1WG7A

Solution structure of pleckstrin homology domain from human kiaa1058 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
b'GSSGSSGAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQEKRNGDSHEDDESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 9
publication title Solution structure of pleckstrin homology domain from human KIAA1058 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wg7A01
2D10A 2ELBA 3IVFA 2EC1A 3ODOA 4MT7A 3QBVB 2ZPYA 3TCAA 3BINA 2BCJA 1GG3A 1WJ1A 1BWNA 2CODA 4EMOA 3FSSA 4GMXB 5D3YA 4HAZB 1U2BA 2H7EA 1ZC4B 5J3YA 4GZUA 1H4RA 1V89A 4WSFA 2XQNM 4HB0B 3ULBA 1U29A 3PVWA 1XX0A 1SGHA 2K00A 2D9VA 3O96A 3PP2A 2ELAA 2I1KA 2YSZA 2OQBA 1NTYA 5EFXA 1NI2A 5D27A 2LYDA 1X86A 1WI1A 2QKLA 4L6EA 4MK0A 2M14A 5JLJB 4CHMA 3NSUA 1FGYA 2CY5A 1MK9B 3P7ZA 3VOQA 3AU5A 1UEFA 3A8QA 1AQCA 2ROZB 2MKRA 3WA0A 2RSGA 2Z0OA 1LW3A 2DTCA 3ULCA 4HAYB 4HB3B 4Z2NA 5DHFB 1U27A 1ZC3B 1Z87A 3SYXA 2N0YA 3ZVRA 2DKQA 1KZGA 1AWEA 1XKEA 5D3XA 1EF1A 2J0KA 3QWMA 4EJNA 4A6KA 5JP4A 1ZVRA 3FM8C 5C5BA 2NMBA 5LONB 4HB4B 3PVUA 4GXBA 1U5FA 2IYBA 2I1JA 2LULA 1XODA 1OMWA 3SO6A 5C5BB 1ZM0A 1DROA 1FB8A 4CHJA 1FAOA 5L81A 4F7GA 5CLLB 1BTNA 2I5FA 3KRWA 4IOYX 2GJYA 4HDOA 5KQ1A 3SUZA 1FHWA 4A6HA 2DHKA 3AU4A 2RNRB 5HE1A 3PEGA 3D8FA 4ZRKA 5JHGA 4DX90 5J3TA 1NU2A 2VSZA 2D9WA 2DHJA 2YT1A 1BAKA 3TW1A 2Y8GA 3LJUX 1XCGA 4TYZA 3TVVA 5LOPB 3FEHA 3DXDA 1V5UA 1K5DB 4WVFB 2P8VA 2DHIA 1DBHA 1TJ6A 3AJ4A 1N3HA 1EVHA 1WGQA 4DBBA 1ZSQA 2E2XA 2RUKB 4HHVA 4GPTB 1GC7A 1I7AA 3OANA 2Q13A 2D11A 3F0WA 5FI1A 3QIJA 4DXAB 1E5WA 4HAXB 2PZ1A 2X18A 2M38A 1H10A 2YRYA 3U7DA 2LOXA 1U5EA 5HE2A 1QQGA 4KHOA 1FGZA 2D4QA 3HK0A 2W2XC 4BBKA 4Z2MB 2ADZA 2LG1A 5HE3A 2HE7A 4GN1A 1BTKA 5D3VA 2H7DA 1U5GA 2Y7BA 1TXDA 4K2OA 4HAWB 2EMTA 1MIXA 2L2IA 4K81A 5HE0A 4HAUB 2CY4A 2GCJA 1DDMA 2EMSA 1DDWA 3TO1A 1UNRA 5DHAB 1K5GB 3BJIA 3T06A 2R0DA 3CXBB 2DKPA 3HQCA 3F5RA 2W2WA 4XWXA 2P0DA 4KHAA 1X11A 2YT0A 4B6HA 3SV1A 2AL6A 1OQNA 2YF0A 3GYOA 1M7EA 2V76A 1QC6A 2D2QA 2ROVA 5FI0A 3PSCA 2YS3A 2LKOA 2N23A 5CLQB 4NY0A 1OY2A 4DX8A 1MKEA 1WVHA 5C79A 4EKUA 4Y94A 1KI1B 2D9XA 1V5MA 2LOZA 4IFSA 4P7IA 2Z0PA 2P0HA 2K2JA 4A6FB 3A8PA 1WG7A 1PFJA 3ODWA 4WJ7A 1LB1A 4IAPA 1UPRA 1ISNA 1P3RA 3KSYA 2DYQA 1GC6A 1EGXA 4KHBB 3RCPA 2MDXA 5C6RA 2HTHB 2GCLA 1V5PA 1B55A 1Q67A 3DXEA 5KQ4A 1DDVA 1P6SA 1Y19B 1UPQA 3KRXA 2L1CA 2K2UA 1WJMA 2NZ8B 2YS1A 4HATB 4YL8A 1FOEA 2J59M 5D3WA 2VRWB 3TFMA 1UNPA 2P0FA 4PQ0A 2COFA 4YONA 1FHOA 2DA0A 2COAA 3ODXA 2Z0QA 2DX1A 4F7UP 2MWNB 3U8ZA 1MAIA 3N7CA 2COCA 4PNKA 3D8DA 1TQZA 4TKNA 1FHXA 2UVMA 4ZRIA 4ZRJA 2D9ZA 2FJLA 1EAZA 2JP2A 3X23A 3UZTA 1SHCA 3SNHA 2AEHA 2DFKA 2EJ8A 5J3QA 1W1GA 3VIAA 4C0AA 3G9WA 1RRPB 3P6AA 4KAXB 1KZ7A 5DI9B 2DYNA 3KZ1A 3M1IB 3MPXA 1M7RA 3HW2B 4HB2B 1V61A 2MFQA 2DLWA 1Y5OA 2CRFA 1X05A 4F7HA 1UNQA 4KVGB 2G35A 3KY9A 2GS0A 4K2PA 2YS5A 5JHHA 2QKMA 4A5KA 5GOWB 1J19A 4HAVB 1PMSA 1W1HA 2Y8FA 5DH9B 1IRSA 4H8SA 1NTVA 4HDQA 2RVBB 4D0NB 1PLSA 1DYNA 2DN6A 4MY6A 1X1FA 3PZDA 3D8EA 2I5CA 3DXCA 2UZRA 3MDBC 1MPHA 4A6FA 2YVCA 2KUPA 1RJ2A 1XR0B 4NSWA 2J0MA 2UZSA 3GYPA 1MK7B 2KGXB 3PVLA 1WGUA 1J0WA 2CAYA 3A98B 3PG7A 2J0JA 2VKIA 3WYFB 4GMVA 2KCJA 5KCVA 3ML4A 1V88A 3CIKA 4K17A 2R09A 1XD4A 2D9YA 2OTXA 3ZDTA 1I2HA 2DX5A 1W1DA 2W2XD 3V5WA 2RLOA 4CYEA 1P5TA 5C16A 1X1GA 1U5DA 2IFSA 5DIFB 1MIZB 2RGNB
chains in the Genus database with same CATH superfamily
2D10A 2ELBA 3IVFA 2EC1A 3ODOA 2Z14A 4MT7A 3QBVB 2ZPYA 3TCAA 4QJ5B 3BINA 2BCJA 1GG3A 1WJ1A 1BWNA 2CODA 4EMOA 3FSSA 4GMXB 4DIXA 5D3YA 4HAZB 1U2BA 2H7EA 1ZC4B 2YT2A 5J3YA 4GZUA 1H4RA 1V89A 4WSFA 2XQNM 4HB0B 3ULBA 1U29A 3PVWA 1XX0A 1SGHA 2K00A 2D9VA 3O96A 3PP2A 2ELAA 3OHMB 2I1KA 2YSZA 2OQBA 1NTYA 5EFXA 1NI2A 5D27A 2LYDA 1X86A 1WI1A 2QKLA 4L6EA 4MK0A 2M14A 5JLJB 4CHMA 3NSUA 1FGYA 2CY5A 1MK9B 3P7ZA 3VOQA 3AU5A 1UEFA 3A8QA 1AQCA 2ROZB 2MKRA 3WA0A 2RRFA 2RSGA 2Z0OA 1LW3A 2DTCA 3ULCA 4HAYB 4HB3B 4Z2NA 2R2YA 5DHFB 1U27A 1ZC3B 5IRSA 1Z87A 3SYXA 2N0YA 3ZVRA 2DKQA 2FJUB 1KZGA 1AWEA 1XKEA 5D3XA 1EF1A 2J0KA 3QWMA 4EJNA 4A6KA 5JP4A 1ZVRA 3FM8C 5C5BA 2NMBA 5LONB 4HB4B 3PVUA 4GXBA 1U5FA 2IYBA 2I1JA 2LULA 1XODA 1OMWA 3SO6A 5C5BB 1ZM0A 1DROA 1FB8A 4CHJA 1FAOA 5L81A 4F7GA 5CLLB 1BTNA 2I5FA 3NWAA 3KRWA 3DCXA 2GJYA 4IOYX 4HDOA 5KQ1A 3SUZA 1FHWA 4A6HA 2DHKA 3AU4A 2RNRB 5HE1A 3PEGA 3D8FA 4ZRKA 5JHGA 4DX90 5J3TA 1NU2A 2VSZA 2D9WA 4QJ3B 2DHJA 2YT1A 1BAKA 3TW1A 2Y8GA 3LJUX 1XCGA 2GUMA 4TYZA 3TVVA 5LOPB 3FEHA 3DXDA 1V5UA 1K5DB 4WVFB 2P8VA 2DHIA 1DBHA 1TJ6A 3AJ4A 1N3HA 1EVHA 1WGQA 4DBBA 1ZSQA 2E2XA 5I2MA 1ZYIA 2RUKB 4HHVA 4GPTB 1GC7A 1I7AA 3OANA 2Q13A 2D11A 3F0WA 5FI1A 3QIJA 4DXAB 1E5WA 4HAXB 2PZ1A 2X18A 2M38A 1H10A 2YRYA 3NWDA 3U7DA 2LOXA 1U5EA 5HE2A 1QQGA 4KHOA 3NWFA 1FGZA 2D4QA 3A58A 3HK0A 2W2XC 4BBKA 4Z2MB 2ADZA 2LG1A 5HE3A 2HE7A 4GN1A 1BTKA 5D3VA 2H7DA 1U5GA 2Y7BA 1TXDA 4QJ4B 4K2OA 1MI1A 4HAWB 2EMTA 1MIXA 2L2IA 4K81A 4GNKB 5HE0A 4HAUB 2CY4A 2GCJA 1DDMA 2EMSA 1DDWA 3TO1A 2Z4DA 1UNRA 5I2SA 5DHAB 1K5GB 3BJIA 3T06A 2R0DA 3CXBB 2DKPA 3HQCA 3F5RA 2W2WA 4XWXA 2P0DA 4KHAA 1X11A 2YT0A 4B6HA 3SV1A 2K49A 3NW8A 2AL6A 1OQNA 2YF0A 3GYOA 1M7EA 2V76A 1QC6A 2D2QA 2ROVA 5FI0A 3PSCA 2YS3A 2LKOA 2N23A 5CLQB 4NY0A 1OY2A 4DX8A 2ZKMX 1MKEA 1WVHA 5C79A 4EKUA 4Y94A 1KI1B 4OT1A 2D9XA 1V5MA 2LOZA 4IFSA 4P7IA 2Z0PA 2P0HA 2K2JA 4A6FB 3A8PA 1WG7A 1PFJA 3ODWA 4WJ7A 1LB1A 4IAPA 1UPRA 1ISNA 3HIEA 1P3RA 3KSYA 2DYQA 1GC6A 1EGXA 4KHBB 3RCPA 4OSNA 2MDXA 5C6RA 2HTHB 2GCLA 1V5PA 1B55A 1Q67A 3DXEA 5KQ4A 1DDVA 1P6SA 1Y19B 1UPQA 3KRXA 2L1CA 2K2UA 1WJMA 2NZ8B 2YS1A 4HATB 4YL8A 1FOEA 2J59M 5D3WA 2VRWB 2Z59A 3TFMA 1UNPA 2P0FA 4PQ0A 2COFA 4YONA 1FHOA 2DA0A 2COAA 3ODXA 2Z0QA 2DX1A 4F7UP 2MWNB 3U8ZA 1MAIA 3N7CA 2COCA 2KIGA 4PNKA 3D8DA 1TQZA 4TKNA 3B77A 1FHXA 3HSAA 2KUQA 2UVMA 4QXAB 4ZRIA 4ZRJA 1T77A 2D9ZA 2FJLA 1EAZA 2JP2A 3X23A 3UZTA 1SHCA 2NBVA 3SNHA 2AEHA 2DFKA 2EJ8A 5J3QA 1W1GA 3VIAA 4C0AA 3G9WA 5LG4B 1RRPB 3P6AA 4KAXB 1KZ7A 5DI9B 2DYNA 3FVCA 3KZ1A 3M1IB 3MPXA 1M7RA 3HW2B 4HB2B 1V61A 2MFQA 2DLWA 1Y5OA 2CRFA 1X05A 2KIEA 4F7HA 1UNQA 4KVGB 2G35A 3KY9A 2GS0A 4K2PA 2YS5A 5JHHA 2QKMA 4A5KA 5GOWB 1J19A 4HAVB 1PMSA 2Z13A 1W1HA 2Y8FA 5DH9B 1IRSA 4H8SA 1NTVA 4HDQA 2RVBB 4D0NB 3U12A 1PLSA 1DYNA 2DN6A 4MY6A 1X1FA 3PZDA 3D8EA 2I5CA 3DXCA 2UZRA 3MDBC 1MPHA 4A6FA 2YVCA 2KUPA 1RJ2A 4L1RA 1XR0B 4NSWA 2J0MA 2UZSA 4GOUA 3GYPA 1MK7B 4D6WA 2KGXB 3PVLA 1WGUA 1J0WA 4HSIA 2CAYA 4KHBA 3A98B 5M4YB 3PG7A 2J0JA 2VKIA 2K8EA 2KR0A 3WYFB 4GMVA 2KCJA 5KCVA 3ML4A 1V88A 3CIKA 4K17A 2R09A 1XD4A 2D9YA 2OTXA 3ZDTA 1I2HA 4CSQA 2DX5A 1W1DA 2W2XD 3V5WA 2RLOA 4CYEA 1P5TA 5C16A 1X1GA 1U5DA 2IFSA 5DIFB 1MIZB 2RGNB
chains in the Genus database with same CATH topology
2D10A 2ELBA 3IVFA 2EC1A 3ODOA 4MT7A 3QBVB 2ZPYA 3TCAA 3BINA 2BCJA 1GG3A 1WJ1A 1BWNA 2CODA 4EMOA 3FSSA 4GMXB 5D3YA 4HAZB 1U2BA 2H7EA 1ZC4B 5J3YA 4GZUA 1H4RA 1V89A 4WSFA 2XQNM 4HB0B 3ULBA 1U29A 3PVWA 1XX0A 1SGHA 2K00A 2D9VA 3O96A 3PP2A 2ELAA 2I1KA 2YSZA 2OQBA 1NTYA 5EFXA 1NI2A 5D27A 2LYDA 1X86A 1WI1A 2QKLA 4L6EA 4MK0A 2M14A 5JLJB 4CHMA 3NSUA 1FGYA 2CY5A 1MK9B 3P7ZA 3VOQA 3AU5A 1UEFA 3A8QA 1AQCA 2ROZB 2MKRA 3WA0A 2RSGA 2Z0OA 1LW3A 2DTCA 3ULCA 4HAYB 4HB3B 4Z2NA 5DHFB 1U27A 1ZC3B 1Z87A 3SYXA 2N0YA 3ZVRA 2DKQA 1KZGA 1AWEA 1XKEA 5D3XA 1EF1A 2J0KA 3QWMA 4EJNA 4A6KA 5JP4A 1ZVRA 3FM8C 5C5BA 2NMBA 5LONB 4HB4B 3PVUA 4GXBA 1U5FA 2IYBA 2I1JA 2LULA 1XODA 1OMWA 3SO6A 5C5BB 1ZM0A 1DROA 1FB8A 4CHJA 1FAOA 5L81A 4F7GA 5CLLB 1BTNA 2I5FA 3KRWA 4IOYX 2GJYA 4HDOA 5KQ1A 3SUZA 1FHWA 4A6HA 2DHKA 3AU4A 2RNRB 5HE1A 3PEGA 3D8FA 4ZRKA 5JHGA 4DX90 5J3TA 1NU2A 2VSZA 2D9WA 2DHJA 2YT1A 1BAKA 3TW1A 2Y8GA 3LJUX 1XCGA 4TYZA 3TVVA 5LOPB 3FEHA 3DXDA 1V5UA 1K5DB 4WVFB 2P8VA 2DHIA 1DBHA 1TJ6A 3AJ4A 1N3HA 1EVHA 1WGQA 4DBBA 1ZSQA 2E2XA 2RUKB 4HHVA 4GPTB 1GC7A 1I7AA 3OANA 2Q13A 2D11A 3F0WA 5FI1A 3QIJA 4DXAB 1E5WA 4HAXB 2PZ1A 2X18A 2M38A 1H10A 2YRYA 3U7DA 2LOXA 1U5EA 5HE2A 1QQGA 4KHOA 1FGZA 2D4QA 3HK0A 2W2XC 4BBKA 4Z2MB 2ADZA 2LG1A 5HE3A 2HE7A 4GN1A 1BTKA 5D3VA 2H7DA 1U5GA 2Y7BA 1TXDA 4K2OA 4HAWB 2EMTA 1MIXA 2L2IA 4K81A 5HE0A 4HAUB 2CY4A 2GCJA 1DDMA 2EMSA 1DDWA 3TO1A 1UNRA 5DHAB 1K5GB 3BJIA 3T06A 2R0DA 3CXBB 2DKPA 3HQCA 3F5RA 2W2WA 4XWXA 2P0DA 4KHAA 1X11A 2YT0A 4B6HA 3SV1A 2AL6A 1OQNA 2YF0A 3GYOA 1M7EA 2V76A 1QC6A 2D2QA 2ROVA 5FI0A 3PSCA 2YS3A 2LKOA 2N23A 5CLQB 4NY0A 1OY2A 4DX8A 1MKEA 1WVHA 5C79A 4EKUA 4Y94A 1KI1B 2D9XA 1V5MA 2LOZA 4IFSA 4P7IA 2Z0PA 2P0HA 2K2JA 4A6FB 3A8PA 1WG7A 1PFJA 3ODWA 4WJ7A 1LB1A 4IAPA 1UPRA 1ISNA 1P3RA 3KSYA 2DYQA 1GC6A 1EGXA 4KHBB 3RCPA 2MDXA 5C6RA 2HTHB 2GCLA 1V5PA 1B55A 1Q67A 3DXEA 5KQ4A 1DDVA 1P6SA 1Y19B 1UPQA 3KRXA 2L1CA 2K2UA 1WJMA 2NZ8B 2YS1A 4HATB 4YL8A 1FOEA 2J59M 5D3WA 2VRWB 3TFMA 1UNPA 2P0FA 4PQ0A 2COFA 4YONA 1FHOA 2DA0A 2COAA 3ODXA 2Z0QA 2DX1A 4F7UP 2MWNB 3U8ZA 1MAIA 3N7CA 2COCA 4PNKA 3D8DA 1TQZA 4TKNA 1FHXA 2UVMA 4ZRIA 4ZRJA 2D9ZA 2FJLA 1EAZA 2JP2A 3X23A 3UZTA 1SHCA 3SNHA 2AEHA 2DFKA 2EJ8A 5J3QA 1W1GA 3VIAA 4C0AA 3G9WA 1RRPB 3P6AA 4KAXB 1KZ7A 5DI9B 2DYNA 3KZ1A 3M1IB 3MPXA 1M7RA 3HW2B 4HB2B 1V61A 2MFQA 2DLWA 1Y5OA 2CRFA 1X05A 4F7HA 1UNQA 4KVGB 2G35A 3KY9A 2GS0A 4K2PA 2YS5A 5JHHA 2QKMA 4A5KA 5GOWB 1J19A 4HAVB 1PMSA 1W1HA 2Y8FA 5DH9B 1IRSA 4H8SA 1NTVA 4HDQA 2RVBB 4D0NB 1PLSA 1DYNA 2DN6A 4MY6A 1X1FA 3PZDA 3D8EA 2I5CA 3DXCA 2UZRA 3MDBC 1MPHA 4A6FA 2YVCA 2KUPA 1RJ2A 1XR0B 4NSWA 2J0MA 2UZSA 3GYPA 1MK7B 2KGXB 3PVLA 1WGUA 1J0WA 2CAYA 3A98B 3PG7A 2J0JA 2VKIA 3WYFB 4GMVA 2KCJA 5KCVA 3ML4A 1V88A 3CIKA 4K17A 2R09A 1XD4A 2D9YA 2OTXA 3ZDTA 1I2HA 2DX5A 1W1DA 2W2XD 3V5WA 2RLOA 4CYEA 1P5TA 5C16A 1X1GA 1U5DA 2IFSA 5DIFB 1MIZB 2RGNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  2ELB A;  3IVF A;  2EC1 A;  3ODO A;  4MT7 A;  3QBV B;  2ZPY A;  3TCA A;  3BIN A;  2BCJ A;  1GG3 A;  1WJ1 A;  1BWN A;  2COD A;  4EMO A;  3FSS A;  4GMX B;  5D3Y A;  4HAZ B;  1U2B A;  2H7E A;  1ZC4 B;  5J3Y A;  4GZU A;  1H4R A;  1V89 A;  4WSF A;  2XQN M;  4HB0 B;  3ULB A;  1U29 A;  3PVW A;  1XX0 A;  1SGH A;  2K00 A;  2D9V A;  3O96 A;  3PP2 A;  2ELA A;  2I1K A;  2YSZ A;  2OQB A;  1NTY A;  5EFX A;  1NI2 A;  5D27 A;  2LYD A;  1X86 A;  1WI1 A;  2QKL A;  4L6E A;  4MK0 A;  2M14 A;  5JLJ B;  4CHM A;  3NSU A;  1FGY A;  2CY5 A;  1MK9 B;  3P7Z A;  3VOQ A;  3AU5 A;  1UEF A;  3A8Q A;  1AQC A;  2ROZ B;  2MKR A;  3WA0 A;  2RSG A;  2Z0O A;  1LW3 A;  2DTC A;  3ULC A;  4HAY B;  4HB3 B;  4Z2N A;  5DHF B;  1U27 A;  1ZC3 B;  1Z87 A;  3SYX A;  2N0Y A;  3ZVR A;  2DKQ A;  1KZG A;  1AWE A;  1XKE A;  5D3X A;  1EF1 A;  2J0K A;  3QWM A;  4EJN A;  4A6K A;  5JP4 A;  1ZVR A;  3FM8 C;  5C5B A;  2NMB A;  5LON B;  4HB4 B;  3PVU A;  4GXB A;  1U5F A;  2IYB A;  2I1J A;  2LUL A;  1XOD A;  1OMW A;  3SO6 A;  5C5B B;  1ZM0 A;  1DRO A;  1FB8 A;  4CHJ A;  1FAO A;  5L81 A;  4F7G A;  5CLL B;  1BTN A;  2I5F A;  3KRW A;  4IOY X;  2GJY A;  4HDO A;  5KQ1 A;  3SUZ A;  1FHW A;  4A6H A;  2DHK A;  3AU4 A;  2RNR B;  5HE1 A;  3PEG A;  3D8F A;  4ZRK A;  5JHG A;  4DX9 0;  5J3T A;  1NU2 A;  2VSZ A;  2D9W A;  2DHJ A;  2YT1 A;  1BAK A;  3TW1 A;  2Y8G A;  3LJU X;  1XCG A;  4TYZ A;  3TVV A;  5LOP B;  3FEH A;  3DXD A;  1V5U A;  1K5D B;  4WVF B;  2P8V A;  2DHI A;  1DBH A;  1TJ6 A;  3AJ4 A;  1N3H A;  1EVH A;  1WGQ A;  4DBB A;  1ZSQ A;  2E2X A;  2RUK B;  4HHV A;  4GPT B;  1GC7 A;  1I7A A;  3OAN A;  2Q13 A;  2D11 A;  3F0W A;  5FI1 A;  3QIJ A;  4DXA B;  1E5W A;  4HAX B;  2PZ1 A;  2X18 A;  2M38 A;  1H10 A;  2YRY A;  3U7D A;  2LOX A;  1U5E A;  5HE2 A;  1QQG A;  4KHO A;  1FGZ A;  2D4Q A;  3HK0 A;  2W2X C;  4BBK A;  4Z2M B;  2ADZ A;  2LG1 A;  5HE3 A;  2HE7 A;  4GN1 A;  1BTK A;  5D3V A;  2H7D A;  1U5G A;  2Y7B A;  1TXD A;  4K2O A;  4HAW B;  2EMT A;  1MIX A;  2L2I A;  4K81 A;  5HE0 A;  4HAU B;  2CY4 A;  2GCJ A;  1DDM A;  2EMS A;  1DDW A;  3TO1 A;  1UNR A;  5DHA B;  1K5G B;  3BJI A;  3T06 A;  2R0D A;  3CXB B;  2DKP A;  3HQC A;  3F5R A;  2W2W A;  4XWX A;  2P0D A;  4KHA A;  1X11 A;  2YT0 A;  4B6H A;  3SV1 A;  2AL6 A;  1OQN A;  2YF0 A;  3GYO A;  1M7E A;  2V76 A;  1QC6 A;  2D2Q A;  2ROV A;  5FI0 A;  3PSC A;  2YS3 A;  2LKO A;  2N23 A;  5CLQ B;  4NY0 A;  1OY2 A;  4DX8 A;  1MKE A;  1WVH A;  5C79 A;  4EKU A;  4Y94 A;  1KI1 B;  2D9X A;  1V5M A;  2LOZ A;  4IFS A;  4P7I A;  2Z0P A;  2P0H A;  2K2J A;  4A6F B;  3A8P A;  1WG7 A;  1PFJ A;  3ODW A;  4WJ7 A;  1LB1 A;  4IAP A;  1UPR A;  1ISN A;  1P3R A;  3KSY A;  2DYQ A;  1GC6 A;  1EGX A;  4KHB B;  3RCP A;  2MDX A;  5C6R A;  2HTH B;  2GCL A;  1V5P A;  1B55 A;  1Q67 A;  3DXE A;  5KQ4 A;  1DDV A;  1P6S A;  1Y19 B;  1UPQ A;  3KRX A;  2L1C A;  2K2U A;  1WJM A;  2NZ8 B;  2YS1 A;  4HAT B;  4YL8 A;  1FOE A;  2J59 M;  5D3W A;  2VRW B;  3TFM A;  1UNP A;  2P0F A;  4PQ0 A;  2COF A;  4YON A;  1FHO A;  2DA0 A;  2COA A;  3ODX A;  2Z0Q A;  2DX1 A;  4F7U P;  2MWN B;  3U8Z A;  1MAI A;  3N7C A;  2COC A;  4PNK A;  3D8D A;  1TQZ A;  4TKN A;  1FHX A;  2UVM A;  4ZRI A;  4ZRJ A;  2D9Z A;  2FJL A;  1EAZ A;  2JP2 A;  3X23 A;  3UZT A;  1SHC A;  3SNH A;  2AEH A;  2DFK A;  2EJ8 A;  5J3Q A;  1W1G A;  3VIA A;  4C0A A;  3G9W A;  1RRP B;  3P6A A;  4KAX B;  1KZ7 A;  5DI9 B;  2DYN A;  3KZ1 A;  3M1I B;  3MPX A;  1M7R A;  3HW2 B;  4HB2 B;  1V61 A;  2MFQ A;  2DLW A;  1Y5O A;  2CRF A;  1X05 A;  4F7H A;  1UNQ A;  4KVG B;  2G35 A;  3KY9 A;  2GS0 A;  4K2P A;  2YS5 A;  5JHH A;  2QKM A;  4A5K A;  5GOW B;  1J19 A;  4HAV B;  1PMS A;  1W1H A;  2Y8F A;  5DH9 B;  1IRS A;  4H8S A;  1NTV A;  4HDQ A;  2RVB B;  4D0N B;  1PLS A;  1DYN A;  2DN6 A;  4MY6 A;  1X1F A;  3PZD A;  3D8E A;  2I5C A;  3DXC A;  2UZR A;  3MDB C;  1MPH A;  4A6F A;  2YVC A;  2KUP A;  1RJ2 A;  1XR0 B;  4NSW A;  2J0M A;  2UZS A;  3GYP A;  1MK7 B;  2KGX B;  3PVL A;  1WGU A;  1J0W A;  2CAY A;  3A98 B;  3PG7 A;  2J0J A;  2VKI A;  3WYF B;  4GMV A;  2KCJ A;  5KCV A;  3ML4 A;  1V88 A;  3CIK A;  4K17 A;  2R09 A;  1XD4 A;  2D9Y A;  2OTX A;  3ZDT A;  1I2H A;  2DX5 A;  1W1D A;  2W2X D;  3V5W A;  2RLO A;  4CYE A;  1P5T A;  5C16 A;  1X1G A;  1U5D A;  2IFS A;  5DIF B;  1MIZ B;  2RGN B; 
#chains in the Genus database with same CATH topology
 2D10 A;  2ELB A;  3IVF A;  2EC1 A;  3ODO A;  2Z14 A;  4MT7 A;  3QBV B;  2ZPY A;  3TCA A;  4QJ5 B;  3BIN A;  2BCJ A;  1GG3 A;  1WJ1 A;  1BWN A;  2COD A;  4EMO A;  3FSS A;  4GMX B;  4DIX A;  5D3Y A;  4HAZ B;  1U2B A;  2H7E A;  1ZC4 B;  2YT2 A;  5J3Y A;  4GZU A;  1H4R A;  1V89 A;  4WSF A;  2XQN M;  4HB0 B;  3ULB A;  1U29 A;  3PVW A;  1XX0 A;  1SGH A;  2K00 A;  2D9V A;  3O96 A;  3PP2 A;  2ELA A;  3OHM B;  2I1K A;  2YSZ A;  2OQB A;  1NTY A;  5EFX A;  1NI2 A;  5D27 A;  2LYD A;  1X86 A;  1WI1 A;  2QKL A;  4L6E A;  4MK0 A;  2M14 A;  5JLJ B;  4CHM A;  3NSU A;  1FGY A;  2CY5 A;  1MK9 B;  3P7Z A;  3VOQ A;  3AU5 A;  1UEF A;  3A8Q A;  1AQC A;  2ROZ B;  2MKR A;  3WA0 A;  2RRF A;  2RSG A;  2Z0O A;  1LW3 A;  2DTC A;  3ULC A;  4HAY B;  4HB3 B;  4Z2N A;  2R2Y A;  5DHF B;  1U27 A;  1ZC3 B;  5IRS A;  1Z87 A;  3SYX A;  2N0Y A;  3ZVR A;  2DKQ A;  2FJU B;  1KZG A;  1AWE A;  1XKE A;  5D3X A;  1EF1 A;  2J0K A;  3QWM A;  4EJN A;  4A6K A;  5JP4 A;  1ZVR A;  3FM8 C;  5C5B A;  2NMB A;  5LON B;  4HB4 B;  3PVU A;  4GXB A;  1U5F A;  2IYB A;  2I1J A;  2LUL A;  1XOD A;  1OMW A;  3SO6 A;  5C5B B;  1ZM0 A;  1DRO A;  1FB8 A;  4CHJ A;  1FAO A;  5L81 A;  4F7G A;  5CLL B;  1BTN A;  2I5F A;  3NWA A;  3KRW A;  3DCX A;  2GJY A;  4IOY X;  4HDO A;  5KQ1 A;  3SUZ A;  1FHW A;  4A6H A;  2DHK A;  3AU4 A;  2RNR B;  5HE1 A;  3PEG A;  3D8F A;  4ZRK A;  5JHG A;  4DX9 0;  5J3T A;  1NU2 A;  2VSZ A;  2D9W A;  4QJ3 B;  2DHJ A;  2YT1 A;  1BAK A;  3TW1 A;  2Y8G A;  3LJU X;  1XCG A;  2GUM A;  4TYZ A;  3TVV A;  5LOP B;  3FEH A;  3DXD A;  1V5U A;  1K5D B;  4WVF B;  2P8V A;  2DHI A;  1DBH A;  1TJ6 A;  3AJ4 A;  1N3H A;  1EVH A;  1WGQ A;  4DBB A;  1ZSQ A;  2E2X A;  5I2M A;  1ZYI A;  2RUK B;  4HHV A;  4GPT B;  1GC7 A;  1I7A A;  3OAN A;  2Q13 A;  2D11 A;  3F0W A;  5FI1 A;  3QIJ A;  4DXA B;  1E5W A;  4HAX B;  2PZ1 A;  2X18 A;  2M38 A;  1H10 A;  2YRY A;  3NWD A;  3U7D A;  2LOX A;  1U5E A;  5HE2 A;  1QQG A;  4KHO A;  3NWF A;  1FGZ A;  2D4Q A;  3A58 A;  3HK0 A;  2W2X C;  4BBK A;  4Z2M B;  2ADZ A;  2LG1 A;  5HE3 A;  2HE7 A;  4GN1 A;  1BTK A;  5D3V A;  2H7D A;  1U5G A;  2Y7B A;  1TXD A;  4QJ4 B;  4K2O A;  1MI1 A;  4HAW B;  2EMT A;  1MIX A;  2L2I A;  4K81 A;  4GNK B;  5HE0 A;  4HAU B;  2CY4 A;  2GCJ A;  1DDM A;  2EMS A;  1DDW A;  3TO1 A;  2Z4D A;  1UNR A;  5I2S A;  5DHA B;  1K5G B;  3BJI A;  3T06 A;  2R0D A;  3CXB B;  2DKP A;  3HQC A;  3F5R A;  2W2W A;  4XWX A;  2P0D A;  4KHA A;  1X11 A;  2YT0 A;  4B6H A;  3SV1 A;  2K49 A;  3NW8 A;  2AL6 A;  1OQN A;  2YF0 A;  3GYO A;  1M7E A;  2V76 A;  1QC6 A;  2D2Q A;  2ROV A;  5FI0 A;  3PSC A;  2YS3 A;  2LKO A;  2N23 A;  5CLQ B;  4NY0 A;  1OY2 A;  4DX8 A;  2ZKM X;  1MKE A;  1WVH A;  5C79 A;  4EKU A;  4Y94 A;  1KI1 B;  4OT1 A;  2D9X A;  1V5M A;  2LOZ A;  4IFS A;  4P7I A;  2Z0P A;  2P0H A;  2K2J A;  4A6F B;  3A8P A;  1WG7 A;  1PFJ A;  3ODW A;  4WJ7 A;  1LB1 A;  4IAP A;  1UPR A;  1ISN A;  3HIE A;  1P3R A;  3KSY A;  2DYQ A;  1GC6 A;  1EGX A;  4KHB B;  3RCP A;  4OSN A;  2MDX A;  5C6R A;  2HTH B;  2GCL A;  1V5P A;  1B55 A;  1Q67 A;  3DXE A;  5KQ4 A;  1DDV A;  1P6S A;  1Y19 B;  1UPQ A;  3KRX A;  2L1C A;  2K2U A;  1WJM A;  2NZ8 B;  2YS1 A;  4HAT B;  4YL8 A;  1FOE A;  2J59 M;  5D3W A;  2VRW B;  2Z59 A;  3TFM A;  1UNP A;  2P0F A;  4PQ0 A;  2COF A;  4YON A;  1FHO A;  2DA0 A;  2COA A;  3ODX A;  2Z0Q A;  2DX1 A;  4F7U P;  2MWN B;  3U8Z A;  1MAI A;  3N7C A;  2COC A;  2KIG A;  4PNK A;  3D8D A;  1TQZ A;  4TKN A;  3B77 A;  1FHX A;  3HSA A;  2KUQ A;  2UVM A;  4QXA B;  4ZRI A;  4ZRJ A;  1T77 A;  2D9Z A;  2FJL A;  1EAZ A;  2JP2 A;  3X23 A;  3UZT A;  1SHC A;  2NBV A;  3SNH A;  2AEH A;  2DFK A;  2EJ8 A;  5J3Q A;  1W1G A;  3VIA A;  4C0A A;  3G9W A;  5LG4 B;  1RRP B;  3P6A A;  4KAX B;  1KZ7 A;  5DI9 B;  2DYN A;  3FVC A;  3KZ1 A;  3M1I B;  3MPX A;  1M7R A;  3HW2 B;  4HB2 B;  1V61 A;  2MFQ A;  2DLW A;  1Y5O A;  2CRF A;  1X05 A;  2KIE A;  4F7H A;  1UNQ A;  4KVG B;  2G35 A;  3KY9 A;  2GS0 A;  4K2P A;  2YS5 A;  5JHH A;  2QKM A;  4A5K A;  5GOW B;  1J19 A;  4HAV B;  1PMS A;  2Z13 A;  1W1H A;  2Y8F A;  5DH9 B;  1IRS A;  4H8S A;  1NTV A;  4HDQ A;  2RVB B;  4D0N B;  3U12 A;  1PLS A;  1DYN A;  2DN6 A;  4MY6 A;  1X1F A;  3PZD A;  3D8E A;  2I5C A;  3DXC A;  2UZR A;  3MDB C;  1MPH A;  4A6F A;  2YVC A;  2KUP A;  1RJ2 A;  4L1R A;  1XR0 B;  4NSW A;  2J0M A;  2UZS A;  4GOU A;  3GYP A;  1MK7 B;  4D6W A;  2KGX B;  3PVL A;  1WGU A;  1J0W A;  4HSI A;  2CAY A;  4KHB A;  3A98 B;  5M4Y B;  3PG7 A;  2J0J A;  2VKI A;  2K8E A;  2KR0 A;  3WYF B;  4GMV A;  2KCJ A;  5KCV A;  3ML4 A;  1V88 A;  3CIK A;  4K17 A;  2R09 A;  1XD4 A;  2D9Y A;  2OTX A;  3ZDT A;  1I2H A;  4CSQ A;  2DX5 A;  1W1D A;  2W2X D;  3V5W A;  2RLO A;  4CYE A;  1P5T A;  5C16 A;  1X1G A;  1U5D A;  2IFS A;  5DIF B;  1MIZ B;  2RGN B; 
#chains in the Genus database with same CATH homology
 2D10 A;  2ELB A;  3IVF A;  2EC1 A;  3ODO A;  4MT7 A;  3QBV B;  2ZPY A;  3TCA A;  3BIN A;  2BCJ A;  1GG3 A;  1WJ1 A;  1BWN A;  2COD A;  4EMO A;  3FSS A;  4GMX B;  5D3Y A;  4HAZ B;  1U2B A;  2H7E A;  1ZC4 B;  5J3Y A;  4GZU A;  1H4R A;  1V89 A;  4WSF A;  2XQN M;  4HB0 B;  3ULB A;  1U29 A;  3PVW A;  1XX0 A;  1SGH A;  2K00 A;  2D9V A;  3O96 A;  3PP2 A;  2ELA A;  2I1K A;  2YSZ A;  2OQB A;  1NTY A;  5EFX A;  1NI2 A;  5D27 A;  2LYD A;  1X86 A;  1WI1 A;  2QKL A;  4L6E A;  4MK0 A;  2M14 A;  5JLJ B;  4CHM A;  3NSU A;  1FGY A;  2CY5 A;  1MK9 B;  3P7Z A;  3VOQ A;  3AU5 A;  1UEF A;  3A8Q A;  1AQC A;  2ROZ B;  2MKR A;  3WA0 A;  2RSG A;  2Z0O A;  1LW3 A;  2DTC A;  3ULC A;  4HAY B;  4HB3 B;  4Z2N A;  5DHF B;  1U27 A;  1ZC3 B;  1Z87 A;  3SYX A;  2N0Y A;  3ZVR A;  2DKQ A;  1KZG A;  1AWE A;  1XKE A;  5D3X A;  1EF1 A;  2J0K A;  3QWM A;  4EJN A;  4A6K A;  5JP4 A;  1ZVR A;  3FM8 C;  5C5B A;  2NMB A;  5LON B;  4HB4 B;  3PVU A;  4GXB A;  1U5F A;  2IYB A;  2I1J A;  2LUL A;  1XOD A;  1OMW A;  3SO6 A;  5C5B B;  1ZM0 A;  1DRO A;  1FB8 A;  4CHJ A;  1FAO A;  5L81 A;  4F7G A;  5CLL B;  1BTN A;  2I5F A;  3KRW A;  4IOY X;  2GJY A;  4HDO A;  5KQ1 A;  3SUZ A;  1FHW A;  4A6H A;  2DHK A;  3AU4 A;  2RNR B;  5HE1 A;  3PEG A;  3D8F A;  4ZRK A;  5JHG A;  4DX9 0;  5J3T A;  1NU2 A;  2VSZ A;  2D9W A;  2DHJ A;  2YT1 A;  1BAK A;  3TW1 A;  2Y8G A;  3LJU X;  1XCG A;  4TYZ A;  3TVV A;  5LOP B;  3FEH A;  3DXD A;  1V5U A;  1K5D B;  4WVF B;  2P8V A;  2DHI A;  1DBH A;  1TJ6 A;  3AJ4 A;  1N3H A;  1EVH A;  1WGQ A;  4DBB A;  1ZSQ A;  2E2X A;  2RUK B;  4HHV A;  4GPT B;  1GC7 A;  1I7A A;  3OAN A;  2Q13 A;  2D11 A;  3F0W A;  5FI1 A;  3QIJ A;  4DXA B;  1E5W A;  4HAX B;  2PZ1 A;  2X18 A;  2M38 A;  1H10 A;  2YRY A;  3U7D A;  2LOX A;  1U5E A;  5HE2 A;  1QQG A;  4KHO A;  1FGZ A;  2D4Q A;  3HK0 A;  2W2X C;  4BBK A;  4Z2M B;  2ADZ A;  2LG1 A;  5HE3 A;  2HE7 A;  4GN1 A;  1BTK A;  5D3V A;  2H7D A;  1U5G A;  2Y7B A;  1TXD A;  4K2O A;  4HAW B;  2EMT A;  1MIX A;  2L2I A;  4K81 A;  5HE0 A;  4HAU B;  2CY4 A;  2GCJ A;  1DDM A;  2EMS A;  1DDW A;  3TO1 A;  1UNR A;  5DHA B;  1K5G B;  3BJI A;  3T06 A;  2R0D A;  3CXB B;  2DKP A;  3HQC A;  3F5R A;  2W2W A;  4XWX A;  2P0D A;  4KHA A;  1X11 A;  2YT0 A;  4B6H A;  3SV1 A;  2AL6 A;  1OQN A;  2YF0 A;  3GYO A;  1M7E A;  2V76 A;  1QC6 A;  2D2Q A;  2ROV A;  5FI0 A;  3PSC A;  2YS3 A;  2LKO A;  2N23 A;  5CLQ B;  4NY0 A;  1OY2 A;  4DX8 A;  1MKE A;  1WVH A;  5C79 A;  4EKU A;  4Y94 A;  1KI1 B;  2D9X A;  1V5M A;  2LOZ A;  4IFS A;  4P7I A;  2Z0P A;  2P0H A;  2K2J A;  4A6F B;  3A8P A;  1WG7 A;  1PFJ A;  3ODW A;  4WJ7 A;  1LB1 A;  4IAP A;  1UPR A;  1ISN A;  1P3R A;  3KSY A;  2DYQ A;  1GC6 A;  1EGX A;  4KHB B;  3RCP A;  2MDX A;  5C6R A;  2HTH B;  2GCL A;  1V5P A;  1B55 A;  1Q67 A;  3DXE A;  5KQ4 A;  1DDV A;  1P6S A;  1Y19 B;  1UPQ A;  3KRX A;  2L1C A;  2K2U A;  1WJM A;  2NZ8 B;  2YS1 A;  4HAT B;  4YL8 A;  1FOE A;  2J59 M;  5D3W A;  2VRW B;  3TFM A;  1UNP A;  2P0F A;  4PQ0 A;  2COF A;  4YON A;  1FHO A;  2DA0 A;  2COA A;  3ODX A;  2Z0Q A;  2DX1 A;  4F7U P;  2MWN B;  3U8Z A;  1MAI A;  3N7C A;  2COC A;  4PNK A;  3D8D A;  1TQZ A;  4TKN A;  1FHX A;  2UVM A;  4ZRI A;  4ZRJ A;  2D9Z A;  2FJL A;  1EAZ A;  2JP2 A;  3X23 A;  3UZT A;  1SHC A;  3SNH A;  2AEH A;  2DFK A;  2EJ8 A;  5J3Q A;  1W1G A;  3VIA A;  4C0A A;  3G9W A;  1RRP B;  3P6A A;  4KAX B;  1KZ7 A;  5DI9 B;  2DYN A;  3KZ1 A;  3M1I B;  3MPX A;  1M7R A;  3HW2 B;  4HB2 B;  1V61 A;  2MFQ A;  2DLW A;  1Y5O A;  2CRF A;  1X05 A;  4F7H A;  1UNQ A;  4KVG B;  2G35 A;  3KY9 A;  2GS0 A;  4K2P A;  2YS5 A;  5JHH A;  2QKM A;  4A5K A;  5GOW B;  1J19 A;  4HAV B;  1PMS A;  1W1H A;  2Y8F A;  5DH9 B;  1IRS A;  4H8S A;  1NTV A;  4HDQ A;  2RVB B;  4D0N B;  1PLS A;  1DYN A;  2DN6 A;  4MY6 A;  1X1F A;  3PZD A;  3D8E A;  2I5C A;  3DXC A;  2UZR A;  3MDB C;  1MPH A;  4A6F A;  2YVC A;  2KUP A;  1RJ2 A;  1XR0 B;  4NSW A;  2J0M A;  2UZS A;  3GYP A;  1MK7 B;  2KGX B;  3PVL A;  1WGU A;  1J0W A;  2CAY A;  3A98 B;  3PG7 A;  2J0J A;  2VKI A;  3WYF B;  4GMV A;  2KCJ A;  5KCV A;  3ML4 A;  1V88 A;  3CIK A;  4K17 A;  2R09 A;  1XD4 A;  2D9Y A;  2OTX A;  3ZDT A;  1I2H A;  2DX5 A;  1W1D A;  2W2X D;  3V5W A;  2RLO A;  4CYE A;  1P5T A;  5C16 A;  1X1G A;  1U5D A;  2IFS A;  5DIF B;  1MIZ B;  2RGN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...