1WG0A

Structural comparison of nas6p protein structures in two different crystal forms
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
243
structure length
243
Chain Sequence
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNVVDKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural comparison of Nas6p protein structures in two different crystal forms
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 75
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1wg0A01
5CECB 3EHRA 5EIBE 3ZNGA 5ITZF 2BKGA 1DC2A 1IXVA 2DZOA 1NFIE 3W9GA 3LJNA 4B93B 5BXOA 2XZDG 5AQ7A 1SVXA 2JABA 2RFMA 2F8XK 4Z68A 3V79K 3J5PA 5ENOD 1SW6A 5JMND 2MYOA 3T8KA 4RLYA 1YYHA 2QC9A 5CEDB 2XZTG 1BU9A 4G8LA 2DVWA 5AQAA 4LNUD 4N5QA 3EU9A 5AARA 3TWXA 2KBXA 4ATZD 3B7BA 1UOHA 4U8YD 4U8VD 3V30A 3HRAA 2BKKB 3KEAA 4DX6D 4GPMA 3AAAC 4HQDA 3TWVA 4C48B 3TWSA 4TUMA 4BEPA 1K1AA 1QYMA 5CBNA 1MX2A 1AWCB 1AP7A 4A63B 4LG6A 5AQ9A 2L6BA 4HI9A 2XEHA 2XENA 5EIDA 4HNAD 1IKND 1K1BA 2B0OE 2ETAA 2J8SD 4UUCA 4HRNA 2VGEA 4OAVB 5CERB 4JB8P 2DWZA 4O1OA 4YDYA 4K5CA 4DUIA 4F6RD 5ENRD 3DEOA 5ENTD 1N0RA 2FO1E 2RFAA 5EYPF 2AJAA 3TWWA 1G3NB 1OT8A 4O1PA 5HS0A 3UXGA 3NOGD 5D66A 4ZHBA 3W9FA 4BERA 2F37A 1A5EA 2QYJA 3EHQA 5JA4D 2ETCA 5ENQD 3ZU7B 2V5QC 2Y1LE 4K5BA 4BETA 2PNNA 2Y0BG 3J5QB 4DX7D 5BXUA 5KWDA 3V2XA 3V2OA 1DCQA 4HB5A 4NIKA 2A5EA 3UTMA 3TWUA 4LSZE 5AN8A 3HG0D 1MJ0A 4HLLA 5FIOA 2ETBA 4CZ2D 1N0QA 2NYJA 4DX2A 1D9SA 2HE0A 1WDYA 1N11A 3C5RA 3AJIA 4HI8A 4J8YA 2ZGDA 3T9KA 4QFVA 3JXIA 3Q9UC 1BLXB 1WG0A 2V4HC 4HRMB 1MYOA 4U95D 4J7WA 5CBOA 4BSZB 5KNGA 1IHBA 1OY3D 3Q9NC 1MX6A 3UI2A 4OAUC 3JUEA 4G8KA 1S70B 2XEEA 3ZUVB 2ZGGA 3F6QA 4O60A 3V31A 4DRXE 1BI8B 5ENPD 4GMRA 4ZFHA 3NOCD 5AQBA 1K3ZD 4U96D 5CEAA 1MX4A 2P2CP 5HKPA 1TR4A 1BD8A 5EILA 5HRYA 4BESA 5EN5D 4CYMD 3NBNB 4DX1A 5AAOA 2DZNA 3JXJA 4DX5D 3TWRA 4HRLA 3TWQA 3DEPA 3TWTA 3IXEA 1YCSB 4YDWA 3ZKJA 3D9HA 5KNHD 5EYLA 1BI7B 4F1PA 2KXPC 3B95A 5KBAA 1YMPA 5FINA 4HBDA 5ENSD 3SO8A 4QQIA 2F8YA 4K5AB
chains in the Genus database with same CATH superfamily
4TXRA 4UI9C 4K0RA 4B93B 4GYOA 3UT8A 1KT0A 2J07A 1Z3XA 2Y3AA 1EYHA 2WXNA 5CCMA 1UOHA 4GPMA 4OYSA 5ARFA 1IQUA 1MX2A 3JUIA 4HI9A 3KAEA 4UI9K 2DYRE 4CCAA 3MCXA 2XEVA 3SQVA 4YDYA 2KZTB 3AG4E 2CFZA 3MGBA 1G3NB 1MHQA 4M3OA 3CVPA 4ZHBA 1XGWA 3FFLA 4RQIA 1OCZE 2P9NG 3NF1A 1P5QA 5AIJA 3TXNA 3FTXA 3DSTA 4AP2A 1Q2ZA 4A1GA 3APFA 5E76A 3ABLE 3C5RA 2M63A 1WAO1 1ZB1A 3IKOB 5AYWD 4N3AA 3FEXA 2ZIRA 1OCOE 3JUEA 4G8KA 3GZ2A 3EUVA 5G04C 4ZFHA 5CCLA 4JEHA 3CLJA 1TR4A 5AJDA 3B13A 1KT1A 1N54A 3IXEA 1N94A 5EYLA 3E33A 2KATA 2R5SA 1YA0A 3LJNA 5ENOD 1H6OA 3ABME 3SBTB 3QOUA 3CV0A 3ASFA 4N5QA 5AARA 1DNPA 2OOEA 3TWSA 4BY6A 1QYMA 3U9WA 2X3MA 4I6JA 3UM3A 4FADA 4BTAA 2J4BA 4HNAD 1Z3YA 1XNFA 3PZ4A 4APOA 4DPRA 4G24A 3DEOA 4A1SA 2V4LA 1JUQA 4X8QA 3ZIMA 3T5XA 5KJKA 3ULQA 4DLOA 2KCKA 3ZPJA 4CGWA 2XHEA 5EKQD 4B8CB 3SD5A 4KVOA 4GTRA 5KWDA 4UWLA 3V2OA 1DCQA 4RVBA 3DXKG 4I1MA 2LNIA 4WAFA 3D9NA 4QFVA 1TNOA 2WXOA 5HQ8A 1OCRE 1TYQG 3CHSA 2B6CA 3P2BA 1OWOA 2J4DA 4FC8A 1N4RA 4BT9A 1K3ZD 2H6FA 3QWPA 3FU0A 3SZ7A 3HXEA 3TWRA 3TWQA 3ZRHA 3D9OA 3ASGA 3WXXA 4F7AA 3CVYA 2EILE 1LD8A 4L9PA 2P9KG 3RK6A 1OUVA 3V79K 4OVUA 4JHJA 1ELWA 3FUDA 5FQ6A 3QARA 5EX3A 4DI3A 3B7BA 3L9TA 4IRUA 2OEVA 2V8SE 3SFYA 4GZ5A 5CBNA 4G26A 2WXQA 4N39A 3FUKA 3UPVA 3R7RA 4BFRA 3LS8A 2AXVA 1N0RA 2RFAA 3TWWA 4O1PA 2VSOE 4P29A 3ZHEA 3N71A 1SA4A 3Q7FA 2V5QC 1TNUA 4B89A 2V5FA 4HB5A 2FEZA 5B1BE 4J0UA 5FIOA 2ONDA 1O1RA 1IHGA 2IFUA 3APCA 4YVQC 2IU1A 4KT6B 3BUAA 3P1UA 5LFAA 2GRLA 3FTYA 3LDZA 4XI9A 3S7BA 3PH0C 4UQYA 2VTBA 5G05J 2V0PA 2XPZA 5AQBA 4CRWA 5CEAA 4JL0A 5HRYA 3C3RA 2CHXA 4N5CA 3S2AA 2DYSE 2OV8A 4F1PA 3EDTB 3SFZA 5CMYA 3EHRA 4FULA 3ESKA 2LSUA 4GYYA 5AQ7A 4A3TA 1D8EA 3ASOE 3SF4A 3Q5MA 5LP0A 1IYGA 4XEIG 2BKKB 3CQCB 4LNBA 3ASHA 3PEUB 3IBEA 4BEPA 4GZ6A 2LXMA 2XENA 1EDUA 2J8SD 2XPYA 2VGEA 3DWLG 1A17A 3KSQA 3URZA 4EBAG 3RSEG 1OT8A 5BPPA 4UQXA 4URKA 1TNZA 2PZIA 2Y1LE 3LXUX 2PNNA 3V2XA 1E96B 4I2WA 3PZDA 3MKRA 1D9SA 2DIWA 2P58C 1N11A 4FP7A 1O1SA 4HOSA 4GA1A 3CEQA 2WXKA 3CHOA 3D9MA 1TN7A 1UW4B 5BW8C 4J8FA 3UUXA 4KZ0A 3VTXA 2H6IA 4W9RA 5CMWA 1X81A 4FLBA 3UM1A 4CT4A 4RG6A 4KZCA 4R7LA 2F8YA 3IV0A 3UT4A 2GRPB 1E7VA 4PS3A 1DVPA 3O48A 4HXIA 3ZYLA 2VYIA 3T8KA 1JCSA 2WVIA 1UJJA 3BU8A 2MHKA 3QK0A 4WUYA 3GZ1A 3V30A 4AY5A 1SA5A 1NZNA 4LG6A 3AS8A 2XCBA 2L0IA 4AV7A 5FZRA 5JHBA 4L23A 1H6KA 4K5CA 4EZLA 5B3SE 1HX8A 4AJWA 3QKYA 3UQ3A 5ENNA 1E90A 3LYAA 5T4YA 1H2VC 5HS0A 3UMVA 4E85A 2WXFA 4BERA 1NA3A 3R9AB 1Y8MA 2J08A 2IO3C 5LCWJ 4U0UA 3D9IA 3SNXA 2RG8A 3CVVA 4CZ2D 3PZ1A 1E8YA 4GZDA 2P9UG 5CRUA 2C2LA 4Q96A 4HVBA 4GCOA 3L17A 4UWFA 4PH4B 2RKKA 3V31A 2XRZA 2P2CP 2VGYA 3GW4A 4XX5A 4NQ0A 3I4GA 3TWTA 3ZHEB 4YDWA 3RIBA 3ZKJA 3D9HA 3PREA 5FWQA 3FH7A 2HR2A 1E8ZA 2FF4A 4CDRA 3CK7A 3W9GA 3SGHA 3ASDA 2JABA 3PDNA 5G55A 5A23A 2IOSA 4GPKA 3FHEA 3TL5A 3FP3A 4FHJA 5T8IA 1N9AA 3TWXA 4ILHB 3PZ3A 3QC1A 1S0PA 1NP7A 4IULA 4TV3A 1KPSB 3OTNA 5DBKA 4XE0A 3CVQA 2FO1E 2KCLA 4GTTA 1JPLA 3NZSA 3MJWA 3HIZA 2F37A 5JA4D 3CVWA 3DSXA 4HLEA 4FHKA 1FVFA 3UTMA 4KVMA 1E8XA 4LCTA 1H6PA 2GGFA 2OVBA 2IJGX 3BG1B 2V4HC 3Q75A 3L82A 4KMOA 2X38A 1MX6A 2VQ2A 4JA9A 3U4TA 3AG1E 3MKQB 5AENA 4I9CA 5HI7A 4GAAA 4CGVA 1EF1C 5D2MC 5CRVA 2WB2A 3FUJA 4ACKA 3CK9A 4MKTA 1E7UA 3MZLB 4V3IA 3TG4A 3S7DA 5BUZA 4PS7A 1IXVA 3CSFA 1Z5SC 2I9CA 3JQ0A 5D0OD 2OVFA 3LY9A 4AVXA 1WY6A 5AJLA 5A6CA 3U64A 2OCCE 3L13A 3SHFA 4GTQA 4BTBA 4WWOA 4JHKA 2XEHA 3FTZA 4N2QA 4HRNA 1TN8A 2DWZA 3UKRG 4UWGA 4KXKB 4A3VA 3CSTA 3BQOA 4RG9A 3T5VA 3ESLA 3W9FA 2WMOA 3LKUA 2QZAA 3B7RL 3J5QB 3B7UX 3B7TA 4NIKA 3D9KA 2WXRA 5AN8A 1MZCA 4DX2A 4LERA 5FQ8A 3EJNA 4APFA 5JJ7A 3TJPA 4C0MA 3JXIA 3SBSA 4Y6CA 3FUIA 4UI9J 3JYSA 2AW6A 1OY3D 3DSSA 5FJYA 2J9QA 4N3BA 4J8EA 5ENPD 4CEMA 3C72A 1UG3A 4AXHA 4HRLA 3DEPA 5KNHD 3PUKA 4GU5A 5ENSD 5ARGA 3R9MA 2EIJE 3L54A 1O5MA 2QY7A 5EIBE 2GROB 1NFIE 3G2UA 1SVXA 1OXJA 4IN3B 2NSZA 4GTOA 1HU3A 2P9LG 4ANWA 4WNFA 1E8WA 1FT2A 3FUHA 4YDEA 4EHMA 2R17C 3RU0A 3FUFA 2WMNA 4AEZC 2WXMA 4WNGA 1ZBPA 3HYMB 4XI0A 2UWJG 4OVVA 4TXQA 3NB2A 3NOGD 2RD0A 2AXZA 5G04J 3ZU7B 3FY4A 4K5BA 5T3RA 2EQXA 3ZW3A 2ZXWE 2NYJA 4GZ3A 4YDOA 1WG0A 4EBAA 2GRNB 4HOUA 3AU4A 2LO6A 2XS8A 1KLXA 3MEKA 1S70B 1JWFA 3AS4A 3UT7A 2WXIA 2Y4UA 5KCMA 4HOTA 3CR3A 3FEYA 2Q7FA 1OWPA 4CDNA 5AAOA 1EPUA 1OCCE 4EZJA 3MV2B 4GTVA 3L08A 3QAQA 4H7YA 2XRYA 1D8DA 4GMLA 5FTPA 4FA6A 1INZA 3CVLA 3EU5A 5H7PA 3FWVA 3PEVB 4L2YA 3D3MA 2UY1A 3EIQC 4LEUA 4U8HA 4ACLA 3LVRE 1K1AA 3CHMA 4A63B 5AQ9A 2WXJA 4M7CA 5EYPF 3SY2A 1FPPA 3ZEFA 3PS6A 2GRMA 2GRRB 3G2VA 4BETA 3I4RB 2Y0BG 5KJNA 2NC9A 1JWGA 4AM9A 4LSZE 3Q7AA 4HLLA 3LVQE 3L6AA 2WQ7A 3UIOC 3VLDA 3T9KA 4NURA 3VLEA 4U95D 4J7WA 4U0ZA 3ZVVA 3QJZA 3IHYA 4GCNA 2FO7A 4ME2A 2XEEA 4F3VA 3FU3A 1Z6TA 3AU5A 3ASNE 3NOCD 1HH8A 5A7DB 2X6KA 2GRQB 1BD8A 5LOZA 3FH5A 3JXJA 4UWHA 3CIAA 4I2ZA 4BX8A 3ZYKA 2Y69E 5FINA 3MA5A 3FU5A 3CQGB 4WNDA 1DC2A 2NXPA 2YINA 5BXOA 2CG2A 2XZDG 5KJLA 3HXBA 2RFMA 2VSNA 3L22A 3J5PA 4JEUA 2CHWA 3LY7A 2WXHA 3BEEA 2LAHA 3DPYA 3TAXA 2C0MA 3D9LA 3MYVA 4U8VD 4DX6D 1TN6A 3HXCA 2XGOA 5ANRA 3LJ3A 4PDXA 5EX0A 4MBGA 4OAVB 4GB9A 5JJ6A 1KZOA 5D66A 3FTVA 2WXGA 2ETCA 1N4SA 3TWUA 5IY5E 3FUEA 4U7EB 2HM8A 2QFCA 2VGXA 2HE0A 1WDYA 3ZXSA 1RW2A 3VTYA 2DCPA 4G23A 2F0YA 3RAUA 3Q4AB 4MLPA 2J09A 1QQEA 3ZUVB 2WXLA 3PNLB 2EIKE 4U96D 4WWNA 3FUMA 2H6HA 2HYZA 2XGSA 3KEZA 1UJKA 4DX1A 4EECA 4I6GA 2X6FA 3RRMB 2A5UA 1YMPA 1PC2A 2X6JA 3HVEA 4ILGA 3U3WA 3UINC 4PUCA 4Z68A 3ISMC 3Q73A 3IEGA 4I6EA 1QNFA 3MX3A 3KSLA 3EU9A 1Y6IA 3EIJA 1H0AA 5FQ7A 4AY6A 3C3QA 2L6BA 1TNYA 1NA0A 3GZSA 1TEZA 4A55A 3OAWA 3QNKA 4LRZA 4DUIA 4JC8A 4WWPA 4AOFA 3UXGA 1H2UA 4F1SA 1NL4A 4LNGA 1ZU2A 5FZQA 4CT0A 2QYJA 2ZISA 2I6HA 2VSXE 3ZYMA 2VTBB 3DBSA 2YQ8A 5J08A 5EDSA 3HG0D 1OWNA 5D0QD 2ZU6B 1HFAA 1V55E 4L7TA 2XPIA 3S7JA 3Q47B 2UY1B 4FJYA 3Q78A 1HS6A 3F6QA 4GMRA 4FJZA 1SZ9A 4NACA 3CVXA 3AG3E 4ANVA 5HKPA 3TGOA 5DIZA 3E34A 4CYMD 3FTWA 4DX5D 4MRUA 3UKUG 2XGMA 3ZXPA 5CHEE 3B95A 5C2YA 1O1TA 1H2TC 2MRIA 3SO8A 1N4QA 2P9SG 2PQNA 3FU6A 4C9BB 2BKGA 2LUHA 3ZFWA 4BT8A 4YVOA 4TRQA 4ILIA 3DXMG 2IOLA 2E2EA 1SW6A 4JPSA 3D9JA 3ULEG 5M72A 2XZTG 4G8LA 2KBXA 3KEAA 4I17A 3AAAC 3TWVA 3RKVA 4XZ4A 2X6IA 4TUMA 2WQHA 4H7XA 3MV3B 2XS1A 3CHRA 5EIDA 1BPOA 1K1BA 1RZ4A 4O6FA 4G2VA 4UUCA 5ENRD 3WG7E 2HO1A 5ENTD 1FVHA 2AJAA 2CG3A 3R7QA 4G1TA 1LTXA 3GYZA 1N95A 3PRZA 4DX7D 1QBQA 3Q79A 5C1DA 3FUNA 3B7SA 3PZ2A 3RRUA 2YHCA 3OXLA 4N2SA 4I1AA 1N0QA 1U3DA 3HDXA 1JCQA 3SFXA 2I1JA 3Q9NC 3PE4A 4U04A 2AXUA 4GA2A 1IQRA 4FU3A 1N52A 3JQ1A 1NI1A 5B1AE 3S7FA 4BESA 3NBNB 1K8KG 4B94A 4DLQA 3I5PA 4GTSA 1HE8A 2KXPC 2QYUA 3FTUA 5E75A 4KYOB 4WNEA 4K5AB 4E6HA 5BV0A 5BNWA 1SZAA 4U63A 4PS8A 4J8DA 4BX9A 2GW1A 1WM5A 2F8XK 5G05C 4JXTA 2AVPA 2VGXB 3FDHA 1S64A 3UIPC 5AQAA 4LNUD 4ANXA 4U8YD 3HRAA 1DCEA 3BG0B 5LX8A 1OWMA 1OWLA 3NZUA 1IKND 2ETAA 1TJFA 4O1OA 2BUGA 2IQCA 2KM4A 4EQFA 5BV1A 3EHMA 4GZCA 2H6GA 4DJAA 1A5EA 2E0IA 3LEWA 3HVEB 2FI7A 3UM2A 2IO2C 4ATGA 2CFUA 1MJ0A 2VJ8A 2IEJA 3T8MA 3CHPA 3SI5A 2FULA 3ML8A 3C98A 1QZ2A 4D10C 4HOQA 1LD7A 5CBOA 5KNGA 1IHBA 2L9BA 4HS2A 3G2TA 4O60A 1FT1A 3CKBA 1PY1A 1MX4A 1U2VG 4Q69A 3ABKE 5EILA 1HZ4A 1MQSA 3QWVA 1ELKA 3DSVA 4DK5A 4IYPA 4HBDA 5ITZF 3E30A 2DZOA 4TXPA 3E37A 4U0SA 3HXDA 2LAIA 1HG2A 2IF4A 3Q49B 3OXFA 1YYHA 2QC9A 5CEDB 4EZKA 3ULYA 1B89A 1ELRA 2I1KA 3ONKA 2VSYA 4U07A 3CVNA 4I43A 4C48B 4Q94A 4B8AA 3D9PA 4J6IA 1V54E 1SQMA 3KS2A 2X6HA 5KJMA 2Y4TA 2L0TB 4I9EA 3K9IA 3O4ZA 3ZGQA 3RJVA 2YHEA 3ZYQA 1U3CA 4DI4A 3EHQA 1UN8A 5BXUA 3PUJA 2A5EA 3APDA 1LF8A 2IY0C 2ETBA 2R2LA 4JD2G 4KBQA 2JLBA 3CKCA 3I3NA 4HI8A 2XQ0A 2WQ6A 1BLXB 3EHNA 4CDMA 4HRMB 4YNDA 4AIFA 3DPDA 4B0ZA 4DRXE 3E4BA 4XKCA 4J8SA 3OXGA 2KZTA 2LSVA 3QB2A 5LCWC 3RO3A 4LUNU 2EINE 2R03A 2KC7A 1N4PA 1HF8A 3TG5A 1BI7B 5KBAA 4I1OB 5CECB 2ILRA 3MKQA 3CK8A 3IHVA 3G2WA 3TXMA 2CHZA 4C0EA 5JHAA 3PNTB 2XCCA 1UN9A 2OEWA 4JW1A 2BF0X 2MYOA 5J90A 3LY8A 1JCRA 4ANUA 4ATZD 3FTSA 2PL2A 1HG5A 4ABNA 4BSXA 4HQDA 1HO8A 5G2NA 3AS5A 4Y6WA 2B0OE 3UX4A 2I2OA 4GTMA 5CERB 4JB8P 1HXIA 3C3OA 4F6RD 3HXFA 5BT1A 3LCAA 4JHRA 4FLHA 5FQ4A 4GTPA 4MS6A 3AG2E 5ANLA 1H19A 2BTDA 3DRAA 1W3BA 4G25A 4N3CA 3G2SA 3U66A 3X2QE 4TUUA 1VDYA 2FBNA 3QDNA 2WXPA 3AJIA 5FZSA 2ZGDA 4GMJA 1S63A 1KZPA 1MYOA 4BSZB 3ML9A 1PAQA 4RSYA 2L6JA 4UWKA 2A4ZA 3RO2A 3ONLA 2ZGGA 4JA7A 2AWIA 1BI8B 3UM0A 1FCHA 5EN5D 2DZNA 4L2LA 4G11A 3CGHA 2LXLA 4F53A 4HFGA 4QQIA 3KD7A 1YCSB 1TJCA 3ZNGA 3PVLA 3NAWA 2DBAA 3FH8A 2PM6A 2WPVA 5JMND 4RLYA 3CHQA 2C0LA 3DSUA 1BU9A 2DVWA 3FULA 3HHMA 2R02A 5FT9A 4BWRA 1AWCB 1AP7A 1GW6A 2PM7A 3RRNB 2KCVA 4K03A 4JZYA 4UQZA 3PE3A 4XKBA 3Q15A 1X5BA 4JVSA 5ENQD 3E32A 5JJTA 1TNBA 2R05A 3JCKC 2BEDA 4L1BA 2PQRA 2IONA 4XIFA 4EPZA 3L16A 2J49A 4J8YA 3QWWA 3Q9UC 4HORA 1L5JA 3UI2A 4GYWA 3CVUA 4OAUC 2JEKA 3VLFA 3DSWA 2YNQA 2R59A 2MOWA 3ENEA 4GA0A 3NQPA 2EIME 2P9PG 2WM9A 3LPZA 3ZN3A 2P9IG 4NRHB
chains in the Genus database with same CATH topology
5CECB 3EHRA 5EIBE 3ZNGA 5ITZF 2BKGA 1DC2A 1IXVA 2DZOA 1NFIE 3W9GA 3LJNA 4B93B 5BXOA 2XZDG 5AQ7A 1SVXA 2JABA 2RFMA 2F8XK 4Z68A 3V79K 3J5PA 5ENOD 1SW6A 5JMND 2MYOA 3T8KA 4RLYA 1YYHA 2QC9A 5CEDB 2XZTG 1BU9A 4G8LA 2DVWA 5AQAA 4LNUD 4N5QA 3EU9A 5AARA 3TWXA 2KBXA 4ATZD 3B7BA 1UOHA 4U8YD 4U8VD 3V30A 3HRAA 2BKKB 3KEAA 4DX6D 4GPMA 3AAAC 4HQDA 3TWVA 4C48B 3TWSA 4TUMA 4BEPA 1K1AA 1QYMA 5CBNA 1MX2A 1AWCB 1AP7A 4A63B 4LG6A 5AQ9A 2L6BA 4HI9A 2XEHA 2XENA 5EIDA 4HNAD 1IKND 1K1BA 2B0OE 2ETAA 2J8SD 4UUCA 4HRNA 2VGEA 4OAVB 5CERB 4JB8P 2DWZA 4O1OA 4YDYA 4K5CA 4DUIA 4F6RD 5ENRD 3DEOA 5ENTD 1N0RA 2FO1E 2RFAA 5EYPF 2AJAA 3TWWA 1G3NB 1OT8A 4O1PA 5HS0A 3UXGA 3NOGD 5D66A 4ZHBA 3W9FA 4BERA 2F37A 1A5EA 2QYJA 3EHQA 5JA4D 2ETCA 5ENQD 3ZU7B 2V5QC 2Y1LE 4K5BA 4BETA 2PNNA 2Y0BG 3J5QB 4DX7D 5BXUA 5KWDA 3V2XA 3V2OA 1DCQA 4HB5A 4NIKA 2A5EA 3UTMA 3TWUA 4LSZE 5AN8A 3HG0D 1MJ0A 4HLLA 5FIOA 2ETBA 4CZ2D 1N0QA 2NYJA 4DX2A 1D9SA 2HE0A 1WDYA 1N11A 3C5RA 3AJIA 4HI8A 4J8YA 2ZGDA 3T9KA 4QFVA 3JXIA 3Q9UC 1BLXB 1WG0A 2V4HC 4HRMB 1MYOA 4U95D 4J7WA 5CBOA 4BSZB 5KNGA 1IHBA 1OY3D 3Q9NC 1MX6A 3UI2A 4OAUC 3JUEA 4G8KA 1S70B 2XEEA 3ZUVB 2ZGGA 3F6QA 4O60A 3V31A 4DRXE 1BI8B 5ENPD 4GMRA 4ZFHA 3NOCD 5AQBA 1K3ZD 4U96D 5CEAA 1MX4A 2P2CP 5HKPA 1TR4A 1BD8A 5EILA 5HRYA 4BESA 5EN5D 4CYMD 3NBNB 4DX1A 5AAOA 2DZNA 3JXJA 4DX5D 3TWRA 4HRLA 3TWQA 3DEPA 3TWTA 3IXEA 1YCSB 4YDWA 3ZKJA 3D9HA 5KNHD 5EYLA 1BI7B 4F1PA 2KXPC 3B95A 5KBAA 1YMPA 5FINA 4HBDA 5ENSD 3SO8A 4QQIA 2F8YA 4K5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEC B;  3EHR A;  5EIB E;  3ZNG A;  5ITZ F;  2BKG A;  1DC2 A;  1IXV A;  2DZO A;  1NFI E;  3W9G A;  3LJN A;  4B93 B;  5BXO A;  2XZD G;  5AQ7 A;  1SVX A;  2JAB A;  2RFM A;  2F8X K;  4Z68 A;  3V79 K;  3J5P A;  5ENO D;  1SW6 A;  5JMN D;  2MYO A;  3T8K A;  4RLY A;  1YYH A;  2QC9 A;  5CED B;  2XZT G;  1BU9 A;  4G8L A;  2DVW A;  5AQA A;  4LNU D;  4N5Q A;  3EU9 A;  5AAR A;  3TWX A;  2KBX A;  4ATZ D;  3B7B A;  1UOH A;  4U8Y D;  4U8V D;  3V30 A;  3HRA A;  2BKK B;  3KEA A;  4DX6 D;  4GPM A;  3AAA C;  4HQD A;  3TWV A;  4C48 B;  3TWS A;  4TUM A;  4BEP A;  1K1A A;  1QYM A;  5CBN A;  1MX2 A;  1AWC B;  1AP7 A;  4A63 B;  4LG6 A;  5AQ9 A;  2L6B A;  4HI9 A;  2XEH A;  2XEN A;  5EID A;  4HNA D;  1IKN D;  1K1B A;  2B0O E;  2ETA A;  2J8S D;  4UUC A;  4HRN A;  2VGE A;  4OAV B;  5CER B;  4JB8 P;  2DWZ A;  4O1O A;  4YDY A;  4K5C A;  4DUI A;  4F6R D;  5ENR D;  3DEO A;  5ENT D;  1N0R A;  2FO1 E;  2RFA A;  5EYP F;  2AJA A;  3TWW A;  1G3N B;  1OT8 A;  4O1P A;  5HS0 A;  3UXG A;  3NOG D;  5D66 A;  4ZHB A;  3W9F A;  4BER A;  2F37 A;  1A5E A;  2QYJ A;  3EHQ A;  5JA4 D;  2ETC A;  5ENQ D;  3ZU7 B;  2V5Q C;  2Y1L E;  4K5B A;  4BET A;  2PNN A;  2Y0B G;  3J5Q B;  4DX7 D;  5BXU A;  5KWD A;  3V2X A;  3V2O A;  1DCQ A;  4HB5 A;  4NIK A;  2A5E A;  3UTM A;  3TWU A;  4LSZ E;  5AN8 A;  3HG0 D;  1MJ0 A;  4HLL A;  5FIO A;  2ETB A;  4CZ2 D;  1N0Q A;  2NYJ A;  4DX2 A;  1D9S A;  2HE0 A;  1WDY A;  1N11 A;  3C5R A;  3AJI A;  4HI8 A;  4J8Y A;  2ZGD A;  3T9K A;  4QFV A;  3JXI A;  3Q9U C;  1BLX B;  1WG0 A;  2V4H C;  4HRM B;  1MYO A;  4U95 D;  4J7W A;  5CBO A;  4BSZ B;  5KNG A;  1IHB A;  1OY3 D;  3Q9N C;  1MX6 A;  3UI2 A;  4OAU C;  3JUE A;  4G8K A;  1S70 B;  2XEE A;  3ZUV B;  2ZGG A;  3F6Q A;  4O60 A;  3V31 A;  4DRX E;  1BI8 B;  5ENP D;  4GMR A;  4ZFH A;  3NOC D;  5AQB A;  1K3Z D;  4U96 D;  5CEA A;  1MX4 A;  2P2C P;  5HKP A;  1TR4 A;  1BD8 A;  5EIL A;  5HRY A;  4BES A;  5EN5 D;  4CYM D;  3NBN B;  4DX1 A;  5AAO A;  2DZN A;  3JXJ A;  4DX5 D;  3TWR A;  4HRL A;  3TWQ A;  3DEP A;  3TWT A;  3IXE A;  1YCS B;  4YDW A;  3ZKJ A;  3D9H A;  5KNH D;  5EYL A;  1BI7 B;  4F1P A;  2KXP C;  3B95 A;  5KBA A;  1YMP A;  5FIN A;  4HBD A;  5ENS D;  3SO8 A;  4QQI A;  2F8Y A;  4K5A B; 
#chains in the Genus database with same CATH topology
 4TXR A;  4UI9 C;  4K0R A;  4B93 B;  4GYO A;  3UT8 A;  1KT0 A;  2J07 A;  1Z3X A;  2Y3A A;  1EYH A;  2WXN A;  5CCM A;  1UOH A;  4GPM A;  4OYS A;  5ARF A;  1IQU A;  1MX2 A;  3JUI A;  4HI9 A;  3KAE A;  4UI9 K;  2DYR E;  4CCA A;  3MCX A;  2XEV A;  3SQV A;  4YDY A;  2KZT B;  3AG4 E;  2CFZ A;  3MGB A;  1G3N B;  1MHQ A;  4M3O A;  3CVP A;  4ZHB A;  1XGW A;  3FFL A;  4RQI A;  1OCZ E;  2P9N G;  3NF1 A;  1P5Q A;  5AIJ A;  3TXN A;  3FTX A;  3DST A;  4AP2 A;  1Q2Z A;  4A1G A;  3APF A;  5E76 A;  3ABL E;  3C5R A;  2M63 A;  1WAO 1;  1ZB1 A;  3IKO B;  5AYW D;  4N3A A;  3FEX A;  2ZIR A;  1OCO E;  3JUE A;  4G8K A;  3GZ2 A;  3EUV A;  5G04 C;  4ZFH A;  5CCL A;  4JEH A;  3CLJ A;  1TR4 A;  5AJD A;  3B13 A;  1KT1 A;  1N54 A;  3IXE A;  1N94 A;  5EYL A;  3E33 A;  2KAT A;  2R5S A;  1YA0 A;  3LJN A;  5ENO D;  1H6O A;  3ABM E;  3SBT B;  3QOU A;  3CV0 A;  3ASF A;  4N5Q A;  5AAR A;  1DNP A;  2OOE A;  3TWS A;  4BY6 A;  1QYM A;  3U9W A;  2X3M A;  4I6J A;  3UM3 A;  4FAD A;  4BTA A;  2J4B A;  4HNA D;  1Z3Y A;  1XNF A;  3PZ4 A;  4APO A;  4DPR A;  4G24 A;  3DEO A;  4A1S A;  2V4L A;  1JUQ A;  4X8Q A;  3ZIM A;  3T5X A;  5KJK A;  3ULQ A;  4DLO A;  2KCK A;  3ZPJ A;  4CGW A;  2XHE A;  5EKQ D;  4B8C B;  3SD5 A;  4KVO A;  4GTR A;  5KWD A;  4UWL A;  3V2O A;  1DCQ A;  4RVB A;  3DXK G;  4I1M A;  2LNI A;  4WAF A;  3D9N A;  4QFV A;  1TNO A;  2WXO A;  5HQ8 A;  1OCR E;  1TYQ G;  3CHS A;  2B6C A;  3P2B A;  1OWO A;  2J4D A;  4FC8 A;  1N4R A;  4BT9 A;  1K3Z D;  2H6F A;  3QWP A;  3FU0 A;  3SZ7 A;  3HXE A;  3TWR A;  3TWQ A;  3ZRH A;  3D9O A;  3ASG A;  3WXX A;  4F7A A;  3CVY A;  2EIL E;  1LD8 A;  4L9P A;  2P9K G;  3RK6 A;  1OUV A;  3V79 K;  4OVU A;  4JHJ A;  1ELW A;  3FUD A;  5FQ6 A;  3QAR A;  5EX3 A;  4DI3 A;  3B7B A;  3L9T A;  4IRU A;  2OEV A;  2V8S E;  3SFY A;  4GZ5 A;  5CBN A;  4G26 A;  2WXQ A;  4N39 A;  3FUK A;  3UPV A;  3R7R A;  4BFR A;  3LS8 A;  2AXV A;  1N0R A;  2RFA A;  3TWW A;  4O1P A;  2VSO E;  4P29 A;  3ZHE A;  3N71 A;  1SA4 A;  3Q7F A;  2V5Q C;  1TNU A;  4B89 A;  2V5F A;  4HB5 A;  2FEZ A;  5B1B E;  4J0U A;  5FIO A;  2OND A;  1O1R A;  1IHG A;  2IFU A;  3APC A;  4YVQ C;  2IU1 A;  4KT6 B;  3BUA A;  3P1U A;  5LFA A;  2GRL A;  3FTY A;  3LDZ A;  4XI9 A;  3S7B A;  3PH0 C;  4UQY A;  2VTB A;  5G05 J;  2V0P A;  2XPZ A;  5AQB A;  4CRW A;  5CEA A;  4JL0 A;  5HRY A;  3C3R A;  2CHX A;  4N5C A;  3S2A A;  2DYS E;  2OV8 A;  4F1P A;  3EDT B;  3SFZ A;  5CMY A;  3EHR A;  4FUL A;  3ESK A;  2LSU A;  4GYY A;  5AQ7 A;  4A3T A;  1D8E A;  3ASO E;  3SF4 A;  3Q5M A;  5LP0 A;  1IYG A;  4XEI G;  2BKK B;  3CQC B;  4LNB A;  3ASH A;  3PEU B;  3IBE A;  4BEP A;  4GZ6 A;  2LXM A;  2XEN A;  1EDU A;  2J8S D;  2XPY A;  2VGE A;  3DWL G;  1A17 A;  3KSQ A;  3URZ A;  4EBA G;  3RSE G;  1OT8 A;  5BPP A;  4UQX A;  4URK A;  1TNZ A;  2PZI A;  2Y1L E;  3LXU X;  2PNN A;  3V2X A;  1E96 B;  4I2W A;  3PZD A;  3MKR A;  1D9S A;  2DIW A;  2P58 C;  1N11 A;  4FP7 A;  1O1S A;  4HOS A;  4GA1 A;  3CEQ A;  2WXK A;  3CHO A;  3D9M A;  1TN7 A;  1UW4 B;  5BW8 C;  4J8F A;  3UUX A;  4KZ0 A;  3VTX A;  2H6I A;  4W9R A;  5CMW A;  1X81 A;  4FLB A;  3UM1 A;  4CT4 A;  4RG6 A;  4KZC A;  4R7L A;  2F8Y A;  3IV0 A;  3UT4 A;  2GRP B;  1E7V A;  4PS3 A;  1DVP A;  3O48 A;  4HXI A;  3ZYL A;  2VYI A;  3T8K A;  1JCS A;  2WVI A;  1UJJ A;  3BU8 A;  2MHK A;  3QK0 A;  4WUY A;  3GZ1 A;  3V30 A;  4AY5 A;  1SA5 A;  1NZN A;  4LG6 A;  3AS8 A;  2XCB A;  2L0I A;  4AV7 A;  5FZR A;  5JHB A;  4L23 A;  1H6K A;  4K5C A;  4EZL A;  5B3S E;  1HX8 A;  4AJW A;  3QKY A;  3UQ3 A;  5ENN A;  1E90 A;  3LYA A;  5T4Y A;  1H2V C;  5HS0 A;  3UMV A;  4E85 A;  2WXF A;  4BER A;  1NA3 A;  3R9A B;  1Y8M A;  2J08 A;  2IO3 C;  5LCW J;  4U0U A;  3D9I A;  3SNX A;  2RG8 A;  3CVV A;  4CZ2 D;  3PZ1 A;  1E8Y A;  4GZD A;  2P9U G;  5CRU A;  2C2L A;  4Q96 A;  4HVB A;  4GCO A;  3L17 A;  4UWF A;  4PH4 B;  2RKK A;  3V31 A;  2XRZ A;  2P2C P;  2VGY A;  3GW4 A;  4XX5 A;  4NQ0 A;  3I4G A;  3TWT A;  3ZHE B;  4YDW A;  3RIB A;  3ZKJ A;  3D9H A;  3PRE A;  5FWQ A;  3FH7 A;  2HR2 A;  1E8Z A;  2FF4 A;  4CDR A;  3CK7 A;  3W9G A;  3SGH A;  3ASD A;  2JAB A;  3PDN A;  5G55 A;  5A23 A;  2IOS A;  4GPK A;  3FHE A;  3TL5 A;  3FP3 A;  4FHJ A;  5T8I A;  1N9A A;  3TWX A;  4ILH B;  3PZ3 A;  3QC1 A;  1S0P A;  1NP7 A;  4IUL A;  4TV3 A;  1KPS B;  3OTN A;  5DBK A;  4XE0 A;  3CVQ A;  2FO1 E;  2KCL A;  4GTT A;  1JPL A;  3NZS A;  3MJW A;  3HIZ A;  2F37 A;  5JA4 D;  3CVW A;  3DSX A;  4HLE A;  4FHK A;  1FVF A;  3UTM A;  4KVM A;  1E8X A;  4LCT A;  1H6P A;  2GGF A;  2OVB A;  2IJG X;  3BG1 B;  2V4H C;  3Q75 A;  3L82 A;  4KMO A;  2X38 A;  1MX6 A;  2VQ2 A;  4JA9 A;  3U4T A;  3AG1 E;  3MKQ B;  5AEN A;  4I9C A;  5HI7 A;  4GAA A;  4CGV A;  1EF1 C;  5D2M C;  5CRV A;  2WB2 A;  3FUJ A;  4ACK A;  3CK9 A;  4MKT A;  1E7U A;  3MZL B;  4V3I A;  3TG4 A;  3S7D A;  5BUZ A;  4PS7 A;  1IXV A;  3CSF A;  1Z5S C;  2I9C A;  3JQ0 A;  5D0O D;  2OVF A;  3LY9 A;  4AVX A;  1WY6 A;  5AJL A;  5A6C A;  3U64 A;  2OCC E;  3L13 A;  3SHF A;  4GTQ A;  4BTB A;  4WWO A;  4JHK A;  2XEH A;  3FTZ A;  4N2Q A;  4HRN A;  1TN8 A;  2DWZ A;  3UKR G;  4UWG A;  4KXK B;  4A3V A;  3CST A;  3BQO A;  4RG9 A;  3T5V A;  3ESL A;  3W9F A;  2WMO A;  3LKU A;  2QZA A;  3B7R L;  3J5Q B;  3B7U X;  3B7T A;  4NIK A;  3D9K A;  2WXR A;  5AN8 A;  1MZC A;  4DX2 A;  4LER A;  5FQ8 A;  3EJN A;  4APF A;  5JJ7 A;  3TJP A;  4C0M A;  3JXI A;  3SBS A;  4Y6C A;  3FUI A;  4UI9 J;  3JYS A;  2AW6 A;  1OY3 D;  3DSS A;  5FJY A;  2J9Q A;  4N3B A;  4J8E A;  5ENP D;  4CEM A;  3C72 A;  1UG3 A;  4AXH A;  4HRL A;  3DEP A;  5KNH D;  3PUK A;  4GU5 A;  5ENS D;  5ARG A;  3R9M A;  2EIJ E;  3L54 A;  1O5M A;  2QY7 A;  5EIB E;  2GRO B;  1NFI E;  3G2U A;  1SVX A;  1OXJ A;  4IN3 B;  2NSZ A;  4GTO A;  1HU3 A;  2P9L G;  4ANW A;  4WNF A;  1E8W A;  1FT2 A;  3FUH A;  4YDE A;  4EHM A;  2R17 C;  3RU0 A;  3FUF A;  2WMN A;  4AEZ C;  2WXM A;  4WNG A;  1ZBP A;  3HYM B;  4XI0 A;  2UWJ G;  4OVV A;  4TXQ A;  3NB2 A;  3NOG D;  2RD0 A;  2AXZ A;  5G04 J;  3ZU7 B;  3FY4 A;  4K5B A;  5T3R A;  2EQX A;  3ZW3 A;  2ZXW E;  2NYJ A;  4GZ3 A;  4YDO A;  1WG0 A;  4EBA A;  2GRN B;  4HOU A;  3AU4 A;  2LO6 A;  2XS8 A;  1KLX A;  3MEK A;  1S70 B;  1JWF A;  3AS4 A;  3UT7 A;  2WXI A;  2Y4U A;  5KCM A;  4HOT A;  3CR3 A;  3FEY A;  2Q7F A;  1OWP A;  4CDN A;  5AAO A;  1EPU A;  1OCC E;  4EZJ A;  3MV2 B;  4GTV A;  3L08 A;  3QAQ A;  4H7Y A;  2XRY A;  1D8D A;  4GML A;  5FTP A;  4FA6 A;  1INZ A;  3CVL A;  3EU5 A;  5H7P A;  3FWV A;  3PEV B;  4L2Y A;  3D3M A;  2UY1 A;  3EIQ C;  4LEU A;  4U8H A;  4ACL A;  3LVR E;  1K1A A;  3CHM A;  4A63 B;  5AQ9 A;  2WXJ A;  4M7C A;  5EYP F;  3SY2 A;  1FPP A;  3ZEF A;  3PS6 A;  2GRM A;  2GRR B;  3G2V A;  4BET A;  3I4R B;  2Y0B G;  5KJN A;  2NC9 A;  1JWG A;  4AM9 A;  4LSZ E;  3Q7A A;  4HLL A;  3LVQ E;  3L6A A;  2WQ7 A;  3UIO C;  3VLD A;  3T9K A;  4NUR A;  3VLE A;  4U95 D;  4J7W A;  4U0Z A;  3ZVV A;  3QJZ A;  3IHY A;  4GCN A;  2FO7 A;  4ME2 A;  2XEE A;  4F3V A;  3FU3 A;  1Z6T A;  3AU5 A;  3ASN E;  3NOC D;  1HH8 A;  5A7D B;  2X6K A;  2GRQ B;  1BD8 A;  5LOZ A;  3FH5 A;  3JXJ A;  4UWH A;  3CIA A;  4I2Z A;  4BX8 A;  3ZYK A;  2Y69 E;  5FIN A;  3MA5 A;  3FU5 A;  3CQG B;  4WND A;  1DC2 A;  2NXP A;  2YIN A;  5BXO A;  2CG2 A;  2XZD G;  5KJL A;  3HXB A;  2RFM A;  2VSN A;  3L22 A;  3J5P A;  4JEU A;  2CHW A;  3LY7 A;  2WXH A;  3BEE A;  2LAH A;  3DPY A;  3TAX A;  2C0M A;  3D9L A;  3MYV A;  4U8V D;  4DX6 D;  1TN6 A;  3HXC A;  2XGO A;  5ANR A;  3LJ3 A;  4PDX A;  5EX0 A;  4MBG A;  4OAV B;  4GB9 A;  5JJ6 A;  1KZO A;  5D66 A;  3FTV A;  2WXG A;  2ETC A;  1N4S A;  3TWU A;  5IY5 E;  3FUE A;  4U7E B;  2HM8 A;  2QFC A;  2VGX A;  2HE0 A;  1WDY A;  3ZXS A;  1RW2 A;  3VTY A;  2DCP A;  4G23 A;  2F0Y A;  3RAU A;  3Q4A B;  4MLP A;  2J09 A;  1QQE A;  3ZUV B;  2WXL A;  3PNL B;  2EIK E;  4U96 D;  4WWN A;  3FUM A;  2H6H A;  2HYZ A;  2XGS A;  3KEZ A;  1UJK A;  4DX1 A;  4EEC A;  4I6G A;  2X6F A;  3RRM B;  2A5U A;  1YMP A;  1PC2 A;  2X6J A;  3HVE A;  4ILG A;  3U3W A;  3UIN C;  4PUC A;  4Z68 A;  3ISM C;  3Q73 A;  3IEG A;  4I6E A;  1QNF A;  3MX3 A;  3KSL A;  3EU9 A;  1Y6I A;  3EIJ A;  1H0A A;  5FQ7 A;  4AY6 A;  3C3Q A;  2L6B A;  1TNY A;  1NA0 A;  3GZS A;  1TEZ A;  4A55 A;  3OAW A;  3QNK A;  4LRZ A;  4DUI A;  4JC8 A;  4WWP A;  4AOF A;  3UXG A;  1H2U A;  4F1S A;  1NL4 A;  4LNG A;  1ZU2 A;  5FZQ A;  4CT0 A;  2QYJ A;  2ZIS A;  2I6H A;  2VSX E;  3ZYM A;  2VTB B;  3DBS A;  2YQ8 A;  5J08 A;  5EDS A;  3HG0 D;  1OWN A;  5D0Q D;  2ZU6 B;  1HFA A;  1V55 E;  4L7T A;  2XPI A;  3S7J A;  3Q47 B;  2UY1 B;  4FJY A;  3Q78 A;  1HS6 A;  3F6Q A;  4GMR A;  4FJZ A;  1SZ9 A;  4NAC A;  3CVX A;  3AG3 E;  4ANV A;  5HKP A;  3TGO A;  5DIZ A;  3E34 A;  4CYM D;  3FTW A;  4DX5 D;  4MRU A;  3UKU G;  2XGM A;  3ZXP A;  5CHE E;  3B95 A;  5C2Y A;  1O1T A;  1H2T C;  2MRI A;  3SO8 A;  1N4Q A;  2P9S G;  2PQN A;  3FU6 A;  4C9B B;  2BKG A;  2LUH A;  3ZFW A;  4BT8 A;  4YVO A;  4TRQ A;  4ILI A;  3DXM G;  2IOL A;  2E2E A;  1SW6 A;  4JPS A;  3D9J A;  3ULE G;  5M72 A;  2XZT G;  4G8L A;  2KBX A;  3KEA A;  4I17 A;  3AAA C;  3TWV A;  3RKV A;  4XZ4 A;  2X6I A;  4TUM A;  2WQH A;  4H7X A;  3MV3 B;  2XS1 A;  3CHR A;  5EID A;  1BPO A;  1K1B A;  1RZ4 A;  4O6F A;  4G2V A;  4UUC A;  5ENR D;  3WG7 E;  2HO1 A;  5ENT D;  1FVH A;  2AJA A;  2CG3 A;  3R7Q A;  4G1T A;  1LTX A;  3GYZ A;  1N95 A;  3PRZ A;  4DX7 D;  1QBQ A;  3Q79 A;  5C1D A;  3FUN A;  3B7S A;  3PZ2 A;  3RRU A;  2YHC A;  3OXL A;  4N2S A;  4I1A A;  1N0Q A;  1U3D A;  3HDX A;  1JCQ A;  3SFX A;  2I1J A;  3Q9N C;  3PE4 A;  4U04 A;  2AXU A;  4GA2 A;  1IQR A;  4FU3 A;  1N52 A;  3JQ1 A;  1NI1 A;  5B1A E;  3S7F A;  4BES A;  3NBN B;  1K8K G;  4B94 A;  4DLQ A;  3I5P A;  4GTS A;  1HE8 A;  2KXP C;  2QYU A;  3FTU A;  5E75 A;  4KYO B;  4WNE A;  4K5A B;  4E6H A;  5BV0 A;  5BNW A;  1SZA A;  4U63 A;  4PS8 A;  4J8D A;  4BX9 A;  2GW1 A;  1WM5 A;  2F8X K;  5G05 C;  4JXT A;  2AVP A;  2VGX B;  3FDH A;  1S64 A;  3UIP C;  5AQA A;  4LNU D;  4ANX A;  4U8Y D;  3HRA A;  1DCE A;  3BG0 B;  5LX8 A;  1OWM A;  1OWL A;  3NZU A;  1IKN D;  2ETA A;  1TJF A;  4O1O A;  2BUG A;  2IQC A;  2KM4 A;  4EQF A;  5BV1 A;  3EHM A;  4GZC A;  2H6G A;  4DJA A;  1A5E A;  2E0I A;  3LEW A;  3HVE B;  2FI7 A;  3UM2 A;  2IO2 C;  4ATG A;  2CFU A;  1MJ0 A;  2VJ8 A;  2IEJ A;  3T8M A;  3CHP A;  3SI5 A;  2FUL A;  3ML8 A;  3C98 A;  1QZ2 A;  4D10 C;  4HOQ A;  1LD7 A;  5CBO A;  5KNG A;  1IHB A;  2L9B A;  4HS2 A;  3G2T A;  4O60 A;  1FT1 A;  3CKB A;  1PY1 A;  1MX4 A;  1U2V G;  4Q69 A;  3ABK E;  5EIL A;  1HZ4 A;  1MQS A;  3QWV A;  1ELK A;  3DSV A;  4DK5 A;  4IYP A;  4HBD A;  5ITZ F;  3E30 A;  2DZO A;  4TXP A;  3E37 A;  4U0S A;  3HXD A;  2LAI A;  1HG2 A;  2IF4 A;  3Q49 B;  3OXF A;  1YYH A;  2QC9 A;  5CED B;  4EZK A;  3ULY A;  1B89 A;  1ELR A;  2I1K A;  3ONK A;  2VSY A;  4U07 A;  3CVN A;  4I43 A;  4C48 B;  4Q94 A;  4B8A A;  3D9P A;  4J6I A;  1V54 E;  1SQM A;  3KS2 A;  2X6H A;  5KJM A;  2Y4T A;  2L0T B;  4I9E A;  3K9I A;  3O4Z A;  3ZGQ A;  3RJV A;  2YHE A;  3ZYQ A;  1U3C A;  4DI4 A;  3EHQ A;  1UN8 A;  5BXU A;  3PUJ A;  2A5E A;  3APD A;  1LF8 A;  2IY0 C;  2ETB A;  2R2L A;  4JD2 G;  4KBQ A;  2JLB A;  3CKC A;  3I3N A;  4HI8 A;  2XQ0 A;  2WQ6 A;  1BLX B;  3EHN A;  4CDM A;  4HRM B;  4YND A;  4AIF A;  3DPD A;  4B0Z A;  4DRX E;  3E4B A;  4XKC A;  4J8S A;  3OXG A;  2KZT A;  2LSV A;  3QB2 A;  5LCW C;  3RO3 A;  4LUN U;  2EIN E;  2R03 A;  2KC7 A;  1N4P A;  1HF8 A;  3TG5 A;  1BI7 B;  5KBA A;  4I1O B;  5CEC B;  2ILR A;  3MKQ A;  3CK8 A;  3IHV A;  3G2W A;  3TXM A;  2CHZ A;  4C0E A;  5JHA A;  3PNT B;  2XCC A;  1UN9 A;  2OEW A;  4JW1 A;  2BF0 X;  2MYO A;  5J90 A;  3LY8 A;  1JCR A;  4ANU A;  4ATZ D;  3FTS A;  2PL2 A;  1HG5 A;  4ABN A;  4BSX A;  4HQD A;  1HO8 A;  5G2N A;  3AS5 A;  4Y6W A;  2B0O E;  3UX4 A;  2I2O A;  4GTM A;  5CER B;  4JB8 P;  1HXI A;  3C3O A;  4F6R D;  3HXF A;  5BT1 A;  3LCA A;  4JHR A;  4FLH A;  5FQ4 A;  4GTP A;  4MS6 A;  3AG2 E;  5ANL A;  1H19 A;  2BTD A;  3DRA A;  1W3B A;  4G25 A;  4N3C A;  3G2S A;  3U66 A;  3X2Q E;  4TUU A;  1VDY A;  2FBN A;  3QDN A;  2WXP A;  3AJI A;  5FZS A;  2ZGD A;  4GMJ A;  1S63 A;  1KZP A;  1MYO A;  4BSZ B;  3ML9 A;  1PAQ A;  4RSY A;  2L6J A;  4UWK A;  2A4Z A;  3RO2 A;  3ONL A;  2ZGG A;  4JA7 A;  2AWI A;  1BI8 B;  3UM0 A;  1FCH A;  5EN5 D;  2DZN A;  4L2L A;  4G11 A;  3CGH A;  2LXL A;  4F53 A;  4HFG A;  4QQI A;  3KD7 A;  1YCS B;  1TJC A;  3ZNG A;  3PVL A;  3NAW A;  2DBA A;  3FH8 A;  2PM6 A;  2WPV A;  5JMN D;  4RLY A;  3CHQ A;  2C0L A;  3DSU A;  1BU9 A;  2DVW A;  3FUL A;  3HHM A;  2R02 A;  5FT9 A;  4BWR A;  1AWC B;  1AP7 A;  1GW6 A;  2PM7 A;  3RRN B;  2KCV A;  4K03 A;  4JZY A;  4UQZ A;  3PE3 A;  4XKB A;  3Q15 A;  1X5B A;  4JVS A;  5ENQ D;  3E32 A;  5JJT A;  1TNB A;  2R05 A;  3JCK C;  2BED A;  4L1B A;  2PQR A;  2ION A;  4XIF A;  4EPZ A;  3L16 A;  2J49 A;  4J8Y A;  3QWW A;  3Q9U C;  4HOR A;  1L5J A;  3UI2 A;  4GYW A;  3CVU A;  4OAU C;  2JEK A;  3VLF A;  3DSW A;  2YNQ A;  2R59 A;  2MOW A;  3ENE A;  4GA0 A;  3NQP A;  2EIM E;  2P9P G;  2WM9 A;  3LPZ A;  3ZN3 A;  2P9I G;  4NRH B; 
#chains in the Genus database with same CATH homology
 5CEC B;  3EHR A;  5EIB E;  3ZNG A;  5ITZ F;  2BKG A;  1DC2 A;  1IXV A;  2DZO A;  1NFI E;  3W9G A;  3LJN A;  4B93 B;  5BXO A;  2XZD G;  5AQ7 A;  1SVX A;  2JAB A;  2RFM A;  2F8X K;  4Z68 A;  3V79 K;  3J5P A;  5ENO D;  1SW6 A;  5JMN D;  2MYO A;  3T8K A;  4RLY A;  1YYH A;  2QC9 A;  5CED B;  2XZT G;  1BU9 A;  4G8L A;  2DVW A;  5AQA A;  4LNU D;  4N5Q A;  3EU9 A;  5AAR A;  3TWX A;  2KBX A;  4ATZ D;  3B7B A;  1UOH A;  4U8Y D;  4U8V D;  3V30 A;  3HRA A;  2BKK B;  3KEA A;  4DX6 D;  4GPM A;  3AAA C;  4HQD A;  3TWV A;  4C48 B;  3TWS A;  4TUM A;  4BEP A;  1K1A A;  1QYM A;  5CBN A;  1MX2 A;  1AWC B;  1AP7 A;  4A63 B;  4LG6 A;  5AQ9 A;  2L6B A;  4HI9 A;  2XEH A;  2XEN A;  5EID A;  4HNA D;  1IKN D;  1K1B A;  2B0O E;  2ETA A;  2J8S D;  4UUC A;  4HRN A;  2VGE A;  4OAV B;  5CER B;  4JB8 P;  2DWZ A;  4O1O A;  4YDY A;  4K5C A;  4DUI A;  4F6R D;  5ENR D;  3DEO A;  5ENT D;  1N0R A;  2FO1 E;  2RFA A;  5EYP F;  2AJA A;  3TWW A;  1G3N B;  1OT8 A;  4O1P A;  5HS0 A;  3UXG A;  3NOG D;  5D66 A;  4ZHB A;  3W9F A;  4BER A;  2F37 A;  1A5E A;  2QYJ A;  3EHQ A;  5JA4 D;  2ETC A;  5ENQ D;  3ZU7 B;  2V5Q C;  2Y1L E;  4K5B A;  4BET A;  2PNN A;  2Y0B G;  3J5Q B;  4DX7 D;  5BXU A;  5KWD A;  3V2X A;  3V2O A;  1DCQ A;  4HB5 A;  4NIK A;  2A5E A;  3UTM A;  3TWU A;  4LSZ E;  5AN8 A;  3HG0 D;  1MJ0 A;  4HLL A;  5FIO A;  2ETB A;  4CZ2 D;  1N0Q A;  2NYJ A;  4DX2 A;  1D9S A;  2HE0 A;  1WDY A;  1N11 A;  3C5R A;  3AJI A;  4HI8 A;  4J8Y A;  2ZGD A;  3T9K A;  4QFV A;  3JXI A;  3Q9U C;  1BLX B;  1WG0 A;  2V4H C;  4HRM B;  1MYO A;  4U95 D;  4J7W A;  5CBO A;  4BSZ B;  5KNG A;  1IHB A;  1OY3 D;  3Q9N C;  1MX6 A;  3UI2 A;  4OAU C;  3JUE A;  4G8K A;  1S70 B;  2XEE A;  3ZUV B;  2ZGG A;  3F6Q A;  4O60 A;  3V31 A;  4DRX E;  1BI8 B;  5ENP D;  4GMR A;  4ZFH A;  3NOC D;  5AQB A;  1K3Z D;  4U96 D;  5CEA A;  1MX4 A;  2P2C P;  5HKP A;  1TR4 A;  1BD8 A;  5EIL A;  5HRY A;  4BES A;  5EN5 D;  4CYM D;  3NBN B;  4DX1 A;  5AAO A;  2DZN A;  3JXJ A;  4DX5 D;  3TWR A;  4HRL A;  3TWQ A;  3DEP A;  3TWT A;  3IXE A;  1YCS B;  4YDW A;  3ZKJ A;  3D9H A;  5KNH D;  5EYL A;  1BI7 B;  4F1P A;  2KXP C;  3B95 A;  5KBA A;  1YMP A;  5FIN A;  4HBD A;  5ENS D;  3SO8 A;  4QQI A;  2F8Y A;  4K5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...