4WQOB 2CHZA 1LXDA 1WJ6A 4IC7B 4PYZA 4OVUA 1UELA 4MELA 4IG7B 2IYDB 5D94A 3CSTA 4LDTB 2KTFA 2KXJA 2ZEQA 1E8ZA 2LGYA 3KYDD 4GN1A 1PQSA 4M8NA 2IO2B 2R2OA 4W9KA 2FAZA 1H4RA 4F1SA 2LI5A 1LQBA 2HTHA 1WR1A 4KIKB 1C3TA 2N9PC 2OOBB 3VXWA 2L7RA 1WGGA 4WJQA 2AYOB 3DVGY 3QAQA 2GBKA 3UIOB 3A1QB 3ECIA 4BKTA 2KMCA 2C7MB 2V3SA 3QX1A 4G0NB 2K39A 3OJ4B 2MA9B 2O6VD 1WRDB 2KJHB 4ASWC 2LVPA 1J0GA 2LZ6A 1UZXB 4FJYA 3DVGX 3DQVA 4BOSC 1V2YA 1EUVB 2KOXA 2WX0A 2KJRA 2JZZA 2HJ8A 1IYFA 1V49A 3BINA 2IY1B 3X23A 3TL5A 4BKSA 2NVUI 3PS6A 2KDIA 3ONSA 2M17A 4KIKA 3QQ8B 2N4FA 2K6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGM A;  2BKR B;  4BKG A;  3LJ3 A;  4GXB A;  4IWP A;  3NS8 A;  3ZNG C;  4NJ6 A;  4WAA A;  3VTU A;  4A20 A;  4EKU A;  2CHX A;  2J0J A;  3JW0 X;  3NOB A;  2KK8 A;  4ANX A;  1VCB A;  2KMA A;  2VRR B;  4IWQ A;  2FID A;  2IO0 B;  2LRU A;  2DAJ A;  2AWT A;  2FCQ A;  1AAR A;  4N9F 4;  4W9J A;  4GDL A;  3QHT A;  3RT3 B;  4RMA A;  4BBN F;  3IBE A;  3PTF C;  2CU1 A;  2C7N B;  2ZPN A;  4IW0 A;  3DDC B;  2MX2 A;  2RGF A;  3L16 A;  3ZNH B;  3BY4 B;  3DPD A;  4TV3 A;  2O2V A;  4RM8 A;  2GBN A;  2Y5B B;  3NZS A;  5JHB A;  2IO3 B;  3PZD A;  1V81 A;  4LJP B;  2ZCB A;  1OQY A;  1WX8 A;  1C1Y B;  2KN5 A;  1Q5W B;  4MJS B;  4EFO A;  3EFU A;  2ZZP B;  4AJW A;  1BT0 A;  1WXS A;  2KWC A;  1IPG A;  1KLV A;  4LCD E;  4W9D A;  1WXM A;  3JYU A;  4GIV A;  4X57 B;  3TBL D;  3KVF B;  1WZ3 A;  1E90 A;  3CF6 E;  2N7E A;  1U4A A;  4HPM B;  3SD5 A;  4URK A;  4EUT A;  1V80 A;  3B1L X;  4I6L B;  2WWZ A;  2O6V A;  2ZVN A;  2CKH B;  3DBR I;  4OVV A;  3W1Y A;  2DYM A;  1WX7 A;  3ML9 A;  5E6N A;  3CMM B;  3HM6 X;  1NI2 A;  1WIA A;  2DYB A;  2MP2 B;  4ANW A;  3H1U A;  1ZGU B;  4FA6 A;  2GMI C;  4F7Z A;  3VQI A;  1YX5 B;  3QC8 B;  3S2A A;  3ZW3 A;  2K6D B;  5KHQ A;  2J7Q B;  3OJ3 A;  3V6C B;  2BYF A;  1E8X A;  2FIF A;  1WM3 A;  3AUL A;  2N9X A;  1WY8 A;  2KDB A;  2LWP A;  3GOE A;  3Q3J A;  4J6I A;  5D2M B;  3C0R B;  2G45 B;  3OAW A;  2AL3 A;  4JLC A;  3KUZ A;  4WWP A;  1K8R B;  2LXC A;  1ISN A;  2JXX A;  5CTR C;  3TIX A;  1XQQ A;  2L05 A;  4DHJ B;  3UQB A;  2ZNV B;  2KAN A;  5DCN A;  4TQ0 A;  3WIM A;  2KD0 A;  2EKE C;  1WZ0 A;  4IM2 A;  4MGY E;  4F8C B;  2L0T A;  2PEA A;  2RPQ A;  2KVR A;  4GSW A;  1J19 A;  5DPT A;  1F9J A;  1LFD A;  2FCN A;  5KHO A;  2GBJ A;  4TKN A;  5JH5 C;  3ENE A;  5C23 A;  3VH3 B;  3N3K B;  4WJN A;  3WAO A;  3PVL A;  3KUD B;  2KFK A;  4AJY B;  1WGY A;  4W9F A;  3H9D A;  3VTV A;  2M8S A;  2MRP A;  3T9L A;  2Z0D B;  4XC2 A;  3EEC A;  2MSE D;  2C7H A;  5CX3 A;  3APD A;  3VDZ A;  1GJZ A;  2IBI B;  1FXT B;  1EF1 A;  3EHV A;  1WE7 A;  2ZVO A;  2XEW A;  3Q3F A;  5C1Z A;  3APC A;  5J18 A;  2JF5 A;  4PS3 A;  2NCN A;  4NNJ B;  2KTR B;  4AOF A;  2JRI B;  2Z59 B;  4EZK A;  1TTN A;  3UQA A;  1P9D U;  5JHA A;  4ANU A;  1WI0 A;  3RUI B;  2D10 A;  2JWZ A;  3UGB B;  5JZE B;  2BGF A;  4NQL B;  2MBO A;  5LLI A;  4KSK C;  4DWF A;  3HIZ A;  1V5O A;  4DHZ E;  1WFY A;  1WJN A;  2LVO A;  1OTR B;  2R2Q A;  2JVC A;  2ZCC A;  3H7P B;  3IHP C;  2AL6 A;  2N9E B;  3RUL A;  4FHK A;  2FUH B;  2I1K A;  5CHW A;  2IY0 B;  4HDQ A;  4NAW A;  3UIN B;  2KJ6 A;  3NZU A;  2HD5 B;  4KV2 A;  2LGX A;  1P98 A;  3CSF A;  1OEY J;  2FCS A;  3MJW A;  4GU2 A;  2KX3 A;  2KZR A;  4II2 B;  2G4D B;  1Q0W B;  1R4M I;  1LM8 B;  4ICV A;  1NBF C;  3RZF A;  2MCN B;  2WX1 A;  4BOZ B;  1A5R A;  3RD2 A;  1RFA A;  2A5U A;  3ZDM C;  1R4N I;  1I35 A;  4NJ7 A;  4E3C A;  2CS4 A;  2ZJD A;  4GOC A;  3VHT C;  2DZI A;  2XBB C;  1KOT A;  3JVZ X;  1H8C A;  4II3 B;  5EDS A;  1E7U A;  2L76 A;  3NHE B;  1OGW A;  3VVW B;  4BFR A;  2WYQ A;  2KDE B;  3A9J A;  4W9L A;  3SDL C;  3PPA A;  1HE8 A;  3IFW B;  2B3A A;  4E71 A;  2WDT B;  2LXA A;  4ANV A;  3QA8 A;  4G11 A;  4GDL B;  2V4L A;  1L7Y A;  1YIW A;  4ZRI A;  4FAD A;  2JRH A;  4G50 A;  1EF5 A;  4MGZ E;  3R7R A;  1WH3 A;  4LDT D;  1WXA A;  2KX0 A;  1E5W A;  4HWI B;  5FR6 A;  5GMV A;  4P7I A;  4HLE A;  3IG3 A;  3QK0 A;  2IZV B;  1UBI A;  4I6N B;  1GUA B;  4PYU A;  4GB9 A;  2GBR A;  2KFJ A;  4NQK E;  2NBV B;  4AP4 C;  1V5T A;  4PS8 A;  4XX5 A;  3PLU A;  2REX A;  3ZKJ C;  1WGD A;  3DCG A;  4A3P A;  4DDG D;  4HK2 A;  5D7G A;  2G4S A;  3P2B A;  2L8J A;  2PE6 B;  2QHO A;  3UF8 A;  2KQ7 A;  3QIJ A;  4WJP A;  3JSV A;  4NY0 A;  4K81 A;  4WWN A;  5J17 A;  3PLV A;  3WAM A;  1CMX B;  1WYW B;  2MP2 A;  4MDK E;  3EC8 A;  2LJ5 A;  2XK5 B;  1ZKH A;  2PE9 A;  3PGE A;  5AZF A;  4G3X B;  3ZTC A;  2ASQ A;  2K8C A;  3AU5 A;  3NY5 A;  5DPS A;  2KHW B;  3V6E B;  4MH0 E;  1WGR A;  3O65 B;  3ZNI D;  1SIF A;  3UIP B;  1E7V A;  2CR5 A;  2OJR A;  2L00 B;  1WF9 A;  3DBS A;  4IM0 A;  4KZC A;  2Z0E B;  1RLF A;  5LXH A;  4ZRK A;  2XK5 A;  5DPR A;  2DZJ A;  3ML8 A;  3RCZ A;  5HKH A;  1RRB A;  1NDD A;  2NBU A;  3A4S C;  4AWJ A;  4DBG A;  4KDI C;  2EMT A;  3DOW A;  2LD9 A;  1JRU A;  2DAF A;  2J0K A;  4NAW B;  3JSV B;  4NPN A;  1I42 A;  4JL9 A;  3PRP B;  4KZ0 A;  4HXD A;  1X1M A;  4MGI E;  3ZVV A;  1WJU A;  2NR2 A;  2ZPY A;  3D32 A;  3H7P A;  2PJH A;  4MSQ B;  4FBJ B;  3VFK A;  1RAX A;  3H6N A;  4GGQ A;  4DDI D;  1MG8 A;  2KNB A;  3PRM B;  3M62 B;  3M95 A;  3A4R A;  4E74 A;  1GC6 A;  3ZNZ B;  1KJT A;  4BKS D;  2LVQ A;  4RM9 A;  1WM2 A;  2DHZ A;  1WE6 A;  2DYO A;  1YX6 B;  1TGZ B;  2HE7 A;  2D11 A;  2M0X A;  2PPH A;  1D3Z A;  1SE9 A;  2FCM A;  3HM3 A;  3U8Z A;  2MLB A;  4AUQ C;  2I1J A;  2KDF B;  3AU4 A;  3K9O B;  3MHS D;  4KDL B;  4TQ1 A;  1E8Y A;  3HHM A;  1XT9 B;  4DK5 A;  2KLC A;  3I3T B;  3V62 A;  1Z5S B;  3TJP A;  4BBN C;  1TBE A;  3QJZ A;  2V1Y A;  1XD3 B;  2KFK B;  2NPT A;  2KQS A;  3PRZ A;  2N1V A;  3A9J B;  2MBB B;  1WR6 E;  3SU8 X;  1Y8R C;  1YJ1 A;  2D07 B;  3VAW A;  5L83 A;  5G55 A;  1WJ4 A;  2GBM A;  2MBE A;  4LJO B;  4PS7 A;  1EO6 A;  4CO7 A;  3PT2 B;  1OEY A;  3T8M A;  1GNU A;  2K8B A;  5AEK B;  2KC1 A;  4MM3 A;  3L08 A;  2NBW B;  4K1R B;  2BYE A;  1SGH A;  2G3Q B;  2M4N A;  2M1M A;  3APF A;  4FJV B;  4M8M A;  3V61 A;  5DPW A;  5E6P A;  2N7D A;  4EEW A;  3U7D A;  4K7U A;  3VH4 B;  1WXV A;  3GZN I;  4CHK A;  2JT4 B;  3MTN B;  2MBQ A;  4ZRJ A;  4JIO U;  2DZM A;  2K8H A;  3PV1 A;  3VTW A;  3X0W A;  4ICU A;  2MW5 A;  2MBH A;  3TCA A;  3OLM D;  2RD0 A;  3R3M A;  5CHF A;  3PRE A;  4CYE A;  4A3O A;  4M0W B;  2KWV B;  4MEM A;  4XZ4 A;  1GG3 A;  4ZDV A;  2O6V B;  1WMH A;  3VUX A;  3VUW A;  4GDK B;  3N30 A;  4B95 A;  1Z2M A;  2C60 A;  1S1Q B;  4W9I A;  1WGH A;  3RZW C;  4HPL B;  4EZJ A;  2LAS A;  3A9K A;  3KH0 A;  3L10 B;  4K7S A;  3L0W B;  2NS5 A;  3W1S C;  1ZW7 A;  3VUY A;  1IP9 A;  2ZNV C;  3W1S A;  3R7Q A;  2KTR A;  1UBQ A;  3DBH I;  4MJS A;  2BWE S;  5BO4 B;  2MWS B;  2BKF A;  2J0M A;  3IVF A;  4FHJ A;  2EMS A;  3KUC B;  3ZUN A;  1WX9 A;  2JZ3 B;  2JY6 A;  1P1A A;  2O2V B;  3PHX B;  4DHZ B;  4K7W A;  3ALB A;  3QCA A;  1UD7 A;  3U30 A;  3QWZ B;  2L0F A;  3N32 A;  5AZG A;  3QAR A;  2JUO A;  3KW5 B;  1V9J A;  4DXA B;  2K1F A;  2W9N A;  3DBL I;  2K25 A;  3WAL A;  2KKC A;  2IO1 B;  3R66 C;  4KVG B;  4EZL A;  1J8C A;  1S3S G;  1TZ1 A;  3AI5 A;  2BPS A;  3WAP A;  3SHQ A;  4GMV A;  3DVN U;  2N1W A;  4YL8 A;  3M63 B;  5G2N A;  3PSE B;  4I6P A;  5IA7 A;  2DEN B;  2DX5 B;  4HCN B;  2MQJ A;  5AZH A;  1V6E A;  2UWQ A;  4IM3 A;  5E6O A;  4BVU C;  2C5L C;  3KYC D;  4B6W A;  4IUM B;  4B9K A;  4DHJ D;  2CHW A;  1G6J A;  2BWF A;  3L54 A;  4FUL A;  4TUU A;  5TR5 A;  3ZRF A;  4HDO A;  2LUE A;  1Q1O A;  2BYV E;  1T0Y A;  2UYZ B;  4HJK A;  1P0R A;  2D3G A;  3RYT A;  2YVC A;  4MGK E;  2A4Z A;  3ZLZ A;  2YLM A;  1M94 A;  2D2Q A;  3PHW B;  4MSM B;  2BF8 B;  3HK0 A;  5LXI B;  3A1Q A;  4FN2 A;  2C9W B;  1GC7 A;  3B08 A;  1VD2 A;  2NPT B;  4FJZ A;  1UH6 A;  2KO3 A;  4KSL C;  3ZIM A;  2L3Z A;  1V86 A;  3DVN V;  2RR9 A;  3M3J A;  4WWO A;  3WA0 A;  5IAA C;  5CHV C;  3B0A A;  3WAN A;  3ZDT A;  3AXC A;  4FLH A;  2KWU B;  4JQW C;  4WJO A;  2GOW A;  3L13 A;  5D6J B;  1E8W A;  1YQB A;  3H7S A;  4HCP B;  1QZE A;  2DZK A;  4W9E A;  1YD8 U;  5L95 C;  4W9C A;  4W9G A;  3LDZ E;  1L2N A;  4EOY A;  2KC2 A;  5J2R A;  4HVB A;  1P3Q U;  2KLG A;  3A9K B;  2LRW A;  2JPH A;  3A33 B;  3K9P B;  4GDK A;  3ZRC A;  4W9H A;  4IWO A;  1WMH B;  2AEH A;  2LGD A;  3ZTD A;  2FNJ B;  1KM7 A;  3L17 A;  4JGH B;  2RSU A;  3ZO5 B;  4ZYN A;  3V60 A;  3TMP B;  4WQO B;  2CHZ A;  1LXD A;  1WJ6 A;  4IC7 B;  4PYZ A;  4OVU A;  1UEL A;  4MEL A;  4IG7 B;  2IYD B;  5D94 A;  3CST A;  4LDT B;  2KTF A;  2KXJ A;  2ZEQ A;  1E8Z A;  2LGY A;  3KYD D;  4GN1 A;  1PQS A;  4M8N A;  2IO2 B;  2R2O A;  4W9K A;  2FAZ A;  1H4R A;  4F1S A;  2LI5 A;  1LQB A;  2HTH A;  1WR1 A;  4KIK B;  1C3T A;  2N9P C;  2OOB B;  3VXW A;  2L7R A;  1WGG A;  4WJQ A;  2AYO B;  3DVG Y;  3QAQ A;  2GBK A;  3UIO B;  3A1Q B;  3ECI A;  4BKT A;  2KMC A;  2C7M B;  2V3S A;  3QX1 A;  4G0N B;  2K39 A;  3OJ4 B;  2MA9 B;  2O6V D;  1WRD B;  2KJH B;  4ASW C;  2LVP A;  1J0G A;  2LZ6 A;  1UZX B;  4FJY A;  3DVG X;  3DQV A;  4BOS C;  1V2Y A;  1EUV B;  2KOX A;  2WX0 A;  2KJR A;  2JZZ A;  2HJ8 A;  1IYF A;  1V49 A;  3BIN A;  2IY1 B;  3X23 A;  3TL5 A;  4BKS A;  2NVU I;  3PS6 A;  2KDI A;  3ONS A;  2M17 A;  4KIK A;  3QQ8 B;  2N4F A;  2K6Q A; 
#chains in the Genus database with same CATH topology
 1VJK A;  4NZL B;  2VZK B;  4BKG A;  3I9V 1;  4GXB A;  4Q2J A;  4NJ6 A;  4WAA A;  4A20 A;  1HEZ E;  4S0R A;  1XLQ A;  3NOB A;  4ANX A;  1WYG A;  1PGB A;  1AAR A;  4W9J A;  3PTF C;  4QAY A;  2ZPN A;  4IW0 A;  1C9F A;  5D3I B;  1LGR A;  2YEP B;  4LJP B;  5EE9 A;  4N58 A;  2INP E;  1YQ4 B;  1WXS A;  2KWC A;  1ACC A;  1IPG A;  4D2K A;  1KLV A;  4W9D A;  4GIV A;  4X57 B;  3TBL D;  4N6E B;  3CF6 E;  2N7E A;  1U4A A;  4USA A;  1N61 A;  2WWZ A;  3DBL B;  2CKH B;  2WXJ A;  4OVV A;  3W1Y A;  2DYM A;  1V1P A;  3ML9 A;  5E6N A;  1FCL A;  4ZOH C;  1NI2 A;  4ANW A;  1C4A A;  3H1U A;  2HJ1 A;  4FA6 A;  2GMI C;  4F7Z A;  1YX5 B;  4GLS C;  1L0V B;  1ZPS A;  2J52 A;  2LWP A;  3Q3J A;  2G45 B;  3OAW A;  4YXD B;  3KUZ A;  1C77 A;  3TIX A;  4MM3 B;  3ZQ4 A;  2AX5 A;  2KAN A;  4TQ0 A;  2LJI A;  3BVM A;  2EKE C;  1PDX A;  1JWS D;  1JQ4 A;  1N60 A;  3ZJU A;  4XE0 A;  3Q8E A;  1LFD A;  2FCN A;  5C23 A;  1YQ3 B;  3PVL A;  2KDM A;  3BK2 A;  1B9R A;  3H9D A;  3URY A;  2M8S A;  2GI9 A;  3T9L A;  2Z0D B;  3NVZ A;  4XC2 A;  3EEC A;  5CX3 A;  3LB8 C;  3MP9 A;  1P7F A;  3EHV A;  1EF1 A;  2JF5 A;  2E3T A;  2JRI B;  2LGI A;  3GE3 C;  1D4B A;  1TTN A;  3UQA A;  2WXQ A;  1P9D U;  5JHA A;  3TEZ A;  4KSK C;  2FE8 A;  3MHZ A;  4DHZ E;  1WJN A;  2R2Q A;  3RUL A;  1DOY A;  3H7P B;  2AL6 A;  4FHK A;  5CHW A;  2JYE A;  2IY0 B;  4XWW A;  1VLB A;  2HD5 B;  1KLG D;  1P98 A;  2JQR B;  2WDR B;  1A70 A;  1I4P A;  3AEG B;  1R4M I;  4YWG G;  2WX1 A;  1WSP A;  1RFA A;  2E6X A;  3ZDM C;  2TSS A;  2ZJD A;  3W5U B;  2DZI A;  2L76 A;  3RNC C;  3DBH B;  2QJL A;  3IFW B;  2AQ1 B;  1K51 A;  4FAD A;  4MGZ E;  1WH3 A;  1Q10 A;  1WXA A;  1E5W A;  5FR6 A;  2YEP F;  4I6N B;  5HHD G;  1JAL A;  4MT5 A;  2GBR A;  1TKG A;  4NQK E;  4AP4 C;  4PS8 A;  4XX5 A;  3DCG A;  1FIQ A;  2PE6 B;  2RPV A;  3WAM A;  1SBB B;  3HVZ A;  5E6J A;  2MP2 A;  3SEB A;  2LJ5 A;  2XK5 B;  1ZKH A;  3AMZ A;  3ZTC A;  2KHW B;  3V6E B;  2JSV X;  1WGR A;  4YSZ B;  3UIP B;  2L00 B;  1VZ6 A;  1WF9 A;  2KAJ A;  3FC4 A;  4CQN A;  3AEF B;  4C00 A;  2EMT A;  2LD9 A;  1XLP A;  1T5X D;  1QOF A;  4KZ0 A;  4HXD A;  1WJU A;  2NR2 A;  3D32 A;  4MH8 A;  3H7P A;  2PJH A;  4US9 A;  1MG8 A;  3NUH B;  1GC6 A;  1ET9 A;  4B0E A;  1AW7 A;  1WE6 A;  2DYO A;  1YX6 B;  1SE9 A;  2MLB A;  2N9L A;  1E8Y A;  1SJE D;  3HHM A;  2LEK A;  2R61 A;  1E0Z A;  3V62 A;  1WWT A;  1Z5S B;  4RFB A;  1FFV A;  1TBE A;  2D3C A;  3QJZ A;  2KT7 A;  2XNA C;  4XGA B;  2ZW1 A;  4RF0 A;  1Y8R C;  1YJ1 A;  2D07 B;  3VAW A;  5L83 A;  1KTK A;  1JWB D;  1WJ4 A;  3J9C A;  1YJI A;  2GBM A;  1ZUD 2;  2HTM E;  1FMA D;  1GNU A;  3AE8 B;  4DQO C;  3L08 A;  1OQQ A;  1L4D B;  4K1R B;  4P1B C;  5BMI A;  1JRO A;  2G3Q B;  4JWU C;  4M8M A;  2BB5 A;  2JT4 B;  1QQR A;  2MBQ A;  3RNE C;  4JIO U;  3PV1 A;  3VTW A;  2MBH A;  3R3M A;  2RD0 A;  2JWU A;  5CHF A;  3PRE A;  4CYE A;  1V1P B;  2K3U A;  4ZDV A;  3AE3 B;  1WMH A;  3ETR A;  1R7S A;  2W82 A;  4GDK B;  4B95 A;  1Z2M A;  1S1Q B;  3TSS A;  4EZJ A;  3KH0 A;  2Y5P A;  3VUY A;  3R7Q A;  1UBQ A;  4LTU A;  3BII D;  3DBH I;  3T3O A;  5BO4 B;  3RMK C;  2BKF A;  2J0M A;  2EMS A;  3ZUN A;  1NYQ A;  4M0W A;  1T0Q C;  3QCA A;  3U30 A;  3QAR A;  3NZ3 A;  4DXA B;  1BUI C;  2K25 A;  1RWS A;  3R66 C;  3P4Q B;  2CJN A;  2Y3A A;  2OED A;  3BWU D;  3WAP A;  1I4G A;  2WLB A;  3M63 B;  2PLP A;  4ZYS A;  4I6P A;  5IA7 A;  3Q8F A;  1V6E A;  4WUR A;  4IUM B;  2BWF A;  4OHJ A;  3DHG C;  4JE3 B;  1UF0 A;  2BYV E;  2UYZ B;  2BF8 B;  5BYQ A;  4FN2 A;  4LK0 M;  1N62 A;  3B08 A;  3ZIM A;  3V3X A;  2KO3 A;  2L3Z A;  3P4S B;  3M3J A;  2RR9 A;  1L6V A;  1FD6 A;  3AE5 B;  3B0A A;  1YN3 A;  2KWU B;  3T3N A;  1ZOY B;  2GOW A;  5D6J B;  5J2R A;  4HVB A;  2LRW A;  1GB4 A;  4YT0 B;  3ZRC A;  5BYS A;  4W9H A;  3IXS A;  3HUI A;  3L17 A;  4JGH B;  1TKE A;  1MFW A;  3TMP B;  2IGG A;  4XWT A;  3Q8A A;  4IC7 B;  4PYZ A;  4OVU A;  1UEL A;  3GZN B;  5D94 A;  2N9K A;  2ZEQ A;  2IO2 B;  2WNM A;  2WXH A;  2FAZ A;  1H4R A;  2HTH A;  1WR1 A;  1SE3 A;  1I4X A;  2OOB B;  3N20 C;  1XCT L;  2GBK A;  3A1Q B;  3Q8C A;  2KJH B;  4ASW C;  1J0G A;  1MHH E;  1R4N B;  4M00 A;  4MAC A;  2RDB C;  2KJR A;  4ARI A;  1GB1 A;  1T0S C;  3EA6 A;  2M17 A;  1WRI A;  2J53 A;  2N4F A;  1UGM A;  4P6V F;  2JU6 X;  1I4Q A;  2AQ2 B;  2GRI A;  3ZNG C;  3RNA C;  3VTU A;  2CHX A;  2IO0 B;  2AWT A;  4GDL A;  4AS1 A;  2I38 A;  3QHT A;  2WDV B;  3RNB C;  4RMA A;  3C19 A;  2MX2 A;  3ZNH B;  3DPD A;  2O2V A;  4RM8 A;  2GBN A;  2Y5B B;  1PGA A;  2IO3 B;  3PZD A;  2ZCB A;  1WX8 A;  1C1Y B;  4MJS B;  4EFO A;  1BT0 A;  1ZP0 B;  3Q69 A;  1WXM A;  4IDI A;  3KVF B;  1E90 A;  3AED B;  4J3O D;  3DWM A;  3DBR I;  2DYB A;  1WIA A;  2MP2 B;  3S2A A;  5KHQ A;  1C78 A;  1E8X A;  1YJJ A;  4L23 A;  1WM3 A;  1CZP A;  1WY8 A;  4RF1 A;  4J6I A;  3C0R B;  2WXM A;  1IGC A;  1LO5 D;  1STE A;  5CTR C;  4DHJ B;  2L05 A;  5BMH A;  3AE1 B;  3L4P A;  4MGY E;  4BAX A;  2J42 A;  1FEH A;  2WS3 B;  2RPQ A;  2KVR A;  4GSW A;  5KHO A;  2GBJ A;  5JXV A;  3WAO A;  3AM9 A;  3KUD B;  2KFK A;  3NVW A;  4W9F A;  1F1H A;  3PO0 A;  2MRP A;  3AH7 A;  4WAF A;  2MSE D;  2C7H A;  3VDZ A;  4B0M A;  2IBI B;  1FXT B;  2KYW A;  2W3S A;  2ZVO A;  5C1Z A;  2XEW A;  5J18 A;  3APC A;  1FRR A;  2WGS A;  2BW2 A;  4ANU A;  4DXG A;  1IBX B;  5LLI A;  4DWF A;  3HIZ A;  3SFD B;  2LVO A;  2M19 A;  2JVC A;  2N9E B;  2WHI A;  2I1K A;  4NAW A;  3NZU A;  2LGX A;  1OEY J;  2FCS A;  4BZA A;  3TUO A;  1L5P A;  4II2 B;  4ZHP A;  2JZP A;  2MCN B;  4H2A A;  4BOZ B;  1A5R A;  2EKI A;  1R4N I;  1I35 A;  1TY2 A;  1V1O A;  3R2I A;  3VHT C;  2XBB C;  1KOT A;  3JVZ X;  4UDU C;  1E7U A;  3NHE B;  3N9Y C;  1QIL A;  3VVW B;  3A9J A;  5HI1 A;  2Y5C A;  3SDL C;  1HE8 A;  2B3A A;  3NG0 A;  2LXA A;  4ANV A;  3QA8 A;  4G11 A;  3VRB B;  5EE1 A;  2JRH A;  3NJT A;  3R7R A;  2QSD A;  4HWI B;  4HLE A;  3QK0 A;  4GB9 A;  2SAK A;  3I63 C;  2KFJ A;  2W54 A;  2NBV B;  4US8 A;  1T3Q A;  4C4V A;  1WGD A;  1VZ8 A;  4A3P A;  1XF5 L;  4HK2 A;  3P2B A;  1FCC C;  3UF8 A;  3P4P B;  3JSV A;  4WWN A;  1SE2 A;  2HDE A;  1TS3 A;  2BYT A;  1FNV A;  4MDK E;  3BYY B;  3PGE A;  2PE9 A;  5AZF A;  1J7B A;  2ASQ A;  3DBR B;  3KQ4 A;  3ZGZ A;  1YMH E;  1JW9 D;  2CR5 A;  2OJR A;  4PT5 A;  1RLF A;  2XK5 A;  3ML8 A;  2NBU A;  4AWJ A;  1JWA D;  4DBG A;  3DOW A;  1JRU A;  2PVG C;  3W9C B;  1IGD A;  2WP9 B;  3BYT B;  4FBJ B;  3H6N A;  3RI7 C;  2VH2 A;  2KNB A;  2RMM A;  1HZ5 A;  1J7C A;  4OW0 A;  4BKS D;  1L4Z B;  1F0Z A;  4RM9 A;  1WM2 A;  1TGZ B;  4KX6 B;  4KDL B;  1XT9 B;  4DK5 A;  3I3T B;  1XD3 B;  2QIL A;  2NPT A;  2KQS A;  2N1V A;  1WR6 E;  5G55 A;  1N5X A;  3AEB B;  2NTS A;  2MBE A;  4LJO B;  2PIA A;  5G5H A;  1EO6 A;  1OEY A;  3T8M A;  2DWQ A;  2K8B A;  2KC1 A;  2NBW B;  1QKZ A;  1FNU A;  2BYE A;  4ITK A;  3V61 A;  2N0S B;  1MPE A;  2N7D A;  1XEE A;  4LLG M;  4K7U A;  4EEW A;  2K5P A;  3GZN I;  1TS2 A;  2GLS A;  2B76 B;  2DZM A;  3X0W A;  4ICU A;  3N1Y C;  3TCA A;  4A3O A;  4MEM A;  2O6V B;  3VUX A;  3MC9 A;  1YN5 A;  2C60 A;  4W9I A;  4HPL B;  3A9K A;  3L10 B;  1VR9 A;  3W1S C;  3Q8B A;  2ZNV C;  3W1S A;  1HXY D;  1EU4 A;  2MWS B;  1WX9 A;  2JY6 A;  1SIJ A;  2KAC A;  4RH6 A;  1TZO A;  2L0F A;  3N32 A;  5AZG A;  1V9J A;  4EZL A;  4KVG B;  1S3S G;  1TZ1 A;  3AI5 A;  3SHQ A;  3DVN U;  1F52 A;  4YL8 A;  4A8X C;  3OG5 A;  1AN8 A;  5IO9 A;  4IM3 A;  1FXI A;  2C5L C;  4DHJ D;  1ROE A;  5FKA C;  1VZ7 A;  4FUL A;  4TUU A;  1FM0 D;  5TR5 A;  2KQ4 X;  1FPY A;  2LUE A;  4HPP A;  1MHX A;  3ZXR A;  1FXA A;  4MSM B;  3ABV B;  1GC7 A;  4KSL C;  2JXT A;  4FJZ A;  2IGH A;  3AN1 A;  3WA0 A;  2LMC A;  3WAN A;  3I57 A;  4FLH A;  1UGJ A;  4WIP A;  1QZE A;  1EM7 A;  2DZK A;  1YD8 U;  1MG4 A;  3LDZ E;  2KC2 A;  4LNO A;  1CK1 A;  1QOA A;  4TMA B;  2G1E A;  1FRD A;  4IWO A;  2AEH A;  2FNJ B;  3ZO5 B;  4ZYN A;  3HVD A;  4WQO B;  2CHZ A;  1RYJ A;  2JYT A;  4MEL A;  4IG7 B;  5H92 C;  1SEB D;  1BML C;  1D5X C;  3CST A;  4R3D A;  4JPS A;  1E8Z A;  4GN1 A;  2R2O A;  2J4X A;  4F1S A;  1LQB A;  4KIK B;  1C3T A;  2N9P C;  3VXW A;  1HTQ A;  1WGG A;  3QAQ A;  3UIO B;  1ENF A;  2QDF A;  4BKT A;  3QX1 A;  2K39 A;  3WCQ A;  4A90 A;  2LZ6 A;  3DVG X;  4BOS C;  2KOX A;  2JZZ A;  2HJ8 A;  1IYF A;  2KN4 A;  1ZXI A;  2IY1 B;  3TL5 A;  4RGN A;  2WXP A;  2OJW A;  4NJC A;  4IWP A;  2LUM A;  3IT4 B;  2NTT A;  4P1C C;  2J0J A;  2ACZ B;  3JW0 X;  2KK8 A;  4L2Y A;  1MVK A;  2KMA A;  2FID A;  3IBE A;  2H89 B;  2QIE B;  3DDC B;  2RGF A;  3L16 A;  3BY4 B;  3Q2A C;  2WXO A;  2LHD A;  4C80 A;  3NZS A;  2UU7 A;  5JHB A;  1V81 A;  1C4C A;  2KN5 A;  1Q5W B;  1L0Y B;  3EFU A;  1ET6 A;  4AJW A;  4LCD E;  3AE7 B;  3JYU A;  2D5G A;  4URK A;  2V4I B;  1WX7 A;  4YTP B;  1K50 A;  3HM6 X;  2IGD A;  2IND C;  3AV8 A;  3QC8 B;  1E10 A;  2K6D B;  2J7Q B;  3OJ3 A;  3V6C B;  1SB3 C;  2V9H A;  3AUL A;  2KDB A;  3GOE A;  2D3B A;  4YTN B;  5D2M B;  2MJD A;  3ZJT A;  1KFY B;  2SEB D;  2VH1 A;  1K8R B;  1SSN A;  2LXC A;  1ISN A;  1ZDX A;  2JXX A;  3UQB A;  1XQQ A;  4OZB A;  2WQY B;  2ZNV B;  3KLS X;  1WGK A;  1IUE A;  4F8C B;  3I5J C;  2PEA A;  1DOX A;  5C3J B;  4RGM A;  1F9J A;  5JH5 C;  3ENE A;  3N3K B;  4WJN A;  5EE0 A;  3TEY A;  1N63 A;  4C7Z A;  1ESF A;  1GJZ A;  3Q3F A;  1WE7 A;  2NCN A;  2KTR B;  4EZK A;  3B2G A;  1WI0 A;  4WWM A;  3RUI B;  4HKQ A;  1OFF A;  3B2F A;  2JWZ A;  3U52 E;  3ZXV A;  5JZE B;  2BGF A;  2MBO A;  5HFY A;  4RCO A;  1OTR B;  3EUB 2;  2EEL A;  4HDQ A;  3UIN B;  4K3B A;  3CSF A;  4A6Q A;  3R2T A;  2K22 A;  2M56 B;  2KX3 A;  2KZR A;  2ICI A;  1Y56 A;  2G4D B;  3NVV A;  4KKI A;  4KKJ A;  1Q0W B;  1TS4 A;  3MC8 A;  1LM8 B;  4ICV A;  4O1N A;  3RD2 A;  2A5U A;  1L6U A;  1C79 A;  2ZW0 A;  4GOC A;  4M02 A;  3AB5 A;  5EDS A;  1VDV A;  1OGW A;  2KDE B;  4NAM A;  3W5V B;  3PPA A;  1E9M A;  1J7A A;  3FIL A;  3RN9 C;  2WDT B;  3RNF C;  4XYC A;  1EF5 A;  3MC0 B;  2X8X X;  2KX0 A;  3IG3 A;  2IZV B;  1HZ6 A;  4PYU A;  1C76 A;  1V5T A;  3PLU A;  2REX A;  2DLB A;  1CJE A;  4DDG D;  2PMV A;  3SFE B;  2I2Y A;  1PYW D;  2QHO A;  2BTE A;  2KQ7 A;  2QCZ A;  2KVZ A;  4NY0 A;  3LXF A;  4K81 A;  3PLV A;  2WXR A;  1WYW B;  3EC8 A;  3RNG C;  2BBC A;  4G3X B;  3AU5 A;  3NY5 A;  2K9X A;  2WXF A;  3E9S A;  3EFC A;  1E7V A;  3DWG C;  4IM0 A;  2Z0E B;  1NEK B;  1CQV A;  2GB1 A;  3RCZ A;  5HKH A;  1NDD A;  4FXC A;  5MPO A;  2DAF A;  2J0K A;  1AYF A;  4NPN A;  1I42 A;  4JL9 A;  3PRP B;  4MGI E;  2FBW B;  2WU2 B;  4MSQ B;  3VFK A;  4YSX B;  5AUI A;  2W55 A;  4GGQ A;  4DDI D;  4E74 A;  3IAM 1;  4LNF A;  1KJT A;  1IBX A;  1ZE3 D;  2L1A A;  1I4H A;  2HE7 A;  2D11 A;  2M0X A;  1NI3 A;  3AU4 A;  2KDF B;  4TQ1 A;  5IP4 D;  1PFD A;  3KWV A;  4BBN C;  3Q3O C;  3PRZ A;  1D5Z C;  2MBB B;  3BK1 A;  4PS7 A;  4CO7 A;  4OVZ A;  3H8H A;  1N5W A;  2CJO A;  1XO3 A;  4S17 A;  1SF0 A;  1SGH A;  3P42 A;  2M4N A;  2M1M A;  1KRH A;  5DPW A;  3Q14 C;  3VH4 B;  4CHK A;  1NEN B;  4ZRJ A;  2K8H A;  1D6E C;  1R4M B;  3OLM D;  1NYR A;  4XZ4 A;  1GG3 A;  4A9A A;  3N30 A;  1JCK B;  3N1Z C;  2LFI A;  4RGO S;  1WGH A;  3L0W B;  2NS5 A;  1ZW7 A;  3GP7 A;  2INC C;  1IP9 A;  5FR3 A;  2WU5 B;  4MJS A;  4HEA 1;  2JZ3 B;  2O2V B;  4K7W A;  3ALB A;  1V8C A;  5AUK A;  3QWZ B;  5C2T B;  1YN4 A;  2K1F A;  4DXF A;  3DBL I;  1EWY C;  2KKC A;  1I7H A;  3Q3M C;  2V3N A;  2BPS A;  1EU3 A;  1SE4 A;  1TJE A;  2DX5 B;  1E6E B;  2MQJ A;  3GE8 C;  5E6O A;  4BVU C;  4B6W A;  1TS5 A;  1GAQ B;  3ZRF A;  2H88 B;  4HKZ E;  1Q1O A;  1T0Y A;  4HJK A;  1P0R A;  3BZD B;  2D3G A;  3RYT A;  2YVC A;  2A4Z A;  1M94 A;  2D2Q A;  1B1Z A;  2WXI A;  3B9J A;  1T6B X;  1VD2 A;  2NPT B;  1UH6 A;  4RNA A;  3AXC A;  3AE6 B;  5IOI A;  2WXN A;  4JQW C;  3L13 A;  1YQB A;  4HCP B;  4W9E A;  5L95 C;  4W9G A;  1L2N A;  2KLG A;  3A9K B;  2JPH A;  4LNK A;  3K9P B;  4KGS A;  3ZYY X;  3ZTD A;  3VRA B;  1L0X B;  1T0R C;  3NRZ A;  3V60 A;  2LHE A;  1LXD A;  1WJ6 A;  3HRD D;  1JML A;  1D5M C;  5BMG A;  3U7Z A;  1RM6 C;  2LI5 A;  5FK9 C;  1WXQ A;  3TEX A;  1SXT A;  4TSS A;  4ZRQ A;  2L7R A;  2RDG A;  4WJQ A;  3DVG Y;  3ECI A;  1JWU D;  2V3S A;  4G0N B;  4WQM A;  3OJ4 B;  2O6V D;  1WRD B;  2LVP A;  5GXG B;  2IPK D;  4FJY A;  3E56 A;  2WX0 A;  2MHJ A;  3BIN A;  3X23 A;  4JX1 C;  4BKS A;  1TYG B;  3PS6 A;  4KIK A;  4KGR A;  4ACF A;  3LYY A;  2BKR B;  4M01 A;  1K53 A;  3LJ3 A;  4ZRP A;  1YNT E;  3NS8 A;  4XDD A;  4EKU A;  2OHF A;  5BYR A;  1VCB A;  4IWQ A;  2VRR B;  2LRU A;  2DAJ A;  2FCQ A;  1ZDV A;  4N9F 4;  2IDY A;  3BVG A;  3RT3 B;  4BBN F;  3W2D A;  2CU1 A;  2C7N B;  4TV3 A;  2BQQ A;  1VRA B;  1OQY A;  1QLB B;  2ZZP B;  2G9H D;  1F2R C;  1OQR A;  1NVI D;  1QF6 A;  1WZ3 A;  4HPM B;  3SD5 A;  4EUT A;  1V80 A;  3B1L X;  4I6L B;  2ZVN A;  2O6V A;  3CMM B;  1JWM D;  5IKC M;  1ZGU B;  3VQI A;  3ZW3 A;  2BYF A;  2D3A A;  3NVY A;  2FIF A;  2N9X A;  2WXK A;  4YSY B;  2W3R A;  2AL3 A;  4JLC A;  4WWP A;  2AQ3 B;  2BS3 B;  3PZ7 A;  5DCN A;  2CU3 A;  3WIM A;  2KD0 A;  4KGT A;  1WZ0 A;  4IM2 A;  2L0T A;  5TSS A;  1TIF A;  3DHI C;  1J19 A;  5DPT A;  2ON8 A;  4TKN A;  1XXG A;  3VH3 B;  3FIL B;  4AJY B;  1WGY A;  2QMT A;  3VTV A;  3RFZ B;  4AQ7 A;  1ZXH A;  3APD A;  5IN7 A;  4REZ A;  5G5G A;  4PS3 A;  4NNJ B;  4AOF A;  2Z59 B;  3C8Y A;  3AEC B;  1KF6 B;  2Z8L A;  2D10 A;  3UGB B;  4NQL B;  4YTM B;  3O13 A;  1V5O A;  1FNW A;  1WFY A;  3IHP C;  2ZCC A;  4OZA A;  2FUH B;  2KJ6 A;  1MI0 A;  4KV2 A;  4HRS A;  2IJ0 A;  3MJW A;  4GU2 A;  2N7J A;  3AEA B;  5LNK 1;  1NBF C;  3RZF A;  1GOZ A;  1BXT A;  1QT9 A;  2K0P A;  4NJ7 A;  4E3C A;  2CS4 A;  1HQR D;  1H8C A;  4II3 B;  4BFR A;  2WYQ A;  3AEE B;  1I4R A;  4W9L A;  3EGR A;  4E71 A;  5EE3 A;  4GDL B;  2V4L A;  1L7Y A;  1YIW A;  4ZRI A;  4C4V B;  4G50 A;  1JRP A;  2X38 A;  4LDT D;  4C7Y A;  2RDH A;  5GMV A;  3GB1 A;  4P7I A;  2BVC A;  4EE2 A;  1UBI A;  1GUA B;  4OZC A;  3MJ5 A;  1KLU D;  1DYQ A;  1F77 A;  3Q6B A;  3ZKJ C;  5D7G A;  2G4S A;  4LNI A;  2PW9 A;  2L8J A;  3QIJ A;  4N59 A;  4WJP A;  3U2S C;  2L83 A;  1EWC A;  5J17 A;  1CMX B;  2PKO A;  2XN9 C;  2ONQ A;  2KMM A;  1FFU A;  2K8C A;  5DPS A;  1P7E A;  3P4R B;  1N6Z A;  4MH0 E;  3O65 B;  3ZNI D;  1SIF A;  2BT6 A;  3CWI A;  3DBS A;  4KZC A;  5LXH A;  4ZRK A;  5DPR A;  2DZJ A;  2INN E;  1RRB A;  4L1B A;  3A4S C;  4KDI C;  1RFK A;  3KWL A;  4NAW B;  3JSV B;  3N1X C;  4K3C A;  1X1M A;  3ZVV A;  2ZPY A;  4JWS C;  1RAX A;  1E7P B;  3AE9 B;  3PRM B;  3M62 B;  3M95 A;  3A4R A;  1TY0 A;  2JX5 A;  3ZNZ B;  3R8B A;  1TT5 B;  2LVQ A;  1FO4 A;  2DHZ A;  2Q5W D;  3ZJV A;  2PPH A;  1D3Z A;  2FCM A;  3HM3 A;  3U8Z A;  3AE2 B;  4AUQ C;  2I1J A;  3K9O B;  3MHS D;  2KLC A;  2M0A A;  3PZ8 A;  5T8I A;  3TJP A;  1K52 A;  2V1Y A;  2KFK B;  2PVO D;  4RGT A;  3A9J B;  3SU8 X;  3Q3N C;  4HJG E;  3PT2 B;  5AEK B;  4MM3 A;  5I4D A;  2LGS A;  3AE4 B;  1XLN A;  3VR9 B;  3APF A;  4FJV B;  3MFG A;  5E6P A;  3U7D A;  1UUP A;  1WXV A;  4IOI E;  2PTL A;  3MTN B;  2MW5 A;  1XLO A;  3IT6 B;  4M0W B;  2KWV B;  2KWD A;  3VUW A;  3V05 A;  3RZW C;  2LAS A;  2DNF A;  4K7S A;  4C56 C;  5D3D A;  2BS4 B;  2KTR A;  3VR8 B;  2BWE S;  1HA5 A;  3IVF A;  4FHJ A;  3KUC B;  3SR6 A;  1P1A A;  3PHX B;  4DHZ B;  1UD7 A;  2JUO A;  3KW5 B;  2W9N A;  3WAL A;  2IO1 B;  1J8C A;  3P1M A;  2BB6 A;  4A55 A;  1QOG A;  1AWD A;  4WH4 A;  4GMV A;  3GS2 A;  1C4P A;  2N1W A;  5G2N A;  3PSE B;  3IAS 1;  1TKY A;  2DEN B;  4HCN B;  3U4E G;  4IKG A;  5AZH A;  2UWQ A;  3KYC D;  4B9K A;  2CHW A;  1G6J A;  3L54 A;  1KH0 A;  4HDO A;  1PGX A;  3TEW A;  2WXG A;  4MGK E;  3ZLZ A;  2YLM A;  5H8Y E;  5LXI B;  3PHW B;  3HK0 A;  3A1Q A;  2C9W B;  3FAH A;  1V86 A;  3DVN V;  1DOI A;  2BS2 B;  4WWO A;  3UI3 A;  5IAA C;  5CHV C;  3ZDT A;  4WJO A;  1E8W A;  2MEK A;  3CIR B;  3H7S A;  1XCQ L;  4W9C A;  4EOY A;  1P3Q U;  2WDQ B;  3A33 B;  1UNS A;  2VZK D;  2QC8 A;  4GDK A;  1WMH B;  4XDC A;  2LGD A;  1KM7 A;  2FUG 1;  2RSU A;  4HRO A;  2L52 A;  1DGJ A;  1UWX A;  3BVZ A;  4PK1 A;  3FKY A;  2IYD B;  3P63 A;  4P16 A;  4ZHO A;  3OWE B;  3RPF C;  2WXL A;  4LDT B;  3NS1 A;  2MH7 A;  2KTF A;  2KXJ A;  2LGY A;  3KYD D;  4M8N A;  1PQS A;  4W9K A;  1V97 A;  2NMQ A;  1UWM A;  1GPX A;  2MJ3 A;  2L32 A;  2QEJ C;  2V3P A;  1MJD A;  4ARC A;  3DHH C;  4LNN A;  2AYO B;  1M4V A;  1QOB A;  2KMC A;  2MJE A;  2C7M B;  2DBY A;  1PUT A;  2MA9 B;  5HG2 A;  1UZX B;  1YOV B;  3DQV A;  1HTO A;  1EUV B;  1F2R I;  1V2Y A;  1V49 A;  2V0G A;  1SJH D;  2NVU I;  2KDI A;  3ONS A;  3QQ8 B;  2K6Q A; 
#chains in the Genus database with same CATH homology
 1UGM A;  2BKR B;  4BKG A;  3LJ3 A;  4GXB A;  4IWP A;  3NS8 A;  3ZNG C;  4NJ6 A;  4WAA A;  3VTU A;  4A20 A;  4EKU A;  2CHX A;  2J0J A;  3JW0 X;  3NOB A;  2KK8 A;  4ANX A;  1VCB A;  2KMA A;  2VRR B;  4IWQ A;  2FID A;  2IO0 B;  2LRU A;  2DAJ A;  2AWT A;  2FCQ A;  1AAR A;  4N9F 4;  4W9J A;  4GDL A;  3QHT A;  3RT3 B;  4RMA A;  4BBN F;  3IBE A;  3PTF C;  2CU1 A;  2C7N B;  2ZPN A;  4IW0 A;  3DDC B;  2MX2 A;  2RGF A;  3L16 A;  3ZNH B;  3BY4 B;  3DPD A;  4TV3 A;  2O2V A;  4RM8 A;  2GBN A;  2Y5B B;  3NZS A;  5JHB A;  2IO3 B;  3PZD A;  1V81 A;  4LJP B;  2ZCB A;  1OQY A;  1WX8 A;  1C1Y B;  2KN5 A;  1Q5W B;  4MJS B;  4EFO A;  3EFU A;  2ZZP B;  4AJW A;  1BT0 A;  1WXS A;  2KWC A;  1IPG A;  1KLV A;  4LCD E;  4W9D A;  1WXM A;  3JYU A;  4GIV A;  4X57 B;  3TBL D;  3KVF B;  1WZ3 A;  1E90 A;  3CF6 E;  2N7E A;  1U4A A;  4HPM B;  3SD5 A;  4URK A;  4EUT A;  1V80 A;  3B1L X;  4I6L B;  2WWZ A;  2O6V A;  2ZVN A;  2CKH B;  3DBR I;  4OVV A;  3W1Y A;  2DYM A;  1WX7 A;  3ML9 A;  5E6N A;  3CMM B;  3HM6 X;  1NI2 A;  1WIA A;  2DYB A;  2MP2 B;  4ANW A;  3H1U A;  1ZGU B;  4FA6 A;  2GMI C;  4F7Z A;  3VQI A;  1YX5 B;  3QC8 B;  3S2A A;  3ZW3 A;  2K6D B;  5KHQ A;  2J7Q B;  3OJ3 A;  3V6C B;  2BYF A;  1E8X A;  2FIF A;  1WM3 A;  3AUL A;  2N9X A;  1WY8 A;  2KDB A;  2LWP A;  3GOE A;  3Q3J A;  4J6I A;  5D2M B;  3C0R B;  2G45 B;  3OAW A;  2AL3 A;  4JLC A;  3KUZ A;  4WWP A;  1K8R B;  2LXC A;  1ISN A;  2JXX A;  5CTR C;  3TIX A;  1XQQ A;  2L05 A;  4DHJ B;  3UQB A;  2ZNV B;  2KAN A;  5DCN A;  4TQ0 A;  3WIM A;  2KD0 A;  2EKE C;  1WZ0 A;  4IM2 A;  4MGY E;  4F8C B;  2L0T A;  2PEA A;  2RPQ A;  2KVR A;  4GSW A;  1J19 A;  5DPT A;  1F9J A;  1LFD A;  2FCN A;  5KHO A;  2GBJ A;  4TKN A;  5JH5 C;  3ENE A;  5C23 A;  3VH3 B;  3N3K B;  4WJN A;  3WAO A;  3PVL A;  3KUD B;  2KFK A;  4AJY B;  1WGY A;  4W9F A;  3H9D A;  3VTV A;  2M8S A;  2MRP A;  3T9L A;  2Z0D B;  4XC2 A;  3EEC A;  2MSE D;  2C7H A;  5CX3 A;  3APD A;  3VDZ A;  1GJZ A;  2IBI B;  1FXT B;  1EF1 A;  3EHV A;  1WE7 A;  2ZVO A;  2XEW A;  3Q3F A;  5C1Z A;  3APC A;  5J18 A;  2JF5 A;  4PS3 A;  2NCN A;  4NNJ B;  2KTR B;  4AOF A;  2JRI B;  2Z59 B;  4EZK A;  1TTN A;  3UQA A;  1P9D U;  5JHA A;  4ANU A;  1WI0 A;  3RUI B;  2D10 A;  2JWZ A;  3UGB B;  5JZE B;  2BGF A;  4NQL B;  2MBO A;  5LLI A;  4KSK C;  4DWF A;  3HIZ A;  1V5O A;  4DHZ E;  1WFY A;  1WJN A;  2LVO A;  1OTR B;  2R2Q A;  2JVC A;  2ZCC A;  3H7P B;  3IHP C;  2AL6 A;  2N9E B;  3RUL A;  4FHK A;  2FUH B;  2I1K A;  5CHW A;  2IY0 B;  4HDQ A;  4NAW A;  3UIN B;  2KJ6 A;  3NZU A;  2HD5 B;  4KV2 A;  2LGX A;  1P98 A;  3CSF A;  1OEY J;  2FCS A;  3MJW A;  4GU2 A;  2KX3 A;  2KZR A;  4II2 B;  2G4D B;  1Q0W B;  1R4M I;  1LM8 B;  4ICV A;  1NBF C;  3RZF A;  2MCN B;  2WX1 A;  4BOZ B;  1A5R A;  3RD2 A;  1RFA A;  2A5U A;  3ZDM C;  1R4N I;  1I35 A;  4NJ7 A;  4E3C A;  2CS4 A;  2ZJD A;  4GOC A;  3VHT C;  2DZI A;  2XBB C;  1KOT A;  3JVZ X;  1H8C A;  4II3 B;  5EDS A;  1E7U A;  2L76 A;  3NHE B;  1OGW A;  3VVW B;  4BFR A;  2WYQ A;  2KDE B;  3A9J A;  4W9L A;  3SDL C;  3PPA A;  1HE8 A;  3IFW B;  2B3A A;  4E71 A;  2WDT B;  2LXA A;  4ANV A;  3QA8 A;  4G11 A;  4GDL B;  2V4L A;  1L7Y A;  1YIW A;  4ZRI A;  4FAD A;  2JRH A;  4G50 A;  1EF5 A;  4MGZ E;  3R7R A;  1WH3 A;  4LDT D;  1WXA A;  2KX0 A;  1E5W A;  4HWI B;  5FR6 A;  5GMV A;  4P7I A;  4HLE A;  3IG3 A;  3QK0 A;  2IZV B;  1UBI A;  4I6N B;  1GUA B;  4PYU A;  4GB9 A;  2GBR A;  2KFJ A;  4NQK E;  2NBV B;  4AP4 C;  1V5T A;  4PS8 A;  4XX5 A;  3PLU A;  2REX A;  3ZKJ C;  1WGD A;  3DCG A;  4A3P A;  4DDG D;  4HK2 A;  5D7G A;  2G4S A;  3P2B A;  2L8J A;  2PE6 B;  2QHO A;  3UF8 A;  2KQ7 A;  3QIJ A;  4WJP A;  3JSV A;  4NY0 A;  4K81 A;  4WWN A;  5J17 A;  3PLV A;  3WAM A;  1CMX B;  1WYW B;  2MP2 A;  4MDK E;  3EC8 A;  2LJ5 A;  2XK5 B;  1ZKH A;  2PE9 A;  3PGE A;  5AZF A;  4G3X B;  3ZTC A;  2ASQ A;  2K8C A;  3AU5 A;  3NY5 A;  5DPS A;  2KHW B;  3V6E B;  4MH0 E;  1WGR A;  3O65 B;  3ZNI D;  1SIF A;  3UIP B;  1E7V A;  2CR5 A;  2OJR A;  2L00 B;  1WF9 A;  3DBS A;  4IM0 A;  4KZC A;  2Z0E B;  1RLF A;  5LXH A;  4ZRK A;  2XK5 A;  5DPR A;  2DZJ A;  3ML8 A;  3RCZ A;  5HKH A;  1RRB A;  1NDD A;  2NBU A;  3A4S C;  4AWJ A;  4DBG A;  4KDI C;  2EMT A;  3DOW A;  2LD9 A;  1JRU A;  2DAF A;  2J0K A;  4NAW B;  3JSV B;  4NPN A;  1I42 A;  4JL9 A;  3PRP B;  4KZ0 A;  4HXD A;  1X1M A;  4MGI E;  3ZVV A;  1WJU A;  2NR2 A;  2ZPY A;  3D32 A;  3H7P A;  2PJH A;  4MSQ B;  4FBJ B;  3VFK A;  1RAX A;  3H6N A;  4GGQ A;  4DDI D;  1MG8 A;  2KNB A;  3PRM B;  3M62 B;  3M95 A;  3A4R A;  4E74 A;  1GC6 A;  3ZNZ B;  1KJT A;  4BKS D;  2LVQ A;  4RM9 A;  1WM2 A;  2DHZ A;  1WE6 A;  2DYO A;  1YX6 B;  1TGZ B;  2HE7 A;  2D11 A;  2M0X A;  2PPH A;  1D3Z A;  1SE9 A;  2FCM A;  3HM3 A;  3U8Z A;  2MLB A;  4AUQ C;  2I1J A;  2KDF B;  3AU4 A;  3K9O B;  3MHS D;  4KDL B;  4TQ1 A;  1E8Y A;  3HHM A;  1XT9 B;  4DK5 A;  2KLC A;  3I3T B;  3V62 A;  1Z5S B;  3TJP A;  4BBN C;  1TBE A;  3QJZ A;  2V1Y A;  1XD3 B;  2KFK B;  2NPT A;  2KQS A;  3PRZ A;  2N1V A;  3A9J B;  2MBB B;  1WR6 E;  3SU8 X;  1Y8R C;  1YJ1 A;  2D07 B;  3VAW A;  5L83 A;  5G55 A;  1WJ4 A;  2GBM A;  2MBE A;  4LJO B;  4PS7 A;  1EO6 A;  4CO7 A;  3PT2 B;  1OEY A;  3T8M A;  1GNU A;  2K8B A;  5AEK B;  2KC1 A;  4MM3 A;  3L08 A;  2NBW B;  4K1R B;  2BYE A;  1SGH A;  2G3Q B;  2M4N A;  2M1M A;  3APF A;  4FJV B;  4M8M A;  3V61 A;  5DPW A;  5E6P A;  2N7D A;  4EEW A;  3U7D A;  4K7U A;  3VH4 B;  1WXV A;  3GZN I;  4CHK A;  2JT4 B;  3MTN B;  2MBQ A;  4ZRJ A;  4JIO U;  2DZM A;  2K8H A;  3PV1 A;  3VTW A;  3X0W A;  4ICU A;  2MW5 A;  2MBH A;  3TCA A;  3OLM D;  2RD0 A;  3R3M A;  5CHF A;  3PRE A;  4CYE A;  4A3O A;  4M0W B;  2KWV B;  4MEM A;  4XZ4 A;  1GG3 A;  4ZDV A;  2O6V B;  1WMH A;  3VUX A;  3VUW A;  4GDK B;  3N30 A;  4B95 A;  1Z2M A;  2C60 A;  1S1Q B;  4W9I A;  1WGH A;  3RZW C;  4HPL B;  4EZJ A;  2LAS A;  3A9K A;  3KH0 A;  3L10 B;  4K7S A;  3L0W B;  2NS5 A;  3W1S C;  1ZW7 A;  3VUY A;  1IP9 A;  2ZNV C;  3W1S A;  3R7Q A;  2KTR A;  1UBQ A;  3DBH I;  4MJS A;  2BWE S;  5BO4 B;  2MWS B;  2BKF A;  2J0M A;  3IVF A;  4FHJ A;  2EMS A;  3KUC B;  3ZUN A;  1WX9 A;  2JZ3 B;  2JY6 A;  1P1A A;  2O2V B;  3PHX B;  4DHZ B;  4K7W A;  3ALB A;  3QCA A;  1UD7 A;  3U30 A;  3QWZ B;  2L0F A;  3N32 A;  5AZG A;  3QAR A;  2JUO A;  3KW5 B;  1V9J A;  4DXA B;  2K1F A;  2W9N A;  3DBL I;  2K25 A;  3WAL A;  2KKC A;  2IO1 B;  3R66 C;  4KVG B;  4EZL A;  1J8C A;  1S3S G;  1TZ1 A;  3AI5 A;  2BPS A;  3WAP A;  3SHQ A;  4GMV A;  3DVN U;  2N1W A;  4YL8 A;  3M63 B;  5G2N A;  3PSE B;  4I6P A;  5IA7 A;  2DEN B;  2DX5 B;  4HCN B;  2MQJ A;  5AZH A;  1V6E A;  2UWQ A;  4IM3 A;  5E6O A;  4BVU C;  2C5L C;  3KYC D;  4B6W A;  4IUM B;  4B9K A;  4DHJ D;  2CHW A;  1G6J A;  2BWF A;  3L54 A;  4FUL A;  4TUU A;  5TR5 A;  3ZRF A;  4HDO A;  2LUE A;  1Q1O A;  2BYV E;  1T0Y A;  2UYZ B;  4HJK A;  1P0R A;  2D3G A;  3RYT A;  2YVC A;  4MGK E;  2A4Z A;  3ZLZ A;  2YLM A;  1M94 A;  2D2Q A;  3PHW B;  4MSM B;  2BF8 B;  3HK0 A;  5LXI B;  3A1Q A;  4FN2 A;  2C9W B;  1GC7 A;  3B08 A;  1VD2 A;  2NPT B;  4FJZ A;  1UH6 A;  2KO3 A;  4KSL C;  3ZIM A;  2L3Z A;  1V86 A;  3DVN V;  2RR9 A;  3M3J A;  4WWO A;  3WA0 A;  5IAA C;  5CHV C;  3B0A A;  3WAN A;  3ZDT A;  3AXC A;  4FLH A;  2KWU B;  4JQW C;  4WJO A;  2GOW A;  3L13 A;  5D6J B;  1E8W A;  1YQB A;  3H7S A;  4HCP B;  1QZE A;  2DZK A;  4W9E A;  1YD8 U;  5L95 C;  4W9C A;  4W9G A;  3LDZ E;  1L2N A;  4EOY A;  2KC2 A;  5J2R A;  4HVB A;  1P3Q U;  2KLG A;  3A9K B;  2LRW A;  2JPH A;  3A33 B;  3K9P B;  4GDK A;  3ZRC A;  4W9H A;  4IWO A;  1WMH B;  2AEH A;  2LGD A;  3ZTD A;  2FNJ B;  1KM7 A;  3L17 A;  4JGH B;  2RSU A;  3ZO5 B;  4ZYN A;  3V60 A;  3TMP B;  4WQO B;  2CHZ A;  1LXD A;  1WJ6 A;  4IC7 B;  4PYZ A;  4OVU A;  1UEL A;  4MEL A;  4IG7 B;  2IYD B;  5D94 A;  3CST A;  4LDT B;  2KTF A;  2KXJ A;  2ZEQ A;  1E8Z A;  2LGY A;  3KYD D;  4GN1 A;  1PQS A;  4M8N A;  2IO2 B;  2R2O A;  4W9K A;  2FAZ A;  1H4R A;  4F1S A;  2LI5 A;  1LQB A;  2HTH A;  1WR1 A;  4KIK B;  1C3T A;  2N9P C;  2OOB B;  3VXW A;  2L7R A;  1WGG A;  4WJQ A;  2AYO B;  3DVG Y;  3QAQ A;  2GBK A;  3UIO B;  3A1Q B;  3ECI A;  4BKT A;  2KMC A;  2C7M B;  2V3S A;  3QX1 A;  4G0N B;  2K39 A;  3OJ4 B;  2MA9 B;  2O6V D;  1WRD B;  2KJH B;  4ASW C;  2LVP A;  1J0G A;  2LZ6 A;  1UZX B;  4FJY A;  3DVG X;  3DQV A;  4BOS C;  1V2Y A;  1EUV B;  2KOX A;  2WX0 A;  2KJR A;  2JZZ A;  2HJ8 A;  1IYF A;  1V49 A;  3BIN A;  2IY1 B;  3X23 A;  3TL5 A;  4BKS A;  2NVU I;  3PS6 A;  2KDI A;  3ONS A;  2M17 A;  4KIK A;  3QQ8 B;  2N4F A;  2K6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...