1WFYA

Solution structure of the ras-binding domain of mouse rgs14
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
GSSGSSGDQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGEKQPMDLENPVSSVASQTLVLDTPPDAKMSEARSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords regulator of G-protein signaling 14; rap1/rap2 interacting p
publication title Solution structure of the Ras-binding domain of mouse RGS14
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 10
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wfyA01
3L13A 3K9PB 3OJ4B 3MTNB 3ECIA 3ZDMC 1OQYA 1OGWA 1NI2A 1Q0WB 3DBRI 1YX6B 1S3SG 2L3ZA 1J19A 2MBHA 2NCNA 4GDKA 1LM8B 3VUXA 1L2NA 3EC8A 4B9KA 4KZ0A 4FN2A 4FJZA 1VCBA 4W9DA 1P0RA 3L08A 2FIDA 2ZPYA 5CX3A 4PS3A 3DVNV 3Q3JA 4KVGB 3QJZA 4KSLC 2N7DA 2XBBC 2KO3A 2KQSA 2M17A 2PEAA 2PE9A 4LJOB 3VHTC 3W1SA 1Y8RC 2DYOA 2EMTA 3DBSA 2BWES 1WE6A 2EMSA 3IG3A 4A20A 3OAWA 2G45B 4TKNA 4EFOA 4B6WA 5JZEB 5L95C 1XD3B 2DYBA 4IC7B 3H1UA 2Z59B 3N3KB 5D7GA 3GZNI 3N30A 2G4DB 5CTRC 3T8MA 4HDQA 3NZUA 4ANXA 1WRDB 4MGIE 4GGQA 3L16A 2BYFA 1RLFA 1SGHA 2BGFA 3CF6E 4GIVA 3H7PB 3PREA 4DWFA 1LQBA 2BF8B 4NQKE 4NJ7A 3L0WB 3LJ3A 3PHWB 2C5LC 4BFRA 2MW5A 3S2AA 2BKFA 1EO6A 5AZGA 4NAWB 1WGYA 1X1MA 2LWPA 4JIOU 2KKCA 4IM0A 1WGHA 2KOXA 2WWZA 3R3MA 5E6PA 4RMAA 2CU1A 4W9FA 5GMVA 5AZHA 2DENB 1TZ1A 3DQVA 3CSFA 2J0MA 5AZFA 2DX5B 3HM3A 5IA7A 4XC2A 2DZIA 1YD8U 1EUVB 3KW5B 4TV3A 4DDGD 3A33B 2LGYA 1V6EA 5DPRA 3DVGX 2M4NA 3RZFA 3RYTA 2O2VA 1WM2A 2LXAA 2VRRB 2MBEA 3ONSA 2NVUI 1WGGA 3GOEA 3L10B 1KLVA 2KTRB 3UINB 2J7QB 4ZYNA 2Z0DB 1J0GA 3Q3FA 2PE6B 2K8BA 3QARA 1WGRA 2IY1B 2V3SA 4FJVB 3DVGY 4G3XB 1E90A 3V6EB 2K6QA 2YVCA 3W1YA 2FAZA 4CYEA 5JHBA 1WGDA 2KD0A 4MELA 3RZWC 2MX2A 2KZRA 2FIFA 4URKA 5DPTA 5LXHA 3KH0A 3TMPB 3ZNID 4K1RB 2JXXA 4DHZE 3HK0A 3WA0A 4KV2A 5JHAA 1P9DU 4AJWA 1E8WA 2HE7A 3VH4B 1D3ZA 2ZVNA 2XK5A 3QC8B 3KUZA 3KUCB 5J2RA 2D3GA 4HCNB 4W9LA 2JUOA 2XEWA 4BKSA 3DCGA 3I3TB 3UGBB 4AOFA 4IWOA 2KHWB 4X57B 1BT0A 4HWIB 2BPSA 1V80A 1R4MI 2NR2A 5BO4B 5TR5A 1ZGUB 5G55A 1WXSA 4AUQC 5J17A 1P98A 1WMHA 1WR1A 3PV1A 2D07B 4F1SA 4MGKE 4FLHA 2G4SA 1UBIA 3U7DA 1H8CA 2KDIA 4E3CA 1SIFA 4W9JA 1LFDA 1V2YA 3B1LX 3H7PA 1Q1OA 2ASQA 4HLEA 3BY4B 4ZRJA 1U4AA 4FHKA 4JQWC 1WJ6A 3VVWB 4TUUA 1A5RA 2KJHB 5C23A 1WF9A 2KWVB 1J8CA 4BKTA 4NAWA 3KYDD 1YX5B 2FCNA 2MP2B 2EKEC 2JVCA 3IHPC 3WALA 4W9KA 2L7RA 4BBNF 1ZW7A 2K8CA 4ICVA 2ZVOA 1E5WA 2KK8A 2KWUB 3H9DA 3TJPA 4KZCA 4I6PA 2AEHA 2PPHA 2CR5A 2NBWB 4NPNA 2NPTB 3WANA 2IO2B 1V81A 2FUHB 2KMCA 2RPQA 3MHSD 1WXAA 3PGEA 3V6CB 2K25A 2BWFA 3PS6A 3PSEB 2WDTB 3PT2B 2K39A 5DCNA 2GBJA 1M94A 5LLIA 3KVFB 2JRIB 3APFA 1OEYJ 1WY8A 2MA9B 2FNJB 3A9JB 3SDLC 3ZNGC 2HTHA 2KTRA 1UGMA 1IYFA 4PYUA 3ML8A 4W9HA 3V61A 1G6JA 1T0YA 4II2B 2N9EB 3L54A 1WZ0A 2N7EA 2Z0EB 3CMMB 4HJKA 4DHJD 3QAQA 1GUAB 1JRUA 3QA8A 2A4ZA 2IO3B 3PRPB 4FULA 2DZKA 2NBUA 4K7WA 4KIKB 4CO7A 4E71A 2LD9A 4GSWA 3T9LA 2N4FA 3P2BA 5DPSA 1TTNA 2MSED 4FA6A 3JYUA 3A9KB 4GN1A 3VQIA 3WAPA 2N9XA 3B08A 2MLBA 3VTUA 4MGZE 3VFKA 1XQQA 3D32A 2KFKB 3VXWA 3RD2A 5KHQA 4WWPA 2IBIB 4N9F4 3ZLZA 2FCMA 4DHJB 3RUIB 4WAAA 1WI0A 3DPDA 3H6NA 4WJNA 4TQ0A 2IZVB 3JVZX 1TGZB 4PS7A 5E6NA 2ZPNA 2JZ3B 4I6NB 3IFWB 3NY5A 3PPAA 2OOBB 4NQLB 3ZRFA 1TBEA 1EF5A 2LVOA 4M0WB 1H4RA 2O6VD 4FBJB 3QK0A 3R7RA 1P1AA 4HDOA 4P7IA 1KJTA 2KTFA 3DBHI 3QQ8B 2IYDB 3IBEA 5CHFA 2LVQA 3PVLA 3QHTA 2WYQA 3UQBA 2C7NB 2I1JA 2LGXA 3MJWA 4GDLB 3V60A 4IG7B 2ZNVC 4DK5A 2MRPA 2KMAA 4GU2A 5JH5C 2ZEQA 3APDA 3VTWA 2LXCA 3VUWA 4W9IA 2N9PC 1C3TA 1IP9A 4EEWA 4BKGA 1RRBA 2HJ8A 3ZIMA 4DXAB 3UIOB 1KM7A 4AJYB 2DAJA 1UELA 2D2QA 2O6VB 1XT9B 2RD0A 3R7QA 4RM8A 4A3OA 2AL6A 2KDBA 4J6IA 1E7VA 4OVVA 1YQBA 4FJYA 4KDLB 3A4SC 2CHWA 3UIPB 4WJQA 3QIJA 1WJ4A 2K1FA 2MCNB 3ML9A 5G2NA 3WAMA 2KANA 3U8ZA 3TL5A 1EF1A 3O65B 2YLMA 1OEYA 1WJUA 3PTFC 1P3QU 1WX8A 4DBGA 4NJ6A 2KVRA 3ALBA 1PQSA 4MGYE 3A9JA 2MWSB 4W9EA 3VUYA 4HK2A 3ZVVA 3WAOA 2KC2A 1KOTA 4MSMB 3VTVA 2IY0B 5EDSA 1V49A 3QX1A 2KNBA 4G0NB 2ZCCA 2K8HA 4JL9A 5L83A 1GG3A 3CSTA 4MH0E 2MQJA 2R2OA 4ZRKA 3ZNZB 3ZTCA 1E8YA 2LZ6A 4AWJA 1MG8A 2CHZA 2JT4B 4KIKA 1YJ1A 1WJNA 2CHXA 2J0JA 4IW0A 1S1QB 2JWZA 2UYZB 2Y5BB 3A9KA 4GB9A 4ASWC 3M63B 1ISNA 1GC7A 4A3PA 4OVUA 1V5TA 2LASA 2REXA 2KFKA 4RM9A 4TQ1A 5LXIB 2CKHB 1GJZA 4F8CB 3A1QB 4K7UA 1UH6A 2KDEB 4CHKA 4IM3A 3JSVB 2LGDA 2IO1B 3DOWA 3PLUA 4KSKC 3N32A 2K6DB 4AP4C 2RR9A 5AEKB 3M95A 2KJRA 1V5OA 2B3AA 2L0TA 2ZNVB 4MM3A 4MDKE 1V9JA 4W9GA 2V4LA 2DAFA 3M62B 3UF8A 4GXBA 4BOZB 2AWTA 3EHVA 3AU5A 4WWNA 1OTRB 4W9CA 3RCZA 3RT3B 4BBNC 3DVNU 4MSQB 2KQ7A 5KHOA 4JGHB 4E74A 3C0RB 4II3B 4GDLA 1WR6E 4BKSD 4LDTD 1RFAA 1E7UA 4GMVA 2LUEA 2UWQA 2NBVB 2BKRB 4B95A 2L05A 2JZZA 4GOCA 3ZTDA 3W1SC 3ZO5B 1Z5SB 3R66C 2O6VA 3X0WA 2LJ5A 2QHOA 1CMXB 5DPWA 1Q5WB 1IPGA 5CHVC 4LCDE 3B0AA 1WXMA 4EZLA 2KJ6A 2DYMA 2XK5B 2MBQA 2KFJA 3WIMA 3DBLI 5CHWA 2JF5A 4M8MA 4LDTB 1RAXA 4ICUA 4BVUC 1WM3A 2JRHA 2DZMA 2MBBB 2R2QA 4HPLB 4WJPA 3U30A 1AARA 2IO0B 2LRUA 2DHZA 1UZXB 4WJOA 1WX9A 1WXVA 4FHJA 3SD5A 1I42A 1WMHB 2M1MA 4LJPB 4G11A 2RGFA 4HCPB 5D6JB 2N1WA 3ZKJC 2KN5A 2NS5A 2V1YA 3KUDB 2KX0A 5D94A 1NDDA 3KYCD 4FADA 1E8ZA 3NZSA 4IWPA 2A5UA 3AXCA 3UQAA 3HM6X 2C60A 4ZRIA 2FCQA 4EUTA 2GOWA 1WZ3A 3SHQA 3V62A 2LRWA 4MJSB 2JY6A 2GBRA 4DHZB 1K8RB 2GBKA 4ANWA 4HPMB 3HIZA 2L8JA 2ZZPB 4F7ZA 3L17A 1F9JA 2C7HA 4IM2A 3ZRCA 2D10A 4EOYA 3A1QA 2WX1A 1E8XA 3PRMB 2JPHA 2FCSA 2MP2A 1WYWB 3JSVA 4IUMB 4ANVA 1ZKHA 4GDKB 2ZCBA 3ENEA 4ANUA 3EFUA 1FXTB 3LDZE 1Z2MA 2KC1A 5FR6A 3ZDTA 3K9OB 1QZEA 2C7MB 3A4RA 1UBQA 3QCAA 4WQOB 3TCAA 2CS4A 2KDFB 3H7SA 2N1VA 3APCA 2NPTA 2KLCA 4EKUA 1WFYA 1L7YA 3OLMD 4HXDA 4EZKA 1V86A 1VD2A 2L76A 4XZ4A 3ZW3A 2D11A 1GNUA 4WWOA 2I1KA 3SU8X 3DDCB 2W9NA 3RULA 3JW0X 1WX7A 3X23A 5C1ZA 3AULA 4DDID 2PJHA 2C9WB 3BINA 3PZDA 1NBFC 1YIWA 3TIXA 2G3QB 2M8SA 1WH3A 3AU4A 3VDZA 4I6LB 4K81A 2KLGA 2RSUA 2DZJA 3NS8A 2LI5A 3PLVA 3VH3B 2BYVE 4EZJA 2J0KA 4PS8A 5E6OA 2BYEA 4G50A 2KXJA 4HVBA 2L0FA 1LXDA 1WIAA 4K7SA 4ZDVA 2GBNA 2WX0A 5HKHA 2OJRA 2GMIC 2M0XA 4NY0A 3NHEB 2GBMA 3HHMA 2KWCA 3PHXB 4YL8A 2AL3A 3IVFA 4MEMA 4XX5A 1R4NI 3ZNHB 3EECA 5J18A 1HE8A 1WE7A 4PYZA 1I35A 1GC6A 4JLCA 2KX3A 3VAWA 4IWQA 1SE9A 2O2VB 3AI5A 1C1YB 3PRZA 3QWZB 5D2MB 5IAAC 2AYOB 4M8NA 4NNJB 1UD7A 3NOBA 3TBLD 2ZJDA 2L00B 2MBOA 4MJSA 2LVPA 3ZUNA 4KDIC 3OJ3A 2HD5B 4BOSC 3M3JA
chains in the Genus database with same CATH superfamily
2MH7A 3OJ4B 3MTNB 1Q0WB 2WNMA 2NCNA 3VUXA 3EC8A 1R4NB 4FJZA 3L08A 2K5PA 1NI3A 4PS3A 4KVGB 1TYGB 4KSLC 2PEAA 3DHHC 3AE2B 2CJOA 3RN9C 2IGGA 3IG3A 4P16A 2G45B 2PMVA 4IC7B 1YJIA 3Q8AA 3N3KB 3GZNI 3N30A 1HZ5A 4HDQA 4ANXA 1C78A 4MGIE 2BGFA 3CF6E 3H7PB 5BMHA 2RDGA 1OFFA 4YSYB 2J42A 2BW2A 4BFRA 2JQRB 1WGYA 1EWYC 1SB3C 2JSVX 2JYEA 5GMVA 4WQMA 2DENB 4OZCA 3CSFA 5AZFA 4B0EA 5D3IB 3GZNB 4TV3A 4DDGD 5DPRA 2O2VA 2VRRB 1RYJA 4J3OD 1R7SA 3L10B 1UF0A 2J7QB 1ET6A 1YN5A 3DHIC 3AE3B 3C19A 3V6EB 2Z8LA 2YVCA 3W1YA 4B0MA 5JHBA 1WGDA 4HPPA 2BT6A 4EE2A 2KZRA 2QJLA 2PVGC 3HK0A 4ZRPA 3U4EG 2ZVNA 4MACA 3KUCB 2JUOA 3UGBB 1NVID 4HWIB 2NR2A 5TR5A 4IKGA 2LJIA 5G55A 5C3JB 1JWAD 1WXSA 1WR1A 3PV1A 4F1SA 4MGKE 4FLHA 2B76B 1TT5B 2QMTA 2L83A 4ZRJA 1WJ6A 1HA5A 3VVWB 4TUUA 2M0AA 5C23A 1YX5B 1TKYA 2G9HD 3WALA 1ENFA 5D3DA 2L7RA 4BBNF 1C4PA 1ZW7A 2K8CA 1PUTA 2KK8A 2CR5A 1FRDA 4M01A 1K51A 3WANA 3Q8EA 2NPTB 2KVZA 2KMCA 2I38A 1WXAA 4Q2JA 4RGTA 3PSEB 1MFWA 3PT2B 2K39A 5LLIA 1XEEA 3A9JB 3ZNGC 4AQ7A 4KKJA 5BMIA 3BYYB 3ML8A 1G6JA 1T0YA 4RGOS 2N7EA 2Z0EB 1I4PA 1JRUA 4FULA 1ZOYB 4K7WA 4CO7A 1IBXA 4GSWA 1TTNA 2M56B 1PGBA 3ZXRA 3VXWA 5KHQA 1SIJA 2IBIB 1NYQA 3RUIB 4WAAA 3T3NA 1TY0A 2PLPA 2DNFA 1ZDXA 4RGMA 2PIAA 2EELA 2OOBB 4NQLB 1C4CA 3ZRFA 4M0WB 3N9YC 3IAM1 2PVOD 4HDOA 1KLUD 3ETRA 3DBHI 3QQ8B 2WYQA 2AQ1B 3MJWA 3V60A 2GI9A 2ZNVC 3LXFA 2KMAA 3APDA 3IT6B 4W9IA 2N9PC 2QC8A 4BKGA 1RRBA 3FILB 3ZIMA 4AJYB 2O6VB 2RD0A 3R7QA 3NVZA 4RM8A 1E7VA 2QCZA 4OVVA 3RMKC 2CHWA 4WJQA 1LGRA 1QILA 5G2NA 1EF1A 3O65B 1OEYA 3Q3MC 1KTKA 4DBGA 4NJ6A 1KF6B 3AEAB 3WAOA 2KC2A 1KOTA 5EDSA 4PT5A 2K8HA 1TKGA 4WH4A 3CSTA 3TUOA 4ZRKA 2LZ6A 1MG8A 4KIKA 1J7CA 4XWWA 1V8CA 2CHXA 1S1QB 2LHDA 3A9KA 1PDXA 4UDUC 4A3PA 4OVUA 5I4DA 3ZGZA 2LASA 4RM9A 4TQ1A 5LXIB 2CKHB 3A1QB 4K7UA 1XO3A 1OQRA 4LNOA 4RF1A 4AP4C 2G1EA 3BIID 2V3NA 2B3AA 2WXLA 4C7ZA 2LGSA 4GXBA 3RT3B 3AU5A 2WXGA 3RCZA 4W9CA 4A90A 5G5GA 4MSQB 1MHHE 5KHOA 4E74A 2W3SA 4II3B 4MT5A 1WR6E 1FEHA 2BKRB 2AX5A 4YT0B 4NJCA 1Z5SB 3X0WA 2Q5WD 1RFKA 5CHVC 4JPSA 2DYMA 4KGSA 2JF5A 1FXAA 4ICUA 2ON8A 1ESFA 4HPLB 2MBBB 2BS2B 1AARA 3AECB 3ZXVA 2LRUA 1MHXA 1FIQA 4WJOA 2M1MA 2NS5A 1NENB 1NDDA 4FADA 3HM6X 2FCQA 1C76A 2GOWA 3SHQA 1N5XA 4MJSB 3RNGC 1WYGA 1K8RB 4HPMB 3HIZA 4F7ZA 2C7HA 3ZRCA 1KRHA 1E8XA 1JQ4A 2JPHA 1FNWA 4XGAB 2LHEA 2WU2B 3IT4B 1SE3A 3LDZE 3P4QB 3QCAA 4WQOB 3TCAA 4DQOC 2N1VA 3PZ8A 3OLMD 5AUIA 1JROA 1V86A 1FFUA 3H8HA 2Y3AA 4XZ4A 4WWOA 1WX7A 3AULA 2M8SA 3AU4A 4K81A 4N59A 1GB1A 3KLSX 5E6OA 2BYEA 2KXJA 3B9JA 3LB8C 4ZDVA 1HQRD 2OJRA 1SXTA 4NY0A 3NHEB 1J7BA 4MEMA 4USAA 1B9RA 1L6UA 2WXKA 5J18A 1GC6A 4JLCA 4OW0A 2WXFA 1SE9A 3AI5A 1K52A 4NNJB 3NOBA 3Q8BA 4REZA 2Y5CA 1JWMD 4JE3B 2MBOA 3ZUNA 1WWTA 3B2FA 3IAS1 3AMZA 4KKIA 2IPKD 3GE3C 3K9PB 1D4BA 2K3UA 3ECIA 1N62A 2GRIA 1NI2A 3DBRI 4GDKA 4B9KA 1FXIA 1VZ8A 2HTME 5CX3A 3T3OA 1ZXHA 3DVNV 2N7DA 2XBBC 2KQSA 2PE9A 3W2DA 3VHTC 3W1SA 3URYA 1Y8RC 3P63A 1AWDA 4B6WA 5JZEB 3AE6B 1V97A 5CTRC 1SEBD 3NS1A 2BYFA 2VH2A 1SGHA 4GIVA 3DBRB 1E7PB 3PREA 1LQBA 4NQKE 2DWQA 2V3PA 2C5LC 3Q6BA 1EO6A 1B1ZA 1VJKA 4NAWB 4OVZA 4US9A 2L1AA 3DBLB 1WGHA 5E6PA 1YN4A 4LLGM 4W9FA 5AZHA 3AV8A 5HFYA 4ZOHC 2DZIA 2OJWA 1N6ZA 3BK1A 1V6EA 3RYTA 3DVGX 2M4NA 4S17A 1M4VA 2MBEA 1CQVA 3ONSA 5IOIA 1FD6A 4ZYNA 2Z0DB 1VLBA 3MC9A 1J0GA 2PE6B 2K8BA 2YEPF 2V3SA 1EU3A 4G3XB 1E90A 2K6QA 4CYEA 1HEZE 5DPTA 3TMPB 1JCKB 5JHAA 2FBWB 2HE7A 3VH4B 4ZRQA 2XK5A 3QC8B 3KUZA 4HCNB 3I3TB 4AOFA 3BVMA 4IWOA 1STEA 3W5UB 1V80A 1R4MI 3E9SA 2BTEA 1VZ6A 2FE8A 2WXHA 1H8CA 2KDIA 3MC8A 3H7PA 3BY4B 2KN4A 1A5RA 1SJHD 2IGDA 4C4VB 2BB6A 2MP2B 2EKEC 1AW7A 4W9KA 5EE3A 1IGDA 1CJEA 2ZVOA 1E5WA 2KWUB 3TJPA 2W55A 2AEHA 1RWSA 4NPNA 3P42A 1IGCA 2FUHB 3P4PB 3DWGC 3OG5A 3AE1B 3RNAC 1KH0A 2K25A 3RPFC 2WDTB 1DOXA 2IJ0A 3ZJUA 3KVFB 2JRIB 3APFA 4BZAA 3BWUD 2MA9B 2HTHA 1FFVA 4W9HA 1N5WA 3NRZA 4II2B 2Y5PA 3L54A 3QAQA 1V1PB 3PO0A 3QA8A 1XF5L 2NTSA 4IOIE 4KGRA 5DPSA 4FA6A 1QOFA 3I9V1 3D32A 3RD2A 4WWPA 4DHJB 3CWIA 3HVDA 1WI0A 2PW9A 3RNBC 4TQ0A 2IZVB 3JVZX 1FMAD 5E6NA 2JZ3B 1ET9A 3NY5A 3PPAA 1MG4A 2O6VD 4FBJB 1EU4A 3QK0A 3FKYA 3NUHB 1BMLC 1P1AA 1JWBD 4P7IA 2LVQA 1L4ZB 3UQBA 2C7NB 2I1JA 2LGXA 4GDLB 2MRPA 3SFEB 3VTWA 2LXCA 4TSSA 1DGJA 4DXFA 1IP9A 1KM7A 4YTNB 1XT9B 1LO5D 3AH7A 2KDBA 4KDLB 1QOAA 1K50A 3UIPB 2GLSA 1WJ4A 1J7AA 1ZDVA 1DYQA 2K1FA 1QQRA 3U8ZA 4FXCA 1WX8A 4WIPA 3ALBA 3A9JA 4W9EA 4O1NA 4PK1A 3ZVVA 2MHJA 3VTVA 2IY0B 4C00A 2W82A 2R2OA 3ZNZB 1EWCA 4AWJA 1WJNA 4IW0A 4ASWC 3M63B 1YOVB 2HDEA 2N9LA 3FAHA 1GJZA 2KDEB 3KWLA 2IO1B 2BS4B 2EKIA 4KSKC 1SJED 5AEKB 2K22A 3NVVA 1WSPA 1MPEA 1XLOA 2ZNVB 4MM3A 1V9JA 1ROEA 2V4LA 2DAFA 4RF0A 4BOZB 4WWNA 5IN7A 3LYYA 3DVNU 2KQ7A 2UU7A 3Q8CA 2PTLA 4BKSD 1RFAA 2YEPB 2UWQA 4B95A 3FILA 2N9KA 3R66C 2O6VA 1L0VB 2LJ5A 3B0AA 1ZP0B 1WXMA 2L52A 4ZHPA 2MBQA 2KFJA 1RAXA 2N0SB 1E6EB 2FUG1 3ABVB 4FHJA 1I4HA 5D6JB 4HCPB 2RGFA 2KN5A 1JW9D 3KUDB 3Q3NC 3NZSA 1K53A 4OZAA 2C60A 4WWMA 3V62A 4DHZB 3N20C 1QT9A 2L8JA 2ZZPB 2WXIA 2KDMA 1F9JA 3A1QA 2MEKA 1ZKHA 1JRPA 2KC1A 2SEBD 4US8A 3RNCC 3A4RA 4L2YA 2LUMA 3O13A 1N63A 2JWUA 1L7YA 4EZKA 3V3XA 1GNUA 1TZOA 3DBHB 2KMMA 5C1ZA 1L0YB 4DDID 2PJHA 3BINA 3PZDA 1NBFC 1WH3A 1ACCA 1HTQA 3VDZA 4YSZB 2LI5A 2D3AA 4P1CC 1TKEA 1HZ6A 3AEDB 2GBNA 4A9AA 1ZE3D 3HHMA 2KWCA 3IVFA 3ZNHB 1TS5A 3EECA 1HE8A 1WE7A 1I35A 2KX3A 5H8YE 4IWQA 3VAWA 1C1YB 3AE7B 5IKCM 3PZ7A 2BB5A 3TBLD 2D5GA 4MJSA 2WXJA 4RH6A 4OHJA 4HKQA 3L13A 2INDC 3ZDMC 1OGWA 3SR6A 3X23A 1YX6B 1S3SG 2MBHA 1L2NA 3BZDB 4KZ0A 4FN2A 2WXMA 4W9DA 1DOIA 2QILA 3QJZA 1T0QC 2EMTA 3DBSA 2BWES 4K3BA 1WRIA 2VZKB 2XNAC 4A20A 2RMMA 4TKNA 4EFOA 5L95C 1L0XB 2WHIA 2Z59B 2N7JA 4ARCA 1WRDB 4GGQA 1RLFA 4DWFA 1TJEA 4NJ7A 3KWVA 3L0WB 3LJ3A 3AE9B 1GPXA 3NZ3A 3EA6A 3S2AA 5AZGA 4JIOU 2KKCA 2WWZA 2KOXA 1F52A 3R3MA 3AE8B 4RMAA 2CU1A 3DQVA 3MC0B 2J0MA 2DX5B 3U7ZA 3HM3A 1WXQA 5IA7A 1TS2A 2E6XA 5HG2A 1YD8U 1EUVB 1SBBB 2LGYA 1UNSA 1WM2A 4M00A 4RCOA 2NVUI 1WGGA 1KLVA 2KTRB 4ZHOA 3UINB 3Q3FA 4YXDB 2DBYA 1F1HA 2WP9B 1C77A 3U52E 2MX2A 2WXRA 5LXHA 3KH0A 4H2AA 4DHZE 2JXXA 3WA0A 4AJWA 5J2RA 1BXTA 2X8XX 2D3GA 3N1YC 2JZPA 2XEWA 1JALA 3DCGA 1BT0A 5BO4B 3HUIA 1YMHE 4AUQC 1WMHA 2D07B 2G4SA 2X38A 4E3CA 1V2YA 3B1LX 1UGJA 4HLEA 1Q1OA 2ASQA 1U4AA 4JQWC 4N58A 3OWEB 4A55A 1WF9A 2KWVB 3WCQA 4D2KA 4NAWA 1BUIC 4XDCA 2KWDA 3H9DA 4KZCA 4I6PA 1JWSD 2IO2B 2V4IB 4N6EB 1VR9A 3PGEA 3PS6A 5TSSA 2RDHA 5DCNA 2GBJA 2KYWA 1D6EC 1XLNA 1IYFA 3N1XC 3V61A 2ZW0A 4IDIA 4DHJD 1GUAB 5C2TB 2A4ZA 1AYFA 2JX5A 2IO3B 3PRPB 2DZKA 2NBUA 4E71A 4LNKA 2N4FA 3JYUA 3VQIA 2N9XA 2QIEB 3VFKA 2KFKB 1FNVA 1PYWD 3EFCA 3ZLZA 2FCMA 2K9XA 2W3RA 3DPDA 2WDRB 1F2RC 1QLBB 3ZJTA 3P1MA 4I6NB 3IFWB 3AEFB 4HRSA 1TBEA 3ZQ4A 1H4RA 3DWMA 2LFIA 2J4XA 3R2IA 1KJTA 2KTFA 2IYDB 1UWXA 3PVLA 4MH8A 2KAJA 1KFYB 4C4VA 4EEWA 4DXAB 3UIOB 1T3QA 4YWGG 2DAJA 1UELA 2D2QA 2AQ3B 1XCQL 1JMLA 4ARIA 4J6IA 4ITKA 1YQBA 4FJYA 3A4SC 5MPOA 3QIJA 1FCCC 2MCNB 3FC4A 2KANA 4KX6B 1WJUA 1XCTL 3GE8C 1I7HA 2MWSB 1F77A 1L4DB 2D3BA 3GP7A 4HK2A 5EE9A 3VUYA 4LNIA 1V49A 2IDYA 3VRAB 2BBCA 4MH0E 2MQJA 1V1PA 2CHZA 3RNFC 2QDFA 1YJ1A 1GC7A 3W5VB 2REXA 4F8CB 4OZBA 1UH6A 4IM3A 3JSVB 2LGDA 3DOWA 3N32A 2BQQA 2K6DB 3MHZA 5HI1A 2KJRA 1R4MB 4W9GA 3M62B 3UF8A 4XWTA 2AWTA 4YTMB 1OTRB 2WXNA 2LMCA 2DLBA 3TEWA 4JGHB 3Q14C 3C0RB 4GDLA 2BS3B 3NVWA 2NMQA 1DOYA 2NBVB 2JYTA 2WGSA 3W1SC 3ZO5B 4P6VF 2QHOA 1CMXB 4NZLB 1IPGA 3AE5B 2KJ6A 2XK5B 5CHWA 3Q69A 4M8MA 4LDTB 4BVUC 1WM3A 2R2QA 2WDVB 2MJEA 2DHZA 1UZXB 1NEKB 1WX9A 1WXVA 3SD5A 1I42A 4LJPB 4G11A 3TEZA 3ZKJC 5D94A 4IWPA 2A5UA 2ACZB 4ZRIA 2TSSA 4RNAA 2LRWA 3RFZB 3L17A 4EOYA 2WX1A 2INPE 2FCSA 4RGNA 2ZCBA 3ENEA 1L5PA 1QZEA 2RPVA 2VH1A 3K9OB 2I2YA 2NPTA 4EKUA 1WFYA 4HXDA 1YJJA 2V9HA 2D11A 2I1KA 1FCLA 1PGXA 3CIRB 3U2SC 3TIXA 2INNE 4I6LB 2RSUA 1SE2A 3I57A 3NS8A 3VH3B 3PLVA 4EZJA 3TSSA 2GB1A 3AEGB 4HVBA 2JU6X 5EE1A 1WIAA 3IXSA 5HKHA 1A70A 2M0XA 3ZJVA 4YL8A 2AL3A 3R8BA 2NTTA 4XX5A 2O2VB 3SEBA 3PRZA 3QWZB 5IAAC 4M0WA 4M8NA 5EE0A 3VRBB 4TMAB 4C80A 2L00B 3GB1A 4HEA1 3OJ3A 2HD5B 4LNFA 3HRDD 4BOSC 3M3JA 2CU3A 3AEEB 1D5ZC 2VZKD 1OQYA 1C9FA 2L3ZA 1J19A 4L23A 1LM8B 1VCBA 1P0RA 2H89B 2FIDA 2ZPYA 1PFDA 3SFDB 3Q3JA 2KO3A 2WQYB 2M17A 4LJOB 2CJNA 2DYOA 1YQ4B 1WE6A 2EMSA 3AM9A 3OAWA 1XD3B 2DYBA 4ACFA 3H1UA 4HKZE 1MI0A 5D7GA 2G4DB 3T8MA 1SE4A 3NZUA 3L16A 3P4SB 3Q8FA 2BF8B 1I4QA 4DXGA 3BK2A 3PHWB 2MW5A 3E56A 2BKFA 2LWPA 1X1MA 3N1ZC 4GLSC 4IM0A 3GS2A 5FKAC 1SF0A 1TZ1A 3P4RB 3W9CB 1C4AA 4MM3B 4XC2A 3KW5B 1TIFA 3A33B 4L1BA 3RZFA 2LXAA 4A6QA 4LTUA 1AN8A 1CK1A 3GOEA 4KGTA 3I63C 3L4PA 2SAKA 3QARA 1N60A 4XDDA 1VDVA 1WGRA 2IY1B 4FJVB 3DVGY 2M19A 5FK9C 2FAZA 1T6BX 2WXOA 2KD0A 4MELA 3RZWC 2FIFA 4URKA 1IBXB 1WGKA 1F0ZA 3UI3A 3ZNID 1IUEA 4K1RB 2K0PA 4KV2A 1P9DU 1C79A 4R3DA 1E8WA 1D3ZA 2WU5B 4W9LA 1T0RC 3RI7C 4BKSA 2WLBA 2KHWB 4X57B 1QKZA 2BPSA 2WDQB 5HHDG 1ZGUB 2J53A 5J17A 1P98A 1SSNA 2J52A 1UBIA 3U7DA 1SIFA 4W9JA 1LFDA 4LK0M 1ZPSA 4FHKA 2KJHB 1J8CA 5BYSA 4BKTA 4K3CA 3KYDD 2FCNA 5FR3A 2JVCA 3IHPC 2KQ4X 1UUPA 4ICVA 1XLQA 2PPHA 1D5MC 2NBWB 3R2TA 3J9CA 3NVYA 1V81A 2LGIA 2RPQA 3MHSD 4YTPB 3V6CB 1QF6A 2BWFA 1RM6C 1M94A 1OEYJ 1WY8A 2FNJB 5G5HA 3Q2AC 3SDLC 2KTRA 1UGMA 4PYUA 2N9EB 1WZ0A 3CMMB 4HJKA 1GOZA 4KIKB 2QEJC 2LD9A 3T9LA 1E10A 3P2BA 2MSED 1GB4A 3A9KB 4GN1A 3WAPA 1ZXIA 3B08A 2MLBA 1MVKA 3VTUA 4MGZE 1XQQA 2OHFA 4N9F4 3AB5A 3H6NA 4WJNA 1FO4A 1TGZB 4PS7A 2H88B 4NAMA 2QSDA 2ZPNA 1YN3A 4LNNA 1EF5A 1OQQA 2LVOA 3R7RA 1XXGA 2IGHA 3B2GA 3IBEA 5CHFA 3QHTA 3TEXA 4IG7B 4DK5A 2KACA 4GU2A 2ZEQA 5JH5C 4HROA 3RNEC 3VUWA 1C3TA 5E6JA 5JXVA 2HJ8A 4JWSC 4A3OA 2AL6A 2R61A 2D3CA 1F2RI 3ML9A 3WAMA 3TL5A 2MJDA 1P7EA 2YLMA 3PTFC 1P3QU 1TS3A 2KVRA 1PQSA 4MGYE 3BVZA 4MSMB 2XN9C 3QX1A 3VR8B 4RFBA 1GAQB 2KNBA 4G0NB 2ZCCA 4JL9A 5L83A 1GG3A 3ZTCA 1E8YA 3AEBB 1V1OA 2W54A 2JT4B 1JWUD 3Q3OC 2J0JA 2WS3B 2JWZA 2UYZB 3C8YA 2Y5BB 4GB9A 4A8XC 1ISNA 2HJ1A 1HXYD 1V5TA 2KFKA 1ZUD2 4CHKA 4YSXB 3NG0A 1QOGA 3PLUA 1TS4A 1T0SC 2RR9A 3M95A 1Q10A 4AS1A 1V5OA 2L0TA 2V0GA 4MDKE 5IO9A 2KT7A 3EHVA 4BBNC 1KLGD 1CZPA 3EUB2 4WURA 4QAYA 1YQ3B 4LDTD 4CQNA 1E7UA 2ICIA 4GMVA 2BVCA 2LUEA 3AE4B 2L05A 2JZZA 4GOCA 3ZTDA 1FRRA 3AN1A 5BMGA 5DPWA 2WXQA 1YNTE 1EM7A 1Q5WB 1TY2A 4LCDE 4EZLA 3ZYYX 3WIMA 3DBLI 3U30A 2JRHA 2DZMA 4WJPA 2IO0B 1FPYA 2INCC 1HTOA 1MJDA 3MJ5A 1WMHB 2N1WA 3VR9B 5H92C 1D5XC 2V1YA 5AUKA 2KX0A 5BYRA 3KYCD 1E8ZA 1I4GA 1XLPA 3AXCA 3MP9A 3UQAA 4EUTA 5T8IA 1VZ7A 1WZ3A 3BYTB 2JY6A 2GBRA 2L32A 2GBKA 2ONQA 4ANWA 2ZW1A 3BVGA 4S0RA 2BYTA 2E3TA 1E9MA 4IM2A 2MJ3A 2D10A 3PRMB 4IUMB 2MP2A 1WYWB 3JSVA 4ANVA 5LNK1 4GDKB 4JX1C 1I4XA 3EFUA 4ANUA 1FXTB 5FR6A 1Z2MA 3ZDTA 2C7MB 1QOBA 1UBQA 1L6VA 2CS4A 3NJTA 2KDFB 3H7SA 3APCA 2KLCA 1E0ZA 4BAXA 3MFGA 1VD2A 2L76A 3KQ4A 4HJGE 3TEYA 3ZW3A 3SU8X 3DDCB 2W9NA 3RULA 3JW0X 4C56C 2C9WB 4WAFA 2OEDA 1YIWA 1FNUA 4M02A 2G3QB 4XE0A 4XYCA 4ZYSA 1T5XD 2KLGA 1P7FA 2DZJA 2BYVE 2J0KA 4PS8A 5BYQA 1VRAB 1I4RA 4G50A 1NYRA 2L0FA 1Y56A 4JWUC 1LXDA 1N61A 4K7SA 2WX0A 2GMIC 2GBMA 2AQ2B 4C7YA 3PHXB 1R4NI 4PYZA 2RDBC 5D2MB 4P1BC 5GXGB 2AYOB 2JXTA 1UD7A 3V05A 1PGAA 3EGRA 1UWMA 3I5JC 2ZJDA 2WXPA 2LVPA 3DHGC 4KDIC 3HVZA 2PKOA 2LEKA 5IP4D 1FM0D
chains in the Genus database with same CATH topology
3L13A 3K9PB 3OJ4B 3MTNB 3ECIA 3ZDMC 1OQYA 1OGWA 1NI2A 1Q0WB 3DBRI 1YX6B 1S3SG 2L3ZA 1J19A 2MBHA 2NCNA 4GDKA 1LM8B 3VUXA 1L2NA 3EC8A 4B9KA 4KZ0A 4FN2A 4FJZA 1VCBA 4W9DA 1P0RA 3L08A 2FIDA 2ZPYA 5CX3A 4PS3A 3DVNV 3Q3JA 4KVGB 3QJZA 4KSLC 2N7DA 2XBBC 2KO3A 2KQSA 2M17A 2PEAA 2PE9A 4LJOB 3VHTC 3W1SA 1Y8RC 2DYOA 2EMTA 3DBSA 2BWES 1WE6A 2EMSA 3IG3A 4A20A 3OAWA 2G45B 4TKNA 4EFOA 4B6WA 5JZEB 5L95C 1XD3B 2DYBA 4IC7B 3H1UA 2Z59B 3N3KB 5D7GA 3GZNI 3N30A 2G4DB 5CTRC 3T8MA 4HDQA 3NZUA 4ANXA 1WRDB 4MGIE 4GGQA 3L16A 2BYFA 1RLFA 1SGHA 2BGFA 3CF6E 4GIVA 3H7PB 3PREA 4DWFA 1LQBA 2BF8B 4NQKE 4NJ7A 3L0WB 3LJ3A 3PHWB 2C5LC 4BFRA 2MW5A 3S2AA 2BKFA 1EO6A 5AZGA 4NAWB 1WGYA 1X1MA 2LWPA 4JIOU 2KKCA 4IM0A 1WGHA 2KOXA 2WWZA 3R3MA 5E6PA 4RMAA 2CU1A 4W9FA 5GMVA 5AZHA 2DENB 1TZ1A 3DQVA 3CSFA 2J0MA 5AZFA 2DX5B 3HM3A 5IA7A 4XC2A 2DZIA 1YD8U 1EUVB 3KW5B 4TV3A 4DDGD 3A33B 2LGYA 1V6EA 5DPRA 3DVGX 2M4NA 3RZFA 3RYTA 2O2VA 1WM2A 2LXAA 2VRRB 2MBEA 3ONSA 2NVUI 1WGGA 3GOEA 3L10B 1KLVA 2KTRB 3UINB 2J7QB 4ZYNA 2Z0DB 1J0GA 3Q3FA 2PE6B 2K8BA 3QARA 1WGRA 2IY1B 2V3SA 4FJVB 3DVGY 4G3XB 1E90A 3V6EB 2K6QA 2YVCA 3W1YA 2FAZA 4CYEA 5JHBA 1WGDA 2KD0A 4MELA 3RZWC 2MX2A 2KZRA 2FIFA 4URKA 5DPTA 5LXHA 3KH0A 3TMPB 3ZNID 4K1RB 2JXXA 4DHZE 3HK0A 3WA0A 4KV2A 5JHAA 1P9DU 4AJWA 1E8WA 2HE7A 3VH4B 1D3ZA 2ZVNA 2XK5A 3QC8B 3KUZA 3KUCB 5J2RA 2D3GA 4HCNB 4W9LA 2JUOA 2XEWA 4BKSA 3DCGA 3I3TB 3UGBB 4AOFA 4IWOA 2KHWB 4X57B 1BT0A 4HWIB 2BPSA 1V80A 1R4MI 2NR2A 5BO4B 5TR5A 1ZGUB 5G55A 1WXSA 4AUQC 5J17A 1P98A 1WMHA 1WR1A 3PV1A 2D07B 4F1SA 4MGKE 4FLHA 2G4SA 1UBIA 3U7DA 1H8CA 2KDIA 4E3CA 1SIFA 4W9JA 1LFDA 1V2YA 3B1LX 3H7PA 1Q1OA 2ASQA 4HLEA 3BY4B 4ZRJA 1U4AA 4FHKA 4JQWC 1WJ6A 3VVWB 4TUUA 1A5RA 2KJHB 5C23A 1WF9A 2KWVB 1J8CA 4BKTA 4NAWA 3KYDD 1YX5B 2FCNA 2MP2B 2EKEC 2JVCA 3IHPC 3WALA 4W9KA 2L7RA 4BBNF 1ZW7A 2K8CA 4ICVA 2ZVOA 1E5WA 2KK8A 2KWUB 3H9DA 3TJPA 4KZCA 4I6PA 2AEHA 2PPHA 2CR5A 2NBWB 4NPNA 2NPTB 3WANA 2IO2B 1V81A 2FUHB 2KMCA 2RPQA 3MHSD 1WXAA 3PGEA 3V6CB 2K25A 2BWFA 3PS6A 3PSEB 2WDTB 3PT2B 2K39A 5DCNA 2GBJA 1M94A 5LLIA 3KVFB 2JRIB 3APFA 1OEYJ 1WY8A 2MA9B 2FNJB 3A9JB 3SDLC 3ZNGC 2HTHA 2KTRA 1UGMA 1IYFA 4PYUA 3ML8A 4W9HA 3V61A 1G6JA 1T0YA 4II2B 2N9EB 3L54A 1WZ0A 2N7EA 2Z0EB 3CMMB 4HJKA 4DHJD 3QAQA 1GUAB 1JRUA 3QA8A 2A4ZA 2IO3B 3PRPB 4FULA 2DZKA 2NBUA 4K7WA 4KIKB 4CO7A 4E71A 2LD9A 4GSWA 3T9LA 2N4FA 3P2BA 5DPSA 1TTNA 2MSED 4FA6A 3JYUA 3A9KB 4GN1A 3VQIA 3WAPA 2N9XA 3B08A 2MLBA 3VTUA 4MGZE 3VFKA 1XQQA 3D32A 2KFKB 3VXWA 3RD2A 5KHQA 4WWPA 2IBIB 4N9F4 3ZLZA 2FCMA 4DHJB 3RUIB 4WAAA 1WI0A 3DPDA 3H6NA 4WJNA 4TQ0A 2IZVB 3JVZX 1TGZB 4PS7A 5E6NA 2ZPNA 2JZ3B 4I6NB 3IFWB 3NY5A 3PPAA 2OOBB 4NQLB 3ZRFA 1TBEA 1EF5A 2LVOA 4M0WB 1H4RA 2O6VD 4FBJB 3QK0A 3R7RA 1P1AA 4HDOA 4P7IA 1KJTA 2KTFA 3DBHI 3QQ8B 2IYDB 3IBEA 5CHFA 2LVQA 3PVLA 3QHTA 2WYQA 3UQBA 2C7NB 2I1JA 2LGXA 3MJWA 4GDLB 3V60A 4IG7B 2ZNVC 4DK5A 2MRPA 2KMAA 4GU2A 5JH5C 2ZEQA 3APDA 3VTWA 2LXCA 3VUWA 4W9IA 2N9PC 1C3TA 1IP9A 4EEWA 4BKGA 1RRBA 2HJ8A 3ZIMA 4DXAB 3UIOB 1KM7A 4AJYB 2DAJA 1UELA 2D2QA 2O6VB 1XT9B 2RD0A 3R7QA 4RM8A 4A3OA 2AL6A 2KDBA 4J6IA 1E7VA 4OVVA 1YQBA 4FJYA 4KDLB 3A4SC 2CHWA 3UIPB 4WJQA 3QIJA 1WJ4A 2K1FA 2MCNB 3ML9A 5G2NA 3WAMA 2KANA 3U8ZA 3TL5A 1EF1A 3O65B 2YLMA 1OEYA 1WJUA 3PTFC 1P3QU 1WX8A 4DBGA 4NJ6A 2KVRA 3ALBA 1PQSA 4MGYE 3A9JA 2MWSB 4W9EA 3VUYA 4HK2A 3ZVVA 3WAOA 2KC2A 1KOTA 4MSMB 3VTVA 2IY0B 5EDSA 1V49A 3QX1A 2KNBA 4G0NB 2ZCCA 2K8HA 4JL9A 5L83A 1GG3A 3CSTA 4MH0E 2MQJA 2R2OA 4ZRKA 3ZNZB 3ZTCA 1E8YA 2LZ6A 4AWJA 1MG8A 2CHZA 2JT4B 4KIKA 1YJ1A 1WJNA 2CHXA 2J0JA 4IW0A 1S1QB 2JWZA 2UYZB 2Y5BB 3A9KA 4GB9A 4ASWC 3M63B 1ISNA 1GC7A 4A3PA 4OVUA 1V5TA 2LASA 2REXA 2KFKA 4RM9A 4TQ1A 5LXIB 2CKHB 1GJZA 4F8CB 3A1QB 4K7UA 1UH6A 2KDEB 4CHKA 4IM3A 3JSVB 2LGDA 2IO1B 3DOWA 3PLUA 4KSKC 3N32A 2K6DB 4AP4C 2RR9A 5AEKB 3M95A 2KJRA 1V5OA 2B3AA 2L0TA 2ZNVB 4MM3A 4MDKE 1V9JA 4W9GA 2V4LA 2DAFA 3M62B 3UF8A 4GXBA 4BOZB 2AWTA 3EHVA 3AU5A 4WWNA 1OTRB 4W9CA 3RCZA 3RT3B 4BBNC 3DVNU 4MSQB 2KQ7A 5KHOA 4JGHB 4E74A 3C0RB 4II3B 4GDLA 1WR6E 4BKSD 4LDTD 1RFAA 1E7UA 4GMVA 2LUEA 2UWQA 2NBVB 2BKRB 4B95A 2L05A 2JZZA 4GOCA 3ZTDA 3W1SC 3ZO5B 1Z5SB 3R66C 2O6VA 3X0WA 2LJ5A 2QHOA 1CMXB 5DPWA 1Q5WB 1IPGA 5CHVC 4LCDE 3B0AA 1WXMA 4EZLA 2KJ6A 2DYMA 2XK5B 2MBQA 2KFJA 3WIMA 3DBLI 5CHWA 2JF5A 4M8MA 4LDTB 1RAXA 4ICUA 4BVUC 1WM3A 2JRHA 2DZMA 2MBBB 2R2QA 4HPLB 4WJPA 3U30A 1AARA 2IO0B 2LRUA 2DHZA 1UZXB 4WJOA 1WX9A 1WXVA 4FHJA 3SD5A 1I42A 1WMHB 2M1MA 4LJPB 4G11A 2RGFA 4HCPB 5D6JB 2N1WA 3ZKJC 2KN5A 2NS5A 2V1YA 3KUDB 2KX0A 5D94A 1NDDA 3KYCD 4FADA 1E8ZA 3NZSA 4IWPA 2A5UA 3AXCA 3UQAA 3HM6X 2C60A 4ZRIA 2FCQA 4EUTA 2GOWA 1WZ3A 3SHQA 3V62A 2LRWA 4MJSB 2JY6A 2GBRA 4DHZB 1K8RB 2GBKA 4ANWA 4HPMB 3HIZA 2L8JA 2ZZPB 4F7ZA 3L17A 1F9JA 2C7HA 4IM2A 3ZRCA 2D10A 4EOYA 3A1QA 2WX1A 1E8XA 3PRMB 2JPHA 2FCSA 2MP2A 1WYWB 3JSVA 4IUMB 4ANVA 1ZKHA 4GDKB 2ZCBA 3ENEA 4ANUA 3EFUA 1FXTB 3LDZE 1Z2MA 2KC1A 5FR6A 3ZDTA 3K9OB 1QZEA 2C7MB 3A4RA 1UBQA 3QCAA 4WQOB 3TCAA 2CS4A 2KDFB 3H7SA 2N1VA 3APCA 2NPTA 2KLCA 4EKUA 1WFYA 1L7YA 3OLMD 4HXDA 4EZKA 1V86A 1VD2A 2L76A 4XZ4A 3ZW3A 2D11A 1GNUA 4WWOA 2I1KA 3SU8X 3DDCB 2W9NA 3RULA 3JW0X 1WX7A 3X23A 5C1ZA 3AULA 4DDID 2PJHA 2C9WB 3BINA 3PZDA 1NBFC 1YIWA 3TIXA 2G3QB 2M8SA 1WH3A 3AU4A 3VDZA 4I6LB 4K81A 2KLGA 2RSUA 2DZJA 3NS8A 2LI5A 3PLVA 3VH3B 2BYVE 4EZJA 2J0KA 4PS8A 5E6OA 2BYEA 4G50A 2KXJA 4HVBA 2L0FA 1LXDA 1WIAA 4K7SA 4ZDVA 2GBNA 2WX0A 5HKHA 2OJRA 2GMIC 2M0XA 4NY0A 3NHEB 2GBMA 3HHMA 2KWCA 3PHXB 4YL8A 2AL3A 3IVFA 4MEMA 4XX5A 1R4NI 3ZNHB 3EECA 5J18A 1HE8A 1WE7A 4PYZA 1I35A 1GC6A 4JLCA 2KX3A 3VAWA 4IWQA 1SE9A 2O2VB 3AI5A 1C1YB 3PRZA 3QWZB 5D2MB 5IAAC 2AYOB 4M8NA 4NNJB 1UD7A 3NOBA 3TBLD 2ZJDA 2L00B 2MBOA 4MJSA 2LVPA 3ZUNA 4KDIC 3OJ3A 2HD5B 4BOSC 3M3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L13 A;  3K9P B;  3OJ4 B;  3MTN B;  3ECI A;  3ZDM C;  1OQY A;  1OGW A;  1NI2 A;  1Q0W B;  3DBR I;  1YX6 B;  1S3S G;  2L3Z A;  1J19 A;  2MBH A;  2NCN A;  4GDK A;  1LM8 B;  3VUX A;  1L2N A;  3EC8 A;  4B9K A;  4KZ0 A;  4FN2 A;  4FJZ A;  1VCB A;  4W9D A;  1P0R A;  3L08 A;  2FID A;  2ZPY A;  5CX3 A;  4PS3 A;  3DVN V;  3Q3J A;  4KVG B;  3QJZ A;  4KSL C;  2N7D A;  2XBB C;  2KO3 A;  2KQS A;  2M17 A;  2PEA A;  2PE9 A;  4LJO B;  3VHT C;  3W1S A;  1Y8R C;  2DYO A;  2EMT A;  3DBS A;  2BWE S;  1WE6 A;  2EMS A;  3IG3 A;  4A20 A;  3OAW A;  2G45 B;  4TKN A;  4EFO A;  4B6W A;  5JZE B;  5L95 C;  1XD3 B;  2DYB A;  4IC7 B;  3H1U A;  2Z59 B;  3N3K B;  5D7G A;  3GZN I;  3N30 A;  2G4D B;  5CTR C;  3T8M A;  4HDQ A;  3NZU A;  4ANX A;  1WRD B;  4MGI E;  4GGQ A;  3L16 A;  2BYF A;  1RLF A;  1SGH A;  2BGF A;  3CF6 E;  4GIV A;  3H7P B;  3PRE A;  4DWF A;  1LQB A;  2BF8 B;  4NQK E;  4NJ7 A;  3L0W B;  3LJ3 A;  3PHW B;  2C5L C;  4BFR A;  2MW5 A;  3S2A A;  2BKF A;  1EO6 A;  5AZG A;  4NAW B;  1WGY A;  1X1M A;  2LWP A;  4JIO U;  2KKC A;  4IM0 A;  1WGH A;  2KOX A;  2WWZ A;  3R3M A;  5E6P A;  4RMA A;  2CU1 A;  4W9F A;  5GMV A;  5AZH A;  2DEN B;  1TZ1 A;  3DQV A;  3CSF A;  2J0M A;  5AZF A;  2DX5 B;  3HM3 A;  5IA7 A;  4XC2 A;  2DZI A;  1YD8 U;  1EUV B;  3KW5 B;  4TV3 A;  4DDG D;  3A33 B;  2LGY A;  1V6E A;  5DPR A;  3DVG X;  2M4N A;  3RZF A;  3RYT A;  2O2V A;  1WM2 A;  2LXA A;  2VRR B;  2MBE A;  3ONS A;  2NVU I;  1WGG A;  3GOE A;  3L10 B;  1KLV A;  2KTR B;  3UIN B;  2J7Q B;  4ZYN A;  2Z0D B;  1J0G A;  3Q3F A;  2PE6 B;  2K8B A;  3QAR A;  1WGR A;  2IY1 B;  2V3S A;  4FJV B;  3DVG Y;  4G3X B;  1E90 A;  3V6E B;  2K6Q A;  2YVC A;  3W1Y A;  2FAZ A;  4CYE A;  5JHB A;  1WGD A;  2KD0 A;  4MEL A;  3RZW C;  2MX2 A;  2KZR A;  2FIF A;  4URK A;  5DPT A;  5LXH A;  3KH0 A;  3TMP B;  3ZNI D;  4K1R B;  2JXX A;  4DHZ E;  3HK0 A;  3WA0 A;  4KV2 A;  5JHA A;  1P9D U;  4AJW A;  1E8W A;  2HE7 A;  3VH4 B;  1D3Z A;  2ZVN A;  2XK5 A;  3QC8 B;  3KUZ A;  3KUC B;  5J2R A;  2D3G A;  4HCN B;  4W9L A;  2JUO A;  2XEW A;  4BKS A;  3DCG A;  3I3T B;  3UGB B;  4AOF A;  4IWO A;  2KHW B;  4X57 B;  1BT0 A;  4HWI B;  2BPS A;  1V80 A;  1R4M I;  2NR2 A;  5BO4 B;  5TR5 A;  1ZGU B;  5G55 A;  1WXS A;  4AUQ C;  5J17 A;  1P98 A;  1WMH A;  1WR1 A;  3PV1 A;  2D07 B;  4F1S A;  4MGK E;  4FLH A;  2G4S A;  1UBI A;  3U7D A;  1H8C A;  2KDI A;  4E3C A;  1SIF A;  4W9J A;  1LFD A;  1V2Y A;  3B1L X;  3H7P A;  1Q1O A;  2ASQ A;  4HLE A;  3BY4 B;  4ZRJ A;  1U4A A;  4FHK A;  4JQW C;  1WJ6 A;  3VVW B;  4TUU A;  1A5R A;  2KJH B;  5C23 A;  1WF9 A;  2KWV B;  1J8C A;  4BKT A;  4NAW A;  3KYD D;  1YX5 B;  2FCN A;  2MP2 B;  2EKE C;  2JVC A;  3IHP C;  3WAL A;  4W9K A;  2L7R A;  4BBN F;  1ZW7 A;  2K8C A;  4ICV A;  2ZVO A;  1E5W A;  2KK8 A;  2KWU B;  3H9D A;  3TJP A;  4KZC A;  4I6P A;  2AEH A;  2PPH A;  2CR5 A;  2NBW B;  4NPN A;  2NPT B;  3WAN A;  2IO2 B;  1V81 A;  2FUH B;  2KMC A;  2RPQ A;  3MHS D;  1WXA A;  3PGE A;  3V6C B;  2K25 A;  2BWF A;  3PS6 A;  3PSE B;  2WDT B;  3PT2 B;  2K39 A;  5DCN A;  2GBJ A;  1M94 A;  5LLI A;  3KVF B;  2JRI B;  3APF A;  1OEY J;  1WY8 A;  2MA9 B;  2FNJ B;  3A9J B;  3SDL C;  3ZNG C;  2HTH A;  2KTR A;  1UGM A;  1IYF A;  4PYU A;  3ML8 A;  4W9H A;  3V61 A;  1G6J A;  1T0Y A;  4II2 B;  2N9E B;  3L54 A;  1WZ0 A;  2N7E A;  2Z0E B;  3CMM B;  4HJK A;  4DHJ D;  3QAQ A;  1GUA B;  1JRU A;  3QA8 A;  2A4Z A;  2IO3 B;  3PRP B;  4FUL A;  2DZK A;  2NBU A;  4K7W A;  4KIK B;  4CO7 A;  4E71 A;  2LD9 A;  4GSW A;  3T9L A;  2N4F A;  3P2B A;  5DPS A;  1TTN A;  2MSE D;  4FA6 A;  3JYU A;  3A9K B;  4GN1 A;  3VQI A;  3WAP A;  2N9X A;  3B08 A;  2MLB A;  3VTU A;  4MGZ E;  3VFK A;  1XQQ A;  3D32 A;  2KFK B;  3VXW A;  3RD2 A;  5KHQ A;  4WWP A;  2IBI B;  4N9F 4;  3ZLZ A;  2FCM A;  4DHJ B;  3RUI B;  4WAA A;  1WI0 A;  3DPD A;  3H6N A;  4WJN A;  4TQ0 A;  2IZV B;  3JVZ X;  1TGZ B;  4PS7 A;  5E6N A;  2ZPN A;  2JZ3 B;  4I6N B;  3IFW B;  3NY5 A;  3PPA A;  2OOB B;  4NQL B;  3ZRF A;  1TBE A;  1EF5 A;  2LVO A;  4M0W B;  1H4R A;  2O6V D;  4FBJ B;  3QK0 A;  3R7R A;  1P1A A;  4HDO A;  4P7I A;  1KJT A;  2KTF A;  3DBH I;  3QQ8 B;  2IYD B;  3IBE A;  5CHF A;  2LVQ A;  3PVL A;  3QHT A;  2WYQ A;  3UQB A;  2C7N B;  2I1J A;  2LGX A;  3MJW A;  4GDL B;  3V60 A;  4IG7 B;  2ZNV C;  4DK5 A;  2MRP A;  2KMA A;  4GU2 A;  5JH5 C;  2ZEQ A;  3APD A;  3VTW A;  2LXC A;  3VUW A;  4W9I A;  2N9P C;  1C3T A;  1IP9 A;  4EEW A;  4BKG A;  1RRB A;  2HJ8 A;  3ZIM A;  4DXA B;  3UIO B;  1KM7 A;  4AJY B;  2DAJ A;  1UEL A;  2D2Q A;  2O6V B;  1XT9 B;  2RD0 A;  3R7Q A;  4RM8 A;  4A3O A;  2AL6 A;  2KDB A;  4J6I A;  1E7V A;  4OVV A;  1YQB A;  4FJY A;  4KDL B;  3A4S C;  2CHW A;  3UIP B;  4WJQ A;  3QIJ A;  1WJ4 A;  2K1F A;  2MCN B;  3ML9 A;  5G2N A;  3WAM A;  2KAN A;  3U8Z A;  3TL5 A;  1EF1 A;  3O65 B;  2YLM A;  1OEY A;  1WJU A;  3PTF C;  1P3Q U;  1WX8 A;  4DBG A;  4NJ6 A;  2KVR A;  3ALB A;  1PQS A;  4MGY E;  3A9J A;  2MWS B;  4W9E A;  3VUY A;  4HK2 A;  3ZVV A;  3WAO A;  2KC2 A;  1KOT A;  4MSM B;  3VTV A;  2IY0 B;  5EDS A;  1V49 A;  3QX1 A;  2KNB A;  4G0N B;  2ZCC A;  2K8H A;  4JL9 A;  5L83 A;  1GG3 A;  3CST A;  4MH0 E;  2MQJ A;  2R2O A;  4ZRK A;  3ZNZ B;  3ZTC A;  1E8Y A;  2LZ6 A;  4AWJ A;  1MG8 A;  2CHZ A;  2JT4 B;  4KIK A;  1YJ1 A;  1WJN A;  2CHX A;  2J0J A;  4IW0 A;  1S1Q B;  2JWZ A;  2UYZ B;  2Y5B B;  3A9K A;  4GB9 A;  4ASW C;  3M63 B;  1ISN A;  1GC7 A;  4A3P A;  4OVU A;  1V5T A;  2LAS A;  2REX A;  2KFK A;  4RM9 A;  4TQ1 A;  5LXI B;  2CKH B;  1GJZ A;  4F8C B;  3A1Q B;  4K7U A;  1UH6 A;  2KDE B;  4CHK A;  4IM3 A;  3JSV B;  2LGD A;  2IO1 B;  3DOW A;  3PLU A;  4KSK C;  3N32 A;  2K6D B;  4AP4 C;  2RR9 A;  5AEK B;  3M95 A;  2KJR A;  1V5O A;  2B3A A;  2L0T A;  2ZNV B;  4MM3 A;  4MDK E;  1V9J A;  4W9G A;  2V4L A;  2DAF A;  3M62 B;  3UF8 A;  4GXB A;  4BOZ B;  2AWT A;  3EHV A;  3AU5 A;  4WWN A;  1OTR B;  4W9C A;  3RCZ A;  3RT3 B;  4BBN C;  3DVN U;  4MSQ B;  2KQ7 A;  5KHO A;  4JGH B;  4E74 A;  3C0R B;  4II3 B;  4GDL A;  1WR6 E;  4BKS D;  4LDT D;  1RFA A;  1E7U A;  4GMV A;  2LUE A;  2UWQ A;  2NBV B;  2BKR B;  4B95 A;  2L05 A;  2JZZ A;  4GOC A;  3ZTD A;  3W1S C;  3ZO5 B;  1Z5S B;  3R66 C;  2O6V A;  3X0W A;  2LJ5 A;  2QHO A;  1CMX B;  5DPW A;  1Q5W B;  1IPG A;  5CHV C;  4LCD E;  3B0A A;  1WXM A;  4EZL A;  2KJ6 A;  2DYM A;  2XK5 B;  2MBQ A;  2KFJ A;  3WIM A;  3DBL I;  5CHW A;  2JF5 A;  4M8M A;  4LDT B;  1RAX A;  4ICU A;  4BVU C;  1WM3 A;  2JRH A;  2DZM A;  2MBB B;  2R2Q A;  4HPL B;  4WJP A;  3U30 A;  1AAR A;  2IO0 B;  2LRU A;  2DHZ A;  1UZX B;  4WJO A;  1WX9 A;  1WXV A;  4FHJ A;  3SD5 A;  1I42 A;  1WMH B;  2M1M A;  4LJP B;  4G11 A;  2RGF A;  4HCP B;  5D6J B;  2N1W A;  3ZKJ C;  2KN5 A;  2NS5 A;  2V1Y A;  3KUD B;  2KX0 A;  5D94 A;  1NDD A;  3KYC D;  4FAD A;  1E8Z A;  3NZS A;  4IWP A;  2A5U A;  3AXC A;  3UQA A;  3HM6 X;  2C60 A;  4ZRI A;  2FCQ A;  4EUT A;  2GOW A;  1WZ3 A;  3SHQ A;  3V62 A;  2LRW A;  4MJS B;  2JY6 A;  2GBR A;  4DHZ B;  1K8R B;  2GBK A;  4ANW A;  4HPM B;  3HIZ A;  2L8J A;  2ZZP B;  4F7Z A;  3L17 A;  1F9J A;  2C7H A;  4IM2 A;  3ZRC A;  2D10 A;  4EOY A;  3A1Q A;  2WX1 A;  1E8X A;  3PRM B;  2JPH A;  2FCS A;  2MP2 A;  1WYW B;  3JSV A;  4IUM B;  4ANV A;  1ZKH A;  4GDK B;  2ZCB A;  3ENE A;  4ANU A;  3EFU A;  1FXT B;  3LDZ E;  1Z2M A;  2KC1 A;  5FR6 A;  3ZDT A;  3K9O B;  1QZE A;  2C7M B;  3A4R A;  1UBQ A;  3QCA A;  4WQO B;  3TCA A;  2CS4 A;  2KDF B;  3H7S A;  2N1V A;  3APC A;  2NPT A;  2KLC A;  4EKU A;  1WFY A;  1L7Y A;  3OLM D;  4HXD A;  4EZK A;  1V86 A;  1VD2 A;  2L76 A;  4XZ4 A;  3ZW3 A;  2D11 A;  1GNU A;  4WWO A;  2I1K A;  3SU8 X;  3DDC B;  2W9N A;  3RUL A;  3JW0 X;  1WX7 A;  3X23 A;  5C1Z A;  3AUL A;  4DDI D;  2PJH A;  2C9W B;  3BIN A;  3PZD A;  1NBF C;  1YIW A;  3TIX A;  2G3Q B;  2M8S A;  1WH3 A;  3AU4 A;  3VDZ A;  4I6L B;  4K81 A;  2KLG A;  2RSU A;  2DZJ A;  3NS8 A;  2LI5 A;  3PLV A;  3VH3 B;  2BYV E;  4EZJ A;  2J0K A;  4PS8 A;  5E6O A;  2BYE A;  4G50 A;  2KXJ A;  4HVB A;  2L0F A;  1LXD A;  1WIA A;  4K7S A;  4ZDV A;  2GBN A;  2WX0 A;  5HKH A;  2OJR A;  2GMI C;  2M0X A;  4NY0 A;  3NHE B;  2GBM A;  3HHM A;  2KWC A;  3PHX B;  4YL8 A;  2AL3 A;  3IVF A;  4MEM A;  4XX5 A;  1R4N I;  3ZNH B;  3EEC A;  5J18 A;  1HE8 A;  1WE7 A;  4PYZ A;  1I35 A;  1GC6 A;  4JLC A;  2KX3 A;  3VAW A;  4IWQ A;  1SE9 A;  2O2V B;  3AI5 A;  1C1Y B;  3PRZ A;  3QWZ B;  5D2M B;  5IAA C;  2AYO B;  4M8N A;  4NNJ B;  1UD7 A;  3NOB A;  3TBL D;  2ZJD A;  2L00 B;  2MBO A;  4MJS A;  2LVP A;  3ZUN A;  4KDI C;  3OJ3 A;  2HD5 B;  4BOS C;  3M3J A; 
#chains in the Genus database with same CATH topology
 2MH7 A;  3OJ4 B;  3MTN B;  1Q0W B;  2WNM A;  2NCN A;  3VUX A;  3EC8 A;  1R4N B;  4FJZ A;  3L08 A;  2K5P A;  1NI3 A;  4PS3 A;  4KVG B;  1TYG B;  4KSL C;  2PEA A;  3DHH C;  3AE2 B;  2CJO A;  3RN9 C;  2IGG A;  3IG3 A;  4P16 A;  2G45 B;  2PMV A;  4IC7 B;  1YJI A;  3Q8A A;  3N3K B;  3GZN I;  3N30 A;  1HZ5 A;  4HDQ A;  4ANX A;  1C78 A;  4MGI E;  2BGF A;  3CF6 E;  3H7P B;  5BMH A;  2RDG A;  1OFF A;  4YSY B;  2J42 A;  2BW2 A;  4BFR A;  2JQR B;  1WGY A;  1EWY C;  1SB3 C;  2JSV X;  2JYE A;  5GMV A;  4WQM A;  2DEN B;  4OZC A;  3CSF A;  5AZF A;  4B0E A;  5D3I B;  3GZN B;  4TV3 A;  4DDG D;  5DPR A;  2O2V A;  2VRR B;  1RYJ A;  4J3O D;  1R7S A;  3L10 B;  1UF0 A;  2J7Q B;  1ET6 A;  1YN5 A;  3DHI C;  3AE3 B;  3C19 A;  3V6E B;  2Z8L A;  2YVC A;  3W1Y A;  4B0M A;  5JHB A;  1WGD A;  4HPP A;  2BT6 A;  4EE2 A;  2KZR A;  2QJL A;  2PVG C;  3HK0 A;  4ZRP A;  3U4E G;  2ZVN A;  4MAC A;  3KUC B;  2JUO A;  3UGB B;  1NVI D;  4HWI B;  2NR2 A;  5TR5 A;  4IKG A;  2LJI A;  5G55 A;  5C3J B;  1JWA D;  1WXS A;  1WR1 A;  3PV1 A;  4F1S A;  4MGK E;  4FLH A;  2B76 B;  1TT5 B;  2QMT A;  2L83 A;  4ZRJ A;  1WJ6 A;  1HA5 A;  3VVW B;  4TUU A;  2M0A A;  5C23 A;  1YX5 B;  1TKY A;  2G9H D;  3WAL A;  1ENF A;  5D3D A;  2L7R A;  4BBN F;  1C4P A;  1ZW7 A;  2K8C A;  1PUT A;  2KK8 A;  2CR5 A;  1FRD A;  4M01 A;  1K51 A;  3WAN A;  3Q8E A;  2NPT B;  2KVZ A;  2KMC A;  2I38 A;  1WXA A;  4Q2J A;  4RGT A;  3PSE B;  1MFW A;  3PT2 B;  2K39 A;  5LLI A;  1XEE A;  3A9J B;  3ZNG C;  4AQ7 A;  4KKJ A;  5BMI A;  3BYY B;  3ML8 A;  1G6J A;  1T0Y A;  4RGO S;  2N7E A;  2Z0E B;  1I4P A;  1JRU A;  4FUL A;  1ZOY B;  4K7W A;  4CO7 A;  1IBX A;  4GSW A;  1TTN A;  2M56 B;  1PGB A;  3ZXR A;  3VXW A;  5KHQ A;  1SIJ A;  2IBI B;  1NYQ A;  3RUI B;  4WAA A;  3T3N A;  1TY0 A;  2PLP A;  2DNF A;  1ZDX A;  4RGM A;  2PIA A;  2EEL A;  2OOB B;  4NQL B;  1C4C A;  3ZRF A;  4M0W B;  3N9Y C;  3IAM 1;  2PVO D;  4HDO A;  1KLU D;  3ETR A;  3DBH I;  3QQ8 B;  2WYQ A;  2AQ1 B;  3MJW A;  3V60 A;  2GI9 A;  2ZNV C;  3LXF A;  2KMA A;  3APD A;  3IT6 B;  4W9I A;  2N9P C;  2QC8 A;  4BKG A;  1RRB A;  3FIL B;  3ZIM A;  4AJY B;  2O6V B;  2RD0 A;  3R7Q A;  3NVZ A;  4RM8 A;  1E7V A;  2QCZ A;  4OVV A;  3RMK C;  2CHW A;  4WJQ A;  1LGR A;  1QIL A;  5G2N A;  1EF1 A;  3O65 B;  1OEY A;  3Q3M C;  1KTK A;  4DBG A;  4NJ6 A;  1KF6 B;  3AEA B;  3WAO A;  2KC2 A;  1KOT A;  5EDS A;  4PT5 A;  2K8H A;  1TKG A;  4WH4 A;  3CST A;  3TUO A;  4ZRK A;  2LZ6 A;  1MG8 A;  4KIK A;  1J7C A;  4XWW A;  1V8C A;  2CHX A;  1S1Q B;  2LHD A;  3A9K A;  1PDX A;  4UDU C;  4A3P A;  4OVU A;  5I4D A;  3ZGZ A;  2LAS A;  4RM9 A;  4TQ1 A;  5LXI B;  2CKH B;  3A1Q B;  4K7U A;  1XO3 A;  1OQR A;  4LNO A;  4RF1 A;  4AP4 C;  2G1E A;  3BII D;  2V3N A;  2B3A A;  2WXL A;  4C7Z A;  2LGS A;  4GXB A;  3RT3 B;  3AU5 A;  2WXG A;  3RCZ A;  4W9C A;  4A90 A;  5G5G A;  4MSQ B;  1MHH E;  5KHO A;  4E74 A;  2W3S A;  4II3 B;  4MT5 A;  1WR6 E;  1FEH A;  2BKR B;  2AX5 A;  4YT0 B;  4NJC A;  1Z5S B;  3X0W A;  2Q5W D;  1RFK A;  5CHV C;  4JPS A;  2DYM A;  4KGS A;  2JF5 A;  1FXA A;  4ICU A;  2ON8 A;  1ESF A;  4HPL B;  2MBB B;  2BS2 B;  1AAR A;  3AEC B;  3ZXV A;  2LRU A;  1MHX A;  1FIQ A;  4WJO A;  2M1M A;  2NS5 A;  1NEN B;  1NDD A;  4FAD A;  3HM6 X;  2FCQ A;  1C76 A;  2GOW A;  3SHQ A;  1N5X A;  4MJS B;  3RNG C;  1WYG A;  1K8R B;  4HPM B;  3HIZ A;  4F7Z A;  2C7H A;  3ZRC A;  1KRH A;  1E8X A;  1JQ4 A;  2JPH A;  1FNW A;  4XGA B;  2LHE A;  2WU2 B;  3IT4 B;  1SE3 A;  3LDZ E;  3P4Q B;  3QCA A;  4WQO B;  3TCA A;  4DQO C;  2N1V A;  3PZ8 A;  3OLM D;  5AUI A;  1JRO A;  1V86 A;  1FFU A;  3H8H A;  2Y3A A;  4XZ4 A;  4WWO A;  1WX7 A;  3AUL A;  2M8S A;  3AU4 A;  4K81 A;  4N59 A;  1GB1 A;  3KLS X;  5E6O A;  2BYE A;  2KXJ A;  3B9J A;  3LB8 C;  4ZDV A;  1HQR D;  2OJR A;  1SXT A;  4NY0 A;  3NHE B;  1J7B A;  4MEM A;  4USA A;  1B9R A;  1L6U A;  2WXK A;  5J18 A;  1GC6 A;  4JLC A;  4OW0 A;  2WXF A;  1SE9 A;  3AI5 A;  1K52 A;  4NNJ B;  3NOB A;  3Q8B A;  4REZ A;  2Y5C A;  1JWM D;  4JE3 B;  2MBO A;  3ZUN A;  1WWT A;  3B2F A;  3IAS 1;  3AMZ A;  4KKI A;  2IPK D;  3GE3 C;  3K9P B;  1D4B A;  2K3U A;  3ECI A;  1N62 A;  2GRI A;  1NI2 A;  3DBR I;  4GDK A;  4B9K A;  1FXI A;  1VZ8 A;  2HTM E;  5CX3 A;  3T3O A;  1ZXH A;  3DVN V;  2N7D A;  2XBB C;  2KQS A;  2PE9 A;  3W2D A;  3VHT C;  3W1S A;  3URY A;  1Y8R C;  3P63 A;  1AWD A;  4B6W A;  5JZE B;  3AE6 B;  1V97 A;  5CTR C;  1SEB D;  3NS1 A;  2BYF A;  2VH2 A;  1SGH A;  4GIV A;  3DBR B;  1E7P B;  3PRE A;  1LQB A;  4NQK E;  2DWQ A;  2V3P A;  2C5L C;  3Q6B A;  1EO6 A;  1B1Z A;  1VJK A;  4NAW B;  4OVZ A;  4US9 A;  2L1A A;  3DBL B;  1WGH A;  5E6P A;  1YN4 A;  4LLG M;  4W9F A;  5AZH A;  3AV8 A;  5HFY A;  4ZOH C;  2DZI A;  2OJW A;  1N6Z A;  3BK1 A;  1V6E A;  3RYT A;  3DVG X;  2M4N A;  4S17 A;  1M4V A;  2MBE A;  1CQV A;  3ONS A;  5IOI A;  1FD6 A;  4ZYN A;  2Z0D B;  1VLB A;  3MC9 A;  1J0G A;  2PE6 B;  2K8B A;  2YEP F;  2V3S A;  1EU3 A;  4G3X B;  1E90 A;  2K6Q A;  4CYE A;  1HEZ E;  5DPT A;  3TMP B;  1JCK B;  5JHA A;  2FBW B;  2HE7 A;  3VH4 B;  4ZRQ A;  2XK5 A;  3QC8 B;  3KUZ A;  4HCN B;  3I3T B;  4AOF A;  3BVM A;  4IWO A;  1STE A;  3W5U B;  1V80 A;  1R4M I;  3E9S A;  2BTE A;  1VZ6 A;  2FE8 A;  2WXH A;  1H8C A;  2KDI A;  3MC8 A;  3H7P A;  3BY4 B;  2KN4 A;  1A5R A;  1SJH D;  2IGD A;  4C4V B;  2BB6 A;  2MP2 B;  2EKE C;  1AW7 A;  4W9K A;  5EE3 A;  1IGD A;  1CJE A;  2ZVO A;  1E5W A;  2KWU B;  3TJP A;  2W55 A;  2AEH A;  1RWS A;  4NPN A;  3P42 A;  1IGC A;  2FUH B;  3P4P B;  3DWG C;  3OG5 A;  3AE1 B;  3RNA C;  1KH0 A;  2K25 A;  3RPF C;  2WDT B;  1DOX A;  2IJ0 A;  3ZJU A;  3KVF B;  2JRI B;  3APF A;  4BZA A;  3BWU D;  2MA9 B;  2HTH A;  1FFV A;  4W9H A;  1N5W A;  3NRZ A;  4II2 B;  2Y5P A;  3L54 A;  3QAQ A;  1V1P B;  3PO0 A;  3QA8 A;  1XF5 L;  2NTS A;  4IOI E;  4KGR A;  5DPS A;  4FA6 A;  1QOF A;  3I9V 1;  3D32 A;  3RD2 A;  4WWP A;  4DHJ B;  3CWI A;  3HVD A;  1WI0 A;  2PW9 A;  3RNB C;  4TQ0 A;  2IZV B;  3JVZ X;  1FMA D;  5E6N A;  2JZ3 B;  1ET9 A;  3NY5 A;  3PPA A;  1MG4 A;  2O6V D;  4FBJ B;  1EU4 A;  3QK0 A;  3FKY A;  3NUH B;  1BML C;  1P1A A;  1JWB D;  4P7I A;  2LVQ A;  1L4Z B;  3UQB A;  2C7N B;  2I1J A;  2LGX A;  4GDL B;  2MRP A;  3SFE B;  3VTW A;  2LXC A;  4TSS A;  1DGJ A;  4DXF A;  1IP9 A;  1KM7 A;  4YTN B;  1XT9 B;  1LO5 D;  3AH7 A;  2KDB A;  4KDL B;  1QOA A;  1K50 A;  3UIP B;  2GLS A;  1WJ4 A;  1J7A A;  1ZDV A;  1DYQ A;  2K1F A;  1QQR A;  3U8Z A;  4FXC A;  1WX8 A;  4WIP A;  3ALB A;  3A9J A;  4W9E A;  4O1N A;  4PK1 A;  3ZVV A;  2MHJ A;  3VTV A;  2IY0 B;  4C00 A;  2W82 A;  2R2O A;  3ZNZ B;  1EWC A;  4AWJ A;  1WJN A;  4IW0 A;  4ASW C;  3M63 B;  1YOV B;  2HDE A;  2N9L A;  3FAH A;  1GJZ A;  2KDE B;  3KWL A;  2IO1 B;  2BS4 B;  2EKI A;  4KSK C;  1SJE D;  5AEK B;  2K22 A;  3NVV A;  1WSP A;  1MPE A;  1XLO A;  2ZNV B;  4MM3 A;  1V9J A;  1ROE A;  2V4L A;  2DAF A;  4RF0 A;  4BOZ B;  4WWN A;  5IN7 A;  3LYY A;  3DVN U;  2KQ7 A;  2UU7 A;  3Q8C A;  2PTL A;  4BKS D;  1RFA A;  2YEP B;  2UWQ A;  4B95 A;  3FIL A;  2N9K A;  3R66 C;  2O6V A;  1L0V B;  2LJ5 A;  3B0A A;  1ZP0 B;  1WXM A;  2L52 A;  4ZHP A;  2MBQ A;  2KFJ A;  1RAX A;  2N0S B;  1E6E B;  2FUG 1;  3ABV B;  4FHJ A;  1I4H A;  5D6J B;  4HCP B;  2RGF A;  2KN5 A;  1JW9 D;  3KUD B;  3Q3N C;  3NZS A;  1K53 A;  4OZA A;  2C60 A;  4WWM A;  3V62 A;  4DHZ B;  3N20 C;  1QT9 A;  2L8J A;  2ZZP B;  2WXI A;  2KDM A;  1F9J A;  3A1Q A;  2MEK A;  1ZKH A;  1JRP A;  2KC1 A;  2SEB D;  4US8 A;  3RNC C;  3A4R A;  4L2Y A;  2LUM A;  3O13 A;  1N63 A;  2JWU A;  1L7Y A;  4EZK A;  3V3X A;  1GNU A;  1TZO A;  3DBH B;  2KMM A;  5C1Z A;  1L0Y B;  4DDI D;  2PJH A;  3BIN A;  3PZD A;  1NBF C;  1WH3 A;  1ACC A;  1HTQ A;  3VDZ A;  4YSZ B;  2LI5 A;  2D3A A;  4P1C C;  1TKE A;  1HZ6 A;  3AED B;  2GBN A;  4A9A A;  1ZE3 D;  3HHM A;  2KWC A;  3IVF A;  3ZNH B;  1TS5 A;  3EEC A;  1HE8 A;  1WE7 A;  1I35 A;  2KX3 A;  5H8Y E;  4IWQ A;  3VAW A;  1C1Y B;  3AE7 B;  5IKC M;  3PZ7 A;  2BB5 A;  3TBL D;  2D5G A;  4MJS A;  2WXJ A;  4RH6 A;  4OHJ A;  4HKQ A;  3L13 A;  2IND C;  3ZDM C;  1OGW A;  3SR6 A;  3X23 A;  1YX6 B;  1S3S G;  2MBH A;  1L2N A;  3BZD B;  4KZ0 A;  4FN2 A;  2WXM A;  4W9D A;  1DOI A;  2QIL A;  3QJZ A;  1T0Q C;  2EMT A;  3DBS A;  2BWE S;  4K3B A;  1WRI A;  2VZK B;  2XNA C;  4A20 A;  2RMM A;  4TKN A;  4EFO A;  5L95 C;  1L0X B;  2WHI A;  2Z59 B;  2N7J A;  4ARC A;  1WRD B;  4GGQ A;  1RLF A;  4DWF A;  1TJE A;  4NJ7 A;  3KWV A;  3L0W B;  3LJ3 A;  3AE9 B;  1GPX A;  3NZ3 A;  3EA6 A;  3S2A A;  5AZG A;  4JIO U;  2KKC A;  2WWZ A;  2KOX A;  1F52 A;  3R3M A;  3AE8 B;  4RMA A;  2CU1 A;  3DQV A;  3MC0 B;  2J0M A;  2DX5 B;  3U7Z A;  3HM3 A;  1WXQ A;  5IA7 A;  1TS2 A;  2E6X A;  5HG2 A;  1YD8 U;  1EUV B;  1SBB B;  2LGY A;  1UNS A;  1WM2 A;  4M00 A;  4RCO A;  2NVU I;  1WGG A;  1KLV A;  2KTR B;  4ZHO A;  3UIN B;  3Q3F A;  4YXD B;  2DBY A;  1F1H A;  2WP9 B;  1C77 A;  3U52 E;  2MX2 A;  2WXR A;  5LXH A;  3KH0 A;  4H2A A;  4DHZ E;  2JXX A;  3WA0 A;  4AJW A;  5J2R A;  1BXT A;  2X8X X;  2D3G A;  3N1Y C;  2JZP A;  2XEW A;  1JAL A;  3DCG A;  1BT0 A;  5BO4 B;  3HUI A;  1YMH E;  4AUQ C;  1WMH A;  2D07 B;  2G4S A;  2X38 A;  4E3C A;  1V2Y A;  3B1L X;  1UGJ A;  4HLE A;  1Q1O A;  2ASQ A;  1U4A A;  4JQW C;  4N58 A;  3OWE B;  4A55 A;  1WF9 A;  2KWV B;  3WCQ A;  4D2K A;  4NAW A;  1BUI C;  4XDC A;  2KWD A;  3H9D A;  4KZC A;  4I6P A;  1JWS D;  2IO2 B;  2V4I B;  4N6E B;  1VR9 A;  3PGE A;  3PS6 A;  5TSS A;  2RDH A;  5DCN A;  2GBJ A;  2KYW A;  1D6E C;  1XLN A;  1IYF A;  3N1X C;  3V61 A;  2ZW0 A;  4IDI A;  4DHJ D;  1GUA B;  5C2T B;  2A4Z A;  1AYF A;  2JX5 A;  2IO3 B;  3PRP B;  2DZK A;  2NBU A;  4E71 A;  4LNK A;  2N4F A;  3JYU A;  3VQI A;  2N9X A;  2QIE B;  3VFK A;  2KFK B;  1FNV A;  1PYW D;  3EFC A;  3ZLZ A;  2FCM A;  2K9X A;  2W3R A;  3DPD A;  2WDR B;  1F2R C;  1QLB B;  3ZJT A;  3P1M A;  4I6N B;  3IFW B;  3AEF B;  4HRS A;  1TBE A;  3ZQ4 A;  1H4R A;  3DWM A;  2LFI A;  2J4X A;  3R2I A;  1KJT A;  2KTF A;  2IYD B;  1UWX A;  3PVL A;  4MH8 A;  2KAJ A;  1KFY B;  4C4V A;  4EEW A;  4DXA B;  3UIO B;  1T3Q A;  4YWG G;  2DAJ A;  1UEL A;  2D2Q A;  2AQ3 B;  1XCQ L;  1JML A;  4ARI A;  4J6I A;  4ITK A;  1YQB A;  4FJY A;  3A4S C;  5MPO A;  3QIJ A;  1FCC C;  2MCN B;  3FC4 A;  2KAN A;  4KX6 B;  1WJU A;  1XCT L;  3GE8 C;  1I7H A;  2MWS B;  1F77 A;  1L4D B;  2D3B A;  3GP7 A;  4HK2 A;  5EE9 A;  3VUY A;  4LNI A;  1V49 A;  2IDY A;  3VRA B;  2BBC A;  4MH0 E;  2MQJ A;  1V1P A;  2CHZ A;  3RNF C;  2QDF A;  1YJ1 A;  1GC7 A;  3W5V B;  2REX A;  4F8C B;  4OZB A;  1UH6 A;  4IM3 A;  3JSV B;  2LGD A;  3DOW A;  3N32 A;  2BQQ A;  2K6D B;  3MHZ A;  5HI1 A;  2KJR A;  1R4M B;  4W9G A;  3M62 B;  3UF8 A;  4XWT A;  2AWT A;  4YTM B;  1OTR B;  2WXN A;  2LMC A;  2DLB A;  3TEW A;  4JGH B;  3Q14 C;  3C0R B;  4GDL A;  2BS3 B;  3NVW A;  2NMQ A;  1DOY A;  2NBV B;  2JYT A;  2WGS A;  3W1S C;  3ZO5 B;  4P6V F;  2QHO A;  1CMX B;  4NZL B;  1IPG A;  3AE5 B;  2KJ6 A;  2XK5 B;  5CHW A;  3Q69 A;  4M8M A;  4LDT B;  4BVU C;  1WM3 A;  2R2Q A;  2WDV B;  2MJE A;  2DHZ A;  1UZX B;  1NEK B;  1WX9 A;  1WXV A;  3SD5 A;  1I42 A;  4LJP B;  4G11 A;  3TEZ A;  3ZKJ C;  5D94 A;  4IWP A;  2A5U A;  2ACZ B;  4ZRI A;  2TSS A;  4RNA A;  2LRW A;  3RFZ B;  3L17 A;  4EOY A;  2WX1 A;  2INP E;  2FCS A;  4RGN A;  2ZCB A;  3ENE A;  1L5P A;  1QZE A;  2RPV A;  2VH1 A;  3K9O B;  2I2Y A;  2NPT A;  4EKU A;  1WFY A;  4HXD A;  1YJJ A;  2V9H A;  2D11 A;  2I1K A;  1FCL A;  1PGX A;  3CIR B;  3U2S C;  3TIX A;  2INN E;  4I6L B;  2RSU A;  1SE2 A;  3I57 A;  3NS8 A;  3VH3 B;  3PLV A;  4EZJ A;  3TSS A;  2GB1 A;  3AEG B;  4HVB A;  2JU6 X;  5EE1 A;  1WIA A;  3IXS A;  5HKH A;  1A70 A;  2M0X A;  3ZJV A;  4YL8 A;  2AL3 A;  3R8B A;  2NTT A;  4XX5 A;  2O2V B;  3SEB A;  3PRZ A;  3QWZ B;  5IAA C;  4M0W A;  4M8N A;  5EE0 A;  3VRB B;  4TMA B;  4C80 A;  2L00 B;  3GB1 A;  4HEA 1;  3OJ3 A;  2HD5 B;  4LNF A;  3HRD D;  4BOS C;  3M3J A;  2CU3 A;  3AEE B;  1D5Z C;  2VZK D;  1OQY A;  1C9F A;  2L3Z A;  1J19 A;  4L23 A;  1LM8 B;  1VCB A;  1P0R A;  2H89 B;  2FID A;  2ZPY A;  1PFD A;  3SFD B;  3Q3J A;  2KO3 A;  2WQY B;  2M17 A;  4LJO B;  2CJN A;  2DYO A;  1YQ4 B;  1WE6 A;  2EMS A;  3AM9 A;  3OAW A;  1XD3 B;  2DYB A;  4ACF A;  3H1U A;  4HKZ E;  1MI0 A;  5D7G A;  2G4D B;  3T8M A;  1SE4 A;  3NZU A;  3L16 A;  3P4S B;  3Q8F A;  2BF8 B;  1I4Q A;  4DXG A;  3BK2 A;  3PHW B;  2MW5 A;  3E56 A;  2BKF A;  2LWP A;  1X1M A;  3N1Z C;  4GLS C;  4IM0 A;  3GS2 A;  5FKA C;  1SF0 A;  1TZ1 A;  3P4R B;  3W9C B;  1C4A A;  4MM3 B;  4XC2 A;  3KW5 B;  1TIF A;  3A33 B;  4L1B A;  3RZF A;  2LXA A;  4A6Q A;  4LTU A;  1AN8 A;  1CK1 A;  3GOE A;  4KGT A;  3I63 C;  3L4P A;  2SAK A;  3QAR A;  1N60 A;  4XDD A;  1VDV A;  1WGR A;  2IY1 B;  4FJV B;  3DVG Y;  2M19 A;  5FK9 C;  2FAZ A;  1T6B X;  2WXO A;  2KD0 A;  4MEL A;  3RZW C;  2FIF A;  4URK A;  1IBX B;  1WGK A;  1F0Z A;  3UI3 A;  3ZNI D;  1IUE A;  4K1R B;  2K0P A;  4KV2 A;  1P9D U;  1C79 A;  4R3D A;  1E8W A;  1D3Z A;  2WU5 B;  4W9L A;  1T0R C;  3RI7 C;  4BKS A;  2WLB A;  2KHW B;  4X57 B;  1QKZ A;  2BPS A;  2WDQ B;  5HHD G;  1ZGU B;  2J53 A;  5J17 A;  1P98 A;  1SSN A;  2J52 A;  1UBI A;  3U7D A;  1SIF A;  4W9J A;  1LFD A;  4LK0 M;  1ZPS A;  4FHK A;  2KJH B;  1J8C A;  5BYS A;  4BKT A;  4K3C A;  3KYD D;  2FCN A;  5FR3 A;  2JVC A;  3IHP C;  2KQ4 X;  1UUP A;  4ICV A;  1XLQ A;  2PPH A;  1D5M C;  2NBW B;  3R2T A;  3J9C A;  3NVY A;  1V81 A;  2LGI A;  2RPQ A;  3MHS D;  4YTP B;  3V6C B;  1QF6 A;  2BWF A;  1RM6 C;  1M94 A;  1OEY J;  1WY8 A;  2FNJ B;  5G5H A;  3Q2A C;  3SDL C;  2KTR A;  1UGM A;  4PYU A;  2N9E B;  1WZ0 A;  3CMM B;  4HJK A;  1GOZ A;  4KIK B;  2QEJ C;  2LD9 A;  3T9L A;  1E10 A;  3P2B A;  2MSE D;  1GB4 A;  3A9K B;  4GN1 A;  3WAP A;  1ZXI A;  3B08 A;  2MLB A;  1MVK A;  3VTU A;  4MGZ E;  1XQQ A;  2OHF A;  4N9F 4;  3AB5 A;  3H6N A;  4WJN A;  1FO4 A;  1TGZ B;  4PS7 A;  2H88 B;  4NAM A;  2QSD A;  2ZPN A;  1YN3 A;  4LNN A;  1EF5 A;  1OQQ A;  2LVO A;  3R7R A;  1XXG A;  2IGH A;  3B2G A;  3IBE A;  5CHF A;  3QHT A;  3TEX A;  4IG7 B;  4DK5 A;  2KAC A;  4GU2 A;  2ZEQ A;  5JH5 C;  4HRO A;  3RNE C;  3VUW A;  1C3T A;  5E6J A;  5JXV A;  2HJ8 A;  4JWS C;  4A3O A;  2AL6 A;  2R61 A;  2D3C A;  1F2R I;  3ML9 A;  3WAM A;  3TL5 A;  2MJD A;  1P7E A;  2YLM A;  3PTF C;  1P3Q U;  1TS3 A;  2KVR A;  1PQS A;  4MGY E;  3BVZ A;  4MSM B;  2XN9 C;  3QX1 A;  3VR8 B;  4RFB A;  1GAQ B;  2KNB A;  4G0N B;  2ZCC A;  4JL9 A;  5L83 A;  1GG3 A;  3ZTC A;  1E8Y A;  3AEB B;  1V1O A;  2W54 A;  2JT4 B;  1JWU D;  3Q3O C;  2J0J A;  2WS3 B;  2JWZ A;  2UYZ B;  3C8Y A;  2Y5B B;  4GB9 A;  4A8X C;  1ISN A;  2HJ1 A;  1HXY D;  1V5T A;  2KFK A;  1ZUD 2;  4CHK A;  4YSX B;  3NG0 A;  1QOG A;  3PLU A;  1TS4 A;  1T0S C;  2RR9 A;  3M95 A;  1Q10 A;  4AS1 A;  1V5O A;  2L0T A;  2V0G A;  4MDK E;  5IO9 A;  2KT7 A;  3EHV A;  4BBN C;  1KLG D;  1CZP A;  3EUB 2;  4WUR A;  4QAY A;  1YQ3 B;  4LDT D;  4CQN A;  1E7U A;  2ICI A;  4GMV A;  2BVC A;  2LUE A;  3AE4 B;  2L05 A;  2JZZ A;  4GOC A;  3ZTD A;  1FRR A;  3AN1 A;  5BMG A;  5DPW A;  2WXQ A;  1YNT E;  1EM7 A;  1Q5W B;  1TY2 A;  4LCD E;  4EZL A;  3ZYY X;  3WIM A;  3DBL I;  3U30 A;  2JRH A;  2DZM A;  4WJP A;  2IO0 B;  1FPY A;  2INC C;  1HTO A;  1MJD A;  3MJ5 A;  1WMH B;  2N1W A;  3VR9 B;  5H92 C;  1D5X C;  2V1Y A;  5AUK A;  2KX0 A;  5BYR A;  3KYC D;  1E8Z A;  1I4G A;  1XLP A;  3AXC A;  3MP9 A;  3UQA A;  4EUT A;  5T8I A;  1VZ7 A;  1WZ3 A;  3BYT B;  2JY6 A;  2GBR A;  2L32 A;  2GBK A;  2ONQ A;  4ANW A;  2ZW1 A;  3BVG A;  4S0R A;  2BYT A;  2E3T A;  1E9M A;  4IM2 A;  2MJ3 A;  2D10 A;  3PRM B;  4IUM B;  2MP2 A;  1WYW B;  3JSV A;  4ANV A;  5LNK 1;  4GDK B;  4JX1 C;  1I4X A;  3EFU A;  4ANU A;  1FXT B;  5FR6 A;  1Z2M A;  3ZDT A;  2C7M B;  1QOB A;  1UBQ A;  1L6V A;  2CS4 A;  3NJT A;  2KDF B;  3H7S A;  3APC A;  2KLC A;  1E0Z A;  4BAX A;  3MFG A;  1VD2 A;  2L76 A;  3KQ4 A;  4HJG E;  3TEY A;  3ZW3 A;  3SU8 X;  3DDC B;  2W9N A;  3RUL A;  3JW0 X;  4C56 C;  2C9W B;  4WAF A;  2OED A;  1YIW A;  1FNU A;  4M02 A;  2G3Q B;  4XE0 A;  4XYC A;  4ZYS A;  1T5X D;  2KLG A;  1P7F A;  2DZJ A;  2BYV E;  2J0K A;  4PS8 A;  5BYQ A;  1VRA B;  1I4R A;  4G50 A;  1NYR A;  2L0F A;  1Y56 A;  4JWU C;  1LXD A;  1N61 A;  4K7S A;  2WX0 A;  2GMI C;  2GBM A;  2AQ2 B;  4C7Y A;  3PHX B;  1R4N I;  4PYZ A;  2RDB C;  5D2M B;  4P1B C;  5GXG B;  2AYO B;  2JXT A;  1UD7 A;  3V05 A;  1PGA A;  3EGR A;  1UWM A;  3I5J C;  2ZJD A;  2WXP A;  2LVP A;  3DHG C;  4KDI C;  3HVZ A;  2PKO A;  2LEK A;  5IP4 D;  1FM0 D; 
#chains in the Genus database with same CATH homology
 3L13 A;  3K9P B;  3OJ4 B;  3MTN B;  3ECI A;  3ZDM C;  1OQY A;  1OGW A;  1NI2 A;  1Q0W B;  3DBR I;  1YX6 B;  1S3S G;  2L3Z A;  1J19 A;  2MBH A;  2NCN A;  4GDK A;  1LM8 B;  3VUX A;  1L2N A;  3EC8 A;  4B9K A;  4KZ0 A;  4FN2 A;  4FJZ A;  1VCB A;  4W9D A;  1P0R A;  3L08 A;  2FID A;  2ZPY A;  5CX3 A;  4PS3 A;  3DVN V;  3Q3J A;  4KVG B;  3QJZ A;  4KSL C;  2N7D A;  2XBB C;  2KO3 A;  2KQS A;  2M17 A;  2PEA A;  2PE9 A;  4LJO B;  3VHT C;  3W1S A;  1Y8R C;  2DYO A;  2EMT A;  3DBS A;  2BWE S;  1WE6 A;  2EMS A;  3IG3 A;  4A20 A;  3OAW A;  2G45 B;  4TKN A;  4EFO A;  4B6W A;  5JZE B;  5L95 C;  1XD3 B;  2DYB A;  4IC7 B;  3H1U A;  2Z59 B;  3N3K B;  5D7G A;  3GZN I;  3N30 A;  2G4D B;  5CTR C;  3T8M A;  4HDQ A;  3NZU A;  4ANX A;  1WRD B;  4MGI E;  4GGQ A;  3L16 A;  2BYF A;  1RLF A;  1SGH A;  2BGF A;  3CF6 E;  4GIV A;  3H7P B;  3PRE A;  4DWF A;  1LQB A;  2BF8 B;  4NQK E;  4NJ7 A;  3L0W B;  3LJ3 A;  3PHW B;  2C5L C;  4BFR A;  2MW5 A;  3S2A A;  2BKF A;  1EO6 A;  5AZG A;  4NAW B;  1WGY A;  1X1M A;  2LWP A;  4JIO U;  2KKC A;  4IM0 A;  1WGH A;  2KOX A;  2WWZ A;  3R3M A;  5E6P A;  4RMA A;  2CU1 A;  4W9F A;  5GMV A;  5AZH A;  2DEN B;  1TZ1 A;  3DQV A;  3CSF A;  2J0M A;  5AZF A;  2DX5 B;  3HM3 A;  5IA7 A;  4XC2 A;  2DZI A;  1YD8 U;  1EUV B;  3KW5 B;  4TV3 A;  4DDG D;  3A33 B;  2LGY A;  1V6E A;  5DPR A;  3DVG X;  2M4N A;  3RZF A;  3RYT A;  2O2V A;  1WM2 A;  2LXA A;  2VRR B;  2MBE A;  3ONS A;  2NVU I;  1WGG A;  3GOE A;  3L10 B;  1KLV A;  2KTR B;  3UIN B;  2J7Q B;  4ZYN A;  2Z0D B;  1J0G A;  3Q3F A;  2PE6 B;  2K8B A;  3QAR A;  1WGR A;  2IY1 B;  2V3S A;  4FJV B;  3DVG Y;  4G3X B;  1E90 A;  3V6E B;  2K6Q A;  2YVC A;  3W1Y A;  2FAZ A;  4CYE A;  5JHB A;  1WGD A;  2KD0 A;  4MEL A;  3RZW C;  2MX2 A;  2KZR A;  2FIF A;  4URK A;  5DPT A;  5LXH A;  3KH0 A;  3TMP B;  3ZNI D;  4K1R B;  2JXX A;  4DHZ E;  3HK0 A;  3WA0 A;  4KV2 A;  5JHA A;  1P9D U;  4AJW A;  1E8W A;  2HE7 A;  3VH4 B;  1D3Z A;  2ZVN A;  2XK5 A;  3QC8 B;  3KUZ A;  3KUC B;  5J2R A;  2D3G A;  4HCN B;  4W9L A;  2JUO A;  2XEW A;  4BKS A;  3DCG A;  3I3T B;  3UGB B;  4AOF A;  4IWO A;  2KHW B;  4X57 B;  1BT0 A;  4HWI B;  2BPS A;  1V80 A;  1R4M I;  2NR2 A;  5BO4 B;  5TR5 A;  1ZGU B;  5G55 A;  1WXS A;  4AUQ C;  5J17 A;  1P98 A;  1WMH A;  1WR1 A;  3PV1 A;  2D07 B;  4F1S A;  4MGK E;  4FLH A;  2G4S A;  1UBI A;  3U7D A;  1H8C A;  2KDI A;  4E3C A;  1SIF A;  4W9J A;  1LFD A;  1V2Y A;  3B1L X;  3H7P A;  1Q1O A;  2ASQ A;  4HLE A;  3BY4 B;  4ZRJ A;  1U4A A;  4FHK A;  4JQW C;  1WJ6 A;  3VVW B;  4TUU A;  1A5R A;  2KJH B;  5C23 A;  1WF9 A;  2KWV B;  1J8C A;  4BKT A;  4NAW A;  3KYD D;  1YX5 B;  2FCN A;  2MP2 B;  2EKE C;  2JVC A;  3IHP C;  3WAL A;  4W9K A;  2L7R A;  4BBN F;  1ZW7 A;  2K8C A;  4ICV A;  2ZVO A;  1E5W A;  2KK8 A;  2KWU B;  3H9D A;  3TJP A;  4KZC A;  4I6P A;  2AEH A;  2PPH A;  2CR5 A;  2NBW B;  4NPN A;  2NPT B;  3WAN A;  2IO2 B;  1V81 A;  2FUH B;  2KMC A;  2RPQ A;  3MHS D;  1WXA A;  3PGE A;  3V6C B;  2K25 A;  2BWF A;  3PS6 A;  3PSE B;  2WDT B;  3PT2 B;  2K39 A;  5DCN A;  2GBJ A;  1M94 A;  5LLI A;  3KVF B;  2JRI B;  3APF A;  1OEY J;  1WY8 A;  2MA9 B;  2FNJ B;  3A9J B;  3SDL C;  3ZNG C;  2HTH A;  2KTR A;  1UGM A;  1IYF A;  4PYU A;  3ML8 A;  4W9H A;  3V61 A;  1G6J A;  1T0Y A;  4II2 B;  2N9E B;  3L54 A;  1WZ0 A;  2N7E A;  2Z0E B;  3CMM B;  4HJK A;  4DHJ D;  3QAQ A;  1GUA B;  1JRU A;  3QA8 A;  2A4Z A;  2IO3 B;  3PRP B;  4FUL A;  2DZK A;  2NBU A;  4K7W A;  4KIK B;  4CO7 A;  4E71 A;  2LD9 A;  4GSW A;  3T9L A;  2N4F A;  3P2B A;  5DPS A;  1TTN A;  2MSE D;  4FA6 A;  3JYU A;  3A9K B;  4GN1 A;  3VQI A;  3WAP A;  2N9X A;  3B08 A;  2MLB A;  3VTU A;  4MGZ E;  3VFK A;  1XQQ A;  3D32 A;  2KFK B;  3VXW A;  3RD2 A;  5KHQ A;  4WWP A;  2IBI B;  4N9F 4;  3ZLZ A;  2FCM A;  4DHJ B;  3RUI B;  4WAA A;  1WI0 A;  3DPD A;  3H6N A;  4WJN A;  4TQ0 A;  2IZV B;  3JVZ X;  1TGZ B;  4PS7 A;  5E6N A;  2ZPN A;  2JZ3 B;  4I6N B;  3IFW B;  3NY5 A;  3PPA A;  2OOB B;  4NQL B;  3ZRF A;  1TBE A;  1EF5 A;  2LVO A;  4M0W B;  1H4R A;  2O6V D;  4FBJ B;  3QK0 A;  3R7R A;  1P1A A;  4HDO A;  4P7I A;  1KJT A;  2KTF A;  3DBH I;  3QQ8 B;  2IYD B;  3IBE A;  5CHF A;  2LVQ A;  3PVL A;  3QHT A;  2WYQ A;  3UQB A;  2C7N B;  2I1J A;  2LGX A;  3MJW A;  4GDL B;  3V60 A;  4IG7 B;  2ZNV C;  4DK5 A;  2MRP A;  2KMA A;  4GU2 A;  5JH5 C;  2ZEQ A;  3APD A;  3VTW A;  2LXC A;  3VUW A;  4W9I A;  2N9P C;  1C3T A;  1IP9 A;  4EEW A;  4BKG A;  1RRB A;  2HJ8 A;  3ZIM A;  4DXA B;  3UIO B;  1KM7 A;  4AJY B;  2DAJ A;  1UEL A;  2D2Q A;  2O6V B;  1XT9 B;  2RD0 A;  3R7Q A;  4RM8 A;  4A3O A;  2AL6 A;  2KDB A;  4J6I A;  1E7V A;  4OVV A;  1YQB A;  4FJY A;  4KDL B;  3A4S C;  2CHW A;  3UIP B;  4WJQ A;  3QIJ A;  1WJ4 A;  2K1F A;  2MCN B;  3ML9 A;  5G2N A;  3WAM A;  2KAN A;  3U8Z A;  3TL5 A;  1EF1 A;  3O65 B;  2YLM A;  1OEY A;  1WJU A;  3PTF C;  1P3Q U;  1WX8 A;  4DBG A;  4NJ6 A;  2KVR A;  3ALB A;  1PQS A;  4MGY E;  3A9J A;  2MWS B;  4W9E A;  3VUY A;  4HK2 A;  3ZVV A;  3WAO A;  2KC2 A;  1KOT A;  4MSM B;  3VTV A;  2IY0 B;  5EDS A;  1V49 A;  3QX1 A;  2KNB A;  4G0N B;  2ZCC A;  2K8H A;  4JL9 A;  5L83 A;  1GG3 A;  3CST A;  4MH0 E;  2MQJ A;  2R2O A;  4ZRK A;  3ZNZ B;  3ZTC A;  1E8Y A;  2LZ6 A;  4AWJ A;  1MG8 A;  2CHZ A;  2JT4 B;  4KIK A;  1YJ1 A;  1WJN A;  2CHX A;  2J0J A;  4IW0 A;  1S1Q B;  2JWZ A;  2UYZ B;  2Y5B B;  3A9K A;  4GB9 A;  4ASW C;  3M63 B;  1ISN A;  1GC7 A;  4A3P A;  4OVU A;  1V5T A;  2LAS A;  2REX A;  2KFK A;  4RM9 A;  4TQ1 A;  5LXI B;  2CKH B;  1GJZ A;  4F8C B;  3A1Q B;  4K7U A;  1UH6 A;  2KDE B;  4CHK A;  4IM3 A;  3JSV B;  2LGD A;  2IO1 B;  3DOW A;  3PLU A;  4KSK C;  3N32 A;  2K6D B;  4AP4 C;  2RR9 A;  5AEK B;  3M95 A;  2KJR A;  1V5O A;  2B3A A;  2L0T A;  2ZNV B;  4MM3 A;  4MDK E;  1V9J A;  4W9G A;  2V4L A;  2DAF A;  3M62 B;  3UF8 A;  4GXB A;  4BOZ B;  2AWT A;  3EHV A;  3AU5 A;  4WWN A;  1OTR B;  4W9C A;  3RCZ A;  3RT3 B;  4BBN C;  3DVN U;  4MSQ B;  2KQ7 A;  5KHO A;  4JGH B;  4E74 A;  3C0R B;  4II3 B;  4GDL A;  1WR6 E;  4BKS D;  4LDT D;  1RFA A;  1E7U A;  4GMV A;  2LUE A;  2UWQ A;  2NBV B;  2BKR B;  4B95 A;  2L05 A;  2JZZ A;  4GOC A;  3ZTD A;  3W1S C;  3ZO5 B;  1Z5S B;  3R66 C;  2O6V A;  3X0W A;  2LJ5 A;  2QHO A;  1CMX B;  5DPW A;  1Q5W B;  1IPG A;  5CHV C;  4LCD E;  3B0A A;  1WXM A;  4EZL A;  2KJ6 A;  2DYM A;  2XK5 B;  2MBQ A;  2KFJ A;  3WIM A;  3DBL I;  5CHW A;  2JF5 A;  4M8M A;  4LDT B;  1RAX A;  4ICU A;  4BVU C;  1WM3 A;  2JRH A;  2DZM A;  2MBB B;  2R2Q A;  4HPL B;  4WJP A;  3U30 A;  1AAR A;  2IO0 B;  2LRU A;  2DHZ A;  1UZX B;  4WJO A;  1WX9 A;  1WXV A;  4FHJ A;  3SD5 A;  1I42 A;  1WMH B;  2M1M A;  4LJP B;  4G11 A;  2RGF A;  4HCP B;  5D6J B;  2N1W A;  3ZKJ C;  2KN5 A;  2NS5 A;  2V1Y A;  3KUD B;  2KX0 A;  5D94 A;  1NDD A;  3KYC D;  4FAD A;  1E8Z A;  3NZS A;  4IWP A;  2A5U A;  3AXC A;  3UQA A;  3HM6 X;  2C60 A;  4ZRI A;  2FCQ A;  4EUT A;  2GOW A;  1WZ3 A;  3SHQ A;  3V62 A;  2LRW A;  4MJS B;  2JY6 A;  2GBR A;  4DHZ B;  1K8R B;  2GBK A;  4ANW A;  4HPM B;  3HIZ A;  2L8J A;  2ZZP B;  4F7Z A;  3L17 A;  1F9J A;  2C7H A;  4IM2 A;  3ZRC A;  2D10 A;  4EOY A;  3A1Q A;  2WX1 A;  1E8X A;  3PRM B;  2JPH A;  2FCS A;  2MP2 A;  1WYW B;  3JSV A;  4IUM B;  4ANV A;  1ZKH A;  4GDK B;  2ZCB A;  3ENE A;  4ANU A;  3EFU A;  1FXT B;  3LDZ E;  1Z2M A;  2KC1 A;  5FR6 A;  3ZDT A;  3K9O B;  1QZE A;  2C7M B;  3A4R A;  1UBQ A;  3QCA A;  4WQO B;  3TCA A;  2CS4 A;  2KDF B;  3H7S A;  2N1V A;  3APC A;  2NPT A;  2KLC A;  4EKU A;  1WFY A;  1L7Y A;  3OLM D;  4HXD A;  4EZK A;  1V86 A;  1VD2 A;  2L76 A;  4XZ4 A;  3ZW3 A;  2D11 A;  1GNU A;  4WWO A;  2I1K A;  3SU8 X;  3DDC B;  2W9N A;  3RUL A;  3JW0 X;  1WX7 A;  3X23 A;  5C1Z A;  3AUL A;  4DDI D;  2PJH A;  2C9W B;  3BIN A;  3PZD A;  1NBF C;  1YIW A;  3TIX A;  2G3Q B;  2M8S A;  1WH3 A;  3AU4 A;  3VDZ A;  4I6L B;  4K81 A;  2KLG A;  2RSU A;  2DZJ A;  3NS8 A;  2LI5 A;  3PLV A;  3VH3 B;  2BYV E;  4EZJ A;  2J0K A;  4PS8 A;  5E6O A;  2BYE A;  4G50 A;  2KXJ A;  4HVB A;  2L0F A;  1LXD A;  1WIA A;  4K7S A;  4ZDV A;  2GBN A;  2WX0 A;  5HKH A;  2OJR A;  2GMI C;  2M0X A;  4NY0 A;  3NHE B;  2GBM A;  3HHM A;  2KWC A;  3PHX B;  4YL8 A;  2AL3 A;  3IVF A;  4MEM A;  4XX5 A;  1R4N I;  3ZNH B;  3EEC A;  5J18 A;  1HE8 A;  1WE7 A;  4PYZ A;  1I35 A;  1GC6 A;  4JLC A;  2KX3 A;  3VAW A;  4IWQ A;  1SE9 A;  2O2V B;  3AI5 A;  1C1Y B;  3PRZ A;  3QWZ B;  5D2M B;  5IAA C;  2AYO B;  4M8N A;  4NNJ B;  1UD7 A;  3NOB A;  3TBL D;  2ZJD A;  2L00 B;  2MBO A;  4MJS A;  2LVP A;  3ZUN A;  4KDI C;  3OJ3 A;  2HD5 B;  4BOS C;  3M3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...