1WG7A

Solution structure of pleckstrin homology domain from human kiaa1058 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
GSSGSSGAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQEKRNGDSHEDDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of pleckstrin homology domain from human KIAA1058 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 9
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wg7A01
3ZDTA 4B6HA 1DDMA 1TJ6A 1NU2A 2I5CA 1V5PA 2GCJA 1X1FA 4HDQA 2DA0A 1NTVA 1DBHA 4BBKA 1EVHA 2AEHA 3FSSA 2ELAA 4CHJA 5C16A 3ODOA 4HAXB 3VIAA 2K2UA 2ROVA 2R09A 5C5BA 1SHCA 1Z87A 2OQBA 2NZ8B 3CIKA 4KVGB 2RVBB 3X23A 2RUKB 2COAA 4A5KA 4IOYX 2X18A 4K2PA 2DYNA 3KZ1A 1TQZA 1UNQA 2D9VA 3O96A 4WVFB 1X1GA 1ZVRA 2K00A 2Y8FA 2YT0A 3AU5A 1M7RA 1OY2A 3GYPA 1W1HA 1KZGA 1V61A 3KRXA 5D3YA 3SV1A 2DHKA 5KQ4A 4HATB 2G35A 4XWXA 3BJIA 1U27A 2VSZA 2EMSA 4HDOA 1ZM0A 4L6EA 2MKRA 4HAYB 1V5MA 1ZC3B 4ZRJA 5FI1A 1B55A 1U5EA 4GMXB 2UVMA 5DHAB 2UZSA 3HQCA 5J3YA 3VOQA 1WVHA 1Y19B 4K17A 2ELBA 4GXBA 4YL8A 3LJUX 4MT7A 3BINA 1Q67A 1FOEA 2P0HA 3U8ZA 4DX90 2DYQA 2DLWA 3KY9A 4NSWA 2DHIA 3ODWA 1WG7A 2CY5A 1KI1B 2LYDA 2ZPYA 3A8QA 3QWMA 2E2XA 2ROZB 2Z0QA 1LW3A 2W2WA 1M7EA 1X05A 3TCAA 4WSFA 3IVFA 1FB8A 4DBBA 1QC6A 1RJ2A 3V5WA 1W1GA 1UEFA 2D11A 4C0AA 2YRYA 1WI1A 1UNRA 1Y5OA 1KZ7A 4HB3B 5CLQB 2GCLA 3PVUA 2D2QA 2DHJA 3G9WA 2MFQA 1GC7A 3PEGA 1BAKA 3QBVB 4MY6A 3CXBB 2YS5A 3NSUA 4NY0A 5C6RA 1FHXA 4F7GA 2UZRA 1J0WA 1DDWA 1ZC4B 4GZUA 5DH9B 4KHBB 2NMBA 2YS3A 2H7DA 2XQNM 1V5UA 4KHOA 2M14A 2ADZA 1EGXA 5CLLB 4ZRIA 1OMWA 1EAZA 2I1JA 2Y8GA 4HAWB 4P7IA 3AJ4A 1DROA 2LKOA 1WJ1A 1OQNA 3AU4A 1XR0B 5DI9B 2GJYA 2RGNB 1MPHA 1J19A 2D10A 4CYEA 2L2IA 3F0WA 4A6HA 3DXEA 5DHFB 2HE7A 2J59M 2CODA 4GPTB 4KHAA 1TXDA 3MPXA 3FEHA 1U5FA 3MDBC 4GMVA 4Y94A 4Z2MB 5JP4A 3T06A 2PZ1A 3PZDA 5GOWB 5J3TA 2EC1A 2CAYA 2M38A 2I5FA 3D8DA 1XODA 2QKMA 5KQ1A 5J3QA 2D9ZA 2RLOA 2Z0OA 5C79A 2RSGA 2VRWB 3M1IB 1WJMA 1W1DA 1U5DA 2KCJA 2LOZA 2DX5A 3N7CA 2CY4A 2COCA 1MK7B 2P0DA 2EMTA 3SO6A 1ZSQA 5HE0A 2Q13A 1DDVA 4HAZB 3SUZA 3TW1A 3TO1A 4F7HA 3P6AA 3HK0A 1GC6A 4KAXB 4H8SA 2N0YA 4Z2NA 2H7EA 5KCVA 2J0MA 2GS0A 1NTYA 2MWNB 2YF0A 4HB2B 1K5DB 4HB0B 3TVVA 1FGZA 1UNPA 1WGUA 3PVLA 1BTKA 2OTXA 4TYZA 1XKEA 1X11A 1DYNA 2RNRB 2KUPA 4PQ0A 1XCGA 4F7UP 2LULA 4DXAB 2L1CA 4K81A 2AL6A 3GYOA 3UZTA 1U29A 1PFJA 1AQCA 1P5TA 2D9WA 3OANA 5HE1A 5LOPB 4WJ7A 2P8VA 3F5RA 5EFXA 5JHGA 2HTHB 2N23A 3QIJA 4A6KA 1N3HA 2Z0PA 1IRSA 3PP2A 3SNHA 4K2OA 2P0FA 1UPRA 2V76A 2QKLA 4EKUA 1MK9B 1V88A 3A98B 4HAUB 2DKPA 3A8PA 5D3VA 1UPQA 1PLSA 3D8FA 2K2JA 5DIFB 2DFKA 1XX0A 3D8EA 2FJLA 5LONB 3WYFB 1I2HA 2J0JA 4CHMA 2W2XD 4A6FA 2R0DA 1P3RA 1FHOA 5JLJB 4MK0A 2Y7BA 1XD4A 1ISNA 4D0NB 1E5WA 1I7AA 1MKEA 3HW2B 1MIXA 3P7ZA 1GG3A 2YS1A 4HB4B 1AWEA 5D27A 3RCPA 1H4RA 1U2BA 3PVWA 4A6FB 1BTNA 5C5BB 2DX1A 2IYBA 1U5GA 1P6SA 1BWNA 5L81A 2W2XC 4PNKA 2DTCA 1FHWA 2D4QA 2LG1A 1FGYA 3FM8C 2VKIA 2LOXA 2DKQA 3ULBA 1V89A 1K5GB 2CRFA 4DX8A 5D3WA 2D9YA 1RRPB 2YVCA 1QQGA 4GN1A 1FAOA 1LB1A 3ODXA 1WGQA 1NI2A 2COFA 3PG7A 1MAIA 4HAVB 5D3XA 5HE2A 3DXDA 3KRWA 2EJ8A 2D9XA 4EJNA 3ZVRA 5FI0A 3ULCA 2J0KA 3ML4A 4IFSA 2YSZA 2YT1A 3PSCA 4EMOA 5JHHA 2DN6A 4YONA 1H10A 1X86A 4TKNA 5HE3A 2MDXA 2IFSA 3DXCA 2JP2A 1SGHA 4ZRKA 4IAPA 2I1KA 3KSYA 3WA0A 4HHVA 3SYXA 1MIZB 2BCJA 1PMSA 1EF1A 3U7DA 3TFMA 2KGXB
chains in the Genus database with same CATH superfamily
3ZDTA 4B6HA 1DDMA 1TJ6A 1NU2A 2I5CA 1V5PA 2K8EA 2GCJA 1X1FA 4HDQA 2DA0A 1NTVA 1DBHA 4BBKA 1EVHA 2AEHA 3FSSA 4KHBA 2ELAA 4CHJA 5C16A 2R2YA 3ODOA 4HAXB 3VIAA 2K2UA 2ROVA 2R09A 5M4YB 5C5BA 1SHCA 1Z87A 2OQBA 2NZ8B 3CIKA 4KVGB 2RVBB 3X23A 2RUKB 5IRSA 3NWAA 2COAA 2Z4DA 4A5KA 4IOYX 2X18A 4K2PA 2DYNA 3KZ1A 1TQZA 1UNQA 2D9VA 4OSNA 3O96A 4WVFB 1X1GA 1ZVRA 2K00A 2Y8FA 2YT0A 3AU5A 1M7RA 1OY2A 3GYPA 1W1HA 1KZGA 1V61A 3KRXA 5D3YA 3SV1A 2DHKA 5KQ4A 4HATB 2G35A 4XWXA 3BJIA 1U27A 2VSZA 2EMSA 4HDOA 1ZM0A 4L6EA 2MKRA 5I2MA 4HAYB 1V5MA 1ZC3B 4ZRJA 5FI1A 1B55A 4GNKB 1U5EA 4GMXB 2UVMA 5DHAB 2UZSA 3HQCA 5J3YA 3VOQA 4QJ5B 1WVHA 1Y19B 4K17A 2ELBA 4GXBA 4YL8A 3LJUX 4MT7A 3BINA 1Q67A 1FOEA 2P0HA 3U8ZA 4DX90 2DYQA 2DLWA 3KY9A 4NSWA 2DHIA 3ODWA 1WG7A 2CY5A 1KI1B 3B77A 2LYDA 2ZPYA 3A8QA 3QWMA 2E2XA 2ROZB 2Z0QA 1LW3A 2W2WA 1M7EA 1X05A 3TCAA 4WSFA 3IVFA 1FB8A 4DBBA 1QC6A 1RJ2A 3V5WA 1W1GA 1UEFA 2D11A 4C0AA 2YRYA 1WI1A 1UNRA 1Y5OA 1KZ7A 4HB3B 5CLQB 2GCLA 3PVUA 2D2QA 2DHJA 3G9WA 2MFQA 1GC7A 3PEGA 1BAKA 3QBVB 4MY6A 3CXBB 2YS5A 3NSUA 4NY0A 5C6RA 1FHXA 4F7GA 2UZRA 1J0WA 1DDWA 1ZC4B 4GZUA 5DH9B 4KHBB 2NMBA 2YS3A 2H7DA 2XQNM 1V5UA 4KHOA 2M14A 2ADZA 1EGXA 5CLLB 4ZRIA 1OMWA 1EAZA 2I1JA 2Y8GA 2Z14A 4HAWB 3AJ4A 4P7IA 1DROA 2LKOA 1WJ1A 2K49A 1OQNA 3A58A 3AU4A 1XR0B 5DI9B 2GJYA 2RGNB 1MPHA 1J19A 2D10A 4CYEA 2L2IA 3F0WA 4A6HA 3DXEA 5DHFB 2HE7A 2J59M 2CODA 4GPTB 4KHAA 1TXDA 3MPXA 3FEHA 1U5FA 3MDBC 4GMVA 4Y94A 4Z2MB 5JP4A 3T06A 2PZ1A 3PZDA 5GOWB 5J3TA 2EC1A 2CAYA 2M38A 2I5FA 3D8DA 1XODA 2QKMA 5KQ1A 5J3QA 2D9ZA 2RLOA 2Z0OA 5C79A 2RSGA 2VRWB 3M1IB 2NBVA 1WJMA 1W1DA 1U5DA 3OHMB 2KCJA 2LOZA 2DX5A 3N7CA 2CY4A 2COCA 1MK7B 2P0DA 2EMTA 3SO6A 1ZYIA 1ZSQA 5HE0A 2Q13A 5LG4B 1DDVA 4HAZB 3SUZA 3TW1A 3TO1A 4F7HA 3P6AA 3HK0A 1GC6A 4KAXB 4H8SA 2Z13A 2N0YA 4Z2NA 2H7EA 2KUQA 5KCVA 2J0MA 2GS0A 1NTYA 2MWNB 2YF0A 4HB2B 1K5DB 4HB0B 3TVVA 1T77A 1FGZA 1UNPA 1WGUA 2Z59A 3PVLA 1BTKA 2OTXA 2RRFA 4TYZA 1XKEA 1X11A 1DYNA 2RNRB 2KUPA 4PQ0A 1XCGA 4F7UP 2LULA 4DXAB 3HSAA 2L1CA 4K81A 2AL6A 3HIEA 3DCXA 3GYOA 3UZTA 1U29A 1PFJA 3NWDA 1AQCA 1P5TA 2D9WA 3OANA 5HE1A 5LOPB 4WJ7A 2P8VA 3F5RA 5EFXA 5JHGA 1MI1A 2HTHB 2N23A 3QIJA 4A6KA 1N3HA 2ZKMX 2Z0PA 1IRSA 3PP2A 3SNHA 4K2OA 2P0FA 2GUMA 1UPRA 2V76A 2YT2A 2QKLA 4EKUA 1MK9B 1V88A 3A98B 4HAUB 2DKPA 3A8PA 5D3VA 1UPQA 5I2SA 1PLSA 2KR0A 2K2JA 3D8FA 5DIFB 2DFKA 1XX0A 3D8EA 2FJLA 5LONB 3WYFB 1I2HA 2J0JA 2KIEA 4CHMA 2W2XD 4A6FA 2R0DA 1P3RA 1FHOA 5JLJB 4QJ4B 4MK0A 4OT1A 2Y7BA 1XD4A 1ISNA 4D0NB 1E5WA 1I7AA 1MKEA 3HW2B 1MIXA 3P7ZA 1GG3A 2YS1A 4HB4B 1AWEA 5D27A 3RCPA 1H4RA 1U2BA 3PVWA 4A6FB 1BTNA 5C5BB 2DX1A 4GOUA 2IYBA 1U5GA 1P6SA 1BWNA 5L81A 2W2XC 4PNKA 2DTCA 1FHWA 2D4QA 2LG1A 1FGYA 4QJ3B 3FM8C 2VKIA 2LOXA 2DKQA 3ULBA 1V89A 1K5GB 2CRFA 4DX8A 5D3WA 4D6WA 2D9YA 3FVCA 1RRPB 2YVCA 1QQGA 4GN1A 1FAOA 1LB1A 3ODXA 1WGQA 1NI2A 2COFA 2FJUB 3PG7A 1MAIA 4HAVB 5D3XA 3U12A 5HE2A 3DXDA 3KRWA 2KIGA 2EJ8A 4DIXA 2D9XA 4EJNA 4CSQA 3ZVRA 5FI0A 3ULCA 2J0KA 3ML4A 4IFSA 2YSZA 2YT1A 3PSCA 4L1RA 4EMOA 5JHHA 2DN6A 4YONA 1H10A 1X86A 4TKNA 5HE3A 2MDXA 2IFSA 3DXCA 4HSIA 2JP2A 4QXAB 1SGHA 3NW8A 4ZRKA 4IAPA 2I1KA 3KSYA 3WA0A 4HHVA 3SYXA 1MIZB 2BCJA 3NWFA 1PMSA 1EF1A 3U7DA 3TFMA 2KGXB
chains in the Genus database with same CATH topology
3ZDTA 4B6HA 1DDMA 1TJ6A 1NU2A 2I5CA 1V5PA 2GCJA 1X1FA 4HDQA 2DA0A 1NTVA 1DBHA 4BBKA 1EVHA 2AEHA 3FSSA 2ELAA 4CHJA 5C16A 3ODOA 4HAXB 3VIAA 2K2UA 2ROVA 2R09A 5C5BA 1SHCA 1Z87A 2OQBA 2NZ8B 3CIKA 4KVGB 2RVBB 3X23A 2RUKB 2COAA 4A5KA 4IOYX 2X18A 4K2PA 2DYNA 3KZ1A 1TQZA 1UNQA 2D9VA 3O96A 4WVFB 1X1GA 1ZVRA 2K00A 2Y8FA 2YT0A 3AU5A 1M7RA 1OY2A 3GYPA 1W1HA 1KZGA 1V61A 3KRXA 5D3YA 3SV1A 2DHKA 5KQ4A 4HATB 2G35A 4XWXA 3BJIA 1U27A 2VSZA 2EMSA 4HDOA 1ZM0A 4L6EA 2MKRA 4HAYB 1V5MA 1ZC3B 4ZRJA 5FI1A 1B55A 1U5EA 4GMXB 2UVMA 5DHAB 2UZSA 3HQCA 5J3YA 3VOQA 1WVHA 1Y19B 4K17A 2ELBA 4GXBA 4YL8A 3LJUX 4MT7A 3BINA 1Q67A 1FOEA 2P0HA 3U8ZA 4DX90 2DYQA 2DLWA 3KY9A 4NSWA 2DHIA 3ODWA 1WG7A 2CY5A 1KI1B 2LYDA 2ZPYA 3A8QA 3QWMA 2E2XA 2ROZB 2Z0QA 1LW3A 2W2WA 1M7EA 1X05A 3TCAA 4WSFA 3IVFA 1FB8A 4DBBA 1QC6A 1RJ2A 3V5WA 1W1GA 1UEFA 2D11A 4C0AA 2YRYA 1WI1A 1UNRA 1Y5OA 1KZ7A 4HB3B 5CLQB 2GCLA 3PVUA 2D2QA 2DHJA 3G9WA 2MFQA 1GC7A 3PEGA 1BAKA 3QBVB 4MY6A 3CXBB 2YS5A 3NSUA 4NY0A 5C6RA 1FHXA 4F7GA 2UZRA 1J0WA 1DDWA 1ZC4B 4GZUA 5DH9B 4KHBB 2NMBA 2YS3A 2H7DA 2XQNM 1V5UA 4KHOA 2M14A 2ADZA 1EGXA 5CLLB 4ZRIA 1OMWA 1EAZA 2I1JA 2Y8GA 4HAWB 4P7IA 3AJ4A 1DROA 2LKOA 1WJ1A 1OQNA 3AU4A 1XR0B 5DI9B 2GJYA 2RGNB 1MPHA 1J19A 2D10A 4CYEA 2L2IA 3F0WA 4A6HA 3DXEA 5DHFB 2HE7A 2J59M 2CODA 4GPTB 4KHAA 1TXDA 3MPXA 3FEHA 1U5FA 3MDBC 4GMVA 4Y94A 4Z2MB 5JP4A 3T06A 2PZ1A 3PZDA 5GOWB 5J3TA 2EC1A 2CAYA 2M38A 2I5FA 3D8DA 1XODA 2QKMA 5KQ1A 5J3QA 2D9ZA 2RLOA 2Z0OA 5C79A 2RSGA 2VRWB 3M1IB 1WJMA 1W1DA 1U5DA 2KCJA 2LOZA 2DX5A 3N7CA 2CY4A 2COCA 1MK7B 2P0DA 2EMTA 3SO6A 1ZSQA 5HE0A 2Q13A 1DDVA 4HAZB 3SUZA 3TW1A 3TO1A 4F7HA 3P6AA 3HK0A 1GC6A 4KAXB 4H8SA 2N0YA 4Z2NA 2H7EA 5KCVA 2J0MA 2GS0A 1NTYA 2MWNB 2YF0A 4HB2B 1K5DB 4HB0B 3TVVA 1FGZA 1UNPA 1WGUA 3PVLA 1BTKA 2OTXA 4TYZA 1XKEA 1X11A 1DYNA 2RNRB 2KUPA 4PQ0A 1XCGA 4F7UP 2LULA 4DXAB 2L1CA 4K81A 2AL6A 3GYOA 3UZTA 1U29A 1PFJA 1AQCA 1P5TA 2D9WA 3OANA 5HE1A 5LOPB 4WJ7A 2P8VA 3F5RA 5EFXA 5JHGA 2HTHB 2N23A 3QIJA 4A6KA 1N3HA 2Z0PA 1IRSA 3PP2A 3SNHA 4K2OA 2P0FA 1UPRA 2V76A 2QKLA 4EKUA 1MK9B 1V88A 3A98B 4HAUB 2DKPA 3A8PA 5D3VA 1UPQA 1PLSA 3D8FA 2K2JA 5DIFB 2DFKA 1XX0A 3D8EA 2FJLA 5LONB 3WYFB 1I2HA 2J0JA 4CHMA 2W2XD 4A6FA 2R0DA 1P3RA 1FHOA 5JLJB 4MK0A 2Y7BA 1XD4A 1ISNA 4D0NB 1E5WA 1I7AA 1MKEA 3HW2B 1MIXA 3P7ZA 1GG3A 2YS1A 4HB4B 1AWEA 5D27A 3RCPA 1H4RA 1U2BA 3PVWA 4A6FB 1BTNA 5C5BB 2DX1A 2IYBA 1U5GA 1P6SA 1BWNA 5L81A 2W2XC 4PNKA 2DTCA 1FHWA 2D4QA 2LG1A 1FGYA 3FM8C 2VKIA 2LOXA 2DKQA 3ULBA 1V89A 1K5GB 2CRFA 4DX8A 5D3WA 2D9YA 1RRPB 2YVCA 1QQGA 4GN1A 1FAOA 1LB1A 3ODXA 1WGQA 1NI2A 2COFA 3PG7A 1MAIA 4HAVB 5D3XA 5HE2A 3DXDA 3KRWA 2EJ8A 2D9XA 4EJNA 3ZVRA 5FI0A 3ULCA 2J0KA 3ML4A 4IFSA 2YSZA 2YT1A 3PSCA 4EMOA 5JHHA 2DN6A 4YONA 1H10A 1X86A 4TKNA 5HE3A 2MDXA 2IFSA 3DXCA 2JP2A 1SGHA 4ZRKA 4IAPA 2I1KA 3KSYA 3WA0A 4HHVA 3SYXA 1MIZB 2BCJA 1PMSA 1EF1A 3U7DA 3TFMA 2KGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDT A;  4B6H A;  1DDM A;  1TJ6 A;  1NU2 A;  2I5C A;  1V5P A;  2GCJ A;  1X1F A;  4HDQ A;  2DA0 A;  1NTV A;  1DBH A;  4BBK A;  1EVH A;  2AEH A;  3FSS A;  2ELA A;  4CHJ A;  5C16 A;  3ODO A;  4HAX B;  3VIA A;  2K2U A;  2ROV A;  2R09 A;  5C5B A;  1SHC A;  1Z87 A;  2OQB A;  2NZ8 B;  3CIK A;  4KVG B;  2RVB B;  3X23 A;  2RUK B;  2COA A;  4A5K A;  4IOY X;  2X18 A;  4K2P A;  2DYN A;  3KZ1 A;  1TQZ A;  1UNQ A;  2D9V A;  3O96 A;  4WVF B;  1X1G A;  1ZVR A;  2K00 A;  2Y8F A;  2YT0 A;  3AU5 A;  1M7R A;  1OY2 A;  3GYP A;  1W1H A;  1KZG A;  1V61 A;  3KRX A;  5D3Y A;  3SV1 A;  2DHK A;  5KQ4 A;  4HAT B;  2G35 A;  4XWX A;  3BJI A;  1U27 A;  2VSZ A;  2EMS A;  4HDO A;  1ZM0 A;  4L6E A;  2MKR A;  4HAY B;  1V5M A;  1ZC3 B;  4ZRJ A;  5FI1 A;  1B55 A;  1U5E A;  4GMX B;  2UVM A;  5DHA B;  2UZS A;  3HQC A;  5J3Y A;  3VOQ A;  1WVH A;  1Y19 B;  4K17 A;  2ELB A;  4GXB A;  4YL8 A;  3LJU X;  4MT7 A;  3BIN A;  1Q67 A;  1FOE A;  2P0H A;  3U8Z A;  4DX9 0;  2DYQ A;  2DLW A;  3KY9 A;  4NSW A;  2DHI A;  3ODW A;  1WG7 A;  2CY5 A;  1KI1 B;  2LYD A;  2ZPY A;  3A8Q A;  3QWM A;  2E2X A;  2ROZ B;  2Z0Q A;  1LW3 A;  2W2W A;  1M7E A;  1X05 A;  3TCA A;  4WSF A;  3IVF A;  1FB8 A;  4DBB A;  1QC6 A;  1RJ2 A;  3V5W A;  1W1G A;  1UEF A;  2D11 A;  4C0A A;  2YRY A;  1WI1 A;  1UNR A;  1Y5O A;  1KZ7 A;  4HB3 B;  5CLQ B;  2GCL A;  3PVU A;  2D2Q A;  2DHJ A;  3G9W A;  2MFQ A;  1GC7 A;  3PEG A;  1BAK A;  3QBV B;  4MY6 A;  3CXB B;  2YS5 A;  3NSU A;  4NY0 A;  5C6R A;  1FHX A;  4F7G A;  2UZR A;  1J0W A;  1DDW A;  1ZC4 B;  4GZU A;  5DH9 B;  4KHB B;  2NMB A;  2YS3 A;  2H7D A;  2XQN M;  1V5U A;  4KHO A;  2M14 A;  2ADZ A;  1EGX A;  5CLL B;  4ZRI A;  1OMW A;  1EAZ A;  2I1J A;  2Y8G A;  4HAW B;  4P7I A;  3AJ4 A;  1DRO A;  2LKO A;  1WJ1 A;  1OQN A;  3AU4 A;  1XR0 B;  5DI9 B;  2GJY A;  2RGN B;  1MPH A;  1J19 A;  2D10 A;  4CYE A;  2L2I A;  3F0W A;  4A6H A;  3DXE A;  5DHF B;  2HE7 A;  2J59 M;  2COD A;  4GPT B;  4KHA A;  1TXD A;  3MPX A;  3FEH A;  1U5F A;  3MDB C;  4GMV A;  4Y94 A;  4Z2M B;  5JP4 A;  3T06 A;  2PZ1 A;  3PZD A;  5GOW B;  5J3T A;  2EC1 A;  2CAY A;  2M38 A;  2I5F A;  3D8D A;  1XOD A;  2QKM A;  5KQ1 A;  5J3Q A;  2D9Z A;  2RLO A;  2Z0O A;  5C79 A;  2RSG A;  2VRW B;  3M1I B;  1WJM A;  1W1D A;  1U5D A;  2KCJ A;  2LOZ A;  2DX5 A;  3N7C A;  2CY4 A;  2COC A;  1MK7 B;  2P0D A;  2EMT A;  3SO6 A;  1ZSQ A;  5HE0 A;  2Q13 A;  1DDV A;  4HAZ B;  3SUZ A;  3TW1 A;  3TO1 A;  4F7H A;  3P6A A;  3HK0 A;  1GC6 A;  4KAX B;  4H8S A;  2N0Y A;  4Z2N A;  2H7E A;  5KCV A;  2J0M A;  2GS0 A;  1NTY A;  2MWN B;  2YF0 A;  4HB2 B;  1K5D B;  4HB0 B;  3TVV A;  1FGZ A;  1UNP A;  1WGU A;  3PVL A;  1BTK A;  2OTX A;  4TYZ A;  1XKE A;  1X11 A;  1DYN A;  2RNR B;  2KUP A;  4PQ0 A;  1XCG A;  4F7U P;  2LUL A;  4DXA B;  2L1C A;  4K81 A;  2AL6 A;  3GYO A;  3UZT A;  1U29 A;  1PFJ A;  1AQC A;  1P5T A;  2D9W A;  3OAN A;  5HE1 A;  5LOP B;  4WJ7 A;  2P8V A;  3F5R A;  5EFX A;  5JHG A;  2HTH B;  2N23 A;  3QIJ A;  4A6K A;  1N3H A;  2Z0P A;  1IRS A;  3PP2 A;  3SNH A;  4K2O A;  2P0F A;  1UPR A;  2V76 A;  2QKL A;  4EKU A;  1MK9 B;  1V88 A;  3A98 B;  4HAU B;  2DKP A;  3A8P A;  5D3V A;  1UPQ A;  1PLS A;  3D8F A;  2K2J A;  5DIF B;  2DFK A;  1XX0 A;  3D8E A;  2FJL A;  5LON B;  3WYF B;  1I2H A;  2J0J A;  4CHM A;  2W2X D;  4A6F A;  2R0D A;  1P3R A;  1FHO A;  5JLJ B;  4MK0 A;  2Y7B A;  1XD4 A;  1ISN A;  4D0N B;  1E5W A;  1I7A A;  1MKE A;  3HW2 B;  1MIX A;  3P7Z A;  1GG3 A;  2YS1 A;  4HB4 B;  1AWE A;  5D27 A;  3RCP A;  1H4R A;  1U2B A;  3PVW A;  4A6F B;  1BTN A;  5C5B B;  2DX1 A;  2IYB A;  1U5G A;  1P6S A;  1BWN A;  5L81 A;  2W2X C;  4PNK A;  2DTC A;  1FHW A;  2D4Q A;  2LG1 A;  1FGY A;  3FM8 C;  2VKI A;  2LOX A;  2DKQ A;  3ULB A;  1V89 A;  1K5G B;  2CRF A;  4DX8 A;  5D3W A;  2D9Y A;  1RRP B;  2YVC A;  1QQG A;  4GN1 A;  1FAO A;  1LB1 A;  3ODX A;  1WGQ A;  1NI2 A;  2COF A;  3PG7 A;  1MAI A;  4HAV B;  5D3X A;  5HE2 A;  3DXD A;  3KRW A;  2EJ8 A;  2D9X A;  4EJN A;  3ZVR A;  5FI0 A;  3ULC A;  2J0K A;  3ML4 A;  4IFS A;  2YSZ A;  2YT1 A;  3PSC A;  4EMO A;  5JHH A;  2DN6 A;  4YON A;  1H10 A;  1X86 A;  4TKN A;  5HE3 A;  2MDX A;  2IFS A;  3DXC A;  2JP2 A;  1SGH A;  4ZRK A;  4IAP A;  2I1K A;  3KSY A;  3WA0 A;  4HHV A;  3SYX A;  1MIZ B;  2BCJ A;  1PMS A;  1EF1 A;  3U7D A;  3TFM A;  2KGX B; 
#chains in the Genus database with same CATH topology
 3ZDT A;  4B6H A;  1DDM A;  1TJ6 A;  1NU2 A;  2I5C A;  1V5P A;  2K8E A;  2GCJ A;  1X1F A;  4HDQ A;  2DA0 A;  1NTV A;  1DBH A;  4BBK A;  1EVH A;  2AEH A;  3FSS A;  4KHB A;  2ELA A;  4CHJ A;  5C16 A;  2R2Y A;  3ODO A;  4HAX B;  3VIA A;  2K2U A;  2ROV A;  2R09 A;  5M4Y B;  5C5B A;  1SHC A;  1Z87 A;  2OQB A;  2NZ8 B;  3CIK A;  4KVG B;  2RVB B;  3X23 A;  2RUK B;  5IRS A;  3NWA A;  2COA A;  2Z4D A;  4A5K A;  4IOY X;  2X18 A;  4K2P A;  2DYN A;  3KZ1 A;  1TQZ A;  1UNQ A;  2D9V A;  4OSN A;  3O96 A;  4WVF B;  1X1G A;  1ZVR A;  2K00 A;  2Y8F A;  2YT0 A;  3AU5 A;  1M7R A;  1OY2 A;  3GYP A;  1W1H A;  1KZG A;  1V61 A;  3KRX A;  5D3Y A;  3SV1 A;  2DHK A;  5KQ4 A;  4HAT B;  2G35 A;  4XWX A;  3BJI A;  1U27 A;  2VSZ A;  2EMS A;  4HDO A;  1ZM0 A;  4L6E A;  2MKR A;  5I2M A;  4HAY B;  1V5M A;  1ZC3 B;  4ZRJ A;  5FI1 A;  1B55 A;  4GNK B;  1U5E A;  4GMX B;  2UVM A;  5DHA B;  2UZS A;  3HQC A;  5J3Y A;  3VOQ A;  4QJ5 B;  1WVH A;  1Y19 B;  4K17 A;  2ELB A;  4GXB A;  4YL8 A;  3LJU X;  4MT7 A;  3BIN A;  1Q67 A;  1FOE A;  2P0H A;  3U8Z A;  4DX9 0;  2DYQ A;  2DLW A;  3KY9 A;  4NSW A;  2DHI A;  3ODW A;  1WG7 A;  2CY5 A;  1KI1 B;  3B77 A;  2LYD A;  2ZPY A;  3A8Q A;  3QWM A;  2E2X A;  2ROZ B;  2Z0Q A;  1LW3 A;  2W2W A;  1M7E A;  1X05 A;  3TCA A;  4WSF A;  3IVF A;  1FB8 A;  4DBB A;  1QC6 A;  1RJ2 A;  3V5W A;  1W1G A;  1UEF A;  2D11 A;  4C0A A;  2YRY A;  1WI1 A;  1UNR A;  1Y5O A;  1KZ7 A;  4HB3 B;  5CLQ B;  2GCL A;  3PVU A;  2D2Q A;  2DHJ A;  3G9W A;  2MFQ A;  1GC7 A;  3PEG A;  1BAK A;  3QBV B;  4MY6 A;  3CXB B;  2YS5 A;  3NSU A;  4NY0 A;  5C6R A;  1FHX A;  4F7G A;  2UZR A;  1J0W A;  1DDW A;  1ZC4 B;  4GZU A;  5DH9 B;  4KHB B;  2NMB A;  2YS3 A;  2H7D A;  2XQN M;  1V5U A;  4KHO A;  2M14 A;  2ADZ A;  1EGX A;  5CLL B;  4ZRI A;  1OMW A;  1EAZ A;  2I1J A;  2Y8G A;  2Z14 A;  4HAW B;  3AJ4 A;  4P7I A;  1DRO A;  2LKO A;  1WJ1 A;  2K49 A;  1OQN A;  3A58 A;  3AU4 A;  1XR0 B;  5DI9 B;  2GJY A;  2RGN B;  1MPH A;  1J19 A;  2D10 A;  4CYE A;  2L2I A;  3F0W A;  4A6H A;  3DXE A;  5DHF B;  2HE7 A;  2J59 M;  2COD A;  4GPT B;  4KHA A;  1TXD A;  3MPX A;  3FEH A;  1U5F A;  3MDB C;  4GMV A;  4Y94 A;  4Z2M B;  5JP4 A;  3T06 A;  2PZ1 A;  3PZD A;  5GOW B;  5J3T A;  2EC1 A;  2CAY A;  2M38 A;  2I5F A;  3D8D A;  1XOD A;  2QKM A;  5KQ1 A;  5J3Q A;  2D9Z A;  2RLO A;  2Z0O A;  5C79 A;  2RSG A;  2VRW B;  3M1I B;  2NBV A;  1WJM A;  1W1D A;  1U5D A;  3OHM B;  2KCJ A;  2LOZ A;  2DX5 A;  3N7C A;  2CY4 A;  2COC A;  1MK7 B;  2P0D A;  2EMT A;  3SO6 A;  1ZYI A;  1ZSQ A;  5HE0 A;  2Q13 A;  5LG4 B;  1DDV A;  4HAZ B;  3SUZ A;  3TW1 A;  3TO1 A;  4F7H A;  3P6A A;  3HK0 A;  1GC6 A;  4KAX B;  4H8S A;  2Z13 A;  2N0Y A;  4Z2N A;  2H7E A;  2KUQ A;  5KCV A;  2J0M A;  2GS0 A;  1NTY A;  2MWN B;  2YF0 A;  4HB2 B;  1K5D B;  4HB0 B;  3TVV A;  1T77 A;  1FGZ A;  1UNP A;  1WGU A;  2Z59 A;  3PVL A;  1BTK A;  2OTX A;  2RRF A;  4TYZ A;  1XKE A;  1X11 A;  1DYN A;  2RNR B;  2KUP A;  4PQ0 A;  1XCG A;  4F7U P;  2LUL A;  4DXA B;  3HSA A;  2L1C A;  4K81 A;  2AL6 A;  3HIE A;  3DCX A;  3GYO A;  3UZT A;  1U29 A;  1PFJ A;  3NWD A;  1AQC A;  1P5T A;  2D9W A;  3OAN A;  5HE1 A;  5LOP B;  4WJ7 A;  2P8V A;  3F5R A;  5EFX A;  5JHG A;  1MI1 A;  2HTH B;  2N23 A;  3QIJ A;  4A6K A;  1N3H A;  2ZKM X;  2Z0P A;  1IRS A;  3PP2 A;  3SNH A;  4K2O A;  2P0F A;  2GUM A;  1UPR A;  2V76 A;  2YT2 A;  2QKL A;  4EKU A;  1MK9 B;  1V88 A;  3A98 B;  4HAU B;  2DKP A;  3A8P A;  5D3V A;  1UPQ A;  5I2S A;  1PLS A;  2KR0 A;  2K2J A;  3D8F A;  5DIF B;  2DFK A;  1XX0 A;  3D8E A;  2FJL A;  5LON B;  3WYF B;  1I2H A;  2J0J A;  2KIE A;  4CHM A;  2W2X D;  4A6F A;  2R0D A;  1P3R A;  1FHO A;  5JLJ B;  4QJ4 B;  4MK0 A;  4OT1 A;  2Y7B A;  1XD4 A;  1ISN A;  4D0N B;  1E5W A;  1I7A A;  1MKE A;  3HW2 B;  1MIX A;  3P7Z A;  1GG3 A;  2YS1 A;  4HB4 B;  1AWE A;  5D27 A;  3RCP A;  1H4R A;  1U2B A;  3PVW A;  4A6F B;  1BTN A;  5C5B B;  2DX1 A;  4GOU A;  2IYB A;  1U5G A;  1P6S A;  1BWN A;  5L81 A;  2W2X C;  4PNK A;  2DTC A;  1FHW A;  2D4Q A;  2LG1 A;  1FGY A;  4QJ3 B;  3FM8 C;  2VKI A;  2LOX A;  2DKQ A;  3ULB A;  1V89 A;  1K5G B;  2CRF A;  4DX8 A;  5D3W A;  4D6W A;  2D9Y A;  3FVC A;  1RRP B;  2YVC A;  1QQG A;  4GN1 A;  1FAO A;  1LB1 A;  3ODX A;  1WGQ A;  1NI2 A;  2COF A;  2FJU B;  3PG7 A;  1MAI A;  4HAV B;  5D3X A;  3U12 A;  5HE2 A;  3DXD A;  3KRW A;  2KIG A;  2EJ8 A;  4DIX A;  2D9X A;  4EJN A;  4CSQ A;  3ZVR A;  5FI0 A;  3ULC A;  2J0K A;  3ML4 A;  4IFS A;  2YSZ A;  2YT1 A;  3PSC A;  4L1R A;  4EMO A;  5JHH A;  2DN6 A;  4YON A;  1H10 A;  1X86 A;  4TKN A;  5HE3 A;  2MDX A;  2IFS A;  3DXC A;  4HSI A;  2JP2 A;  4QXA B;  1SGH A;  3NW8 A;  4ZRK A;  4IAP A;  2I1K A;  3KSY A;  3WA0 A;  4HHV A;  3SYX A;  1MIZ B;  2BCJ A;  3NWF A;  1PMS A;  1EF1 A;  3U7D A;  3TFM A;  2KGX B; 
#chains in the Genus database with same CATH homology
 3ZDT A;  4B6H A;  1DDM A;  1TJ6 A;  1NU2 A;  2I5C A;  1V5P A;  2GCJ A;  1X1F A;  4HDQ A;  2DA0 A;  1NTV A;  1DBH A;  4BBK A;  1EVH A;  2AEH A;  3FSS A;  2ELA A;  4CHJ A;  5C16 A;  3ODO A;  4HAX B;  3VIA A;  2K2U A;  2ROV A;  2R09 A;  5C5B A;  1SHC A;  1Z87 A;  2OQB A;  2NZ8 B;  3CIK A;  4KVG B;  2RVB B;  3X23 A;  2RUK B;  2COA A;  4A5K A;  4IOY X;  2X18 A;  4K2P A;  2DYN A;  3KZ1 A;  1TQZ A;  1UNQ A;  2D9V A;  3O96 A;  4WVF B;  1X1G A;  1ZVR A;  2K00 A;  2Y8F A;  2YT0 A;  3AU5 A;  1M7R A;  1OY2 A;  3GYP A;  1W1H A;  1KZG A;  1V61 A;  3KRX A;  5D3Y A;  3SV1 A;  2DHK A;  5KQ4 A;  4HAT B;  2G35 A;  4XWX A;  3BJI A;  1U27 A;  2VSZ A;  2EMS A;  4HDO A;  1ZM0 A;  4L6E A;  2MKR A;  4HAY B;  1V5M A;  1ZC3 B;  4ZRJ A;  5FI1 A;  1B55 A;  1U5E A;  4GMX B;  2UVM A;  5DHA B;  2UZS A;  3HQC A;  5J3Y A;  3VOQ A;  1WVH A;  1Y19 B;  4K17 A;  2ELB A;  4GXB A;  4YL8 A;  3LJU X;  4MT7 A;  3BIN A;  1Q67 A;  1FOE A;  2P0H A;  3U8Z A;  4DX9 0;  2DYQ A;  2DLW A;  3KY9 A;  4NSW A;  2DHI A;  3ODW A;  1WG7 A;  2CY5 A;  1KI1 B;  2LYD A;  2ZPY A;  3A8Q A;  3QWM A;  2E2X A;  2ROZ B;  2Z0Q A;  1LW3 A;  2W2W A;  1M7E A;  1X05 A;  3TCA A;  4WSF A;  3IVF A;  1FB8 A;  4DBB A;  1QC6 A;  1RJ2 A;  3V5W A;  1W1G A;  1UEF A;  2D11 A;  4C0A A;  2YRY A;  1WI1 A;  1UNR A;  1Y5O A;  1KZ7 A;  4HB3 B;  5CLQ B;  2GCL A;  3PVU A;  2D2Q A;  2DHJ A;  3G9W A;  2MFQ A;  1GC7 A;  3PEG A;  1BAK A;  3QBV B;  4MY6 A;  3CXB B;  2YS5 A;  3NSU A;  4NY0 A;  5C6R A;  1FHX A;  4F7G A;  2UZR A;  1J0W A;  1DDW A;  1ZC4 B;  4GZU A;  5DH9 B;  4KHB B;  2NMB A;  2YS3 A;  2H7D A;  2XQN M;  1V5U A;  4KHO A;  2M14 A;  2ADZ A;  1EGX A;  5CLL B;  4ZRI A;  1OMW A;  1EAZ A;  2I1J A;  2Y8G A;  4HAW B;  4P7I A;  3AJ4 A;  1DRO A;  2LKO A;  1WJ1 A;  1OQN A;  3AU4 A;  1XR0 B;  5DI9 B;  2GJY A;  2RGN B;  1MPH A;  1J19 A;  2D10 A;  4CYE A;  2L2I A;  3F0W A;  4A6H A;  3DXE A;  5DHF B;  2HE7 A;  2J59 M;  2COD A;  4GPT B;  4KHA A;  1TXD A;  3MPX A;  3FEH A;  1U5F A;  3MDB C;  4GMV A;  4Y94 A;  4Z2M B;  5JP4 A;  3T06 A;  2PZ1 A;  3PZD A;  5GOW B;  5J3T A;  2EC1 A;  2CAY A;  2M38 A;  2I5F A;  3D8D A;  1XOD A;  2QKM A;  5KQ1 A;  5J3Q A;  2D9Z A;  2RLO A;  2Z0O A;  5C79 A;  2RSG A;  2VRW B;  3M1I B;  1WJM A;  1W1D A;  1U5D A;  2KCJ A;  2LOZ A;  2DX5 A;  3N7C A;  2CY4 A;  2COC A;  1MK7 B;  2P0D A;  2EMT A;  3SO6 A;  1ZSQ A;  5HE0 A;  2Q13 A;  1DDV A;  4HAZ B;  3SUZ A;  3TW1 A;  3TO1 A;  4F7H A;  3P6A A;  3HK0 A;  1GC6 A;  4KAX B;  4H8S A;  2N0Y A;  4Z2N A;  2H7E A;  5KCV A;  2J0M A;  2GS0 A;  1NTY A;  2MWN B;  2YF0 A;  4HB2 B;  1K5D B;  4HB0 B;  3TVV A;  1FGZ A;  1UNP A;  1WGU A;  3PVL A;  1BTK A;  2OTX A;  4TYZ A;  1XKE A;  1X11 A;  1DYN A;  2RNR B;  2KUP A;  4PQ0 A;  1XCG A;  4F7U P;  2LUL A;  4DXA B;  2L1C A;  4K81 A;  2AL6 A;  3GYO A;  3UZT A;  1U29 A;  1PFJ A;  1AQC A;  1P5T A;  2D9W A;  3OAN A;  5HE1 A;  5LOP B;  4WJ7 A;  2P8V A;  3F5R A;  5EFX A;  5JHG A;  2HTH B;  2N23 A;  3QIJ A;  4A6K A;  1N3H A;  2Z0P A;  1IRS A;  3PP2 A;  3SNH A;  4K2O A;  2P0F A;  1UPR A;  2V76 A;  2QKL A;  4EKU A;  1MK9 B;  1V88 A;  3A98 B;  4HAU B;  2DKP A;  3A8P A;  5D3V A;  1UPQ A;  1PLS A;  3D8F A;  2K2J A;  5DIF B;  2DFK A;  1XX0 A;  3D8E A;  2FJL A;  5LON B;  3WYF B;  1I2H A;  2J0J A;  4CHM A;  2W2X D;  4A6F A;  2R0D A;  1P3R A;  1FHO A;  5JLJ B;  4MK0 A;  2Y7B A;  1XD4 A;  1ISN A;  4D0N B;  1E5W A;  1I7A A;  1MKE A;  3HW2 B;  1MIX A;  3P7Z A;  1GG3 A;  2YS1 A;  4HB4 B;  1AWE A;  5D27 A;  3RCP A;  1H4R A;  1U2B A;  3PVW A;  4A6F B;  1BTN A;  5C5B B;  2DX1 A;  2IYB A;  1U5G A;  1P6S A;  1BWN A;  5L81 A;  2W2X C;  4PNK A;  2DTC A;  1FHW A;  2D4Q A;  2LG1 A;  1FGY A;  3FM8 C;  2VKI A;  2LOX A;  2DKQ A;  3ULB A;  1V89 A;  1K5G B;  2CRF A;  4DX8 A;  5D3W A;  2D9Y A;  1RRP B;  2YVC A;  1QQG A;  4GN1 A;  1FAO A;  1LB1 A;  3ODX A;  1WGQ A;  1NI2 A;  2COF A;  3PG7 A;  1MAI A;  4HAV B;  5D3X A;  5HE2 A;  3DXD A;  3KRW A;  2EJ8 A;  2D9X A;  4EJN A;  3ZVR A;  5FI0 A;  3ULC A;  2J0K A;  3ML4 A;  4IFS A;  2YSZ A;  2YT1 A;  3PSC A;  4EMO A;  5JHH A;  2DN6 A;  4YON A;  1H10 A;  1X86 A;  4TKN A;  5HE3 A;  2MDX A;  2IFS A;  3DXC A;  2JP2 A;  1SGH A;  4ZRK A;  4IAP A;  2I1K A;  3KSY A;  3WA0 A;  4HHV A;  3SYX A;  1MIZ B;  2BCJ A;  1PMS A;  1EF1 A;  3U7D A;  3TFM A;  2KGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...