1WG7A

Solution structure of pleckstrin homology domain from human kiaa1058 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
150
structure length
150
Chain Sequence
GSSGSSGAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQEKRNGDSHEDDESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 9
publication title Solution structure of pleckstrin homology domain from human KIAA1058 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wg7A01
2HE7A 1UNPA 4DXAB 4GXBA 3VOQA 2VSZA 1NU2A 2UZSA 3ODOA 1U27A 3PVWA 1AWEA 2W2WA 1ZM0A 4A6FA 2MDXA 3U8ZA 2COCA 4HAVB 1BTNA 2ADZA 2ELAA 2I1JA 3MPXA 1OQNA 5D3XA 2LOZA 1UNQA 2M38A 2KGXB 3BINA 2YS1A 2Y7BA 2DX1A 3ZDTA 1P5TA 1V89A 1MK9B 1K5DB 1WVHA 3SNHA 2EJ8A 1WJMA 2LULA 2M14A 2Z0OA 1WJ1A 2KUPA 1X86A 2RLOA 4ZRJA 2J59M 5FI1A 1DDWA 1EF1A 2Z0PA 2MKRA 1FGYA 2P0FA 1DDVA 5J3YA 2YS3A 1V5UA 4DX8A 2LKOA 1WGUA 1FOEA 4HAXB 2Z0QA 1B55A 5J3TA 1ISNA 5KCVA 2DHIA 5C79A 2R09A 2J0KA 3T06A 2LYDA 2J0MA 2DFKA 2P0HA 2OTXA 4K81A 3F5RA 3ZVRA 3SV1A 5HE0A 1KI1B 5HE3A 1UPQA 5LONB 4GPTB 3N7CA 2NMBA 4A6KA 1IRSA 5DHFB 1U2BA 4MY6A 4TKNA 1PFJA 4HB4B 5C5BB 1FAOA 1WGQA 2V76A 4NY0A 4EKUA 2XQNM 1V61A 2COFA 2D2QA 2K2JA 1MAIA 2YVCA 2RNRB 3HW2B 4K2PA 5KQ4A 3ULCA 5CLQB 2D9ZA 1LW3A 2Y8FA 2RSGA 1MPHA 2NZ8B 2N0YA 1UNRA 2PZ1A 2N23A 3GYPA 3PSCA 1LB1A 1W1GA 4KHBB 3TVVA 3FM8C 4EJNA 4F7UP 2K2UA 2DX5A 1TXDA 1EGXA 4IOYX 4L6EA 4GMVA 2IYBA 1TQZA 1U5DA 1U29A 3U7DA 5DHAB 1V5PA 3KRXA 1MK7B 3WA0A 2D9YA 2P8VA 4WJ7A 5JP4A 2DHJA 2CODA 2L2IA 3X23A 4MT7A 5C6RA 3AU4A 1I2HA 2X18A 4TYZA 1GC6A 1N3HA 3DXEA 2D11A 2YRYA 4XWXA 4Y94A 1BWNA 3IVFA 3FSSA 4CHJA 2DYNA 5C5BA 4D0NB 3G9WA 1M7RA 1GC7A 2BCJA 3ODXA 1ZSQA 4GZUA 2D9XA 1X1FA 2H7EA 1SHCA 3QBVB 3KY9A 2G35A 1FB8A 3A98B 4NSWA 2RUKB 4ZRKA 3SO6A 2DN6A 4HDQA 2CY4A 1DDMA 2J0JA 5FI0A 3VIAA 3TFMA 1GG3A 5DI9B 1OMWA 4H8SA 5EFXA 3PVLA 1Q67A 1QQGA 1DYNA 1Z87A 5C16A 1U5GA 1EVHA 2I5CA 4HATB 2QKMA 3NSUA 1PMSA 4A5KA 2YS5A 2FJLA 2CAYA 3KZ1A 1DROA 3LJUX 3TO1A 4KVGB 1MIZB 4IFSA 4WVFB 3QWMA 4CHMA 3D8FA 5DIFB 1H10A 1J0WA 5L81A 1XR0B 1K5GB 4HB3B 3CXBB 5DH9B 3AU5A 1XKEA 2RVBB 2UZRA 4CYEA 4C0AA 4KHOA 4Z2NA 5D3YA 2ROVA 3AJ4A 4PNKA 3UZTA 2D4QA 5D3VA 2MWNB 4Z2MB 1DBHA 3TCAA 2ROZB 2DKQA 3BJIA 1ZC3B 3KRWA 2W2XC 2MFQA 2DHKA 1RJ2A 1WG7A 2D9WA 2GCJA 2W2XD 2LOXA 1P3RA 3SUZA 4DX90 1EAZA 2GS0A 1E5WA 3F0WA 4KHAA 3TW1A 4GN1A 1KZ7A 2EMSA 5CLLB 5JHHA 3D8EA 3RCPA 1SGHA 3PEGA 2AEHA 4ZRIA 3PG7A 2E2XA 1ZC4B 3M1IB 2I5FA 5GOWB 2GJYA 2R0DA 2D9VA 4HB2B 3OANA 1TJ6A 1XD4A 2EC1A 1W1HA 2EMTA 4HAZB 3P6AA 2UVMA 1BAKA 2YT1A 4KAXB 1I7AA 5JLJB 1Y5OA 2DKPA 2D10A 2AL6A 2ZPYA 2CY5A 4MK0A 1V5MA 3P7ZA 4HAYB 5J3QA 1U5FA 3ULBA 1U5EA 2YT0A 1FHXA 3FEHA 3ODWA 2OQBA 1RRPB 2KCJA 2VRWB 4HDOA 5KQ1A 1OY2A 5LOPB 2HTHB 2DTCA 4BBKA 5D27A 3KSYA 3PP2A 4HAUB 4YONA 1NTVA 4HB0B 3PZDA 2RGNB 1PLSA 1X1GA 4DBBA 4A6FB 4K17A 1V88A 4IAPA 1WI1A 3CIKA 3O96A 4F7HA 2Q13A 1ZVRA 1BTKA 1FGZA 2DLWA 1XX0A 1KZGA 2DA0A 3DXCA 1XCGA 5HE1A 4EMOA 3V5WA 3QIJA 2LG1A 2K00A 3PVUA 4K2OA 4WSFA 4HHVA 4B6HA 1AQCA 1FHWA 1FHOA 3WYFB 4P7IA 1H4RA 1Y19B 2H7DA 1MKEA 2VKIA 4HAWB 2I1KA 1MIXA 4GMXB 2P0DA 1NTYA 2ELBA 1QC6A 1UPRA 4F7GA 3SYXA 3A8PA 2JP2A 4YL8A 3MDBC 5JHGA 1UEFA 2YF0A 1P6SA 1XODA 1W1DA 3D8DA 2Y8GA 1M7EA 3DXDA 2IFSA 2QKLA 5D3WA 3HQCA 2DYQA 3ML4A 3HK0A 2CRFA 1J19A 2COAA 1NI2A 5HE2A 1X11A 2L1CA 4A6HA 1X05A 2GCLA 4PQ0A 2YSZA 3A8QA 3GYOA
chains in the Genus database with same CATH superfamily
3FVCA 2HE7A 1UNPA 4DXAB 4GXBA 3VOQA 2VSZA 1NU2A 2UZSA 3ODOA 1U27A 3PVWA 1AWEA 2W2WA 1ZM0A 4A6FA 2MDXA 3NWAA 3U8ZA 2COCA 4HAVB 1BTNA 2ADZA 2ELAA 2I1JA 3MPXA 1OQNA 5D3XA 2LOZA 1UNQA 2M38A 2KGXB 3BINA 2YS1A 2Y7BA 2DX1A 3ZDTA 1P5TA 1V89A 1MK9B 1K5DB 1WVHA 3SNHA 2EJ8A 1WJMA 2NBVA 2LULA 2M14A 2Z0OA 1WJ1A 2KUPA 1X86A 2RLOA 4ZRJA 2J59M 5FI1A 1DDWA 1EF1A 2Z0PA 2MKRA 1FGYA 2P0FA 1DDVA 5J3YA 2YS3A 1V5UA 4DX8A 2LKOA 1WGUA 1FOEA 4HAXB 2Z0QA 1T77A 1B55A 5J3TA 3NWFA 1ISNA 5KCVA 2DHIA 5C79A 2R09A 2R2YA 2J0KA 3T06A 2LYDA 2J0MA 2RRFA 2DFKA 2P0HA 2OTXA 4K81A 3F5RA 3ZVRA 3SV1A 5LG4B 5HE0A 1KI1B 5HE3A 1UPQA 5LONB 4GPTB 3N7CA 2NMBA 2Z13A 4A6KA 1IRSA 5DHFB 1U2BA 4MY6A 4TKNA 1PFJA 4HB4B 2KUQA 5C5BB 1FAOA 1WGQA 2V76A 4NY0A 4EKUA 2XQNM 3HSAA 1V61A 2COFA 2D2QA 2K2JA 1MAIA 2YVCA 2RNRB 3HW2B 2KIEA 4K2PA 5KQ4A 3ULCA 5CLQB 2D9ZA 1LW3A 2Y8FA 2RSGA 2Z59A 1MPHA 2NZ8B 2N0YA 1UNRA 2PZ1A 2KIGA 2N23A 3GYPA 3PSCA 1LB1A 1W1GA 4KHBB 3TVVA 3FM8C 4EJNA 4F7UP 2K2UA 2DX5A 1TXDA 1EGXA 4IOYX 4L6EA 4GMVA 2IYBA 1TQZA 1U5DA 1U29A 3U7DA 5DHAB 1V5PA 3KRXA 1MK7B 3WA0A 2D9YA 2P8VA 4WJ7A 5JP4A 2DHJA 2CODA 2L2IA 4GOUA 3HIEA 3NWDA 3OHMB 4GNKB 4QXAB 4OSNA 3X23A 4MT7A 5C6RA 3AU4A 1I2HA 2X18A 4TYZA 1GC6A 1N3HA 3DXEA 2D11A 2YRYA 4XWXA 4Y94A 4D6WA 1BWNA 3IVFA 3FSSA 4CHJA 2DYNA 5C5BA 4D0NB 3G9WA 1M7RA 1GC7A 2BCJA 3ODXA 1ZSQA 4GZUA 2D9XA 5M4YB 1X1FA 2H7EA 1SHCA 3QBVB 3KY9A 2G35A 1FB8A 3A98B 4HSIA 4NSWA 2RUKB 4ZRKA 3SO6A 2DN6A 4HDQA 2CY4A 1DDMA 2J0JA 5FI0A 3VIAA 3TFMA 2YT2A 1GG3A 5DI9B 1OMWA 4KHBA 4H8SA 5EFXA 3PVLA 2Z4DA 1Q67A 1MI1A 1QQGA 1DYNA 1Z87A 5C16A 1U5GA 1EVHA 2I5CA 4HATB 2QKMA 3NSUA 1PMSA 4A5KA 2YS5A 2FJLA 2CAYA 5IRSA 3KZ1A 1DROA 3LJUX 3TO1A 2Z14A 4KVGB 1MIZB 4IFSA 4WVFB 3QWMA 4CHMA 3D8FA 5DIFB 2ZKMX 1H10A 1J0WA 5L81A 1XR0B 1K5GB 4HB3B 3CXBB 5DH9B 3AU5A 1XKEA 2RVBB 2UZRA 4CYEA 4C0AA 4KHOA 3DCXA 4Z2NA 5D3YA 2ROVA 3AJ4A 4OT1A 4PNKA 4QJ5B 3UZTA 2D4QA 5D3VA 2MWNB 4Z2MB 1DBHA 3TCAA 2ROZB 2DKQA 3BJIA 1ZC3B 3KRWA 2W2XC 2MFQA 1ZYIA 3B77A 2DHKA 1RJ2A 1WG7A 2D9WA 2GCJA 2W2XD 2LOXA 1P3RA 3SUZA 4DX90 1EAZA 2GS0A 1E5WA 3F0WA 4KHAA 3TW1A 4GN1A 1KZ7A 2EMSA 5CLLB 5JHHA 3D8EA 3RCPA 1SGHA 2KR0A 3PEGA 2AEHA 4ZRIA 3PG7A 2E2XA 1ZC4B 3NW8A 3M1IB 2I5FA 5GOWB 2GJYA 2R0DA 2D9VA 4HB2B 3OANA 1TJ6A 1XD4A 2GUMA 2EC1A 1W1HA 2K49A 2EMTA 2K8EA 4HAZB 3P6AA 2UVMA 1BAKA 2YT1A 4KAXB 1I7AA 5JLJB 3A58A 1Y5OA 2DKPA 2D10A 2AL6A 2ZPYA 2CY5A 4MK0A 1V5MA 3P7ZA 4HAYB 5J3QA 1U5FA 3ULBA 1U5EA 2YT0A 1FHXA 3FEHA 3ODWA 5I2MA 2OQBA 1RRPB 2KCJA 2VRWB 4HDOA 5KQ1A 5I2SA 1OY2A 5LOPB 2HTHB 2DTCA 4CSQA 4L1RA 4BBKA 5D27A 3KSYA 3PP2A 4QJ4B 4HAUB 4YONA 1NTVA 4HB0B 3PZDA 2RGNB 1PLSA 1X1GA 3U12A 4DBBA 4A6FB 4K17A 1V88A 4IAPA 1WI1A 3CIKA 3O96A 4F7HA 2Q13A 1ZVRA 4QJ3B 1BTKA 1FGZA 2DLWA 1XX0A 1KZGA 2DA0A 3DXCA 1XCGA 5HE1A 4EMOA 3V5WA 3QIJA 2LG1A 2K00A 3PVUA 4K2OA 4WSFA 4HHVA 4B6HA 1AQCA 1FHWA 1FHOA 3WYFB 4P7IA 1H4RA 1Y19B 2H7DA 1MKEA 2VKIA 4HAWB 2I1KA 1MIXA 4GMXB 2P0DA 1NTYA 2ELBA 1QC6A 1UPRA 4F7GA 3SYXA 3A8PA 2JP2A 4YL8A 3MDBC 5JHGA 2FJUB 1UEFA 2YF0A 1P6SA 1XODA 1W1DA 3D8DA 2Y8GA 1M7EA 3DXDA 2IFSA 2QKLA 5D3WA 3HQCA 2DYQA 3ML4A 3HK0A 2CRFA 1J19A 2COAA 1NI2A 5HE2A 1X11A 2L1CA 4A6HA 1X05A 4DIXA 2GCLA 4PQ0A 2YSZA 3A8QA 3GYOA
chains in the Genus database with same CATH topology
2HE7A 1UNPA 4DXAB 4GXBA 3VOQA 2VSZA 1NU2A 2UZSA 3ODOA 1U27A 3PVWA 1AWEA 2W2WA 1ZM0A 4A6FA 2MDXA 3U8ZA 2COCA 4HAVB 1BTNA 2ADZA 2ELAA 2I1JA 3MPXA 1OQNA 5D3XA 2LOZA 1UNQA 2M38A 2KGXB 3BINA 2YS1A 2Y7BA 2DX1A 3ZDTA 1P5TA 1V89A 1MK9B 1K5DB 1WVHA 3SNHA 2EJ8A 1WJMA 2LULA 2M14A 2Z0OA 1WJ1A 2KUPA 1X86A 2RLOA 4ZRJA 2J59M 5FI1A 1DDWA 1EF1A 2Z0PA 2MKRA 1FGYA 2P0FA 1DDVA 5J3YA 2YS3A 1V5UA 4DX8A 2LKOA 1WGUA 1FOEA 4HAXB 2Z0QA 1B55A 5J3TA 1ISNA 5KCVA 2DHIA 5C79A 2R09A 2J0KA 3T06A 2LYDA 2J0MA 2DFKA 2P0HA 2OTXA 4K81A 3F5RA 3ZVRA 3SV1A 5HE0A 1KI1B 5HE3A 1UPQA 5LONB 4GPTB 3N7CA 2NMBA 4A6KA 1IRSA 5DHFB 1U2BA 4MY6A 4TKNA 1PFJA 4HB4B 5C5BB 1FAOA 1WGQA 2V76A 4NY0A 4EKUA 2XQNM 1V61A 2COFA 2D2QA 2K2JA 1MAIA 2YVCA 2RNRB 3HW2B 4K2PA 5KQ4A 3ULCA 5CLQB 2D9ZA 1LW3A 2Y8FA 2RSGA 1MPHA 2NZ8B 2N0YA 1UNRA 2PZ1A 2N23A 3GYPA 3PSCA 1LB1A 1W1GA 4KHBB 3TVVA 3FM8C 4EJNA 4F7UP 2K2UA 2DX5A 1TXDA 1EGXA 4IOYX 4L6EA 4GMVA 2IYBA 1TQZA 1U5DA 1U29A 3U7DA 5DHAB 1V5PA 3KRXA 1MK7B 3WA0A 2D9YA 2P8VA 4WJ7A 5JP4A 2DHJA 2CODA 2L2IA 3X23A 4MT7A 5C6RA 3AU4A 1I2HA 2X18A 4TYZA 1GC6A 1N3HA 3DXEA 2D11A 2YRYA 4XWXA 4Y94A 1BWNA 3IVFA 3FSSA 4CHJA 2DYNA 5C5BA 4D0NB 3G9WA 1M7RA 1GC7A 2BCJA 3ODXA 1ZSQA 4GZUA 2D9XA 1X1FA 2H7EA 1SHCA 3QBVB 3KY9A 2G35A 1FB8A 3A98B 4NSWA 2RUKB 4ZRKA 3SO6A 2DN6A 4HDQA 2CY4A 1DDMA 2J0JA 5FI0A 3VIAA 3TFMA 1GG3A 5DI9B 1OMWA 4H8SA 5EFXA 3PVLA 1Q67A 1QQGA 1DYNA 1Z87A 5C16A 1U5GA 1EVHA 2I5CA 4HATB 2QKMA 3NSUA 1PMSA 4A5KA 2YS5A 2FJLA 2CAYA 3KZ1A 1DROA 3LJUX 3TO1A 4KVGB 1MIZB 4IFSA 4WVFB 3QWMA 4CHMA 3D8FA 5DIFB 1H10A 1J0WA 5L81A 1XR0B 1K5GB 4HB3B 3CXBB 5DH9B 3AU5A 1XKEA 2RVBB 2UZRA 4CYEA 4C0AA 4KHOA 4Z2NA 5D3YA 2ROVA 3AJ4A 4PNKA 3UZTA 2D4QA 5D3VA 2MWNB 4Z2MB 1DBHA 3TCAA 2ROZB 2DKQA 3BJIA 1ZC3B 3KRWA 2W2XC 2MFQA 2DHKA 1RJ2A 1WG7A 2D9WA 2GCJA 2W2XD 2LOXA 1P3RA 3SUZA 4DX90 1EAZA 2GS0A 1E5WA 3F0WA 4KHAA 3TW1A 4GN1A 1KZ7A 2EMSA 5CLLB 5JHHA 3D8EA 3RCPA 1SGHA 3PEGA 2AEHA 4ZRIA 3PG7A 2E2XA 1ZC4B 3M1IB 2I5FA 5GOWB 2GJYA 2R0DA 2D9VA 4HB2B 3OANA 1TJ6A 1XD4A 2EC1A 1W1HA 2EMTA 4HAZB 3P6AA 2UVMA 1BAKA 2YT1A 4KAXB 1I7AA 5JLJB 1Y5OA 2DKPA 2D10A 2AL6A 2ZPYA 2CY5A 4MK0A 1V5MA 3P7ZA 4HAYB 5J3QA 1U5FA 3ULBA 1U5EA 2YT0A 1FHXA 3FEHA 3ODWA 2OQBA 1RRPB 2KCJA 2VRWB 4HDOA 5KQ1A 1OY2A 5LOPB 2HTHB 2DTCA 4BBKA 5D27A 3KSYA 3PP2A 4HAUB 4YONA 1NTVA 4HB0B 3PZDA 2RGNB 1PLSA 1X1GA 4DBBA 4A6FB 4K17A 1V88A 4IAPA 1WI1A 3CIKA 3O96A 4F7HA 2Q13A 1ZVRA 1BTKA 1FGZA 2DLWA 1XX0A 1KZGA 2DA0A 3DXCA 1XCGA 5HE1A 4EMOA 3V5WA 3QIJA 2LG1A 2K00A 3PVUA 4K2OA 4WSFA 4HHVA 4B6HA 1AQCA 1FHWA 1FHOA 3WYFB 4P7IA 1H4RA 1Y19B 2H7DA 1MKEA 2VKIA 4HAWB 2I1KA 1MIXA 4GMXB 2P0DA 1NTYA 2ELBA 1QC6A 1UPRA 4F7GA 3SYXA 3A8PA 2JP2A 4YL8A 3MDBC 5JHGA 1UEFA 2YF0A 1P6SA 1XODA 1W1DA 3D8DA 2Y8GA 1M7EA 3DXDA 2IFSA 2QKLA 5D3WA 3HQCA 2DYQA 3ML4A 3HK0A 2CRFA 1J19A 2COAA 1NI2A 5HE2A 1X11A 2L1CA 4A6HA 1X05A 2GCLA 4PQ0A 2YSZA 3A8QA 3GYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE7 A;  1UNP A;  4DXA B;  4GXB A;  3VOQ A;  2VSZ A;  1NU2 A;  2UZS A;  3ODO A;  1U27 A;  3PVW A;  1AWE A;  2W2W A;  1ZM0 A;  4A6F A;  2MDX A;  3U8Z A;  2COC A;  4HAV B;  1BTN A;  2ADZ A;  2ELA A;  2I1J A;  3MPX A;  1OQN A;  5D3X A;  2LOZ A;  1UNQ A;  2M38 A;  2KGX B;  3BIN A;  2YS1 A;  2Y7B A;  2DX1 A;  3ZDT A;  1P5T A;  1V89 A;  1MK9 B;  1K5D B;  1WVH A;  3SNH A;  2EJ8 A;  1WJM A;  2LUL A;  2M14 A;  2Z0O A;  1WJ1 A;  2KUP A;  1X86 A;  2RLO A;  4ZRJ A;  2J59 M;  5FI1 A;  1DDW A;  1EF1 A;  2Z0P A;  2MKR A;  1FGY A;  2P0F A;  1DDV A;  5J3Y A;  2YS3 A;  1V5U A;  4DX8 A;  2LKO A;  1WGU A;  1FOE A;  4HAX B;  2Z0Q A;  1B55 A;  5J3T A;  1ISN A;  5KCV A;  2DHI A;  5C79 A;  2R09 A;  2J0K A;  3T06 A;  2LYD A;  2J0M A;  2DFK A;  2P0H A;  2OTX A;  4K81 A;  3F5R A;  3ZVR A;  3SV1 A;  5HE0 A;  1KI1 B;  5HE3 A;  1UPQ A;  5LON B;  4GPT B;  3N7C A;  2NMB A;  4A6K A;  1IRS A;  5DHF B;  1U2B A;  4MY6 A;  4TKN A;  1PFJ A;  4HB4 B;  5C5B B;  1FAO A;  1WGQ A;  2V76 A;  4NY0 A;  4EKU A;  2XQN M;  1V61 A;  2COF A;  2D2Q A;  2K2J A;  1MAI A;  2YVC A;  2RNR B;  3HW2 B;  4K2P A;  5KQ4 A;  3ULC A;  5CLQ B;  2D9Z A;  1LW3 A;  2Y8F A;  2RSG A;  1MPH A;  2NZ8 B;  2N0Y A;  1UNR A;  2PZ1 A;  2N23 A;  3GYP A;  3PSC A;  1LB1 A;  1W1G A;  4KHB B;  3TVV A;  3FM8 C;  4EJN A;  4F7U P;  2K2U A;  2DX5 A;  1TXD A;  1EGX A;  4IOY X;  4L6E A;  4GMV A;  2IYB A;  1TQZ A;  1U5D A;  1U29 A;  3U7D A;  5DHA B;  1V5P A;  3KRX A;  1MK7 B;  3WA0 A;  2D9Y A;  2P8V A;  4WJ7 A;  5JP4 A;  2DHJ A;  2COD A;  2L2I A;  3X23 A;  4MT7 A;  5C6R A;  3AU4 A;  1I2H A;  2X18 A;  4TYZ A;  1GC6 A;  1N3H A;  3DXE A;  2D11 A;  2YRY A;  4XWX A;  4Y94 A;  1BWN A;  3IVF A;  3FSS A;  4CHJ A;  2DYN A;  5C5B A;  4D0N B;  3G9W A;  1M7R A;  1GC7 A;  2BCJ A;  3ODX A;  1ZSQ A;  4GZU A;  2D9X A;  1X1F A;  2H7E A;  1SHC A;  3QBV B;  3KY9 A;  2G35 A;  1FB8 A;  3A98 B;  4NSW A;  2RUK B;  4ZRK A;  3SO6 A;  2DN6 A;  4HDQ A;  2CY4 A;  1DDM A;  2J0J A;  5FI0 A;  3VIA A;  3TFM A;  1GG3 A;  5DI9 B;  1OMW A;  4H8S A;  5EFX A;  3PVL A;  1Q67 A;  1QQG A;  1DYN A;  1Z87 A;  5C16 A;  1U5G A;  1EVH A;  2I5C A;  4HAT B;  2QKM A;  3NSU A;  1PMS A;  4A5K A;  2YS5 A;  2FJL A;  2CAY A;  3KZ1 A;  1DRO A;  3LJU X;  3TO1 A;  4KVG B;  1MIZ B;  4IFS A;  4WVF B;  3QWM A;  4CHM A;  3D8F A;  5DIF B;  1H10 A;  1J0W A;  5L81 A;  1XR0 B;  1K5G B;  4HB3 B;  3CXB B;  5DH9 B;  3AU5 A;  1XKE A;  2RVB B;  2UZR A;  4CYE A;  4C0A A;  4KHO A;  4Z2N A;  5D3Y A;  2ROV A;  3AJ4 A;  4PNK A;  3UZT A;  2D4Q A;  5D3V A;  2MWN B;  4Z2M B;  1DBH A;  3TCA A;  2ROZ B;  2DKQ A;  3BJI A;  1ZC3 B;  3KRW A;  2W2X C;  2MFQ A;  2DHK A;  1RJ2 A;  1WG7 A;  2D9W A;  2GCJ A;  2W2X D;  2LOX A;  1P3R A;  3SUZ A;  4DX9 0;  1EAZ A;  2GS0 A;  1E5W A;  3F0W A;  4KHA A;  3TW1 A;  4GN1 A;  1KZ7 A;  2EMS A;  5CLL B;  5JHH A;  3D8E A;  3RCP A;  1SGH A;  3PEG A;  2AEH A;  4ZRI A;  3PG7 A;  2E2X A;  1ZC4 B;  3M1I B;  2I5F A;  5GOW B;  2GJY A;  2R0D A;  2D9V A;  4HB2 B;  3OAN A;  1TJ6 A;  1XD4 A;  2EC1 A;  1W1H A;  2EMT A;  4HAZ B;  3P6A A;  2UVM A;  1BAK A;  2YT1 A;  4KAX B;  1I7A A;  5JLJ B;  1Y5O A;  2DKP A;  2D10 A;  2AL6 A;  2ZPY A;  2CY5 A;  4MK0 A;  1V5M A;  3P7Z A;  4HAY B;  5J3Q A;  1U5F A;  3ULB A;  1U5E A;  2YT0 A;  1FHX A;  3FEH A;  3ODW A;  2OQB A;  1RRP B;  2KCJ A;  2VRW B;  4HDO A;  5KQ1 A;  1OY2 A;  5LOP B;  2HTH B;  2DTC A;  4BBK A;  5D27 A;  3KSY A;  3PP2 A;  4HAU B;  4YON A;  1NTV A;  4HB0 B;  3PZD A;  2RGN B;  1PLS A;  1X1G A;  4DBB A;  4A6F B;  4K17 A;  1V88 A;  4IAP A;  1WI1 A;  3CIK A;  3O96 A;  4F7H A;  2Q13 A;  1ZVR A;  1BTK A;  1FGZ A;  2DLW A;  1XX0 A;  1KZG A;  2DA0 A;  3DXC A;  1XCG A;  5HE1 A;  4EMO A;  3V5W A;  3QIJ A;  2LG1 A;  2K00 A;  3PVU A;  4K2O A;  4WSF A;  4HHV A;  4B6H A;  1AQC A;  1FHW A;  1FHO A;  3WYF B;  4P7I A;  1H4R A;  1Y19 B;  2H7D A;  1MKE A;  2VKI A;  4HAW B;  2I1K A;  1MIX A;  4GMX B;  2P0D A;  1NTY A;  2ELB A;  1QC6 A;  1UPR A;  4F7G A;  3SYX A;  3A8P A;  2JP2 A;  4YL8 A;  3MDB C;  5JHG A;  1UEF A;  2YF0 A;  1P6S A;  1XOD A;  1W1D A;  3D8D A;  2Y8G A;  1M7E A;  3DXD A;  2IFS A;  2QKL A;  5D3W A;  3HQC A;  2DYQ A;  3ML4 A;  3HK0 A;  2CRF A;  1J19 A;  2COA A;  1NI2 A;  5HE2 A;  1X11 A;  2L1C A;  4A6H A;  1X05 A;  2GCL A;  4PQ0 A;  2YSZ A;  3A8Q A;  3GYO A; 
#chains in the Genus database with same CATH topology
 3FVC A;  2HE7 A;  1UNP A;  4DXA B;  4GXB A;  3VOQ A;  2VSZ A;  1NU2 A;  2UZS A;  3ODO A;  1U27 A;  3PVW A;  1AWE A;  2W2W A;  1ZM0 A;  4A6F A;  2MDX A;  3NWA A;  3U8Z A;  2COC A;  4HAV B;  1BTN A;  2ADZ A;  2ELA A;  2I1J A;  3MPX A;  1OQN A;  5D3X A;  2LOZ A;  1UNQ A;  2M38 A;  2KGX B;  3BIN A;  2YS1 A;  2Y7B A;  2DX1 A;  3ZDT A;  1P5T A;  1V89 A;  1MK9 B;  1K5D B;  1WVH A;  3SNH A;  2EJ8 A;  1WJM A;  2NBV A;  2LUL A;  2M14 A;  2Z0O A;  1WJ1 A;  2KUP A;  1X86 A;  2RLO A;  4ZRJ A;  2J59 M;  5FI1 A;  1DDW A;  1EF1 A;  2Z0P A;  2MKR A;  1FGY A;  2P0F A;  1DDV A;  5J3Y A;  2YS3 A;  1V5U A;  4DX8 A;  2LKO A;  1WGU A;  1FOE A;  4HAX B;  2Z0Q A;  1T77 A;  1B55 A;  5J3T A;  3NWF A;  1ISN A;  5KCV A;  2DHI A;  5C79 A;  2R09 A;  2R2Y A;  2J0K A;  3T06 A;  2LYD A;  2J0M A;  2RRF A;  2DFK A;  2P0H A;  2OTX A;  4K81 A;  3F5R A;  3ZVR A;  3SV1 A;  5LG4 B;  5HE0 A;  1KI1 B;  5HE3 A;  1UPQ A;  5LON B;  4GPT B;  3N7C A;  2NMB A;  2Z13 A;  4A6K A;  1IRS A;  5DHF B;  1U2B A;  4MY6 A;  4TKN A;  1PFJ A;  4HB4 B;  2KUQ A;  5C5B B;  1FAO A;  1WGQ A;  2V76 A;  4NY0 A;  4EKU A;  2XQN M;  3HSA A;  1V61 A;  2COF A;  2D2Q A;  2K2J A;  1MAI A;  2YVC A;  2RNR B;  3HW2 B;  2KIE A;  4K2P A;  5KQ4 A;  3ULC A;  5CLQ B;  2D9Z A;  1LW3 A;  2Y8F A;  2RSG A;  2Z59 A;  1MPH A;  2NZ8 B;  2N0Y A;  1UNR A;  2PZ1 A;  2KIG A;  2N23 A;  3GYP A;  3PSC A;  1LB1 A;  1W1G A;  4KHB B;  3TVV A;  3FM8 C;  4EJN A;  4F7U P;  2K2U A;  2DX5 A;  1TXD A;  1EGX A;  4IOY X;  4L6E A;  4GMV A;  2IYB A;  1TQZ A;  1U5D A;  1U29 A;  3U7D A;  5DHA B;  1V5P A;  3KRX A;  1MK7 B;  3WA0 A;  2D9Y A;  2P8V A;  4WJ7 A;  5JP4 A;  2DHJ A;  2COD A;  2L2I A;  4GOU A;  3HIE A;  3NWD A;  3OHM B;  4GNK B;  4QXA B;  4OSN A;  3X23 A;  4MT7 A;  5C6R A;  3AU4 A;  1I2H A;  2X18 A;  4TYZ A;  1GC6 A;  1N3H A;  3DXE A;  2D11 A;  2YRY A;  4XWX A;  4Y94 A;  4D6W A;  1BWN A;  3IVF A;  3FSS A;  4CHJ A;  2DYN A;  5C5B A;  4D0N B;  3G9W A;  1M7R A;  1GC7 A;  2BCJ A;  3ODX A;  1ZSQ A;  4GZU A;  2D9X A;  5M4Y B;  1X1F A;  2H7E A;  1SHC A;  3QBV B;  3KY9 A;  2G35 A;  1FB8 A;  3A98 B;  4HSI A;  4NSW A;  2RUK B;  4ZRK A;  3SO6 A;  2DN6 A;  4HDQ A;  2CY4 A;  1DDM A;  2J0J A;  5FI0 A;  3VIA A;  3TFM A;  2YT2 A;  1GG3 A;  5DI9 B;  1OMW A;  4KHB A;  4H8S A;  5EFX A;  3PVL A;  2Z4D A;  1Q67 A;  1MI1 A;  1QQG A;  1DYN A;  1Z87 A;  5C16 A;  1U5G A;  1EVH A;  2I5C A;  4HAT B;  2QKM A;  3NSU A;  1PMS A;  4A5K A;  2YS5 A;  2FJL A;  2CAY A;  5IRS A;  3KZ1 A;  1DRO A;  3LJU X;  3TO1 A;  2Z14 A;  4KVG B;  1MIZ B;  4IFS A;  4WVF B;  3QWM A;  4CHM A;  3D8F A;  5DIF B;  2ZKM X;  1H10 A;  1J0W A;  5L81 A;  1XR0 B;  1K5G B;  4HB3 B;  3CXB B;  5DH9 B;  3AU5 A;  1XKE A;  2RVB B;  2UZR A;  4CYE A;  4C0A A;  4KHO A;  3DCX A;  4Z2N A;  5D3Y A;  2ROV A;  3AJ4 A;  4OT1 A;  4PNK A;  4QJ5 B;  3UZT A;  2D4Q A;  5D3V A;  2MWN B;  4Z2M B;  1DBH A;  3TCA A;  2ROZ B;  2DKQ A;  3BJI A;  1ZC3 B;  3KRW A;  2W2X C;  2MFQ A;  1ZYI A;  3B77 A;  2DHK A;  1RJ2 A;  1WG7 A;  2D9W A;  2GCJ A;  2W2X D;  2LOX A;  1P3R A;  3SUZ A;  4DX9 0;  1EAZ A;  2GS0 A;  1E5W A;  3F0W A;  4KHA A;  3TW1 A;  4GN1 A;  1KZ7 A;  2EMS A;  5CLL B;  5JHH A;  3D8E A;  3RCP A;  1SGH A;  2KR0 A;  3PEG A;  2AEH A;  4ZRI A;  3PG7 A;  2E2X A;  1ZC4 B;  3NW8 A;  3M1I B;  2I5F A;  5GOW B;  2GJY A;  2R0D A;  2D9V A;  4HB2 B;  3OAN A;  1TJ6 A;  1XD4 A;  2GUM A;  2EC1 A;  1W1H A;  2K49 A;  2EMT A;  2K8E A;  4HAZ B;  3P6A A;  2UVM A;  1BAK A;  2YT1 A;  4KAX B;  1I7A A;  5JLJ B;  3A58 A;  1Y5O A;  2DKP A;  2D10 A;  2AL6 A;  2ZPY A;  2CY5 A;  4MK0 A;  1V5M A;  3P7Z A;  4HAY B;  5J3Q A;  1U5F A;  3ULB A;  1U5E A;  2YT0 A;  1FHX A;  3FEH A;  3ODW A;  5I2M A;  2OQB A;  1RRP B;  2KCJ A;  2VRW B;  4HDO A;  5KQ1 A;  5I2S A;  1OY2 A;  5LOP B;  2HTH B;  2DTC A;  4CSQ A;  4L1R A;  4BBK A;  5D27 A;  3KSY A;  3PP2 A;  4QJ4 B;  4HAU B;  4YON A;  1NTV A;  4HB0 B;  3PZD A;  2RGN B;  1PLS A;  1X1G A;  3U12 A;  4DBB A;  4A6F B;  4K17 A;  1V88 A;  4IAP A;  1WI1 A;  3CIK A;  3O96 A;  4F7H A;  2Q13 A;  1ZVR A;  4QJ3 B;  1BTK A;  1FGZ A;  2DLW A;  1XX0 A;  1KZG A;  2DA0 A;  3DXC A;  1XCG A;  5HE1 A;  4EMO A;  3V5W A;  3QIJ A;  2LG1 A;  2K00 A;  3PVU A;  4K2O A;  4WSF A;  4HHV A;  4B6H A;  1AQC A;  1FHW A;  1FHO A;  3WYF B;  4P7I A;  1H4R A;  1Y19 B;  2H7D A;  1MKE A;  2VKI A;  4HAW B;  2I1K A;  1MIX A;  4GMX B;  2P0D A;  1NTY A;  2ELB A;  1QC6 A;  1UPR A;  4F7G A;  3SYX A;  3A8P A;  2JP2 A;  4YL8 A;  3MDB C;  5JHG A;  2FJU B;  1UEF A;  2YF0 A;  1P6S A;  1XOD A;  1W1D A;  3D8D A;  2Y8G A;  1M7E A;  3DXD A;  2IFS A;  2QKL A;  5D3W A;  3HQC A;  2DYQ A;  3ML4 A;  3HK0 A;  2CRF A;  1J19 A;  2COA A;  1NI2 A;  5HE2 A;  1X11 A;  2L1C A;  4A6H A;  1X05 A;  4DIX A;  2GCL A;  4PQ0 A;  2YSZ A;  3A8Q A;  3GYO A; 
#chains in the Genus database with same CATH homology
 2HE7 A;  1UNP A;  4DXA B;  4GXB A;  3VOQ A;  2VSZ A;  1NU2 A;  2UZS A;  3ODO A;  1U27 A;  3PVW A;  1AWE A;  2W2W A;  1ZM0 A;  4A6F A;  2MDX A;  3U8Z A;  2COC A;  4HAV B;  1BTN A;  2ADZ A;  2ELA A;  2I1J A;  3MPX A;  1OQN A;  5D3X A;  2LOZ A;  1UNQ A;  2M38 A;  2KGX B;  3BIN A;  2YS1 A;  2Y7B A;  2DX1 A;  3ZDT A;  1P5T A;  1V89 A;  1MK9 B;  1K5D B;  1WVH A;  3SNH A;  2EJ8 A;  1WJM A;  2LUL A;  2M14 A;  2Z0O A;  1WJ1 A;  2KUP A;  1X86 A;  2RLO A;  4ZRJ A;  2J59 M;  5FI1 A;  1DDW A;  1EF1 A;  2Z0P A;  2MKR A;  1FGY A;  2P0F A;  1DDV A;  5J3Y A;  2YS3 A;  1V5U A;  4DX8 A;  2LKO A;  1WGU A;  1FOE A;  4HAX B;  2Z0Q A;  1B55 A;  5J3T A;  1ISN A;  5KCV A;  2DHI A;  5C79 A;  2R09 A;  2J0K A;  3T06 A;  2LYD A;  2J0M A;  2DFK A;  2P0H A;  2OTX A;  4K81 A;  3F5R A;  3ZVR A;  3SV1 A;  5HE0 A;  1KI1 B;  5HE3 A;  1UPQ A;  5LON B;  4GPT B;  3N7C A;  2NMB A;  4A6K A;  1IRS A;  5DHF B;  1U2B A;  4MY6 A;  4TKN A;  1PFJ A;  4HB4 B;  5C5B B;  1FAO A;  1WGQ A;  2V76 A;  4NY0 A;  4EKU A;  2XQN M;  1V61 A;  2COF A;  2D2Q A;  2K2J A;  1MAI A;  2YVC A;  2RNR B;  3HW2 B;  4K2P A;  5KQ4 A;  3ULC A;  5CLQ B;  2D9Z A;  1LW3 A;  2Y8F A;  2RSG A;  1MPH A;  2NZ8 B;  2N0Y A;  1UNR A;  2PZ1 A;  2N23 A;  3GYP A;  3PSC A;  1LB1 A;  1W1G A;  4KHB B;  3TVV A;  3FM8 C;  4EJN A;  4F7U P;  2K2U A;  2DX5 A;  1TXD A;  1EGX A;  4IOY X;  4L6E A;  4GMV A;  2IYB A;  1TQZ A;  1U5D A;  1U29 A;  3U7D A;  5DHA B;  1V5P A;  3KRX A;  1MK7 B;  3WA0 A;  2D9Y A;  2P8V A;  4WJ7 A;  5JP4 A;  2DHJ A;  2COD A;  2L2I A;  3X23 A;  4MT7 A;  5C6R A;  3AU4 A;  1I2H A;  2X18 A;  4TYZ A;  1GC6 A;  1N3H A;  3DXE A;  2D11 A;  2YRY A;  4XWX A;  4Y94 A;  1BWN A;  3IVF A;  3FSS A;  4CHJ A;  2DYN A;  5C5B A;  4D0N B;  3G9W A;  1M7R A;  1GC7 A;  2BCJ A;  3ODX A;  1ZSQ A;  4GZU A;  2D9X A;  1X1F A;  2H7E A;  1SHC A;  3QBV B;  3KY9 A;  2G35 A;  1FB8 A;  3A98 B;  4NSW A;  2RUK B;  4ZRK A;  3SO6 A;  2DN6 A;  4HDQ A;  2CY4 A;  1DDM A;  2J0J A;  5FI0 A;  3VIA A;  3TFM A;  1GG3 A;  5DI9 B;  1OMW A;  4H8S A;  5EFX A;  3PVL A;  1Q67 A;  1QQG A;  1DYN A;  1Z87 A;  5C16 A;  1U5G A;  1EVH A;  2I5C A;  4HAT B;  2QKM A;  3NSU A;  1PMS A;  4A5K A;  2YS5 A;  2FJL A;  2CAY A;  3KZ1 A;  1DRO A;  3LJU X;  3TO1 A;  4KVG B;  1MIZ B;  4IFS A;  4WVF B;  3QWM A;  4CHM A;  3D8F A;  5DIF B;  1H10 A;  1J0W A;  5L81 A;  1XR0 B;  1K5G B;  4HB3 B;  3CXB B;  5DH9 B;  3AU5 A;  1XKE A;  2RVB B;  2UZR A;  4CYE A;  4C0A A;  4KHO A;  4Z2N A;  5D3Y A;  2ROV A;  3AJ4 A;  4PNK A;  3UZT A;  2D4Q A;  5D3V A;  2MWN B;  4Z2M B;  1DBH A;  3TCA A;  2ROZ B;  2DKQ A;  3BJI A;  1ZC3 B;  3KRW A;  2W2X C;  2MFQ A;  2DHK A;  1RJ2 A;  1WG7 A;  2D9W A;  2GCJ A;  2W2X D;  2LOX A;  1P3R A;  3SUZ A;  4DX9 0;  1EAZ A;  2GS0 A;  1E5W A;  3F0W A;  4KHA A;  3TW1 A;  4GN1 A;  1KZ7 A;  2EMS A;  5CLL B;  5JHH A;  3D8E A;  3RCP A;  1SGH A;  3PEG A;  2AEH A;  4ZRI A;  3PG7 A;  2E2X A;  1ZC4 B;  3M1I B;  2I5F A;  5GOW B;  2GJY A;  2R0D A;  2D9V A;  4HB2 B;  3OAN A;  1TJ6 A;  1XD4 A;  2EC1 A;  1W1H A;  2EMT A;  4HAZ B;  3P6A A;  2UVM A;  1BAK A;  2YT1 A;  4KAX B;  1I7A A;  5JLJ B;  1Y5O A;  2DKP A;  2D10 A;  2AL6 A;  2ZPY A;  2CY5 A;  4MK0 A;  1V5M A;  3P7Z A;  4HAY B;  5J3Q A;  1U5F A;  3ULB A;  1U5E A;  2YT0 A;  1FHX A;  3FEH A;  3ODW A;  2OQB A;  1RRP B;  2KCJ A;  2VRW B;  4HDO A;  5KQ1 A;  1OY2 A;  5LOP B;  2HTH B;  2DTC A;  4BBK A;  5D27 A;  3KSY A;  3PP2 A;  4HAU B;  4YON A;  1NTV A;  4HB0 B;  3PZD A;  2RGN B;  1PLS A;  1X1G A;  4DBB A;  4A6F B;  4K17 A;  1V88 A;  4IAP A;  1WI1 A;  3CIK A;  3O96 A;  4F7H A;  2Q13 A;  1ZVR A;  1BTK A;  1FGZ A;  2DLW A;  1XX0 A;  1KZG A;  2DA0 A;  3DXC A;  1XCG A;  5HE1 A;  4EMO A;  3V5W A;  3QIJ A;  2LG1 A;  2K00 A;  3PVU A;  4K2O A;  4WSF A;  4HHV A;  4B6H A;  1AQC A;  1FHW A;  1FHO A;  3WYF B;  4P7I A;  1H4R A;  1Y19 B;  2H7D A;  1MKE A;  2VKI A;  4HAW B;  2I1K A;  1MIX A;  4GMX B;  2P0D A;  1NTY A;  2ELB A;  1QC6 A;  1UPR A;  4F7G A;  3SYX A;  3A8P A;  2JP2 A;  4YL8 A;  3MDB C;  5JHG A;  1UEF A;  2YF0 A;  1P6S A;  1XOD A;  1W1D A;  3D8D A;  2Y8G A;  1M7E A;  3DXD A;  2IFS A;  2QKL A;  5D3W A;  3HQC A;  2DYQ A;  3ML4 A;  3HK0 A;  2CRF A;  1J19 A;  2COA A;  1NI2 A;  5HE2 A;  1X11 A;  2L1C A;  4A6H A;  1X05 A;  2GCL A;  4PQ0 A;  2YSZ A;  3A8Q A;  3GYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...