1WFYA

Solution structure of the ras-binding domain of mouse rgs14
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
GSSGSSGDQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGEKQPMDLENPVSSVASQTLVLDTPPDAKMSEARSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords regulator of G-protein signaling 14; rap1/rap2 interacting p
publication title Solution structure of the Ras-binding domain of mouse RGS14
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 10
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wfyA01
2N1VA 1KLVA 1NDDA 4NNJB 4ANXA 5CTRC 2IBIB 3OJ3A 2XBBC 2NVUI 3N30A 4FJYA 5HKHA 1OEYJ 3A9JB 1IP9A 2KVRA 1OTRB 2JZZA 2KX0A 4KV2A 4J6IA 3RD2A 4BFRA 2WX0A 3NZSA 1GUAB 3ZNZB 3D32A 2LGYA 5J2RA 4HJKA 4AJWA 2LXAA 3CSFA 3ZTDA 1E7VA 4IWQA 3A1QB 4X57B 2KMAA 1P3QU 3ALBA 3ZNID 3VXWA 3ZIMA 1LFDA 3VTWA 2KTFA 3DCGA 1WXVA 2NPTB 4CYEA 3OJ4B 4BOSC 1WGDA 1V6EA 2DX5B 2MP2A 2ZNVB 1UGMA 4IC7B 2KX3A 2LWPA 2KOXA 2KXJA 2N7DA 1Z2MA 2GOWA 2Y5BB 3APDA 3OAWA 3R3MA 4P7IA 1UBQA 3CSTA 4G3XB 2G45B 1KM7A 1R4MI 2D07B 1WJNA 4GIVA 5D6JB 1U4AA 3DDCB 3VVWB 2ZPYA 3BY4B 3KUCB 4YL8A 2AL3A 2GBMA 3A33B 1R4NI 2DZJA 1OQYA 3ZDMC 3QK0A 4TQ0A 2L76A 3EECA 1ZKHA 2FCMA 3L10B 3HHMA 2KDEB 1WX7A 1E5WA 2GMIC 4HDOA 4ANWA 4N9F4 5JZEB 3A4SC 1XD3B 4KVGB 1WXMA 3V60A 3PREA 3MHSD 2KC1A 1IYFA 1RAXA 4WWNA 2KDFB 2JY6A 1WYWB 4G50A 2ZZPB 4JQWC 2FAZA 3WANA 4WJPA 5KHQA 2J0MA 4W9KA 1WFYA 4XZ4A 4RM9A 2UWQA 4EFOA 2M17A 3QQ8B 3QARA 1YX6B 4NQKE 3JW0X 4HWIB 3WAMA 2G4DB 2NBWB 2MQJA 3VAWA 2VRRB 2A4ZA 3B0AA 1T0YA 2PE9A 4II2B 2MA9B 3R66C 1UH6A 2IO1B 1V9JA 1V5TA 1SE9A 4PS7A 1V49A 3TJPA 2JWZA 3QCAA 4E74A 2L0TA 4DWFA 5IA7A 3N32A 3C0RB 4XX5A 5FR6A 2MBOA 4MGIE 5AZGA 4MGZE 1WXSA 4CO7A 4HLEA 3KYDD 3A9JA 4IW0A 5CHVC 1X1MA 4EUTA 2UYZB 5CHWA 2JZ3B 1TGZB 3HM3A 2RR9A 2HTHA 4IWPA 1WGYA 2HJ8A 4HPLB 2FNJB 3LDZE 2HE7A 3L0WB 5CX3A 2RGFA 2V1YA 4NAWA 2LD9A 2LZ6A 1P1AA 2ZCBA 2NPTA 3V6EB 3NS8A 4FA6A 1WR1A 3PV1A 3IVFA 2C9WB 1E90A 2JRIB 4HDQA 3U30A 4FJZA 3B08A 2C7HA 4RM8A 3RULA 3WALA 5C1ZA 2K6DB 3W1SC 2K6QA 3KVFB 5IAAC 3ZNGC 4W9HA 4MGKE 3VUYA 4FJVB 2JT4B 1KJTA 3SU8X 5AEKB 3V6CB 4II3B 2ZVNA 3M3JA 2IO0B 2GBRA 4GN1A 2N9XA 4MJSA 1L7YA 5G55A 4KIKA 5DPSA 2CHWA 1UD7A 2IY1B 3WIMA 4DK5A 3PHXB 3A4RA 1WE7A 1WXAA 2KZRA 2O2VA 3A9KB 3CF6E 2A5UA 2N9EB 2ZJDA 3DBLI 3HK0A 4G0NB 2I1KA 4XC2A 1I35A 4K81A 4MELA 1YIWA 4IWOA 3W1SA 4A3OA 2K8CA 1WJUA 3UQAA 1LM8B 3VH3B 1M94A 5DPWA 1H8CA 4GXBA 3QIJA 4DHJD 2KJRA 3JSVB 1XT9B 3L54A 1EO6A 1VCBA 4MSMB 1TTNA 1V86A 2PPHA 1WR6E 1WMHB 4F8CB 3UINB 1YX5B 2KO3A 4HXDA 1TBEA 2I1JA 4NAWB 4BBNC 1OEYA 2KFJA 3RT3B 4ANUA 4GGQA 4OVVA 2K39A 4JGHB 3SHQA 3TMPB 4BKTA 2DYOA 4LCDE 4JLCA 3M95A 3WA0A 2MRPA 4GSWA 2M4NA 4BKSD 4ICUA 1EF5A 3UF8A 2MBBB 2L00B 2KQ7A 2N1WA 2O6VD 3K9PB 2LVPA 1C1YB 3HIZA 2MCNB 2LVQA 4ASWC 4E3CA 3VUXA 1RLFA 2WYQA 3BINA 2KWCA 3SDLC 2XK5A 4E71A 2V3SA 3IBEA 4HCNB 4GB9A 3M62B 4TQ1A 2CKHB 3OLMD 4MJSB 2PJHA 4AP4C 3W1YA 4ZYNA 3VTVA 2CS4A 2WWZA 1WE6A 2J0KA 2KDIA 4KIKB 3UIPB 1D3ZA 3QA8A 1UELA 3WAPA 4TUUA 5DPTA 3PRPB 1A5RA 2O2VB 2R2OA 3K9OB 4DDID 2D11A 2LGXA 3TCAA 1CMXB 2LRWA 4I6NB 4LJOB 3VFKA 1E8YA 3M63B 2AL6A 3JVZX 2G4SA 1YD8U 1XQQA 2MBEA 2JVCA 4B95A 2BYEA 2FIDA 1YJ1A 2B3AA 3P2BA 3NHEB 2KDBA 3PTFC 4FHJA 4F1SA 1ISNA 2LGDA 4PS8A 3EFUA 3R7QA 4W9GA 2OOBB 1NBFC 3PRMB 2C7MB 3Q3JA 2L8JA 3VDZA 3EHVA 2DZMA 1S3SG 4EEWA 2FIFA 4DHZE 3V61A 1BT0A 5D94A 2NBUA 4DXAB 4KSLC 4EZLA 2AEHA 3PLUA 2JXXA 3DVGY 4ICVA 4KZ0A 1P98A 3DPDA 3I3TB 2KTRA 3QC8B 1NI2A 4K1RB 4K7UA 4MSQB 4WQOB 4LDTD 1WH3A 1V80A 2CU1A 3PZDA 4BKGA 3ZVVA 1QZEA 5L83A 3H9DA 4TV3A 3A9KA 3H6NA 2XK5B 1V5OA 2L0FA 4K7WA 2XEWA 2MBQA 2KFKA 3O65B 1KOTA 2MWSB 2M0XA 4MGYE 1WGGA 1EF1A 4GDLB 2KD0A 2K25A 2C60A 1GJZA 2KJHB 3L13A 2W9NA 3Q3FA 1E8WA 2V4LA 2ZCCA 3JSVA 3QX1A 4BOZB 4G11A 1G6JA 3PT2B 5JH5C 3U8ZA 3VHTC 4K7SA 1WMHA 5D2MB 2D3GA 2IO3B 1TZ1A 5E6NA 4M8NA 3RCZA 1WX8A 4EZJA 2BPSA 4DDGD 4WJNA 3X23A 4GU2A 1J8CA 3IG3A 2KLCA 3APFA 4WWPA 2NCNA 3L16A 2WDTB 4URKA 1S1QB 4KZCA 4GMVA 3IFWB 3DBSA 3T9LA 3ZDTA 2LASA 5DCNA 4NQLB 2EMSA 4BKSA 2KKCA 2KWVB 1GG3A 2CR5A 4IM2A 3HM6X 5L95C 2KANA 2M1MA 2O6VA 3RUIB 2KTRB 1Z5SB 3PLVA 2BWFA 4W9CA 3ZO5B 4ZDVA 3CMMB 2GBNA 3NZUA 5GMVA 5TR5A 1ZGUB 4A3PA 2C5LC 2Z59B 3KW5B 3PPAA 5LLIA 2FCNA 1OGWA 1UBIA 3KYCD 4W9EA 3KUDB 3N3KB 1J0GA 4TKNA 2KFKB 2PE6B 2KWUB 4I6PA 4WJQA 2JRHA 3DBHI 5BO4B 1C3TA 2KJ6A 3DOWA 3SD5A 4FBJB 4I6LB 1MG8A 5G2NA 3TL5A 3GOEA 1WGHA 3MTNB 3VTUA 3GZNI 3ZUNA 5JHBA 2NS5A 3B1LX 2DHZA 4WWOA 1ZW7A 3VUWA 3ZTCA 5C23A 2L3ZA 4GOCA 3ECIA 2LRUA 4RMAA 5LXHA 4OVUA 4DHJB 4LJPB 1WM3A 2DYBA 2GBJA 2IO2B 2N7EA 4JL9A 1J19A 1FXTB 2RSUA 2NR2A 4FN2A 4M8MA 4CHKA 2ZVOA 2MSED 2ZPNA 4W9FA 1WM2A 2ZEQA 5D7GA 2CHXA 2QHOA 3PRZA 2RPQA 4W9LA 3ENEA 2KNBA 2M8SA 2L05A 1V81A 2ASQA 2N9PC 1IPGA 4FULA 4M0WB 4FLHA 5E6OA 2KK8A 5JHAA 2EMTA 1WZ3A 2O6VB 3L08A 4GDLA 1Q1OA 5AZHA 4AOFA 3PS6A 4HVBA 3X0WA 4MEMA 5E6PA 2C7NB 3WAOA 2FCQA 4HCPB 1E8XA 2KQSA 2K8HA 4FHKA 2Z0EB 4IM0A 1P0RA 4ANVA 4KDIC 3RZFA 1GC7A 1WJ4A 2FUHB 2BKRB 3TBLD 3VQIA 1L2NA 4PYUA 3L17A 4HPMB 4GDKA 3ML9A 3H1UA 3NOBA 4IM3A 1K8RB 3PHWB 4NJ6A 5J17A 5KHOA 4AJYB 4PS3A 2KLGA 4MH0E 2G3QB 4BVUC 1WI0A 2LUEA 2D2QA 3ZRFA 2AYOB 4IG7B 4FADA 2YVCA 1JRUA 1Q0WB 1Q5WB 3ONSA 1I42A 1SGHA 1F9JA 1H4RA 3AU5A 3ZRCA 4W9IA 3RYTA 3ZW3A 2EKEC 2JPHA 3LJ3A 2MW5A 2BF8B 2D10A 3EC8A 1EUVB 4NY0A 3ML8A 1WY8A 2J0JA 2RD0A 2FCSA 3U7DA 1E7UA 4PYZA 2MX2A 2DZKA 2K1FA 2KC2A 2KHWB 3ZNHB 2IYDB 4W9JA 4AUQC 3PGEA 2KMCA 4KSKC 4LDTB 4NJ7A 3V62A 5LXIB 2LI5A 1RRBA 4MDKE 2HD5B 2MP2B 2J7QB 2DAFA 1GC6A 1Y8RC 1HE8A 1WZ0A 3DVGX 2GBKA 3PVLA 4WAAA 3ZKJC 3KUZA 2R2QA 4ZRKA 2AWTA 1YQBA 3H7PA 4DBGA 2N4FA 2JF5A 2ZNVC 4IUMB 4GDKB 3PSEB 4DHZB 1WIAA 4HK2A 2BYVE 2BWES 4A20A 4MM3A 2KN5A 1P9DU 2MLBA 2BGFA 3DVNU 4B6WA 2PEAA 3QJZA 3R7RA 3S2AA 1AARA 3AXCA 2MBHA 3JYUA 1UZXB 1LQBA 2DAJA 3A1QA 5J18A 1WRDB 2BYFA 2IY0B 3ZLZA 3UGBB 2LVOA 3AI5A 1GNUA 1PQSA 2Z0DB 2DZIA 4ZRIA 1LXDA 4F7ZA 5AZFA 1WJ6A 4ZRJA 3APCA 3UQBA 2LJ5A 5EDSA 5CHFA 3RZWC 2WX1A 4EZKA 3UIOB 4WJOA 2OJRA 2DENB 4B9KA 4KDLB 3QWZB 2LXCA 4AWJA 3AULA 3MJWA 4EKUA 3QHTA 1VD2A 3AU4A 2JUOA 3H7SA 3DVNV 3DQVA 1WF9A 2DYMA 4JIOU 1E8ZA 2CHZA 3VH4B 3DBRI 4EOYA 1V2YA 3IHPC 3TIXA 4NPNA 5DPRA 2BKFA 2K8BA 4BBNF 2YLMA 3NY5A 3QAQA 1WX9A 3KH0A 4W9DA 1RFAA 2L7RA 3T8MA 3H7PB 1WGRA 1SIFA 2NBVB 2IZVB 2REXA
chains in the Genus database with same CATH superfamily
2IBIB 3N30A 2WP9B 1IP9A 2KX0A 5BMGA 4J6IA 3RD2A 3NVYA 4BFRA 3NZSA 4AJWA 3GZNB 3ZTDA 4X57B 2SEBD 3ZIMA 3DCGA 1FCLA 1MI0A 5C2TB 4IC7B 2LWPA 2KXJA 1Z2MA 4Q2JA 1Y56A 3OAWA 1FRRA 3HUIA 1UBQA 3CSTA 2G45B 3AEAB 1WJNA 1U4AA 3ZXRA 2QCZA 3TEWA 4YL8A 3J9CA 1SBBB 3EECA 1ZKHA 3I63C 3L10B 1TS5A 1WX7A 3BK1A 4N9F4 3A4SC 4KVGB 3V60A 1IYFA 3GE8C 4JQWC 3WANA 4XZ4A 4RM9A 3QQ8B 1YX6B 4NQKE 3AE2B 4XWWA 2KVZA 2J42A 2WXLA 4YTNB 3R66C 1V9JA 1TKYA 2SAKA 4A90A 2D5GA 5FR6A 4MGIE 1PUTA 4IW0A 5BYRA 1TKEA 2JZ3B 1TGZB 1VZ7A 2HTHA 1WGYA 4YTPB 4P1BC 4JWSC 3L0WB 2L83A 2V1YA 2I2YA 2NPTA 3PV1A 1XLOA 1CJEA 3L4PA 1TYGB 3W1SC 1EU3A 1JRPA 2J4XA 4MGKE 3LXFA 1YMHE 4L1BA 2JT4B 1KJTA 4YSYB 1HTOA 3V6CB 2WXIA 3M3JA 4J3OD 5H8YE 3IAS1 1HZ6A 4KIKA 5DPSA 2CHWA 3MC9A 3A4RA 1WXAA 4G0NB 2M0AA 1NYQA 2OJWA 2PVGC 1PYWD 3Q6BA 4GXBA 4RFBA 3L54A 1V86A 2L1AA 3UINB 2I1JA 3PZ8A 1TIFA 1RYJA 4OVVA 1QILA 2K39A 3TMPB 4BKTA 2DYOA 4R3DA 4JLCA 5HHDG 4ICUA 4D2KA 1I4RA 2O6VD 1PGXA 1T0RC 3RNCC 2KWCA 1QOGA 1LGRA 4GB9A 3N1XC 1ZP0B 3NS1A 4KIKB 1WE6A 1L6UA 4JE3B 3PRPB 2R2OA 4DDID 4I6NB 2AX5A 1XQQA 1M4VA 4ITKA 4FHJA 5FKAC 3Q3JA 3VDZA 2L8JA 3EHVA 1FFUA 3V61A 1BT0A 4DXAB 4USAA 4KSLC 3DPDA 2KTRA 2JXTA 4S17A 1WH3A 1V80A 1QZEA 3A9KA 3O65B 3MP9A 4MGYE 1WGGA 1EF1A 4XDCA 1XCQL 1C76A 1K51A 1WMHA 4IOIE 2Y5PA 4RGOS 4M8NA 4L2YA 1WX8A 5IP4D 1ZDVA 3VR9B 3RNGC 3X23A 4GU2A 3APFA 1S1QB 1SE2A 2EMSA 2YEPB 4M0WA 2KKCA 4KKJA 5L95C 5FR3A 2M1MA 2KTRB 2BWFA 4W9CA 3ZO5B 1JWSD 3CMMB 2ZW0A 4RH6A 5TR5A 1ZGUB 4AS1A 2Z59B 3KW5B 3PPAA 4XDDA 3KYCD 1J0GA 4TKNA 2KWUB 4I6PA 4OZBA 2JRHA 5BO4B 3AEFB 1C3TA 3IT6B 4OHJA 5G2NA 3TL5A 1WGHA 3MTNB 3SFDB 3NVVA 3DBRB 5JHBA 3B1LX 2DHZA 4WWOA 1ET9A 1YQ3B 4IDIA 1SE3A 1WM3A 2DYBA 2GBJA 4A55A 1LO5D 4FN2A 4CHKA 2ZVOA 1QOBA 2WS3B 1C78A 3PRZA 1C4AA 3ENEA 2M8SA 1V81A 2ASQA 2W3RA 4M0WB 4FLHA 2WXMA 3DHHC 4GDLA 3W5UB 5AZHA 3PZ7A 4US8A 5E6PA 2PTLA 2KQSA 2WU2B 2Z0EB 3U7ZA 4ANVA 1XLQA 1WJ4A 3B9JA 4PYUA 2HTME 1OQQA 3H1UA 4AJYB 2KLGA 2WGSA 5E6JA 2D2QA 4FADA 2YVCA 2CJNA 1F9JA 1DGJA 1H4RA 1N63A 1GB4A 2EKEC 1JROA 2JPHA 1EWYC 2QEJC 2IPKD 1EUVB 1FEHA 1FM0D 2K0PA 3ZNHB 4NZLB 4CQNA 1T0SC 2KMCA 1SXTA 4NJ7A 2LHEA 3HVZA 1HQRD 1MPEA 1GC6A 1PFDA 3PVLA 2AWTA 1E6EB 2N4FA 2PMVA 2Z8LA 5HI1A 3ZXVA 4YSXB 1JWMD 2KN5A 2MLBA 1STEA 4HKZE 1EU4A 3R7RA 2MBHA 3TEZA 1UZXB 1LQBA 3UI3A 4GLSC 2KQ4X 3ZLZA 2LVOA 4ZRIA 5AZFA 3BK2A 1WJ6A 3APCA 3RZWC 3SFEB 3UIOB 3QWZB 1KLGD 2JUOA 3E56A 3DQVA 1E8ZA 3VH4B 3DBRI 4NPNA 1PDXA 4C7ZA 4WQMA 4BBNF 2YLMA 3NY5A 3QAQA 4W9DA 1RFAA 1WGRA 1SIFA 2KWDA 2N1WA 3K9PB 1NDDA 4ANXA 5CTRC 4FJYA 3DBLB 1OEYJ 3A9JB 2K3UA 3O13A 4KV2A 1OTRB 2JZZA 1JW9D 2WX0A 2LGYA 1VRAB 3AECB 3CSFA 4IWQA 1ZDXA 3ZNID 1ENFA 2I38A 4CYEA 3Q2AC 3OJ4B 1WGDA 2DX5B 1UGMA 2Y5BB 3BYYB 3APDA 1F77A 3R3MA 1D5MC 1JWUD 2QSDA 2LFIA 2ZPYA 3KUCB 3ZDMC 1ACCA 2MEKA 3QK0A 2L76A 2WLBA 4HDOA 5JZEB 3AE7B 3FC4A 3EA6A 2KDFB 2FAZA 1IGDA 2J0MA 4W9KA 1WFYA 2UWQA 1WSPA 2M17A 3QARA 3JW0X 2NBWB 2WHIA 1JALA 1T0YA 2PE9A 2QIEB 3AEEB 1V5TA 4PS7A 1SIJA 3TJPA 5IKCM 2JWZA 4LLGM 4KX6B 4XX5A 1UUPA 5AZGA 4CO7A 3Q8EA 2FUG1 1XLNA 1HXYD 2UYZB 2BS2B 2RR9A 5IO9A 2FNJB 4B0EA 3LDZE 2HE7A 5CX3A 2LD9A 5BMIA 2LZ6A 3NS8A 1R7SA 2C9WB 1FNWA 1XLPA 4HDQA 3B08A 1RFKA 2C7HA 1C4CA 3RULA 3WALA 2K6QA 4RGNA 1ET6A 2G9HD 3ZGZA 4FJVB 1IUEA 1GPXA 1L7YA 5G55A 1UD7A 2IY1B 4DK5A 5IN7A 1HZ5A 2QDFA 3PHXB 1KRHA 2O2VA 3HK0A 2A5UA 2ZW1A 4DQOC 3DBLI 1I35A 2I1KA 3AN1A 4MELA 1FIQA 2LHDA 4A3OA 3DBHB 2GRIA 3UQAA 5DPWA 1FFVA 4DHJD 3JSVB 1EO6A 1Q10A 1VCBA 1L0YB 4MSMB 1TTNA 2PPHA 3N20C 2KO3A 4E74A 1TBEA 4BBNC 1D4BA 4GGQA 1MG4A 4LCDE 2ONQA 2MRPA 2KN4A 2MJDA 1FCCC 2MBBB 2L00B 3B2FA 3U2SC 2KQ7A 2MCNB 3BYTB 2LVQA 2N9KA 2WYQA 4A6QA 1I4GA 2JWUA 4KGRA 3SDLC 4E71A 2DLBA 2V3SA 2CKHB 1AN8A 3AE9B 5TSSA 2PJHA 3W1YA 3VTVA 2KDIA 3UIPB 2BBCA 2O2VB 2D3CA 1IGCA 2LGXA 3VFKA 4XWTA 1E8YA 1KFYB 3M63B 3N9YC 1FMAD 2G4SA 3NVZA 1V1OA 4M00A 2B3AA 3P2BA 4F1SA 4JX1C 3T3OA 1YOVB 2BS4B 2LGDA 4PS8A 2XN9C 4W9GA 1FXAA 4A8XC 2JX5A 1S3SG 2BW2A 3AEDB 4EEWA 1I4HA 4EZLA 1IBXA 3PLUA 2JXXA 1P98A 4HEA1 4NJCA 2D3BA 2PW9A 4WQOB 4LDTD 3PZDA 1ZXHA 4TV3A 4K7WA 2M0XA 1ZOYB 1K53A 2C60A 1GJZA 3Q3FA 1E8WA 2V4LA 3TSSA 2W82A 3QX1A 1CZPA 2EELA 3PT2B 4K7SA 2IO3B 1TZ1A 1QOAA 2HJ1A 3GS2A 1C9FA 3H8HA 2LGSA 3IG3A 3W5VB 3L16A 4KZCA 1D5ZC 3IFWB 3VR8B 3MJ5A 3T9LA 3RMKC 2ON8A 4BKSA 1IBXB 1F1HA 2J52A 3RUIB 1TY0A 1Z5SB 4ZDVA 3RFZB 2GBNA 3NZUA 5GMVA 2C5LC 3DWMA 4WAFA 3Q3MC 1UBIA 4W9EA 1CK1A 3KUDB 1L4DB 5HFYA 3DBHI 2JQRB 3AH7A 2WXOA 2VZKB 3AEBB 1P7EA 4XGAB 3GZNI 2NS5A 2L3ZA 1VDVA 4OVUA 2PLPA 2WDRB 1J19A 2NR2A 1NYRA 2D3AA 4US9A 1MVKA 2ZPNA 1WM2A 5D7GA 1XF5L 4ZRPA 1J7BA 1YQ4B 1IPGA 1MFWA 5E6OA 2KK8A 4LTUA 3NZ3A 1Q1OA 2ACZB 2QMTA 3X0WA 1XEEA 3SEBA 4OVZA 2XNAC 1E8XA 2K8HA 4FHKA 4KDIC 3V05A 3TBLD 2BKRB 1R4MB 3L17A 3HVDA 3ML9A 1XCTL 1L4ZB 4LK0M 5KHOA 2PVOD 1R4NB 2WXPA 1YJIA 4IG7B 2BB6A 1Q0WB 3ONSA 1QF6A 4C80A 3AU5A 3ETRA 2D10A 3EC8A 2V9HA 4C56C 3P4SB 3U7DA 2DZKA 2KC2A 1TY2A 3FILA 4AUQC 1UWXA 3ZJVA 1QKZA 1RRBA 4DXGA 2MP2B 1C79A 1HE8A 4K3BA 4DBGA 2JF5A 4IUMB 1OQRA 4DHZB 2BYVE 3DVNU 4B6WA 1C77A 2PEAA 2RMMA 3MFGA 1AARA 3N1ZC 2JZPA 2W55A 2DAJA 1JMLA 1FPYA 3AI5A 1GNUA 1PQSA 2OEDA 1SEBD 3EGRA 4ZRJA 2G1EA 2CJOA 1TKGA 4FXCA 4KDLB 3FILB 4AWJA 3AULA 3AE6B 4EKUA 1T5XD 3QHTA 3H7SA 3DVNV 4RNAA 2WQYB 1WF9A 1V2YA 3BIID 1WX9A 3KH0A 3T8MA 2NBVB 1G6JA 2REXA 1ZXIA 2N1VA 4NNJB 3OJ3A 3E9SA 1FD6A 2MHJA 1FRDA 1GUAB 3BZDB 3RNEC 3ZNZB 5J2RA 2LXAA 1E7VA 1P3QU 3ALBA 2VH2A 4P16A 1LFDA 2L52A 4XE0A 2KTFA 3IAM1 1SJED 1V6EA 1VLBA 1L5PA 2KX3A 5G5HA 2KOXA 2GOWA 2N9LA 4P7IA 4G3XB 3AV8A 1R4MI 4GIVA 3VVWB 4PK1A 3IT4B 3A33B 4BZAA 1R4NI 3V3XA 1OQYA 1WWTA 3WCQA 3HHMA 2KDEB 1E5WA 2JYTA 3I5JC 4ARCA 4ANWA 1XD3B 1WXMA 2WNMA 2QJLA 3PREA 1XO3A 1PGBA 2KC1A 3Q8AA 2GI9A 3I9V1 3OG5A 4WJPA 5KHQA 4EFOA 2JYEA 3GP7A 4HWIB 1FNUA 2G4DB 3BVZA 2MQJA 4HRSA 2VRRB 3BVGA 3AMZA 1P7FA 4P1CC 2A4ZA 1E9MA 4II2B 3NJTA 2BQQA 5JXVA 1UH6A 2X8XX 2IO1B 5H92C 2INDC 3AE3B 1SE9A 2PIAA 4BAXA 1V49A 2DBYA 3TEYA 2KMMA 3QCAA 4DWFA 3N32A 3C0RB 5C3JB 2FBWB 4HLEA 2V3NA 3A9JA 3HM3A 1UNSA 5EE9A 4RF0A 1ROEA 3PO0A 4IWPA 3P4RB 3VRAB 2HJ8A 4HPLB 3W9CB 2RGFA 4NAWA 2ZCBA 3V6EB 3RI7C 2K22A 3MHZA 1L0VB 1V8CA 2JRIB 1TS2A 3U30A 1I4PA 4FJZA 1SB3C 1N62A 5C1ZA 2K6DB 3KVFB 5IAAC 3R2IA 4W9HA 3URYA 3SU8X 2WDVB 3U52E 5AEKB 4II3B 3U4EG 4O1NA 4GN1A 3GB1A 2N9XA 1N61A 1WE7A 2KZRA 2N9EB 2ZJDA 5G5GA 1B1ZA 5I4DA 1WJUA 1AWDA 2IGDA 2LEKA 1M94A 2BTEA 1H8CA 1I4QA 3QIJA 3P63A 4NAWB 2KFJA 4H2AA 1T6BX 3M95A 3WA0A 2BYTA 2K5PA 2M4NA 1FXIA 2LVPA 3NRZA 2DNFA 4E3CA 1V97A 3RPFC 1RLFA 2PKOA 3BINA 3Q69A 4C7YA 3M62B 1L0XB 3Q8CA 5MPOA 2YEPF 4AP4C 2CS4A 1D3ZA 3QA8A 3WAPA 1ZE3D 4TUUA 5DPTA 3SR6A 4LNKA 3TCAA 4LJOB 2DWQA 2MBEA 1NENB 1N60A 1RM6C 2JVCA 1YJJA 2E6XA 4B95A 2BYEA 2FIDA 4LNOA 2KDBA 3KWLA 1E0ZA 4NAMA 3FAHA 1GOZA 1NBFC 5BYSA 2C7MB 2DZMA 1QQRA 3R2TA 2IDYA 5LNK1 1FO4A 2FIFA 1FNVA 1UF0A 1N5WA 4KZ0A 4ICVA 5AUIA 4K7UA 4MSQB 2WXHA 1B9RA 3ZVVA 5L83A 3H9DA 2L0FA 2XEWA 2MBQA 2MWSB 2OHFA 2KD0A 2V3PA 2KJHB 3L13A 3JSVA 4HPPA 5JH5C 3U8ZA 5D2MB 3P42A 4MACA 5E6NA 2H88B 4DDGD 2KDMA 2HDEA 2LMCA 3I57A 4WWPA 4URKA 4UDUC 4TSSA 3ZDTA 2LASA 5DCNA 4NQLB 1ESFA 3FKYA 1GG3A 2IJ0A 3HM6X 2O6VA 3PLVA 3R8BA 1QLBB 4N58A 5AUKA 2KYWA 4S0RA 4YTMB 5LLIA 2FCNA 1OGWA 4M02A 3N3KB 2PE6B 3SD5A 4ZOHC 2RDBC 1MG8A 1MHXA 4I6LB 3VTUA 3ZUNA 5C23A 4GOCA 1WRIA 3ECIA 5LXHA 5BMHA 3IXSA 1FXTB 2RSUA 2MSED 4W9FA 2ZEQA 1N6ZA 2RPQA 4W9LA 3BVMA 5FK9C 2N9PC 1TS4A 1XXGA 2EMTA 3VRBB 1WZ3A 2AQ2B 2O6VB 4AOFA 4HVBA 4MEMA 4HCPB 2FCQA 1EWCA 2WXRA 1WYGA 3DHGC 4IM0A 3P4PB 2FUHB 3VQIA 3W2DA 1L2NA 2N0SB 3C19A 4IM3A 1K8RB 4NJ6A 5J17A 2MJEA 1N5XA 2G3QB 1WI0A 2E3TA 5GXGB 3KQ4A 1Q5WB 1SGHA 3ZW3A 2VH1A 4W9IA 5BYQA 1NEKB 3LJ3A 2MW5A 1WY8A 2BVCA 2RD0A 1OFFA 5HG2A 2FCSA 2RPVA 1E7UA 2MX2A 3ABVB 2K1FA 4YXDB 4A9AA 4KSKC 3V62A 5LXIB 4MDKE 1ZUD2 2WDQB 2J7QB 2DAFA 2RDGA 1Y8RC 1JWBD 3TUOA 4KKIA 4ZRKA 1YQBA 2WXQA 3H7PA 3LB8C 4ARIA 3PSEB 1WIAA 1SSNA 4HK2A 2BWES 4A20A 4MM3A 1P9DU 1TS3A 2BGFA 3S2AA 3AXCA 3JYUA 4WIPA 1T3QA 3A1QA 4HROA 2BYFA 4JPSA 5EE0A 3UGBB 3ZJUA 3P4QB 1LXDA 3EUB2 3UQBA 2LJ5A 2W54A 4ZHPA 2WX1A 4EZKA 4WJOA 4N6EB 3AE1B 2LXCA 2QILA 1VD2A 2X38A 2GLSA 2J53A 3TIXA 5DPRA 2K8BA 4RF1A 1E10A 2L7RA 3H7PB 1SF0A 1F2RC 1KLVA 1TZOA 4LNFA 2NTSA 2XBBC 2NVUI 4N59A 5HKHA 4MM3B 2KVRA 4OW0A 4HJGE 3D32A 5IOIA 4HJKA 1SJHD 3A1QB 2KMAA 2JSVX 3VXWA 3VTWA 2WXGA 1WXVA 2NPTB 1QOFA 4BOSC 2MP2A 2ZNVB 4DXFA 2N7DA 1TT5B 2RDHA 4WWMA 1KM7A 2LJIA 4QAYA 2D07B 5D6JB 3CIRB 3DDCB 1BMLC 3BY4B 1UWMA 2AL3A 2GBMA 1DYQA 2DZJA 1KF6B 4IKGA 4TQ0A 4L23A 2FCMA 4C4VA 2GMIC 1ZPSA 3MHSD 1RAXA 4WWNA 2JY6A 1WYWB 4G50A 2ZZPB 2IGHA 3MC8A 1TJEA 3WAMA 1I7HA 3VAWA 1GAQB 4ZRQA 3B0AA 2MA9B 2B76B 2KT7A 2INPE 1J7CA 2TSSA 3KWVA 3Q8BA 4MH8A 2L0TA 5IA7A 2MH7A 2MBOA 1A70A 4PT5A 2JU6X 1WXSA 4MGZE 3KYDD 5CHVC 1X1MA 4EUTA 5CHWA 4YT0B 3LYYA 4C4VB 3ZQ4A 3Q3NC 1HTQA 3AB5A 1P1AA 4FA6A 3N1YC 1WR1A 3IVFA 4K3CA 1E90A 4RM8A 1T0QC 2BS3B 3AEGB 3ZNGC 3CWIA 3VUYA 3B2GA 4XYCA 1PGAA 2ZVNA 1BUIC 1J7AA 2IO0B 2GBRA 4MJSA 1UGJA 2VZKD 3WIMA 4RGTA 3A9KB 3CF6E 4XC2A 2AQ1B 4K81A 3BWUD 1YIWA 2W3SA 4IWOA 1MJDA 2K8CA 3W1SA 1LM8B 3VH3B 2KJRA 1XT9B 4B0MA 4JWUC 1WR6E 1WMHB 4F8CB 1YX5B 4HXDA 4ANUA 1OEYA 3RT3B 2WXJA 2LGIA 4JGHB 3SHQA 4GSWA 4BKSD 3UF8A 1EF5A 2LUMA 1HA5A 4REZA 4OZCA 1C1YB 3HIZA 4ASWC 3VUXA 2MJ3A 1K50A 1YN4A 2XK5A 2K9XA 3IBEA 4HCNB 1VR9A 3Q3OC 1K52A 4TQ1A 3OLMD 4MJSB 2NMQA 4ZYNA 2WWZA 2J0KA 1HEZE 5EE3A 1UELA 1A5RA 3K9OB 2D11A 1CMXB 2LRWA 1JQ4A 2AL6A 3JVZX 3GE3C 1YD8U 4AQ7A 2V0GA 1YJ1A 3RNAC 3NHEB 3PTFC 1VZ8A 2Y5CA 1GB1A 2CU3A 1ISNA 3EFUA 3R7QA 2BT6A 2M56B 2OOBB 3MC0B 3PRMB 2GB1A 2KACA 4LNNA 4DHZE 3ZJTA 2INNE 5D94A 2NBUA 2AEHA 1KH0A 3DVGY 3I3TB 3QC8B 1NI2A 4K1RB 4M01A 3AM9A 2N7JA 2CU1A 4BKGA 4WURA 3H6NA 2XK5B 1V5OA 2KFKA 1KOTA 4GDLB 2K25A 3OWEB 1KTKA 2M19A 4OZAA 2W9NA 2ZCCA 3RNFC 4BOZB 4ZHOA 4G11A 1C4PA 2BB5A 3VHTC 4YWGG 2D3GA 1JWAD 2WU5B 3RCZA 4EZJA 2BPSA 4WJNA 1CQVA 1J8CA 2KLCA 3P1MA 1D6EC 2NCNA 2WDTB 2WXFA 4KGSA 4GMVA 3DBSA 3NVWA 1L6VA 1YNTE 2KWVB 2CR5A 4IM2A 1VJKA 2KANA 5T8IA 4A3PA 2KFKB 4WJQA 4RGMA 1DOYA 2KJ6A 3DOWA 4YSZB 4FBJB 2KAJA 1YN3A 3GOEA 3Q14C 1E7PB 2UU7A 1ZW7A 3VUWA 3ZTCA 1F0ZA 1YN5A 2LRUA 4RMAA 4RCOA 4DHJB 3DHIC 4LJPB 2N7EA 2IO2B 4JL9A 4M8MA 4P6VF 2CHXA 2QHOA 3Q8FA 2KNBA 2L05A 4ACFA 4FULA 5JHAA 2INCC 3L08A 3PS6A 1WGKA 3TEXA 1MHHE 2C7NB 3WAOA 1I4XA 1NVID 1P0RA 3DWGC 1GC7A 3RZFA 4HPMB 4GDKA 3NOBA 1AW7A 4TMAB 3PHWB 5D3IB 2H89B 4PS3A 4EE2A 4MH0E 4BVUC 1AYFA 2LUEA 3ZRFA 2AYOB 2ICIA 1JRUA 1F2RI 1BXTA 3NUHB 1I42A 3HRDD 3AE8B 3ZRCA 3RYTA 1DOXA 5EE1A 2BF8B 3AE5B 2AQ3B 4NY0A 3ML8A 2J0JA 4KGTA 4PYZA 2KHWB 3AE4B 2IYDB 4W9JA 2R61A 3PGEA 4LDTB 2NTTA 2LI5A 4C00A 2HD5B 2WXKA 3T3NA 4HKQA 1SE4A 1WZ0A 4WAAA 3DVGX 2GBKA 3ZKJC 3C8YA 3KUZA 2R2QA 2IGGA 3RN9C 1V1PA 2WXNA 2ZNVC 1D5XC 4GDKB 1JCKB 2V4IB 2Q5WD 3QJZA 2Y3AA 2QC8A 1F52A 1WXQA 4LNIA 2EKIA 3ZYYX 1NI3A 5J18A 3KLSX 1WRDB 3EFCA 2IY0B 4ZYSA 2Z0DB 2DZIA 1QT9A 4F7ZA 2L32A 3NG0A 3RNBC 5EDSA 5CHFA 1EM7A 2OJRA 2DENB 4B9KA 1RWSA 3MJWA 3AU4A 1KLUD 1VZ6A 2DYMA 4JIOU 2CHZA 4EOYA 2FE8A 5D3DA 3IHPC 4WH4A 2BKFA 4MT5A 1DOIA 1V1PB 2IZVB
chains in the Genus database with same CATH topology
2N1VA 1KLVA 1NDDA 4NNJB 4ANXA 5CTRC 2IBIB 3OJ3A 2XBBC 2NVUI 3N30A 4FJYA 5HKHA 1OEYJ 3A9JB 1IP9A 2KVRA 1OTRB 2JZZA 2KX0A 4KV2A 4J6IA 3RD2A 4BFRA 2WX0A 3NZSA 1GUAB 3ZNZB 3D32A 2LGYA 5J2RA 4HJKA 4AJWA 2LXAA 3CSFA 3ZTDA 1E7VA 4IWQA 3A1QB 4X57B 2KMAA 1P3QU 3ALBA 3ZNID 3VXWA 3ZIMA 1LFDA 3VTWA 2KTFA 3DCGA 1WXVA 2NPTB 4CYEA 3OJ4B 4BOSC 1WGDA 1V6EA 2DX5B 2MP2A 2ZNVB 1UGMA 4IC7B 2KX3A 2LWPA 2KOXA 2KXJA 2N7DA 1Z2MA 2GOWA 2Y5BB 3APDA 3OAWA 3R3MA 4P7IA 1UBQA 3CSTA 4G3XB 2G45B 1KM7A 1R4MI 2D07B 1WJNA 4GIVA 5D6JB 1U4AA 3DDCB 3VVWB 2ZPYA 3BY4B 3KUCB 4YL8A 2AL3A 2GBMA 3A33B 1R4NI 2DZJA 1OQYA 3ZDMC 3QK0A 4TQ0A 2L76A 3EECA 1ZKHA 2FCMA 3L10B 3HHMA 2KDEB 1WX7A 1E5WA 2GMIC 4HDOA 4ANWA 4N9F4 5JZEB 3A4SC 1XD3B 4KVGB 1WXMA 3V60A 3PREA 3MHSD 2KC1A 1IYFA 1RAXA 4WWNA 2KDFB 2JY6A 1WYWB 4G50A 2ZZPB 4JQWC 2FAZA 3WANA 4WJPA 5KHQA 2J0MA 4W9KA 1WFYA 4XZ4A 4RM9A 2UWQA 4EFOA 2M17A 3QQ8B 3QARA 1YX6B 4NQKE 3JW0X 4HWIB 3WAMA 2G4DB 2NBWB 2MQJA 3VAWA 2VRRB 2A4ZA 3B0AA 1T0YA 2PE9A 4II2B 2MA9B 3R66C 1UH6A 2IO1B 1V9JA 1V5TA 1SE9A 4PS7A 1V49A 3TJPA 2JWZA 3QCAA 4E74A 2L0TA 4DWFA 5IA7A 3N32A 3C0RB 4XX5A 5FR6A 2MBOA 4MGIE 5AZGA 4MGZE 1WXSA 4CO7A 4HLEA 3KYDD 3A9JA 4IW0A 5CHVC 1X1MA 4EUTA 2UYZB 5CHWA 2JZ3B 1TGZB 3HM3A 2RR9A 2HTHA 4IWPA 1WGYA 2HJ8A 4HPLB 2FNJB 3LDZE 2HE7A 3L0WB 5CX3A 2RGFA 2V1YA 4NAWA 2LD9A 2LZ6A 1P1AA 2ZCBA 2NPTA 3V6EB 3NS8A 4FA6A 1WR1A 3PV1A 3IVFA 2C9WB 1E90A 2JRIB 4HDQA 3U30A 4FJZA 3B08A 2C7HA 4RM8A 3RULA 3WALA 5C1ZA 2K6DB 3W1SC 2K6QA 3KVFB 5IAAC 3ZNGC 4W9HA 4MGKE 3VUYA 4FJVB 2JT4B 1KJTA 3SU8X 5AEKB 3V6CB 4II3B 2ZVNA 3M3JA 2IO0B 2GBRA 4GN1A 2N9XA 4MJSA 1L7YA 5G55A 4KIKA 5DPSA 2CHWA 1UD7A 2IY1B 3WIMA 4DK5A 3PHXB 3A4RA 1WE7A 1WXAA 2KZRA 2O2VA 3A9KB 3CF6E 2A5UA 2N9EB 2ZJDA 3DBLI 3HK0A 4G0NB 2I1KA 4XC2A 1I35A 4K81A 4MELA 1YIWA 4IWOA 3W1SA 4A3OA 2K8CA 1WJUA 3UQAA 1LM8B 3VH3B 1M94A 5DPWA 1H8CA 4GXBA 3QIJA 4DHJD 2KJRA 3JSVB 1XT9B 3L54A 1EO6A 1VCBA 4MSMB 1TTNA 1V86A 2PPHA 1WR6E 1WMHB 4F8CB 3UINB 1YX5B 2KO3A 4HXDA 1TBEA 2I1JA 4NAWB 4BBNC 1OEYA 2KFJA 3RT3B 4ANUA 4GGQA 4OVVA 2K39A 4JGHB 3SHQA 3TMPB 4BKTA 2DYOA 4LCDE 4JLCA 3M95A 3WA0A 2MRPA 4GSWA 2M4NA 4BKSD 4ICUA 1EF5A 3UF8A 2MBBB 2L00B 2KQ7A 2N1WA 2O6VD 3K9PB 2LVPA 1C1YB 3HIZA 2MCNB 2LVQA 4ASWC 4E3CA 3VUXA 1RLFA 2WYQA 3BINA 2KWCA 3SDLC 2XK5A 4E71A 2V3SA 3IBEA 4HCNB 4GB9A 3M62B 4TQ1A 2CKHB 3OLMD 4MJSB 2PJHA 4AP4C 3W1YA 4ZYNA 3VTVA 2CS4A 2WWZA 1WE6A 2J0KA 2KDIA 4KIKB 3UIPB 1D3ZA 3QA8A 1UELA 3WAPA 4TUUA 5DPTA 3PRPB 1A5RA 2O2VB 2R2OA 3K9OB 4DDID 2D11A 2LGXA 3TCAA 1CMXB 2LRWA 4I6NB 4LJOB 3VFKA 1E8YA 3M63B 2AL6A 3JVZX 2G4SA 1YD8U 1XQQA 2MBEA 2JVCA 4B95A 2BYEA 2FIDA 1YJ1A 2B3AA 3P2BA 3NHEB 2KDBA 3PTFC 4FHJA 4F1SA 1ISNA 2LGDA 4PS8A 3EFUA 3R7QA 4W9GA 2OOBB 1NBFC 3PRMB 2C7MB 3Q3JA 2L8JA 3VDZA 3EHVA 2DZMA 1S3SG 4EEWA 2FIFA 4DHZE 3V61A 1BT0A 5D94A 2NBUA 4DXAB 4KSLC 4EZLA 2AEHA 3PLUA 2JXXA 3DVGY 4ICVA 4KZ0A 1P98A 3DPDA 3I3TB 2KTRA 3QC8B 1NI2A 4K1RB 4K7UA 4MSQB 4WQOB 4LDTD 1WH3A 1V80A 2CU1A 3PZDA 4BKGA 3ZVVA 1QZEA 5L83A 3H9DA 4TV3A 3A9KA 3H6NA 2XK5B 1V5OA 2L0FA 4K7WA 2XEWA 2MBQA 2KFKA 3O65B 1KOTA 2MWSB 2M0XA 4MGYE 1WGGA 1EF1A 4GDLB 2KD0A 2K25A 2C60A 1GJZA 2KJHB 3L13A 2W9NA 3Q3FA 1E8WA 2V4LA 2ZCCA 3JSVA 3QX1A 4BOZB 4G11A 1G6JA 3PT2B 5JH5C 3U8ZA 3VHTC 4K7SA 1WMHA 5D2MB 2D3GA 2IO3B 1TZ1A 5E6NA 4M8NA 3RCZA 1WX8A 4EZJA 2BPSA 4DDGD 4WJNA 3X23A 4GU2A 1J8CA 3IG3A 2KLCA 3APFA 4WWPA 2NCNA 3L16A 2WDTB 4URKA 1S1QB 4KZCA 4GMVA 3IFWB 3DBSA 3T9LA 3ZDTA 2LASA 5DCNA 4NQLB 2EMSA 4BKSA 2KKCA 2KWVB 1GG3A 2CR5A 4IM2A 3HM6X 5L95C 2KANA 2M1MA 2O6VA 3RUIB 2KTRB 1Z5SB 3PLVA 2BWFA 4W9CA 3ZO5B 4ZDVA 3CMMB 2GBNA 3NZUA 5GMVA 5TR5A 1ZGUB 4A3PA 2C5LC 2Z59B 3KW5B 3PPAA 5LLIA 2FCNA 1OGWA 1UBIA 3KYCD 4W9EA 3KUDB 3N3KB 1J0GA 4TKNA 2KFKB 2PE6B 2KWUB 4I6PA 4WJQA 2JRHA 3DBHI 5BO4B 1C3TA 2KJ6A 3DOWA 3SD5A 4FBJB 4I6LB 1MG8A 5G2NA 3TL5A 3GOEA 1WGHA 3MTNB 3VTUA 3GZNI 3ZUNA 5JHBA 2NS5A 3B1LX 2DHZA 4WWOA 1ZW7A 3VUWA 3ZTCA 5C23A 2L3ZA 4GOCA 3ECIA 2LRUA 4RMAA 5LXHA 4OVUA 4DHJB 4LJPB 1WM3A 2DYBA 2GBJA 2IO2B 2N7EA 4JL9A 1J19A 1FXTB 2RSUA 2NR2A 4FN2A 4M8MA 4CHKA 2ZVOA 2MSED 2ZPNA 4W9FA 1WM2A 2ZEQA 5D7GA 2CHXA 2QHOA 3PRZA 2RPQA 4W9LA 3ENEA 2KNBA 2M8SA 2L05A 1V81A 2ASQA 2N9PC 1IPGA 4FULA 4M0WB 4FLHA 5E6OA 2KK8A 5JHAA 2EMTA 1WZ3A 2O6VB 3L08A 4GDLA 1Q1OA 5AZHA 4AOFA 3PS6A 4HVBA 3X0WA 4MEMA 5E6PA 2C7NB 3WAOA 2FCQA 4HCPB 1E8XA 2KQSA 2K8HA 4FHKA 2Z0EB 4IM0A 1P0RA 4ANVA 4KDIC 3RZFA 1GC7A 1WJ4A 2FUHB 2BKRB 3TBLD 3VQIA 1L2NA 4PYUA 3L17A 4HPMB 4GDKA 3ML9A 3H1UA 3NOBA 4IM3A 1K8RB 3PHWB 4NJ6A 5J17A 5KHOA 4AJYB 4PS3A 2KLGA 4MH0E 2G3QB 4BVUC 1WI0A 2LUEA 2D2QA 3ZRFA 2AYOB 4IG7B 4FADA 2YVCA 1JRUA 1Q0WB 1Q5WB 3ONSA 1I42A 1SGHA 1F9JA 1H4RA 3AU5A 3ZRCA 4W9IA 3RYTA 3ZW3A 2EKEC 2JPHA 3LJ3A 2MW5A 2BF8B 2D10A 3EC8A 1EUVB 4NY0A 3ML8A 1WY8A 2J0JA 2RD0A 2FCSA 3U7DA 1E7UA 4PYZA 2MX2A 2DZKA 2K1FA 2KC2A 2KHWB 3ZNHB 2IYDB 4W9JA 4AUQC 3PGEA 2KMCA 4KSKC 4LDTB 4NJ7A 3V62A 5LXIB 2LI5A 1RRBA 4MDKE 2HD5B 2MP2B 2J7QB 2DAFA 1GC6A 1Y8RC 1HE8A 1WZ0A 3DVGX 2GBKA 3PVLA 4WAAA 3ZKJC 3KUZA 2R2QA 4ZRKA 2AWTA 1YQBA 3H7PA 4DBGA 2N4FA 2JF5A 2ZNVC 4IUMB 4GDKB 3PSEB 4DHZB 1WIAA 4HK2A 2BYVE 2BWES 4A20A 4MM3A 2KN5A 1P9DU 2MLBA 2BGFA 3DVNU 4B6WA 2PEAA 3QJZA 3R7RA 3S2AA 1AARA 3AXCA 2MBHA 3JYUA 1UZXB 1LQBA 2DAJA 3A1QA 5J18A 1WRDB 2BYFA 2IY0B 3ZLZA 3UGBB 2LVOA 3AI5A 1GNUA 1PQSA 2Z0DB 2DZIA 4ZRIA 1LXDA 4F7ZA 5AZFA 1WJ6A 4ZRJA 3APCA 3UQBA 2LJ5A 5EDSA 5CHFA 3RZWC 2WX1A 4EZKA 3UIOB 4WJOA 2OJRA 2DENB 4B9KA 4KDLB 3QWZB 2LXCA 4AWJA 3AULA 3MJWA 4EKUA 3QHTA 1VD2A 3AU4A 2JUOA 3H7SA 3DVNV 3DQVA 1WF9A 2DYMA 4JIOU 1E8ZA 2CHZA 3VH4B 3DBRI 4EOYA 1V2YA 3IHPC 3TIXA 4NPNA 5DPRA 2BKFA 2K8BA 4BBNF 2YLMA 3NY5A 3QAQA 1WX9A 3KH0A 4W9DA 1RFAA 2L7RA 3T8MA 3H7PB 1WGRA 1SIFA 2NBVB 2IZVB 2REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1V A;  1KLV A;  1NDD A;  4NNJ B;  4ANX A;  5CTR C;  2IBI B;  3OJ3 A;  2XBB C;  2NVU I;  3N30 A;  4FJY A;  5HKH A;  1OEY J;  3A9J B;  1IP9 A;  2KVR A;  1OTR B;  2JZZ A;  2KX0 A;  4KV2 A;  4J6I A;  3RD2 A;  4BFR A;  2WX0 A;  3NZS A;  1GUA B;  3ZNZ B;  3D32 A;  2LGY A;  5J2R A;  4HJK A;  4AJW A;  2LXA A;  3CSF A;  3ZTD A;  1E7V A;  4IWQ A;  3A1Q B;  4X57 B;  2KMA A;  1P3Q U;  3ALB A;  3ZNI D;  3VXW A;  3ZIM A;  1LFD A;  3VTW A;  2KTF A;  3DCG A;  1WXV A;  2NPT B;  4CYE A;  3OJ4 B;  4BOS C;  1WGD A;  1V6E A;  2DX5 B;  2MP2 A;  2ZNV B;  1UGM A;  4IC7 B;  2KX3 A;  2LWP A;  2KOX A;  2KXJ A;  2N7D A;  1Z2M A;  2GOW A;  2Y5B B;  3APD A;  3OAW A;  3R3M A;  4P7I A;  1UBQ A;  3CST A;  4G3X B;  2G45 B;  1KM7 A;  1R4M I;  2D07 B;  1WJN A;  4GIV A;  5D6J B;  1U4A A;  3DDC B;  3VVW B;  2ZPY A;  3BY4 B;  3KUC B;  4YL8 A;  2AL3 A;  2GBM A;  3A33 B;  1R4N I;  2DZJ A;  1OQY A;  3ZDM C;  3QK0 A;  4TQ0 A;  2L76 A;  3EEC A;  1ZKH A;  2FCM A;  3L10 B;  3HHM A;  2KDE B;  1WX7 A;  1E5W A;  2GMI C;  4HDO A;  4ANW A;  4N9F 4;  5JZE B;  3A4S C;  1XD3 B;  4KVG B;  1WXM A;  3V60 A;  3PRE A;  3MHS D;  2KC1 A;  1IYF A;  1RAX A;  4WWN A;  2KDF B;  2JY6 A;  1WYW B;  4G50 A;  2ZZP B;  4JQW C;  2FAZ A;  3WAN A;  4WJP A;  5KHQ A;  2J0M A;  4W9K A;  1WFY A;  4XZ4 A;  4RM9 A;  2UWQ A;  4EFO A;  2M17 A;  3QQ8 B;  3QAR A;  1YX6 B;  4NQK E;  3JW0 X;  4HWI B;  3WAM A;  2G4D B;  2NBW B;  2MQJ A;  3VAW A;  2VRR B;  2A4Z A;  3B0A A;  1T0Y A;  2PE9 A;  4II2 B;  2MA9 B;  3R66 C;  1UH6 A;  2IO1 B;  1V9J A;  1V5T A;  1SE9 A;  4PS7 A;  1V49 A;  3TJP A;  2JWZ A;  3QCA A;  4E74 A;  2L0T A;  4DWF A;  5IA7 A;  3N32 A;  3C0R B;  4XX5 A;  5FR6 A;  2MBO A;  4MGI E;  5AZG A;  4MGZ E;  1WXS A;  4CO7 A;  4HLE A;  3KYD D;  3A9J A;  4IW0 A;  5CHV C;  1X1M A;  4EUT A;  2UYZ B;  5CHW A;  2JZ3 B;  1TGZ B;  3HM3 A;  2RR9 A;  2HTH A;  4IWP A;  1WGY A;  2HJ8 A;  4HPL B;  2FNJ B;  3LDZ E;  2HE7 A;  3L0W B;  5CX3 A;  2RGF A;  2V1Y A;  4NAW A;  2LD9 A;  2LZ6 A;  1P1A A;  2ZCB A;  2NPT A;  3V6E B;  3NS8 A;  4FA6 A;  1WR1 A;  3PV1 A;  3IVF A;  2C9W B;  1E90 A;  2JRI B;  4HDQ A;  3U30 A;  4FJZ A;  3B08 A;  2C7H A;  4RM8 A;  3RUL A;  3WAL A;  5C1Z A;  2K6D B;  3W1S C;  2K6Q A;  3KVF B;  5IAA C;  3ZNG C;  4W9H A;  4MGK E;  3VUY A;  4FJV B;  2JT4 B;  1KJT A;  3SU8 X;  5AEK B;  3V6C B;  4II3 B;  2ZVN A;  3M3J A;  2IO0 B;  2GBR A;  4GN1 A;  2N9X A;  4MJS A;  1L7Y A;  5G55 A;  4KIK A;  5DPS A;  2CHW A;  1UD7 A;  2IY1 B;  3WIM A;  4DK5 A;  3PHX B;  3A4R A;  1WE7 A;  1WXA A;  2KZR A;  2O2V A;  3A9K B;  3CF6 E;  2A5U A;  2N9E B;  2ZJD A;  3DBL I;  3HK0 A;  4G0N B;  2I1K A;  4XC2 A;  1I35 A;  4K81 A;  4MEL A;  1YIW A;  4IWO A;  3W1S A;  4A3O A;  2K8C A;  1WJU A;  3UQA A;  1LM8 B;  3VH3 B;  1M94 A;  5DPW A;  1H8C A;  4GXB A;  3QIJ A;  4DHJ D;  2KJR A;  3JSV B;  1XT9 B;  3L54 A;  1EO6 A;  1VCB A;  4MSM B;  1TTN A;  1V86 A;  2PPH A;  1WR6 E;  1WMH B;  4F8C B;  3UIN B;  1YX5 B;  2KO3 A;  4HXD A;  1TBE A;  2I1J A;  4NAW B;  4BBN C;  1OEY A;  2KFJ A;  3RT3 B;  4ANU A;  4GGQ A;  4OVV A;  2K39 A;  4JGH B;  3SHQ A;  3TMP B;  4BKT A;  2DYO A;  4LCD E;  4JLC A;  3M95 A;  3WA0 A;  2MRP A;  4GSW A;  2M4N A;  4BKS D;  4ICU A;  1EF5 A;  3UF8 A;  2MBB B;  2L00 B;  2KQ7 A;  2N1W A;  2O6V D;  3K9P B;  2LVP A;  1C1Y B;  3HIZ A;  2MCN B;  2LVQ A;  4ASW C;  4E3C A;  3VUX A;  1RLF A;  2WYQ A;  3BIN A;  2KWC A;  3SDL C;  2XK5 A;  4E71 A;  2V3S A;  3IBE A;  4HCN B;  4GB9 A;  3M62 B;  4TQ1 A;  2CKH B;  3OLM D;  4MJS B;  2PJH A;  4AP4 C;  3W1Y A;  4ZYN A;  3VTV A;  2CS4 A;  2WWZ A;  1WE6 A;  2J0K A;  2KDI A;  4KIK B;  3UIP B;  1D3Z A;  3QA8 A;  1UEL A;  3WAP A;  4TUU A;  5DPT A;  3PRP B;  1A5R A;  2O2V B;  2R2O A;  3K9O B;  4DDI D;  2D11 A;  2LGX A;  3TCA A;  1CMX B;  2LRW A;  4I6N B;  4LJO B;  3VFK A;  1E8Y A;  3M63 B;  2AL6 A;  3JVZ X;  2G4S A;  1YD8 U;  1XQQ A;  2MBE A;  2JVC A;  4B95 A;  2BYE A;  2FID A;  1YJ1 A;  2B3A A;  3P2B A;  3NHE B;  2KDB A;  3PTF C;  4FHJ A;  4F1S A;  1ISN A;  2LGD A;  4PS8 A;  3EFU A;  3R7Q A;  4W9G A;  2OOB B;  1NBF C;  3PRM B;  2C7M B;  3Q3J A;  2L8J A;  3VDZ A;  3EHV A;  2DZM A;  1S3S G;  4EEW A;  2FIF A;  4DHZ E;  3V61 A;  1BT0 A;  5D94 A;  2NBU A;  4DXA B;  4KSL C;  4EZL A;  2AEH A;  3PLU A;  2JXX A;  3DVG Y;  4ICV A;  4KZ0 A;  1P98 A;  3DPD A;  3I3T B;  2KTR A;  3QC8 B;  1NI2 A;  4K1R B;  4K7U A;  4MSQ B;  4WQO B;  4LDT D;  1WH3 A;  1V80 A;  2CU1 A;  3PZD A;  4BKG A;  3ZVV A;  1QZE A;  5L83 A;  3H9D A;  4TV3 A;  3A9K A;  3H6N A;  2XK5 B;  1V5O A;  2L0F A;  4K7W A;  2XEW A;  2MBQ A;  2KFK A;  3O65 B;  1KOT A;  2MWS B;  2M0X A;  4MGY E;  1WGG A;  1EF1 A;  4GDL B;  2KD0 A;  2K25 A;  2C60 A;  1GJZ A;  2KJH B;  3L13 A;  2W9N A;  3Q3F A;  1E8W A;  2V4L A;  2ZCC A;  3JSV A;  3QX1 A;  4BOZ B;  4G11 A;  1G6J A;  3PT2 B;  5JH5 C;  3U8Z A;  3VHT C;  4K7S A;  1WMH A;  5D2M B;  2D3G A;  2IO3 B;  1TZ1 A;  5E6N A;  4M8N A;  3RCZ A;  1WX8 A;  4EZJ A;  2BPS A;  4DDG D;  4WJN A;  3X23 A;  4GU2 A;  1J8C A;  3IG3 A;  2KLC A;  3APF A;  4WWP A;  2NCN A;  3L16 A;  2WDT B;  4URK A;  1S1Q B;  4KZC A;  4GMV A;  3IFW B;  3DBS A;  3T9L A;  3ZDT A;  2LAS A;  5DCN A;  4NQL B;  2EMS A;  4BKS A;  2KKC A;  2KWV B;  1GG3 A;  2CR5 A;  4IM2 A;  3HM6 X;  5L95 C;  2KAN A;  2M1M A;  2O6V A;  3RUI B;  2KTR B;  1Z5S B;  3PLV A;  2BWF A;  4W9C A;  3ZO5 B;  4ZDV A;  3CMM B;  2GBN A;  3NZU A;  5GMV A;  5TR5 A;  1ZGU B;  4A3P A;  2C5L C;  2Z59 B;  3KW5 B;  3PPA A;  5LLI A;  2FCN A;  1OGW A;  1UBI A;  3KYC D;  4W9E A;  3KUD B;  3N3K B;  1J0G A;  4TKN A;  2KFK B;  2PE6 B;  2KWU B;  4I6P A;  4WJQ A;  2JRH A;  3DBH I;  5BO4 B;  1C3T A;  2KJ6 A;  3DOW A;  3SD5 A;  4FBJ B;  4I6L B;  1MG8 A;  5G2N A;  3TL5 A;  3GOE A;  1WGH A;  3MTN B;  3VTU A;  3GZN I;  3ZUN A;  5JHB A;  2NS5 A;  3B1L X;  2DHZ A;  4WWO A;  1ZW7 A;  3VUW A;  3ZTC A;  5C23 A;  2L3Z A;  4GOC A;  3ECI A;  2LRU A;  4RMA A;  5LXH A;  4OVU A;  4DHJ B;  4LJP B;  1WM3 A;  2DYB A;  2GBJ A;  2IO2 B;  2N7E A;  4JL9 A;  1J19 A;  1FXT B;  2RSU A;  2NR2 A;  4FN2 A;  4M8M A;  4CHK A;  2ZVO A;  2MSE D;  2ZPN A;  4W9F A;  1WM2 A;  2ZEQ A;  5D7G A;  2CHX A;  2QHO A;  3PRZ A;  2RPQ A;  4W9L A;  3ENE A;  2KNB A;  2M8S A;  2L05 A;  1V81 A;  2ASQ A;  2N9P C;  1IPG A;  4FUL A;  4M0W B;  4FLH A;  5E6O A;  2KK8 A;  5JHA A;  2EMT A;  1WZ3 A;  2O6V B;  3L08 A;  4GDL A;  1Q1O A;  5AZH A;  4AOF A;  3PS6 A;  4HVB A;  3X0W A;  4MEM A;  5E6P A;  2C7N B;  3WAO A;  2FCQ A;  4HCP B;  1E8X A;  2KQS A;  2K8H A;  4FHK A;  2Z0E B;  4IM0 A;  1P0R A;  4ANV A;  4KDI C;  3RZF A;  1GC7 A;  1WJ4 A;  2FUH B;  2BKR B;  3TBL D;  3VQI A;  1L2N A;  4PYU A;  3L17 A;  4HPM B;  4GDK A;  3ML9 A;  3H1U A;  3NOB A;  4IM3 A;  1K8R B;  3PHW B;  4NJ6 A;  5J17 A;  5KHO A;  4AJY B;  4PS3 A;  2KLG A;  4MH0 E;  2G3Q B;  4BVU C;  1WI0 A;  2LUE A;  2D2Q A;  3ZRF A;  2AYO B;  4IG7 B;  4FAD A;  2YVC A;  1JRU A;  1Q0W B;  1Q5W B;  3ONS A;  1I42 A;  1SGH A;  1F9J A;  1H4R A;  3AU5 A;  3ZRC A;  4W9I A;  3RYT A;  3ZW3 A;  2EKE C;  2JPH A;  3LJ3 A;  2MW5 A;  2BF8 B;  2D10 A;  3EC8 A;  1EUV B;  4NY0 A;  3ML8 A;  1WY8 A;  2J0J A;  2RD0 A;  2FCS A;  3U7D A;  1E7U A;  4PYZ A;  2MX2 A;  2DZK A;  2K1F A;  2KC2 A;  2KHW B;  3ZNH B;  2IYD B;  4W9J A;  4AUQ C;  3PGE A;  2KMC A;  4KSK C;  4LDT B;  4NJ7 A;  3V62 A;  5LXI B;  2LI5 A;  1RRB A;  4MDK E;  2HD5 B;  2MP2 B;  2J7Q B;  2DAF A;  1GC6 A;  1Y8R C;  1HE8 A;  1WZ0 A;  3DVG X;  2GBK A;  3PVL A;  4WAA A;  3ZKJ C;  3KUZ A;  2R2Q A;  4ZRK A;  2AWT A;  1YQB A;  3H7P A;  4DBG A;  2N4F A;  2JF5 A;  2ZNV C;  4IUM B;  4GDK B;  3PSE B;  4DHZ B;  1WIA A;  4HK2 A;  2BYV E;  2BWE S;  4A20 A;  4MM3 A;  2KN5 A;  1P9D U;  2MLB A;  2BGF A;  3DVN U;  4B6W A;  2PEA A;  3QJZ A;  3R7R A;  3S2A A;  1AAR A;  3AXC A;  2MBH A;  3JYU A;  1UZX B;  1LQB A;  2DAJ A;  3A1Q A;  5J18 A;  1WRD B;  2BYF A;  2IY0 B;  3ZLZ A;  3UGB B;  2LVO A;  3AI5 A;  1GNU A;  1PQS A;  2Z0D B;  2DZI A;  4ZRI A;  1LXD A;  4F7Z A;  5AZF A;  1WJ6 A;  4ZRJ A;  3APC A;  3UQB A;  2LJ5 A;  5EDS A;  5CHF A;  3RZW C;  2WX1 A;  4EZK A;  3UIO B;  4WJO A;  2OJR A;  2DEN B;  4B9K A;  4KDL B;  3QWZ B;  2LXC A;  4AWJ A;  3AUL A;  3MJW A;  4EKU A;  3QHT A;  1VD2 A;  3AU4 A;  2JUO A;  3H7S A;  3DVN V;  3DQV A;  1WF9 A;  2DYM A;  4JIO U;  1E8Z A;  2CHZ A;  3VH4 B;  3DBR I;  4EOY A;  1V2Y A;  3IHP C;  3TIX A;  4NPN A;  5DPR A;  2BKF A;  2K8B A;  4BBN F;  2YLM A;  3NY5 A;  3QAQ A;  1WX9 A;  3KH0 A;  4W9D A;  1RFA A;  2L7R A;  3T8M A;  3H7P B;  1WGR A;  1SIF A;  2NBV B;  2IZV B;  2REX A; 
#chains in the Genus database with same CATH topology
 2IBI B;  3N30 A;  2WP9 B;  1IP9 A;  2KX0 A;  5BMG A;  4J6I A;  3RD2 A;  3NVY A;  4BFR A;  3NZS A;  4AJW A;  3GZN B;  3ZTD A;  4X57 B;  2SEB D;  3ZIM A;  3DCG A;  1FCL A;  1MI0 A;  5C2T B;  4IC7 B;  2LWP A;  2KXJ A;  1Z2M A;  4Q2J A;  1Y56 A;  3OAW A;  1FRR A;  3HUI A;  1UBQ A;  3CST A;  2G45 B;  3AEA B;  1WJN A;  1U4A A;  3ZXR A;  2QCZ A;  3TEW A;  4YL8 A;  3J9C A;  1SBB B;  3EEC A;  1ZKH A;  3I63 C;  3L10 B;  1TS5 A;  1WX7 A;  3BK1 A;  4N9F 4;  3A4S C;  4KVG B;  3V60 A;  1IYF A;  3GE8 C;  4JQW C;  3WAN A;  4XZ4 A;  4RM9 A;  3QQ8 B;  1YX6 B;  4NQK E;  3AE2 B;  4XWW A;  2KVZ A;  2J42 A;  2WXL A;  4YTN B;  3R66 C;  1V9J A;  1TKY A;  2SAK A;  4A90 A;  2D5G A;  5FR6 A;  4MGI E;  1PUT A;  4IW0 A;  5BYR A;  1TKE A;  2JZ3 B;  1TGZ B;  1VZ7 A;  2HTH A;  1WGY A;  4YTP B;  4P1B C;  4JWS C;  3L0W B;  2L83 A;  2V1Y A;  2I2Y A;  2NPT A;  3PV1 A;  1XLO A;  1CJE A;  3L4P A;  1TYG B;  3W1S C;  1EU3 A;  1JRP A;  2J4X A;  4MGK E;  3LXF A;  1YMH E;  4L1B A;  2JT4 B;  1KJT A;  4YSY B;  1HTO A;  3V6C B;  2WXI A;  3M3J A;  4J3O D;  5H8Y E;  3IAS 1;  1HZ6 A;  4KIK A;  5DPS A;  2CHW A;  3MC9 A;  3A4R A;  1WXA A;  4G0N B;  2M0A A;  1NYQ A;  2OJW A;  2PVG C;  1PYW D;  3Q6B A;  4GXB A;  4RFB A;  3L54 A;  1V86 A;  2L1A A;  3UIN B;  2I1J A;  3PZ8 A;  1TIF A;  1RYJ A;  4OVV A;  1QIL A;  2K39 A;  3TMP B;  4BKT A;  2DYO A;  4R3D A;  4JLC A;  5HHD G;  4ICU A;  4D2K A;  1I4R A;  2O6V D;  1PGX A;  1T0R C;  3RNC C;  2KWC A;  1QOG A;  1LGR A;  4GB9 A;  3N1X C;  1ZP0 B;  3NS1 A;  4KIK B;  1WE6 A;  1L6U A;  4JE3 B;  3PRP B;  2R2O A;  4DDI D;  4I6N B;  2AX5 A;  1XQQ A;  1M4V A;  4ITK A;  4FHJ A;  5FKA C;  3Q3J A;  3VDZ A;  2L8J A;  3EHV A;  1FFU A;  3V61 A;  1BT0 A;  4DXA B;  4USA A;  4KSL C;  3DPD A;  2KTR A;  2JXT A;  4S17 A;  1WH3 A;  1V80 A;  1QZE A;  3A9K A;  3O65 B;  3MP9 A;  4MGY E;  1WGG A;  1EF1 A;  4XDC A;  1XCQ L;  1C76 A;  1K51 A;  1WMH A;  4IOI E;  2Y5P A;  4RGO S;  4M8N A;  4L2Y A;  1WX8 A;  5IP4 D;  1ZDV A;  3VR9 B;  3RNG C;  3X23 A;  4GU2 A;  3APF A;  1S1Q B;  1SE2 A;  2EMS A;  2YEP B;  4M0W A;  2KKC A;  4KKJ A;  5L95 C;  5FR3 A;  2M1M A;  2KTR B;  2BWF A;  4W9C A;  3ZO5 B;  1JWS D;  3CMM B;  2ZW0 A;  4RH6 A;  5TR5 A;  1ZGU B;  4AS1 A;  2Z59 B;  3KW5 B;  3PPA A;  4XDD A;  3KYC D;  1J0G A;  4TKN A;  2KWU B;  4I6P A;  4OZB A;  2JRH A;  5BO4 B;  3AEF B;  1C3T A;  3IT6 B;  4OHJ A;  5G2N A;  3TL5 A;  1WGH A;  3MTN B;  3SFD B;  3NVV A;  3DBR B;  5JHB A;  3B1L X;  2DHZ A;  4WWO A;  1ET9 A;  1YQ3 B;  4IDI A;  1SE3 A;  1WM3 A;  2DYB A;  2GBJ A;  4A55 A;  1LO5 D;  4FN2 A;  4CHK A;  2ZVO A;  1QOB A;  2WS3 B;  1C78 A;  3PRZ A;  1C4A A;  3ENE A;  2M8S A;  1V81 A;  2ASQ A;  2W3R A;  4M0W B;  4FLH A;  2WXM A;  3DHH C;  4GDL A;  3W5U B;  5AZH A;  3PZ7 A;  4US8 A;  5E6P A;  2PTL A;  2KQS A;  2WU2 B;  2Z0E B;  3U7Z A;  4ANV A;  1XLQ A;  1WJ4 A;  3B9J A;  4PYU A;  2HTM E;  1OQQ A;  3H1U A;  4AJY B;  2KLG A;  2WGS A;  5E6J A;  2D2Q A;  4FAD A;  2YVC A;  2CJN A;  1F9J A;  1DGJ A;  1H4R A;  1N63 A;  1GB4 A;  2EKE C;  1JRO A;  2JPH A;  1EWY C;  2QEJ C;  2IPK D;  1EUV B;  1FEH A;  1FM0 D;  2K0P A;  3ZNH B;  4NZL B;  4CQN A;  1T0S C;  2KMC A;  1SXT A;  4NJ7 A;  2LHE A;  3HVZ A;  1HQR D;  1MPE A;  1GC6 A;  1PFD A;  3PVL A;  2AWT A;  1E6E B;  2N4F A;  2PMV A;  2Z8L A;  5HI1 A;  3ZXV A;  4YSX B;  1JWM D;  2KN5 A;  2MLB A;  1STE A;  4HKZ E;  1EU4 A;  3R7R A;  2MBH A;  3TEZ A;  1UZX B;  1LQB A;  3UI3 A;  4GLS C;  2KQ4 X;  3ZLZ A;  2LVO A;  4ZRI A;  5AZF A;  3BK2 A;  1WJ6 A;  3APC A;  3RZW C;  3SFE B;  3UIO B;  3QWZ B;  1KLG D;  2JUO A;  3E56 A;  3DQV A;  1E8Z A;  3VH4 B;  3DBR I;  4NPN A;  1PDX A;  4C7Z A;  4WQM A;  4BBN F;  2YLM A;  3NY5 A;  3QAQ A;  4W9D A;  1RFA A;  1WGR A;  1SIF A;  2KWD A;  2N1W A;  3K9P B;  1NDD A;  4ANX A;  5CTR C;  4FJY A;  3DBL B;  1OEY J;  3A9J B;  2K3U A;  3O13 A;  4KV2 A;  1OTR B;  2JZZ A;  1JW9 D;  2WX0 A;  2LGY A;  1VRA B;  3AEC B;  3CSF A;  4IWQ A;  1ZDX A;  3ZNI D;  1ENF A;  2I38 A;  4CYE A;  3Q2A C;  3OJ4 B;  1WGD A;  2DX5 B;  1UGM A;  2Y5B B;  3BYY B;  3APD A;  1F77 A;  3R3M A;  1D5M C;  1JWU D;  2QSD A;  2LFI A;  2ZPY A;  3KUC B;  3ZDM C;  1ACC A;  2MEK A;  3QK0 A;  2L76 A;  2WLB A;  4HDO A;  5JZE B;  3AE7 B;  3FC4 A;  3EA6 A;  2KDF B;  2FAZ A;  1IGD A;  2J0M A;  4W9K A;  1WFY A;  2UWQ A;  1WSP A;  2M17 A;  3QAR A;  3JW0 X;  2NBW B;  2WHI A;  1JAL A;  1T0Y A;  2PE9 A;  2QIE B;  3AEE B;  1V5T A;  4PS7 A;  1SIJ A;  3TJP A;  5IKC M;  2JWZ A;  4LLG M;  4KX6 B;  4XX5 A;  1UUP A;  5AZG A;  4CO7 A;  3Q8E A;  2FUG 1;  1XLN A;  1HXY D;  2UYZ B;  2BS2 B;  2RR9 A;  5IO9 A;  2FNJ B;  4B0E A;  3LDZ E;  2HE7 A;  5CX3 A;  2LD9 A;  5BMI A;  2LZ6 A;  3NS8 A;  1R7S A;  2C9W B;  1FNW A;  1XLP A;  4HDQ A;  3B08 A;  1RFK A;  2C7H A;  1C4C A;  3RUL A;  3WAL A;  2K6Q A;  4RGN A;  1ET6 A;  2G9H D;  3ZGZ A;  4FJV B;  1IUE A;  1GPX A;  1L7Y A;  5G55 A;  1UD7 A;  2IY1 B;  4DK5 A;  5IN7 A;  1HZ5 A;  2QDF A;  3PHX B;  1KRH A;  2O2V A;  3HK0 A;  2A5U A;  2ZW1 A;  4DQO C;  3DBL I;  1I35 A;  2I1K A;  3AN1 A;  4MEL A;  1FIQ A;  2LHD A;  4A3O A;  3DBH B;  2GRI A;  3UQA A;  5DPW A;  1FFV A;  4DHJ D;  3JSV B;  1EO6 A;  1Q10 A;  1VCB A;  1L0Y B;  4MSM B;  1TTN A;  2PPH A;  3N20 C;  2KO3 A;  4E74 A;  1TBE A;  4BBN C;  1D4B A;  4GGQ A;  1MG4 A;  4LCD E;  2ONQ A;  2MRP A;  2KN4 A;  2MJD A;  1FCC C;  2MBB B;  2L00 B;  3B2F A;  3U2S C;  2KQ7 A;  2MCN B;  3BYT B;  2LVQ A;  2N9K A;  2WYQ A;  4A6Q A;  1I4G A;  2JWU A;  4KGR A;  3SDL C;  4E71 A;  2DLB A;  2V3S A;  2CKH B;  1AN8 A;  3AE9 B;  5TSS A;  2PJH A;  3W1Y A;  3VTV A;  2KDI A;  3UIP B;  2BBC A;  2O2V B;  2D3C A;  1IGC A;  2LGX A;  3VFK A;  4XWT A;  1E8Y A;  1KFY B;  3M63 B;  3N9Y C;  1FMA D;  2G4S A;  3NVZ A;  1V1O A;  4M00 A;  2B3A A;  3P2B A;  4F1S A;  4JX1 C;  3T3O A;  1YOV B;  2BS4 B;  2LGD A;  4PS8 A;  2XN9 C;  4W9G A;  1FXA A;  4A8X C;  2JX5 A;  1S3S G;  2BW2 A;  3AED B;  4EEW A;  1I4H A;  4EZL A;  1IBX A;  3PLU A;  2JXX A;  1P98 A;  4HEA 1;  4NJC A;  2D3B A;  2PW9 A;  4WQO B;  4LDT D;  3PZD A;  1ZXH A;  4TV3 A;  4K7W A;  2M0X A;  1ZOY B;  1K53 A;  2C60 A;  1GJZ A;  3Q3F A;  1E8W A;  2V4L A;  3TSS A;  2W82 A;  3QX1 A;  1CZP A;  2EEL A;  3PT2 B;  4K7S A;  2IO3 B;  1TZ1 A;  1QOA A;  2HJ1 A;  3GS2 A;  1C9F A;  3H8H A;  2LGS A;  3IG3 A;  3W5V B;  3L16 A;  4KZC A;  1D5Z C;  3IFW B;  3VR8 B;  3MJ5 A;  3T9L A;  3RMK C;  2ON8 A;  4BKS A;  1IBX B;  1F1H A;  2J52 A;  3RUI B;  1TY0 A;  1Z5S B;  4ZDV A;  3RFZ B;  2GBN A;  3NZU A;  5GMV A;  2C5L C;  3DWM A;  4WAF A;  3Q3M C;  1UBI A;  4W9E A;  1CK1 A;  3KUD B;  1L4D B;  5HFY A;  3DBH I;  2JQR B;  3AH7 A;  2WXO A;  2VZK B;  3AEB B;  1P7E A;  4XGA B;  3GZN I;  2NS5 A;  2L3Z A;  1VDV A;  4OVU A;  2PLP A;  2WDR B;  1J19 A;  2NR2 A;  1NYR A;  2D3A A;  4US9 A;  1MVK A;  2ZPN A;  1WM2 A;  5D7G A;  1XF5 L;  4ZRP A;  1J7B A;  1YQ4 B;  1IPG A;  1MFW A;  5E6O A;  2KK8 A;  4LTU A;  3NZ3 A;  1Q1O A;  2ACZ B;  2QMT A;  3X0W A;  1XEE A;  3SEB A;  4OVZ A;  2XNA C;  1E8X A;  2K8H A;  4FHK A;  4KDI C;  3V05 A;  3TBL D;  2BKR B;  1R4M B;  3L17 A;  3HVD A;  3ML9 A;  1XCT L;  1L4Z B;  4LK0 M;  5KHO A;  2PVO D;  1R4N B;  2WXP A;  1YJI A;  4IG7 B;  2BB6 A;  1Q0W B;  3ONS A;  1QF6 A;  4C80 A;  3AU5 A;  3ETR A;  2D10 A;  3EC8 A;  2V9H A;  4C56 C;  3P4S B;  3U7D A;  2DZK A;  2KC2 A;  1TY2 A;  3FIL A;  4AUQ C;  1UWX A;  3ZJV A;  1QKZ A;  1RRB A;  4DXG A;  2MP2 B;  1C79 A;  1HE8 A;  4K3B A;  4DBG A;  2JF5 A;  4IUM B;  1OQR A;  4DHZ B;  2BYV E;  3DVN U;  4B6W A;  1C77 A;  2PEA A;  2RMM A;  3MFG A;  1AAR A;  3N1Z C;  2JZP A;  2W55 A;  2DAJ A;  1JML A;  1FPY A;  3AI5 A;  1GNU A;  1PQS A;  2OED A;  1SEB D;  3EGR A;  4ZRJ A;  2G1E A;  2CJO A;  1TKG A;  4FXC A;  4KDL B;  3FIL B;  4AWJ A;  3AUL A;  3AE6 B;  4EKU A;  1T5X D;  3QHT A;  3H7S A;  3DVN V;  4RNA A;  2WQY B;  1WF9 A;  1V2Y A;  3BII D;  1WX9 A;  3KH0 A;  3T8M A;  2NBV B;  1G6J A;  2REX A;  1ZXI A;  2N1V A;  4NNJ B;  3OJ3 A;  3E9S A;  1FD6 A;  2MHJ A;  1FRD A;  1GUA B;  3BZD B;  3RNE C;  3ZNZ B;  5J2R A;  2LXA A;  1E7V A;  1P3Q U;  3ALB A;  2VH2 A;  4P16 A;  1LFD A;  2L52 A;  4XE0 A;  2KTF A;  3IAM 1;  1SJE D;  1V6E A;  1VLB A;  1L5P A;  2KX3 A;  5G5H A;  2KOX A;  2GOW A;  2N9L A;  4P7I A;  4G3X B;  3AV8 A;  1R4M I;  4GIV A;  3VVW B;  4PK1 A;  3IT4 B;  3A33 B;  4BZA A;  1R4N I;  3V3X A;  1OQY A;  1WWT A;  3WCQ A;  3HHM A;  2KDE B;  1E5W A;  2JYT A;  3I5J C;  4ARC A;  4ANW A;  1XD3 B;  1WXM A;  2WNM A;  2QJL A;  3PRE A;  1XO3 A;  1PGB A;  2KC1 A;  3Q8A A;  2GI9 A;  3I9V 1;  3OG5 A;  4WJP A;  5KHQ A;  4EFO A;  2JYE A;  3GP7 A;  4HWI B;  1FNU A;  2G4D B;  3BVZ A;  2MQJ A;  4HRS A;  2VRR B;  3BVG A;  3AMZ A;  1P7F A;  4P1C C;  2A4Z A;  1E9M A;  4II2 B;  3NJT A;  2BQQ A;  5JXV A;  1UH6 A;  2X8X X;  2IO1 B;  5H92 C;  2IND C;  3AE3 B;  1SE9 A;  2PIA A;  4BAX A;  1V49 A;  2DBY A;  3TEY A;  2KMM A;  3QCA A;  4DWF A;  3N32 A;  3C0R B;  5C3J B;  2FBW B;  4HLE A;  2V3N A;  3A9J A;  3HM3 A;  1UNS A;  5EE9 A;  4RF0 A;  1ROE A;  3PO0 A;  4IWP A;  3P4R B;  3VRA B;  2HJ8 A;  4HPL B;  3W9C B;  2RGF A;  4NAW A;  2ZCB A;  3V6E B;  3RI7 C;  2K22 A;  3MHZ A;  1L0V B;  1V8C A;  2JRI B;  1TS2 A;  3U30 A;  1I4P A;  4FJZ A;  1SB3 C;  1N62 A;  5C1Z A;  2K6D B;  3KVF B;  5IAA C;  3R2I A;  4W9H A;  3URY A;  3SU8 X;  2WDV B;  3U52 E;  5AEK B;  4II3 B;  3U4E G;  4O1N A;  4GN1 A;  3GB1 A;  2N9X A;  1N61 A;  1WE7 A;  2KZR A;  2N9E B;  2ZJD A;  5G5G A;  1B1Z A;  5I4D A;  1WJU A;  1AWD A;  2IGD A;  2LEK A;  1M94 A;  2BTE A;  1H8C A;  1I4Q A;  3QIJ A;  3P63 A;  4NAW B;  2KFJ A;  4H2A A;  1T6B X;  3M95 A;  3WA0 A;  2BYT A;  2K5P A;  2M4N A;  1FXI A;  2LVP A;  3NRZ A;  2DNF A;  4E3C A;  1V97 A;  3RPF C;  1RLF A;  2PKO A;  3BIN A;  3Q69 A;  4C7Y A;  3M62 B;  1L0X B;  3Q8C A;  5MPO A;  2YEP F;  4AP4 C;  2CS4 A;  1D3Z A;  3QA8 A;  3WAP A;  1ZE3 D;  4TUU A;  5DPT A;  3SR6 A;  4LNK A;  3TCA A;  4LJO B;  2DWQ A;  2MBE A;  1NEN B;  1N60 A;  1RM6 C;  2JVC A;  1YJJ A;  2E6X A;  4B95 A;  2BYE A;  2FID A;  4LNO A;  2KDB A;  3KWL A;  1E0Z A;  4NAM A;  3FAH A;  1GOZ A;  1NBF C;  5BYS A;  2C7M B;  2DZM A;  1QQR A;  3R2T A;  2IDY A;  5LNK 1;  1FO4 A;  2FIF A;  1FNV A;  1UF0 A;  1N5W A;  4KZ0 A;  4ICV A;  5AUI A;  4K7U A;  4MSQ B;  2WXH A;  1B9R A;  3ZVV A;  5L83 A;  3H9D A;  2L0F A;  2XEW A;  2MBQ A;  2MWS B;  2OHF A;  2KD0 A;  2V3P A;  2KJH B;  3L13 A;  3JSV A;  4HPP A;  5JH5 C;  3U8Z A;  5D2M B;  3P42 A;  4MAC A;  5E6N A;  2H88 B;  4DDG D;  2KDM A;  2HDE A;  2LMC A;  3I57 A;  4WWP A;  4URK A;  4UDU C;  4TSS A;  3ZDT A;  2LAS A;  5DCN A;  4NQL B;  1ESF A;  3FKY A;  1GG3 A;  2IJ0 A;  3HM6 X;  2O6V A;  3PLV A;  3R8B A;  1QLB B;  4N58 A;  5AUK A;  2KYW A;  4S0R A;  4YTM B;  5LLI A;  2FCN A;  1OGW A;  4M02 A;  3N3K B;  2PE6 B;  3SD5 A;  4ZOH C;  2RDB C;  1MG8 A;  1MHX A;  4I6L B;  3VTU A;  3ZUN A;  5C23 A;  4GOC A;  1WRI A;  3ECI A;  5LXH A;  5BMH A;  3IXS A;  1FXT B;  2RSU A;  2MSE D;  4W9F A;  2ZEQ A;  1N6Z A;  2RPQ A;  4W9L A;  3BVM A;  5FK9 C;  2N9P C;  1TS4 A;  1XXG A;  2EMT A;  3VRB B;  1WZ3 A;  2AQ2 B;  2O6V B;  4AOF A;  4HVB A;  4MEM A;  4HCP B;  2FCQ A;  1EWC A;  2WXR A;  1WYG A;  3DHG C;  4IM0 A;  3P4P B;  2FUH B;  3VQI A;  3W2D A;  1L2N A;  2N0S B;  3C19 A;  4IM3 A;  1K8R B;  4NJ6 A;  5J17 A;  2MJE A;  1N5X A;  2G3Q B;  1WI0 A;  2E3T A;  5GXG B;  3KQ4 A;  1Q5W B;  1SGH A;  3ZW3 A;  2VH1 A;  4W9I A;  5BYQ A;  1NEK B;  3LJ3 A;  2MW5 A;  1WY8 A;  2BVC A;  2RD0 A;  1OFF A;  5HG2 A;  2FCS A;  2RPV A;  1E7U A;  2MX2 A;  3ABV B;  2K1F A;  4YXD B;  4A9A A;  4KSK C;  3V62 A;  5LXI B;  4MDK E;  1ZUD 2;  2WDQ B;  2J7Q B;  2DAF A;  2RDG A;  1Y8R C;  1JWB D;  3TUO A;  4KKI A;  4ZRK A;  1YQB A;  2WXQ A;  3H7P A;  3LB8 C;  4ARI A;  3PSE B;  1WIA A;  1SSN A;  4HK2 A;  2BWE S;  4A20 A;  4MM3 A;  1P9D U;  1TS3 A;  2BGF A;  3S2A A;  3AXC A;  3JYU A;  4WIP A;  1T3Q A;  3A1Q A;  4HRO A;  2BYF A;  4JPS A;  5EE0 A;  3UGB B;  3ZJU A;  3P4Q B;  1LXD A;  3EUB 2;  3UQB A;  2LJ5 A;  2W54 A;  4ZHP A;  2WX1 A;  4EZK A;  4WJO A;  4N6E B;  3AE1 B;  2LXC A;  2QIL A;  1VD2 A;  2X38 A;  2GLS A;  2J53 A;  3TIX A;  5DPR A;  2K8B A;  4RF1 A;  1E10 A;  2L7R A;  3H7P B;  1SF0 A;  1F2R C;  1KLV A;  1TZO A;  4LNF A;  2NTS A;  2XBB C;  2NVU I;  4N59 A;  5HKH A;  4MM3 B;  2KVR A;  4OW0 A;  4HJG E;  3D32 A;  5IOI A;  4HJK A;  1SJH D;  3A1Q B;  2KMA A;  2JSV X;  3VXW A;  3VTW A;  2WXG A;  1WXV A;  2NPT B;  1QOF A;  4BOS C;  2MP2 A;  2ZNV B;  4DXF A;  2N7D A;  1TT5 B;  2RDH A;  4WWM A;  1KM7 A;  2LJI A;  4QAY A;  2D07 B;  5D6J B;  3CIR B;  3DDC B;  1BML C;  3BY4 B;  1UWM A;  2AL3 A;  2GBM A;  1DYQ A;  2DZJ A;  1KF6 B;  4IKG A;  4TQ0 A;  4L23 A;  2FCM A;  4C4V A;  2GMI C;  1ZPS A;  3MHS D;  1RAX A;  4WWN A;  2JY6 A;  1WYW B;  4G50 A;  2ZZP B;  2IGH A;  3MC8 A;  1TJE A;  3WAM A;  1I7H A;  3VAW A;  1GAQ B;  4ZRQ A;  3B0A A;  2MA9 B;  2B76 B;  2KT7 A;  2INP E;  1J7C A;  2TSS A;  3KWV A;  3Q8B A;  4MH8 A;  2L0T A;  5IA7 A;  2MH7 A;  2MBO A;  1A70 A;  4PT5 A;  2JU6 X;  1WXS A;  4MGZ E;  3KYD D;  5CHV C;  1X1M A;  4EUT A;  5CHW A;  4YT0 B;  3LYY A;  4C4V B;  3ZQ4 A;  3Q3N C;  1HTQ A;  3AB5 A;  1P1A A;  4FA6 A;  3N1Y C;  1WR1 A;  3IVF A;  4K3C A;  1E90 A;  4RM8 A;  1T0Q C;  2BS3 B;  3AEG B;  3ZNG C;  3CWI A;  3VUY A;  3B2G A;  4XYC A;  1PGA A;  2ZVN A;  1BUI C;  1J7A A;  2IO0 B;  2GBR A;  4MJS A;  1UGJ A;  2VZK D;  3WIM A;  4RGT A;  3A9K B;  3CF6 E;  4XC2 A;  2AQ1 B;  4K81 A;  3BWU D;  1YIW A;  2W3S A;  4IWO A;  1MJD A;  2K8C A;  3W1S A;  1LM8 B;  3VH3 B;  2KJR A;  1XT9 B;  4B0M A;  4JWU C;  1WR6 E;  1WMH B;  4F8C B;  1YX5 B;  4HXD A;  4ANU A;  1OEY A;  3RT3 B;  2WXJ A;  2LGI A;  4JGH B;  3SHQ A;  4GSW A;  4BKS D;  3UF8 A;  1EF5 A;  2LUM A;  1HA5 A;  4REZ A;  4OZC A;  1C1Y B;  3HIZ A;  4ASW C;  3VUX A;  2MJ3 A;  1K50 A;  1YN4 A;  2XK5 A;  2K9X A;  3IBE A;  4HCN B;  1VR9 A;  3Q3O C;  1K52 A;  4TQ1 A;  3OLM D;  4MJS B;  2NMQ A;  4ZYN A;  2WWZ A;  2J0K A;  1HEZ E;  5EE3 A;  1UEL A;  1A5R A;  3K9O B;  2D11 A;  1CMX B;  2LRW A;  1JQ4 A;  2AL6 A;  3JVZ X;  3GE3 C;  1YD8 U;  4AQ7 A;  2V0G A;  1YJ1 A;  3RNA C;  3NHE B;  3PTF C;  1VZ8 A;  2Y5C A;  1GB1 A;  2CU3 A;  1ISN A;  3EFU A;  3R7Q A;  2BT6 A;  2M56 B;  2OOB B;  3MC0 B;  3PRM B;  2GB1 A;  2KAC A;  4LNN A;  4DHZ E;  3ZJT A;  2INN E;  5D94 A;  2NBU A;  2AEH A;  1KH0 A;  3DVG Y;  3I3T B;  3QC8 B;  1NI2 A;  4K1R B;  4M01 A;  3AM9 A;  2N7J A;  2CU1 A;  4BKG A;  4WUR A;  3H6N A;  2XK5 B;  1V5O A;  2KFK A;  1KOT A;  4GDL B;  2K25 A;  3OWE B;  1KTK A;  2M19 A;  4OZA A;  2W9N A;  2ZCC A;  3RNF C;  4BOZ B;  4ZHO A;  4G11 A;  1C4P A;  2BB5 A;  3VHT C;  4YWG G;  2D3G A;  1JWA D;  2WU5 B;  3RCZ A;  4EZJ A;  2BPS A;  4WJN A;  1CQV A;  1J8C A;  2KLC A;  3P1M A;  1D6E C;  2NCN A;  2WDT B;  2WXF A;  4KGS A;  4GMV A;  3DBS A;  3NVW A;  1L6V A;  1YNT E;  2KWV B;  2CR5 A;  4IM2 A;  1VJK A;  2KAN A;  5T8I A;  4A3P A;  2KFK B;  4WJQ A;  4RGM A;  1DOY A;  2KJ6 A;  3DOW A;  4YSZ B;  4FBJ B;  2KAJ A;  1YN3 A;  3GOE A;  3Q14 C;  1E7P B;  2UU7 A;  1ZW7 A;  3VUW A;  3ZTC A;  1F0Z A;  1YN5 A;  2LRU A;  4RMA A;  4RCO A;  4DHJ B;  3DHI C;  4LJP B;  2N7E A;  2IO2 B;  4JL9 A;  4M8M A;  4P6V F;  2CHX A;  2QHO A;  3Q8F A;  2KNB A;  2L05 A;  4ACF A;  4FUL A;  5JHA A;  2INC C;  3L08 A;  3PS6 A;  1WGK A;  3TEX A;  1MHH E;  2C7N B;  3WAO A;  1I4X A;  1NVI D;  1P0R A;  3DWG C;  1GC7 A;  3RZF A;  4HPM B;  4GDK A;  3NOB A;  1AW7 A;  4TMA B;  3PHW B;  5D3I B;  2H89 B;  4PS3 A;  4EE2 A;  4MH0 E;  4BVU C;  1AYF A;  2LUE A;  3ZRF A;  2AYO B;  2ICI A;  1JRU A;  1F2R I;  1BXT A;  3NUH B;  1I42 A;  3HRD D;  3AE8 B;  3ZRC A;  3RYT A;  1DOX A;  5EE1 A;  2BF8 B;  3AE5 B;  2AQ3 B;  4NY0 A;  3ML8 A;  2J0J A;  4KGT A;  4PYZ A;  2KHW B;  3AE4 B;  2IYD B;  4W9J A;  2R61 A;  3PGE A;  4LDT B;  2NTT A;  2LI5 A;  4C00 A;  2HD5 B;  2WXK A;  3T3N A;  4HKQ A;  1SE4 A;  1WZ0 A;  4WAA A;  3DVG X;  2GBK A;  3ZKJ C;  3C8Y A;  3KUZ A;  2R2Q A;  2IGG A;  3RN9 C;  1V1P A;  2WXN A;  2ZNV C;  1D5X C;  4GDK B;  1JCK B;  2V4I B;  2Q5W D;  3QJZ A;  2Y3A A;  2QC8 A;  1F52 A;  1WXQ A;  4LNI A;  2EKI A;  3ZYY X;  1NI3 A;  5J18 A;  3KLS X;  1WRD B;  3EFC A;  2IY0 B;  4ZYS A;  2Z0D B;  2DZI A;  1QT9 A;  4F7Z A;  2L32 A;  3NG0 A;  3RNB C;  5EDS A;  5CHF A;  1EM7 A;  2OJR A;  2DEN B;  4B9K A;  1RWS A;  3MJW A;  3AU4 A;  1KLU D;  1VZ6 A;  2DYM A;  4JIO U;  2CHZ A;  4EOY A;  2FE8 A;  5D3D A;  3IHP C;  4WH4 A;  2BKF A;  4MT5 A;  1DOI A;  1V1P B;  2IZV B; 
#chains in the Genus database with same CATH homology
 2N1V A;  1KLV A;  1NDD A;  4NNJ B;  4ANX A;  5CTR C;  2IBI B;  3OJ3 A;  2XBB C;  2NVU I;  3N30 A;  4FJY A;  5HKH A;  1OEY J;  3A9J B;  1IP9 A;  2KVR A;  1OTR B;  2JZZ A;  2KX0 A;  4KV2 A;  4J6I A;  3RD2 A;  4BFR A;  2WX0 A;  3NZS A;  1GUA B;  3ZNZ B;  3D32 A;  2LGY A;  5J2R A;  4HJK A;  4AJW A;  2LXA A;  3CSF A;  3ZTD A;  1E7V A;  4IWQ A;  3A1Q B;  4X57 B;  2KMA A;  1P3Q U;  3ALB A;  3ZNI D;  3VXW A;  3ZIM A;  1LFD A;  3VTW A;  2KTF A;  3DCG A;  1WXV A;  2NPT B;  4CYE A;  3OJ4 B;  4BOS C;  1WGD A;  1V6E A;  2DX5 B;  2MP2 A;  2ZNV B;  1UGM A;  4IC7 B;  2KX3 A;  2LWP A;  2KOX A;  2KXJ A;  2N7D A;  1Z2M A;  2GOW A;  2Y5B B;  3APD A;  3OAW A;  3R3M A;  4P7I A;  1UBQ A;  3CST A;  4G3X B;  2G45 B;  1KM7 A;  1R4M I;  2D07 B;  1WJN A;  4GIV A;  5D6J B;  1U4A A;  3DDC B;  3VVW B;  2ZPY A;  3BY4 B;  3KUC B;  4YL8 A;  2AL3 A;  2GBM A;  3A33 B;  1R4N I;  2DZJ A;  1OQY A;  3ZDM C;  3QK0 A;  4TQ0 A;  2L76 A;  3EEC A;  1ZKH A;  2FCM A;  3L10 B;  3HHM A;  2KDE B;  1WX7 A;  1E5W A;  2GMI C;  4HDO A;  4ANW A;  4N9F 4;  5JZE B;  3A4S C;  1XD3 B;  4KVG B;  1WXM A;  3V60 A;  3PRE A;  3MHS D;  2KC1 A;  1IYF A;  1RAX A;  4WWN A;  2KDF B;  2JY6 A;  1WYW B;  4G50 A;  2ZZP B;  4JQW C;  2FAZ A;  3WAN A;  4WJP A;  5KHQ A;  2J0M A;  4W9K A;  1WFY A;  4XZ4 A;  4RM9 A;  2UWQ A;  4EFO A;  2M17 A;  3QQ8 B;  3QAR A;  1YX6 B;  4NQK E;  3JW0 X;  4HWI B;  3WAM A;  2G4D B;  2NBW B;  2MQJ A;  3VAW A;  2VRR B;  2A4Z A;  3B0A A;  1T0Y A;  2PE9 A;  4II2 B;  2MA9 B;  3R66 C;  1UH6 A;  2IO1 B;  1V9J A;  1V5T A;  1SE9 A;  4PS7 A;  1V49 A;  3TJP A;  2JWZ A;  3QCA A;  4E74 A;  2L0T A;  4DWF A;  5IA7 A;  3N32 A;  3C0R B;  4XX5 A;  5FR6 A;  2MBO A;  4MGI E;  5AZG A;  4MGZ E;  1WXS A;  4CO7 A;  4HLE A;  3KYD D;  3A9J A;  4IW0 A;  5CHV C;  1X1M A;  4EUT A;  2UYZ B;  5CHW A;  2JZ3 B;  1TGZ B;  3HM3 A;  2RR9 A;  2HTH A;  4IWP A;  1WGY A;  2HJ8 A;  4HPL B;  2FNJ B;  3LDZ E;  2HE7 A;  3L0W B;  5CX3 A;  2RGF A;  2V1Y A;  4NAW A;  2LD9 A;  2LZ6 A;  1P1A A;  2ZCB A;  2NPT A;  3V6E B;  3NS8 A;  4FA6 A;  1WR1 A;  3PV1 A;  3IVF A;  2C9W B;  1E90 A;  2JRI B;  4HDQ A;  3U30 A;  4FJZ A;  3B08 A;  2C7H A;  4RM8 A;  3RUL A;  3WAL A;  5C1Z A;  2K6D B;  3W1S C;  2K6Q A;  3KVF B;  5IAA C;  3ZNG C;  4W9H A;  4MGK E;  3VUY A;  4FJV B;  2JT4 B;  1KJT A;  3SU8 X;  5AEK B;  3V6C B;  4II3 B;  2ZVN A;  3M3J A;  2IO0 B;  2GBR A;  4GN1 A;  2N9X A;  4MJS A;  1L7Y A;  5G55 A;  4KIK A;  5DPS A;  2CHW A;  1UD7 A;  2IY1 B;  3WIM A;  4DK5 A;  3PHX B;  3A4R A;  1WE7 A;  1WXA A;  2KZR A;  2O2V A;  3A9K B;  3CF6 E;  2A5U A;  2N9E B;  2ZJD A;  3DBL I;  3HK0 A;  4G0N B;  2I1K A;  4XC2 A;  1I35 A;  4K81 A;  4MEL A;  1YIW A;  4IWO A;  3W1S A;  4A3O A;  2K8C A;  1WJU A;  3UQA A;  1LM8 B;  3VH3 B;  1M94 A;  5DPW A;  1H8C A;  4GXB A;  3QIJ A;  4DHJ D;  2KJR A;  3JSV B;  1XT9 B;  3L54 A;  1EO6 A;  1VCB A;  4MSM B;  1TTN A;  1V86 A;  2PPH A;  1WR6 E;  1WMH B;  4F8C B;  3UIN B;  1YX5 B;  2KO3 A;  4HXD A;  1TBE A;  2I1J A;  4NAW B;  4BBN C;  1OEY A;  2KFJ A;  3RT3 B;  4ANU A;  4GGQ A;  4OVV A;  2K39 A;  4JGH B;  3SHQ A;  3TMP B;  4BKT A;  2DYO A;  4LCD E;  4JLC A;  3M95 A;  3WA0 A;  2MRP A;  4GSW A;  2M4N A;  4BKS D;  4ICU A;  1EF5 A;  3UF8 A;  2MBB B;  2L00 B;  2KQ7 A;  2N1W A;  2O6V D;  3K9P B;  2LVP A;  1C1Y B;  3HIZ A;  2MCN B;  2LVQ A;  4ASW C;  4E3C A;  3VUX A;  1RLF A;  2WYQ A;  3BIN A;  2KWC A;  3SDL C;  2XK5 A;  4E71 A;  2V3S A;  3IBE A;  4HCN B;  4GB9 A;  3M62 B;  4TQ1 A;  2CKH B;  3OLM D;  4MJS B;  2PJH A;  4AP4 C;  3W1Y A;  4ZYN A;  3VTV A;  2CS4 A;  2WWZ A;  1WE6 A;  2J0K A;  2KDI A;  4KIK B;  3UIP B;  1D3Z A;  3QA8 A;  1UEL A;  3WAP A;  4TUU A;  5DPT A;  3PRP B;  1A5R A;  2O2V B;  2R2O A;  3K9O B;  4DDI D;  2D11 A;  2LGX A;  3TCA A;  1CMX B;  2LRW A;  4I6N B;  4LJO B;  3VFK A;  1E8Y A;  3M63 B;  2AL6 A;  3JVZ X;  2G4S A;  1YD8 U;  1XQQ A;  2MBE A;  2JVC A;  4B95 A;  2BYE A;  2FID A;  1YJ1 A;  2B3A A;  3P2B A;  3NHE B;  2KDB A;  3PTF C;  4FHJ A;  4F1S A;  1ISN A;  2LGD A;  4PS8 A;  3EFU A;  3R7Q A;  4W9G A;  2OOB B;  1NBF C;  3PRM B;  2C7M B;  3Q3J A;  2L8J A;  3VDZ A;  3EHV A;  2DZM A;  1S3S G;  4EEW A;  2FIF A;  4DHZ E;  3V61 A;  1BT0 A;  5D94 A;  2NBU A;  4DXA B;  4KSL C;  4EZL A;  2AEH A;  3PLU A;  2JXX A;  3DVG Y;  4ICV A;  4KZ0 A;  1P98 A;  3DPD A;  3I3T B;  2KTR A;  3QC8 B;  1NI2 A;  4K1R B;  4K7U A;  4MSQ B;  4WQO B;  4LDT D;  1WH3 A;  1V80 A;  2CU1 A;  3PZD A;  4BKG A;  3ZVV A;  1QZE A;  5L83 A;  3H9D A;  4TV3 A;  3A9K A;  3H6N A;  2XK5 B;  1V5O A;  2L0F A;  4K7W A;  2XEW A;  2MBQ A;  2KFK A;  3O65 B;  1KOT A;  2MWS B;  2M0X A;  4MGY E;  1WGG A;  1EF1 A;  4GDL B;  2KD0 A;  2K25 A;  2C60 A;  1GJZ A;  2KJH B;  3L13 A;  2W9N A;  3Q3F A;  1E8W A;  2V4L A;  2ZCC A;  3JSV A;  3QX1 A;  4BOZ B;  4G11 A;  1G6J A;  3PT2 B;  5JH5 C;  3U8Z A;  3VHT C;  4K7S A;  1WMH A;  5D2M B;  2D3G A;  2IO3 B;  1TZ1 A;  5E6N A;  4M8N A;  3RCZ A;  1WX8 A;  4EZJ A;  2BPS A;  4DDG D;  4WJN A;  3X23 A;  4GU2 A;  1J8C A;  3IG3 A;  2KLC A;  3APF A;  4WWP A;  2NCN A;  3L16 A;  2WDT B;  4URK A;  1S1Q B;  4KZC A;  4GMV A;  3IFW B;  3DBS A;  3T9L A;  3ZDT A;  2LAS A;  5DCN A;  4NQL B;  2EMS A;  4BKS A;  2KKC A;  2KWV B;  1GG3 A;  2CR5 A;  4IM2 A;  3HM6 X;  5L95 C;  2KAN A;  2M1M A;  2O6V A;  3RUI B;  2KTR B;  1Z5S B;  3PLV A;  2BWF A;  4W9C A;  3ZO5 B;  4ZDV A;  3CMM B;  2GBN A;  3NZU A;  5GMV A;  5TR5 A;  1ZGU B;  4A3P A;  2C5L C;  2Z59 B;  3KW5 B;  3PPA A;  5LLI A;  2FCN A;  1OGW A;  1UBI A;  3KYC D;  4W9E A;  3KUD B;  3N3K B;  1J0G A;  4TKN A;  2KFK B;  2PE6 B;  2KWU B;  4I6P A;  4WJQ A;  2JRH A;  3DBH I;  5BO4 B;  1C3T A;  2KJ6 A;  3DOW A;  3SD5 A;  4FBJ B;  4I6L B;  1MG8 A;  5G2N A;  3TL5 A;  3GOE A;  1WGH A;  3MTN B;  3VTU A;  3GZN I;  3ZUN A;  5JHB A;  2NS5 A;  3B1L X;  2DHZ A;  4WWO A;  1ZW7 A;  3VUW A;  3ZTC A;  5C23 A;  2L3Z A;  4GOC A;  3ECI A;  2LRU A;  4RMA A;  5LXH A;  4OVU A;  4DHJ B;  4LJP B;  1WM3 A;  2DYB A;  2GBJ A;  2IO2 B;  2N7E A;  4JL9 A;  1J19 A;  1FXT B;  2RSU A;  2NR2 A;  4FN2 A;  4M8M A;  4CHK A;  2ZVO A;  2MSE D;  2ZPN A;  4W9F A;  1WM2 A;  2ZEQ A;  5D7G A;  2CHX A;  2QHO A;  3PRZ A;  2RPQ A;  4W9L A;  3ENE A;  2KNB A;  2M8S A;  2L05 A;  1V81 A;  2ASQ A;  2N9P C;  1IPG A;  4FUL A;  4M0W B;  4FLH A;  5E6O A;  2KK8 A;  5JHA A;  2EMT A;  1WZ3 A;  2O6V B;  3L08 A;  4GDL A;  1Q1O A;  5AZH A;  4AOF A;  3PS6 A;  4HVB A;  3X0W A;  4MEM A;  5E6P A;  2C7N B;  3WAO A;  2FCQ A;  4HCP B;  1E8X A;  2KQS A;  2K8H A;  4FHK A;  2Z0E B;  4IM0 A;  1P0R A;  4ANV A;  4KDI C;  3RZF A;  1GC7 A;  1WJ4 A;  2FUH B;  2BKR B;  3TBL D;  3VQI A;  1L2N A;  4PYU A;  3L17 A;  4HPM B;  4GDK A;  3ML9 A;  3H1U A;  3NOB A;  4IM3 A;  1K8R B;  3PHW B;  4NJ6 A;  5J17 A;  5KHO A;  4AJY B;  4PS3 A;  2KLG A;  4MH0 E;  2G3Q B;  4BVU C;  1WI0 A;  2LUE A;  2D2Q A;  3ZRF A;  2AYO B;  4IG7 B;  4FAD A;  2YVC A;  1JRU A;  1Q0W B;  1Q5W B;  3ONS A;  1I42 A;  1SGH A;  1F9J A;  1H4R A;  3AU5 A;  3ZRC A;  4W9I A;  3RYT A;  3ZW3 A;  2EKE C;  2JPH A;  3LJ3 A;  2MW5 A;  2BF8 B;  2D10 A;  3EC8 A;  1EUV B;  4NY0 A;  3ML8 A;  1WY8 A;  2J0J A;  2RD0 A;  2FCS A;  3U7D A;  1E7U A;  4PYZ A;  2MX2 A;  2DZK A;  2K1F A;  2KC2 A;  2KHW B;  3ZNH B;  2IYD B;  4W9J A;  4AUQ C;  3PGE A;  2KMC A;  4KSK C;  4LDT B;  4NJ7 A;  3V62 A;  5LXI B;  2LI5 A;  1RRB A;  4MDK E;  2HD5 B;  2MP2 B;  2J7Q B;  2DAF A;  1GC6 A;  1Y8R C;  1HE8 A;  1WZ0 A;  3DVG X;  2GBK A;  3PVL A;  4WAA A;  3ZKJ C;  3KUZ A;  2R2Q A;  4ZRK A;  2AWT A;  1YQB A;  3H7P A;  4DBG A;  2N4F A;  2JF5 A;  2ZNV C;  4IUM B;  4GDK B;  3PSE B;  4DHZ B;  1WIA A;  4HK2 A;  2BYV E;  2BWE S;  4A20 A;  4MM3 A;  2KN5 A;  1P9D U;  2MLB A;  2BGF A;  3DVN U;  4B6W A;  2PEA A;  3QJZ A;  3R7R A;  3S2A A;  1AAR A;  3AXC A;  2MBH A;  3JYU A;  1UZX B;  1LQB A;  2DAJ A;  3A1Q A;  5J18 A;  1WRD B;  2BYF A;  2IY0 B;  3ZLZ A;  3UGB B;  2LVO A;  3AI5 A;  1GNU A;  1PQS A;  2Z0D B;  2DZI A;  4ZRI A;  1LXD A;  4F7Z A;  5AZF A;  1WJ6 A;  4ZRJ A;  3APC A;  3UQB A;  2LJ5 A;  5EDS A;  5CHF A;  3RZW C;  2WX1 A;  4EZK A;  3UIO B;  4WJO A;  2OJR A;  2DEN B;  4B9K A;  4KDL B;  3QWZ B;  2LXC A;  4AWJ A;  3AUL A;  3MJW A;  4EKU A;  3QHT A;  1VD2 A;  3AU4 A;  2JUO A;  3H7S A;  3DVN V;  3DQV A;  1WF9 A;  2DYM A;  4JIO U;  1E8Z A;  2CHZ A;  3VH4 B;  3DBR I;  4EOY A;  1V2Y A;  3IHP C;  3TIX A;  4NPN A;  5DPR A;  2BKF A;  2K8B A;  4BBN F;  2YLM A;  3NY5 A;  3QAQ A;  1WX9 A;  3KH0 A;  4W9D A;  1RFA A;  2L7R A;  3T8M A;  3H7P B;  1WGR A;  1SIF A;  2NBV B;  2IZV B;  2REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...