1WGKA

Solution structure of mouse hypothetical protein 2900073h19rik
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGMAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2900073H19 protein
publication title Solution Structure of Mouse Hypothetical Protein 2900073H19RIK
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wgkA01
1SB3C 3LB8C 1IUEA 3AV8A 1FXAA 4ZHOA 1ZOYB 2WDRB 3ZYYX 1T3QA 1KRHA 3KWLA 4ZOHC 1A70A 1L6UA 2FBWB 2HTME 3AE8B 4IDIA 2JQRB 3FAHA 4JWUC 1N5WA 3AE1B 3AM9A 2CU3A 2H88B 3AEEB 2PVGC 1FIQA 1TKEA 2K9XA 3B2FA 3DWGC 1TKYA 3PO0A 1VDVA 3RPFC 4US9A 1QOBA 4HRSA 1FO4A 2PKOA 3HVZA 3P1MA 1UWMA 2G1EA 4YSYB 1DOYA 1SF0A 3NVYA 1WWTA 3W5UB 1JWAD 1JROA 1V97A 4YTNB 5MPOA 4N6EB 4YSZB 4WQMA 1QLBB 2H89B 1TYGB 1PFDA 2MH7A 2KAJA 2WLBA 3P63A 3VRAB 4C7ZA 3NVVA 5C2TB 4A9AA 3NRZA 1PUTA 1NEKB 1J7AA 1WXQA 1JQ4A 1JRPA 1TJEA 2WQYB 1AYFA 1F0ZA 3AE7B 3EUB2 1FRRA 2OHFA 4N58A 1YQ3B 4LTUA 2QJLA 1ZUD2 4YTMB 2L52A 2WU2B 5C3JB 1JALA 2Q5WD 3NVZA 1OFFA 1DOIA 3SR6A 2L83A 1YJIA 1OQQA 3B2GA 2W55A 3AECB 3ETRA 1N5XA 1B9RA 2K22A 1ZXIA 1RFKA 4P6VF 1J7CA 1FM0D 1JWBD 3AEBB 1J7BA 3CWIA 1QOFA 1QF6A 2B76B 2W3RA 4YT0B 3HRDD 1QOGA 3AMZA 3SFDB 1VJKA 5AUKA 1TKGA 2BS3B 5EE9A 1VLBA 1E7PB 3SFEB 2M19A 1FFUA 1GAQB 3WCQA 1XLNA 1NYRA 4JWSC 1L6VA 3P4SB 2DWQA 3AH7A 2WP9B 1RM6C 1N62A 2BT6A 2MJEA 5EE1A 3AEFB 1GPXA 1YJJA 2E3TA 1WRIA 2ACZB 3AE5B 2WU5B 3ABVB 4JX1C 1N61A 2JX5A 1E10A 1CZPA 1DGJA 2Y5CA 3AE9B 2WS3B 3FC4A 1RYJA 1PDXA 3AB5A 3CIRB 1R7SA 3AEDB 4YSXB 1NYQA 2M56B 3AEAB 3VR9B 3AE2B 3P4QB 5H8YE 1RWSA 1ZP0B 3AEGB 1WYGA 1QT9A 2PVOD 3AE3B 1XLOA 1L5PA 1SIJA 3B9JA 4WWMA 4US8A 1AWDA 1V8CA 3AE4B 1NVID 3VRBB 3LXFA 4USAA 1WGKA 4C80A 2W54A 3L4PA 1XLQA 3P4RB 1E9MA 2MJ3A 5H92C 1XO3A 2PIAA 3W9CB 1YQ4B 1NENB 2BS4B 2MJDA 1QOAA 4KX6B 1FFVA 2DBYA 2WDQB 1ROEA 1KFYB 1N60A 2W3SA 5EE0A 2K5PA 1NI3A 3HUIA 1DOXA 2QIEB 1E0ZA 5G5HA 4YTPB 4YXDB 4C7YA 5AUIA 2CJNA 2WDVB 5EE3A 5GXGB 3P4PB 4HROA 1FRDA 4FXCA 2AX5A 3NVWA 4ITKA 1E6EB 1FXIA 1KF6B 2KMMA 2N0SB 3VR8B 3W5VB 4ZHPA 1EWYC 1JW9D 1N63A 1FMAD 1OQRA 1XLPA 1I7HA 2BS2B 2LEKA 1CJEA 3BIID 2CJOA 3NS1A 5G5GA 3AN1A 2EKIA 4N59A 3DWMA 3AE6B 1L0VB
chains in the Genus database with same CATH superfamily
2LHEA 3DQVA 3GZNI 4FJZA 2GBNA 2K8BA 1VCBA 1P7EA 2A5UA 3AEEB 3RZFA 3MFGA 4K7UA 1M94A 2QSDA 1VDVA 4HRSA 3QQ8B 4YSYB 5D7GA 1R4NI 2PEAA 2OJWA 1C77A 3RD2A 2MBHA 2C60A 1OEYA 4BOZB 3DBSA 1FNUA 1J7AA 1JRPA 1UGJA 5FKAC 4A3PA 1S1QB 1I4RA 1OEYJ 3MTNB 1D6EC 3ZXVA 1P9DU 1LGRA 1OGWA 4FLHA 1UWXA 1RFKA 4GB9A 3ZJTA 3A1QA 4K3BA 4M0WB 1V6EA 3R7RA 4ZDVA 2GBMA 2WP9B 3UQAA 1CQVA 1E7VA 3W2DA 1WRIA 5CTRC 2IGGA 3PT2B 3AE9B 3U4EG 1PDXA 2Z8LA 2C5LC 2MP2B 2M56B 1F2RI 2LUMA 3H6NA 5H8YE 3UIOB 5JH5C 2KDMA 3B9JA 1XLOA 1WX9A 1NVID 3P4RB 1XLQA 3TMPB 2L76A 2V4IB 4IM3A 3WAOA 1OTRB 2BS4B 1FXTB 3DBLI 4BKSA 2J7QB 2WDQB 3QX1A 2R61A 1K50A 5IP4D 1F52A 1R4MI 2DYBA 1UD7A 3DDCB 1X1MA 2D3CA 2KWCA 1JWMD 3S2AA 2LEKA 3PSEB 2RGFA 3A9JA 4B0MA 2PW9A 3AN1A 4TV3A 2WXFA 2LGDA 5IAAC 2GBJA 3UI3A 1T3QA 4W9CA 4REZA 1WMHA 4JWUC 3Q8FA 1VZ8A 3ZXRA 4BZAA 2L3ZA 4R3DA 2JPHA 3PO0A 2MBEA 2N9LA 3TJPA 3MHSD 1YN3A 1KJTA 1V49A 2I38A 2C7NB 3CSTA 3I63C 4LDTD 1TYGB 3NRZA 3ZLZA 2DYOA 3ZRFA 3QJZA 1C1YB 2R2OA 3BVGA 2QJLA 4S0RA 4FULA 3Q69A 1YMHE 1MFWA 3OJ4B 1I35A 1GG3A 1F77A 4P6VF 3DPDA 4HLEA 2L0TA 2FIDA 2B76B 2DAFA 3EECA 2GMIC 5EE9A 5CX3A 2KWDA 2ZPYA 1EU4A 3PRZA 2MX2A 1RM6C 4RF0A 4K81A 3EC8A 1TS3A 4MM3A 2ACZB 2WU5B 3RI7C 2G45B 1HE8A 2KFKA 5AZHA 4MT5A 3AEAB 1QKZA 1RWSA 2J0JA 1L5PA 1WJ6A 3VRBB 1GNUA 1L2NA 2JVCA 1ZDXA 2Z59B 2AL3A 2WXGA 3IBEA 2W3SA 4NNJB 2RPVA 5HFYA 3UINB 2XK5A 2N7DA 4HPLB 4PYZA 2NBWB 4IWQA 4EZJA 2RDHA 1I7HA 5L95C 2KDIA 2J0MA 4AUQC 1EUVB 1L0YB 2DLBA 4IC7B 4NJCA 2JZZA 2V3NA 3N20C 3ZRCA 4TUUA 4US9A 3N30A 2I1KA 1BT0A 5BYQA 5TR5A 3V05A 4CYEA 1WGRA 1YQ3B 4DBGA 2LVQA 2J4XA 4KVGB 3DCGA 1ZPSA 3SR6A 2I1JA 2WXMA 4HDOA 1D5ZC 1QOFA 1HXYD 3MC0B 3AMZA 3PZ7A 3KUZA 4MH0E 1WGHA 1IPGA 2Z0DB 4E74A 5EE1A 3KUCB 2HDEA 2MEKA 4M00A 1UBQA 2JU6X 3CIRB 1ISNA 1ZE3D 1V5OA 4PS8A 4USAA 5LXIB 4GU2A 4GGQA 2PMVA 3Q2AC 4WH4A 1RAXA 1T0QC 1I42A 1QILA 2M4NA 2AWTA 3C0RB 3RUIB 1N60A 2K5PA 2QIEB 4EE2A 3GOEA 4YTPB 4L1BA 3VUWA 5I4DA 1HEZE 1FRDA 2GRIA 5LNK1 2AX5A 1WGGA 1XLPA 4A6QA 2LWPA 3NS1A 3T9LA 1T0YA 2KQSA 4GDKB 4EUTA 4XWWA 2O6VD 1TZ1A 2K0PA 2WXOA 3V61A 3U8ZA 2D3BA 4JE3B 2Y5BB 4AWJA 2EMSA 4DDID 4AP4C 1UWMA 2LASA 4KDIC 4DXAB 1B1ZA 4JLCA 2KC1A 4M8NA 2WX0A 3URYA 2LUEA 1TS5A 2KWVB 2KN4A 3HHMA 4DDGD 3RNAC 4II2B 4XWTA 1Q0WB 4KDLB 4M0WA 3RZWC 3PREA 1L0XB 2KNBA 5BMGA 4ICVA 4IW0A 2KHWB 2K22A 1WGDA 4W9EA 2ZCCA 3EHVA 1GOZA 3T8MA 2BB5A 1D3ZA 1SE9A 2MCNB 4IG7B 2D07B 2FCNA 5IOIA 2YEPF 2ONQA 1FEHA 2WXIA 2KX0A 1TT5B 4ARCA 1WSPA 2MP2A 4XDDA 2VH1A 4O1NA 3BINA 1N61A 4ANVA 4W9HA 3FC4A 4L2YA 3AB5A 3FKYA 2ICIA 1XEEA 4M01A 4MACA 3RULA 2ZJDA 2O6VB 1WR1A 1WXSA 1VZ6A 2ZEQA 1V9JA 4BVUC 4W9DA 5AUIA 4K7WA 3W5VB 4BBNC 2KMMA 5KHQA 3BIID 2MRPA 3PHWB 1ZOYB 2WDRB 2BVCA 2BGFA 1BXTA 3A4RA 3MP9A 2CHXA 3J9CA 1MG8A 2JQRB 2UYZB 5AEKB 2KDFB 2D3GA 3B2FA 3VVWB 2DAJA 2L00B 4J3OD 1C4CA 4F7ZA 4AQ7A 1HQRD 1F9JA 2ZPNA 2MHJA 4IM2A 3U2SC 4W9GA 4HPPA 3MC9A 2IZVB 1WI0A 3ZW3A 1HZ6A 2VH2A 2OHFA 2IO1B 3AULA 3I5JC 3X0WA 1ZGUB 3L08A 3RCZA 2WU2B 1N6ZA 3VXWA 4DXGA 1JALA 4OW0A 4ZRKA 3R2IA 4KZ0A 1U4AA 1ZXIA 5FR6A 3AEBB 2W3RA 1C3TA 2XN9C 3Q6BA 3GE3C 4A55A 1GUAB 2M19A 1FFUA 2JRIB 2L8JA 1L6VA 4WJQA 4WIPA 3W1YA 2VZKB 5HHDG 3W1SC 2NPTB 2BKRB 2PJHA 3KVFB 1GC7A 2FUHB 4B95A 3APDA 2Y3AA 2RR9A 3WANA 2LGYA 1I4PA 1VZ7A 2L1AA 3GB1A 4B9KA 1AWDA 3VTUA 1STEA 4MJSB 2FCQA 2KMCA 3JSVB 1C76A 1KLGD 4GSWA 2HE7A 2KTFA 3KWVA 3M62B 4S17A 3ONSA 2IPKD 1NI3A 2C9WB 2XEWA 1RLFA 4G11A 1PQSA 2X8XX 4HROA 1KTKA 1Z5SB 3N9YC 1V1OA 4DHZE 1FMAD 1UBIA 1WR6E 3ENEA 4W9KA 2JWUA 4N59A 3AE6B 1C4AA 2KK8A 3HVDA 1IBXA 4IDIA 4WURA 2V1YA 4FJVB 3ZIMA 2BW2A 1ET6A 1V2YA 4ZRIA 2IYDB 4WQMA 2MH7A 4WJNA 4WJPA 4XZ4A 1WRDB 5J17A 3KW5B 1JQ4A 3C8YA 5LLIA 2N9PC 2KKCA 4JPSA 2JT4B 3N1XC 2Q5WD 1I4XA 1KOTA 4UDUC 1V1PB 1WJUA 3ETRA 5DPSA 4XDCA 1J7BA 2KVZA 3NHEB 2IO2B 3ZTDA 2DYMA 2KDBA 1VLBA 2IY0B 3T3OA 1AARA 2J52A 4JWSC 2WWZA 2JX5A 2KJHB 4IM0A 2G9HD 3JW0X 4ACFA 1MPEA 4W9JA 2JXTA 5E6PA 3P1MA 1WYGA 4PS3A 3VTWA 2O2VB 3LJ3A 1I4GA 1ZXHA 4CHKA 1YQ4B 4QAYA 2MJDA 2MQJA 3HUIA 2WYQA 3DBHB 1SE3A 2WDVB 4Q2JA 1KH0A 3VFKA 1EWYC 2YEPB 2LGIA 5TSSA 3LB8C 3AV8A 2IDYA 4W9IA 4RGTA 3U7DA 3OLMD 3FAHA 4TKNA 3Q3MC 1YX5B 1G6JA 3IVFA 3RPFC 2FIFA 2PKOA 4KZCA 2XBBC 4JQWC 3VTVA 1V97A 3MJ5A 3IAM1 3H7PA 4YSZB 2WLBA 1VR9A 2KAJA 3QC8B 1JCKB 4MGIE 4DK5A 3ZQ4A 2FNJB 4GDLB 2J42A 4RFBA 2ZVOA 3Q8EA 3VUYA 4KV2A 3B1LX 3L54A 2UWQA 4LNOA 3DHGC 1ZKHA 2INCC 1SBBB 3EA6A 2W55A 2WNMA 1JWBD 2WXHA 2MBQA 3N32A 5FR3A 1TBEA 4FJYA 1QOGA 1YNTE 3T3NA 5AUKA 4RNAA 2SEBD 1SSNA 3WCQA 2KYWA 2GBRA 4WWNA 1PGBA 3IAS1 1YJJA 5DPWA 1OQYA 4GXBA 1CZPA 1DGJA 2AQ2B 1M4VA 3V6EB 3PGEA 2BWFA 4KIKB 2BPSA 1C79A 1P7FA 2BQQA 2R2QA 2O6VA 1V86A 4LJOB 1E9MA 3QIJA 4OZCA 2PIAA 2MWSB 3DBRI 3A9KA 4KKJA 4DHZB 1SXTA 3QA8A 3KQ4A 1UNSA 2QC8A 3NVWA 3KH0A 2KWUB 1TS2A 3BWUD 2BS2B 2FAZA 5JHBA 4LLGM 4N9F4 5G55A 1WE7A 3GZNB 1E7UA 4C4VA 3RNBC 2HD5B 2ZVNA 2A4ZA 1JWUD 1H8CA 2BWES 1FIQA 4MSMB 3DWGC 2NBUA 3TEXA 3HVZA 2CR5A 1R4NB 4IWPA 4K7SA 2G3QB 2KZRA 3P63A 3IG3A 4NAWB 4ICUA 1TJEA 2AEHA 2LXCA 4M8MA 1F0ZA 3Q8AA 2RDBC 1WJNA 4HJGE 1MG4A 2L52A 1WM3A 2DX5B 3B2GA 1OQQA 4NJ6A 1N5XA 1P1AA 2UU7A 2BYVE 2LRWA 4CQNA 2NPTA 1VJKA 1Q10A 1C9FA 3HM3A 3PRPB 4RGOS 4BBNF 2JZPA 4FN2A 2E3TA 2MW5A 4MJSA 2J0KA 4P1CC 4NJ7A 1FNWA 1P98A 2NR2A 3VR9B 2GI9A 3P4QB 1NI2A 3UF8A 4D2KA 1ZP0B 3SHQA 1K53A 3LDZE 4C80A 3L4PA 1WF9A 2V3SA 1E8WA 4KGSA 4P16A 1SIFA 4ZRPA 4K3CA 3DBLB 3I3TB 1ROEA 4FBJB 3NZUA 1DOXA 2NBVB 3Q8BA 5D2MB 1R4MB 4NAMA 3ZUNA 2EMTA 1HTQA 4HVBA 2PLPA 1KF6B 2B3AA 3PS6A 4ZHPA 4EZKA 2CJOA 3KYDD 2GBKA 4AJYB 2RMMA 1FO4A 2KX3A 3UGBB 3W1SA 3AM9A 1TKEA 4KSKC 2BBCA 2QDFA 1UGMA 1IP9A 2WXLA 1E8XA 5IKCM 1JWAD 4GOCA 4HJKA 2QEJC 3BZDB 4HEA1 2YVCA 3IHPC 3B0AA 4HKQA 3GE8C 1K8RB 1WXQA 3A1QB 1HZ5A 1PGXA 1FPYA 3ZGZA 3SDLC 3Q3OC 2DHZA 2BYFA 3ZKJC 1TS4A 3AECB 2LI5A 4OVUA 2NVUI 2CS4A 3VDZA 3ZO5B 2CHWA 1TKGA 3NY5A 3TCAA 1EF1A 3AI5A 1YQBA 3P4SB 5D3DA 5FK9C 3PLVA 4I6PA 2OJRA 3VH3B 4IKGA 1A5RA 1E5WA 2O2VA 4HXDA 3ZDTA 1UELA 2KQ4X 4OHJA 4W9FA 3AEGB 1Q1OA 1QT9A 3Q8CA 4FADA 4US8A 2DENB 2KDEB 4HCNB 2AL6A 2DZJA 3H1UA 1WGKA 2JYEA 4MGZE 2NS5A 1JWSD 5E6JA 3W9CB 4HPMB 3A9JB 4A20A 1QOAA 3PRMB 4KGRA 2KACA 1K52A 2LFIA 3HIZA 3V6CB 1IYFA 4YXDB 1WMHB 1BUIC 2N0SB 2WXKA 2V4LA 2KQ7A 2RSUA 1CJEA 3IFWB 5IN7A 4J6IA 3Q14C 2ZW0A 1IUEA 2VZKD 1TIFA 2J53A 3DHIC 3B08A 1SJHD 3RN9C 3I57A 3WAMA 3L13A 2K9XA 3VH4B 1AN8A 1SF0A 1WWTA 2N9XA 3ZTCA 5MPOA 1D4BA 4RM8A 4XYCA 1EO6A 2BB6A 3AU4A 4LK0M 4JIOU 4A9AA 3RMKC 2LGSA 2CHZA 4OVZA 2KLGA 1V80A 3EUB2 1V5TA 4LNKA 3KUDB 4MM3B 2EKEC 2KFKB 3X23A 5E6OA 1EM7A 5CHWA 4NY0A 1WFYA 5BYSA 2REXA 1L4ZB 2M0AA 2PPHA 4KIKA 2MBBB 2N1WA 3APFA 2INPE 1EWCA 2Z0EB 3DBHI 4DWFA 1R7SA 3AE2B 2JXXA 4MGYE 1EU3A 2XK5B 4TSSA 3LXFA 2LJIA 3WA0A 3RNCC 3A33B 4RGMA 3OAWA 2XNAC 3MHZA 3P4PB 1TTNA 3KLSX 3M3JA 5EDSA 2LMCA 4I6LB 2GLSA 2EKIA 3GS2A 3AU5A 2LVPA 2KFJA 2V3PA 3KWLA 1E8ZA 3DVGY 4ANWA 1BMLC 4G3XB 1WZ0A 4WAFA 3PPAA 2NCNA 5AZFA 1EF5A 4HKZE 1SGHA 2WGSA 4WWOA 1QOBA 1XT9B 3PV1A 4MH8A 5E6NA 1Q5WB 4AS1A 2LGXA 2H89B 2WX1A 1ENFA 3IXSA 2D2QA 2JRHA 2FE8A 4XE0A 3H7SA 3O65B 1ET9A 3AE7B 1FRRA 3DHHC 4LTUA 1IGCA 1ZUD2 4FHKA 3APCA 2KTRB 1PGAA 2JY6A 3RYTA 2L83A 3D32A 4C56C 2AYOB 3SD5A 2D10A 3E9SA 4YT0B 4KKIA 1WGYA 2N9KA 3K9PB 4BKTA 3IT4B 1XLNA 2NTSA 3AH7A 2FUG1 2M1MA 2KC2A 3QK0A 2LVOA 1T5XD 3NZSA 4XX5A 2Y5CA 3VHTC 1J19A 1D5XC 2CU1A 3AEDB 4YSXB 4A3OA 3AE3B 4WWMA 4RMAA 2N7EA 3VUXA 2N7JA 4AJWA 2MLBA 4AOFA 2W54A 2RDGA 1Z2MA 2C7HA 2ZCBA 4KX6B 1XCQL 3Q3NC 1F1HA 1HA5A 3N1ZC 4B6WA 3ECIA 1J8CA 4EFOA 2M0XA 2CJNA 1SJED 1GB4A 2KJ6A 5T8IA 3DOWA 2WXQA 1WH3A 1FXAA 4PS7A 4ZOHC 5CHFA 2CU3A 4EEWA 3NG0A 2KOXA 3PZ8A 4GDKA 1DOYA 1LXDA 2KMAA 3NVYA 4FHJA 1MJDA 1PFDA 1KLVA 5C2TB 2WHIA 3UIPB 1MHXA 2D11A 4NPNA 3MJWA 3WIMA 4DQOC 2BKFA 3TBLD 5C3JB 3NVZA 1YJIA 3AXCA 1J7CA 3ZNZB 2WXRA 4E71A 2W9NA 2K1FA 3BK2A 5AZGA 4HDQA 4PT5A 1GAQB 5DPTA 3V3XA 4JGHB 4G0NB 2PTLA 4DXFA 4BFRA 2WXJA 3V62A 2HJ8A 4FA6A 1TY2A 1ZDVA 1GJZA 1YX6B 5H92C 3R3MA 2M17A 3BVZA 2DZKA 3IT6B 1WXVA 4W9LA 4LNFA 2OEDA 1XQQA 2MA9B 2D3AA 1XCTL 2KO3A 2DNFA 3ZYYX 4JL9A 4MELA 4X57B 1WXAA 2WDTB 2INDC 2KXJA 1N5WA 2N4FA 3AE1B 3RT3B 2LZ6A 3C19A 2H88B 1YD8U 2L32A 2NMQA 3BYYB 1C78A 1WIAA 5G2NA 3W5UB 2RPQA 3K9OB 4PYUA 1P0RA 4N6EB 3Q3FA 1L7YA 3NVVA 5D6JB 4YWGG 1KLUD 4YTMB 4OZBA 3ZNGC 1F2RC 1KM7A 4NQLB 1OFFA 1DOIA 4MDKE 2LD9A 1WZ3A 1QF6A 3U30A 4TQ1A 5JHAA 3RNFC 3QARA 4LJPB 1TGZB 2BT6A 3BYTB 2W82A 1FD6A 2GB1A 3DVNU 4ARIA 2K25A 3FILB 3AE5B 3ABVB 1TZOA 1LO5D 1L4DB 2MSED 1V8CA 3AE4B 2JYTA 4LDTB 4IWOA 1XO3A 1I4QA 3PLUA 3EFCA 5IO9A 3M63B 1IGDA 1FFVA 3ZNID 3TEWA 1LFDA 4OVVA 2G4SA 5EE0A 2V9HA 4BKGA 4LNIA 5HKHA 3U52E 4LCDE 1IBXB 1T6BX 4XGAB 1GB1A 3JSVA 5JXVA 4M02A 3I9V1 1E8YA 2JZ3B 1I4HA 3L16A 1SB3C 3VAWA 4ZHOA 2BYEA 1A70A 5DPRA 3R7QA 1SE2A 3Q3JA 4DHJD 3H9DA 4F8CB 4RGNA 4HWIB 2PVGC 4BKSD 2KJRA 2D5GA 1FCCC 4K1RB 1K51A 5C1ZA 2IO3B 2SAKA 2G1EA 2RD0A 4GIVA 2ZW1A 4YTNB 4G50A 4HK2A 3LYYA 2AQ3B 1Y56A 4ANXA 5BO4B 2KTRA 5KHOA 1NEKB 2ZNVC 3NS8A 4HCPB 3MC8A 2JSVX 2PE6B 3NZ3A 4ZYSA 4URKA 2IY1B 4H2AA 1NBFC 1VRAB 2BS3B 4MGKE 4ZRQA 1FCLA 5GMVA 2QMTA 2L05A 1NDDA 3EFUA 4RF1A 2IBIB 1JMLA 4WWPA 2LXAA 3DVGX 3KYCD 3ZJVA 1V1PA 3TEYA 2MJEA 1VD2A 3AEFB 1YOVB 4MEMA 4KGTA 1WYWB 2PE9A 2QILA 1RRBA 2FCMA 3EGRA 1RYJA 2KANA 2M8SA 3PHXB 1UF0A 1SIJA 4P7IA 3UQBA 2K8CA 3P2BA 4IUMB 1V81A 5J18A 2I2YA 4A90A 3DBRB 3SU8X 2IO0B 3CF6E 3BVMA 3PVLA 1KFYB 3HM6X 1XD3B 3HK0A 2Y5PA 3O13A 4BAXA 5G5HA 2ZNVB 4DHJB 1E90A 1RFAA 3TEZA 1YIWA 5GXGB 1J0GA 1PYWD 2LHDA 3NUHB 1E6EB 1FXIA 1D5MC 2N1VA 2WXPA 4WQOB 1JW9D 1C4PA 2X38A 3QAQA 3ZDMC 1TY0A 2YLMA 5BYRA 1KRHA 3U7ZA 3AE8B 4TQ0A 2MBOA 4OZAA 1LQBA 1WJ4A 3H7PB 3ML8A 3TUOA 1WX7A 5C23A 1T0SC 3V60A 4B0EA 2IGHA 1WE6A 2BYTA 1SEBD 5DCNA 4A8XC 1UH6A 2INNE 3JVZX 1JROA 2TSSA 1LM8B 1QLBB 4GMVA 5D94A 4F1SA 2AQ1B 2WQYB 5J2RA 2KD0A 1T0RC 1WY8A 4NZLB 3NOBA 3RNEC 2JF5A 3CSFA 4GDLA 2JUOA 3QWZB 2BTEA 3DVNV 4TMAB 5IA7A 2KT7A 3ML9A 3SFDB 2DZIA 3PTFC 1QZEA 2OOBB 1E7PB 2LRUA 3SFEB 4BOSC 1ZW7A 2LJ5A 2HJ1A 3M95A 1N62A 2IJ0A 3E56A 1GPXA 2KLCA 4JX1C 1HTOA 1ACCA 1S3SG 3L17A 2C7MB 4NQKE 1MHHE 2WS3B 3A9KB 1SE4A 4YL8A 4EKUA 2WXNA 2PVOD 3L0WB 3ZJUA 3ZNHB 4EZLA 3WAPA 2E6XA 1GC6A 4XC2A 4P1BC 4GN1A 1UZXB 2CKHB 2VRRB 3H8HA 3NJTA 1ESFA 2DBYA 1MI0A 3JYUA 4PK1A 1E0ZA 1YJ1A 3VQIA 5D3IB 4C4VB 4FXCA 1YN5A 4ZRJA 1N63A 1OQRA 3OWEB 1H4RA 4ANUA 4C00A 5G5GA 1FNVA 3R8BA 3DWMA 2KN5A 1JRUA 4ZYNA 4RCOA 3R2TA 1L6UA 2FBWB 2HTME 4KSLC 4GLSC 4RM9A 1WM2A 1WXMA 2K6QA 3BY4B 1CK1A 2QCZA 1CMXB 2G4DB 1TKYA 4WAAA 2HTHA 2QHOA 2BF8B 3WALA 2K6DB 1UUPA 2FCSA 3PZDA 3ALBA 4LNNA 5LXHA 3VRAB 4C7ZA 3ZVVA 3L10B 4I6NB 2L0FA 5BMIA 1PUTA 1MVKA 3OJ3A 5HG2A 1XF5L 1AYFA 2L7RA 4N58A 3N1YC 2V0GA 2GOWA 3A4SC 1B9RA 1P3QU 3QCAA 2ZZPB 4CO7A 2K39A 2K8HA 4NAWA 1YN4A 5HI1A 3TL5A 1FM0D 3TIXA 3CWIA 3R66C 3HRDD 2IGDA 3FILA 3QHTA 2ASQA 3RFZB 1DYQA 1NYRA 4IOIE 1WX8A 2DWQA 2NTTA 2K3UA 4EOYA 1E10A 3TSSA 1AW7A 3OG5A 4II3B 4WJOA 3RNGC 1NYQA 4RH6A 5CHVC 2JWZA 4MSQB 5JZEB 1Y8RC 2MJ3A 5L83A 1NENB 2N9EB 3GP7A 3SEBA 3N3KB 4ASWC 4C7YA 1QQRA 5EE3A 4E3CA 2DZMA 5BMHA 3VR8B 4ITKA 2EELA 2ON8A 4L23A 3P42A 1XXGA 3CMMB 3BK1A 2KVRA 1L0VB
chains in the Genus database with same CATH topology
2LHEA 1ZOYB 2WDRB 3ZYYX 1BXTA 3MP9A 3W1SA 3J9CA 2JQRB 1N5WA 1P7EA 3AE1B 3AM9A 2H88B 2L32A 2NMQA 3AEEB 1TKEA 3B2FA 3MFGA 2BBCA 2QSDA 1VDVA 2WXLA 3BYYB 4J3OD 4HRSA 1C4CA 4AQ7A 1HQRD 1C78A 4YSYB 5D7GA 3W5UB 1JWAD 4N6EB 1C77A 2QEJC 3BZDB 3U2SC 4HEA1 3NVVA 1FNUA 1HZ6A 4YWGG 4HKQA 1J7AA 1WXQA 1JRPA 1HZ5A 1KLUD 1UGJA 2OHFA 1PGXA 5FKAC 3ZGZA 1I4RA 4YTMB 4OZBA 2WU2B 1D6EC 1F2RC 4DXGA 1JALA 4OW0A 1OFFA 1DOIA 1TS4A 3AECB 1UWXA 3R2IA 1ZXIA 1RFKA 3AEBB 3ZJTA 1QF6A 2W3RA 2XN9C 4A55A 1TKGA 4TQ1A 2M19A 1FFUA 1L6VA 3P4SB 5D3DA 5FK9C 2WP9B 2BT6A 3BYTB 2W82A 2VZKB 4WIPA 4IKGA 1CQVA 5HHDG 2GB1A 3W2DA 1FD6A 4ARIA 3FILB 1WRIA 3AE5B 3ABVB 2IGGA 1TZOA 2KQ4X 1LO5D 3AE9B 3U4EG 1PDXA 2Z8LA 1L4DB 4OHJA 2Y3AA 2M56B 1F2RI 2LUMA 5H8YE 1I4PA 3AEGB 2KDMA 1QT9A 3B9JA 3Q8CA 1XLOA 4US8A 1VZ7A 2L1AA 3GB1A 1AWDA 1V8CA 3AE4B 1NVID 1STEA 2JYTA 1WGKA 2JYEA 3P4RB 1XLQA 2V4IB 1XO3A 1I4QA 1C76A 1JWSD 1KLGD 5E6JA 2BS4B 3W9CB 1IGDA 3KWVA 1QOAA 4KGRA 1FFVA 3TEWA 2WDQB 2KACA 2IPKD 5EE0A 1K52A 1NI3A 2LFIA 4YXDB 2R61A 3U52E 1K50A 1IBXB 1T6BX 1BUIC 4HROA 1KTKA 1GB1A 3N9YC 2N0SB 2WXKA 1V1OA 1JWMD 2LEKA 1FMAD 1CJEA 4B0MA 5JXVA 3I9V1 2PW9A 3AN1A 2WXFA 2JWUA 1I4HA 4N59A 2ZW0A 1C4AA 3AE6B 3HVDA 1SB3C 1IUEA 4ZHOA 3UI3A 1T3QA 2VZKD 1IBXA 4REZA 1A70A 4IDIA 2J53A 4JWUC 1SE2A 3Q8FA 1SJHD 4WURA 1VZ8A 4RGNA 3I57A 2PVGC 2K9XA 4R3DA 2D5GA 2BW2A 3PO0A 1ET6A 1FCCC 2N9LA 1K51A 1YN3A 2SAKA 1AN8A 2G1EA 1SF0A 2I38A 1WWTA 2ZW1A 4YTNB 5MPOA 1D4BA 4WQMA 3LYYA 1TYGB 2MH7A 2AQ3B 1Y56A 2BB6A 4LK0M 4A9AA 3NRZA 2DYOA 1NEKB 4OVZA 1JQ4A 3C8YA 3EUB2 3BVGA 4JPSA 2QJLA 3Q69A 1YMHE 2JSVX 2Q5WD 1I4XA 4UDUC 1V1PB 3NZ3A 3ETRA 4ZYSA 1F77A 4MM3B 4P6VF 4XDCA 1J7BA 4H2AA 2B76B 1VRAB 2DYMA 2BS3B 5EE9A 1VLBA 4ZRQA 2KWDA 1EM7A 3T3OA 1FCLA 2J52A 2QMTA 5BYSA 4RF1A 1JMLA 4JWSC 1EU4A 1L4ZB 3ZJVA 2M0AA 1V1PA 1RM6C 3TEYA 2MJEA 4RF0A 3AEFB 1TS3A 4KGTA 2ACZB 2WU5B 2JX5A 2INPE 1EWCA 2G9HD 2QILA 3EGRA 1RYJA 1R7SA 1MPEA 2JXTA 4MT5A 3AEAB 3AE2B 1QKZA 1RWSA 3P1MA 1WYGA 1L5PA 1EU3A 1SIJA 4TSSA 3VRBB 1I4GA 3LXFA 1ZXHA 2LJIA 2I2YA 1ZDXA 4A90A 1YQ4B 2WXGA 2MJDA 3BVMA 1KFYB 2W3SA 2RPVA 3HUIA 2Y5PA 3O13A 4RGMA 5G5HA 5HFYA 4Q2JA 1SE3A 2WDVB 2XNAC 3TEZA 3MHZA 3P4PB 5GXGB 1KH0A 1PYWD 2LHDA 3NUHB 1E6EB 1FXIA 1D5MC 2RDHA 3KLSX 2WXPA 1EWYC 1JW9D 2YEPB 1I7HA 1C4PA 2LMCA 2LGIA 2EKIA 2X38A 5TSSA 3GS2A 1TY0A 3LB8C 3AV8A 5BYRA 2IDYA 1KRHA 3U7ZA 2V3PA 3KWLA 4RGTA 1L0YB 3AE8B 4TQ0A 2DLBA 4OZAA 3FAHA 3TUOA 4B0EA 2IGHA 1BMLC 4NJCA 4WAFA 2V3NA 2BYTA 1SEBD 4HKZE 4A8XC 3RPFC 4US9A 1QOBA 4MH8A 1FO4A 2PKOA 2INNE 4AS1A 1JROA 1V97A 2TSSA 3MJ5A 3IAM1 5BYQA 4YSZB 1QLBB 2H89B 2WLBA 1VR9A 2KAJA 1ENFA 3IXSA 1JCKB 2AQ1B 3ZQ4A 4GDLB 2FE8A 4XE0A 3V05A 2J42A 2WQYB 4RFBA 1ET9A 3AE7B 3Q8EA 1FRRA 1YQ3B 4LTUA 1IGCA 2J4XA 1ZUD2 4NZLB 1PGAA 1SBBB 1ZPSA 3EA6A 3SR6A 2L83A 2W55A 4C56C 2WNMA 2WXMA 1JWBD 2WXHA 3E9SA 1D5ZC 1QOFA 1HXYD 3MC0B 5FR3A 4TMAB 2BTEA 4YT0B 1QOGA 3AMZA 3PZ7A 4KKIA 1YNTE 3SFDB 2N9KA 3T3NA 5AUKA 3IT4B 4RNAA 1E7PB 2SEBD 3SFEB 1SSNA 1XLNA 3WCQA 2NTSA 1PGBA 3AH7A 1N62A 5EE1A 2FUG1 2IJ0A 3E56A 1GPXA 3IAS1 1YJJA 2HDEA 4JX1C 1T5XD 2MEKA 1ACCA 1CZPA 1DGJA 2Y5CA 2AQ2B 1MHHE 1M4VA 2JU6X 2WS3B 1D5XC 3CIRB 3AEDB 4YSXB 1SE4A 1ZE3D 1C79A 1P7FA 2WXNA 2PVOD 3AE3B 3ZJUA 4WWMA 2N7JA 2E6XA 4USAA 2W54A 1E9MA 2RDGA 4OZCA 2PIAA 2PMVA 4WH4A 3H8HA 1QILA 1ESFA 4KX6B 4KKJA 2DBYA 1SXTA 1XCQL 1N60A 2K5PA 1MI0A 1HA5A 2QIEB 3KQ4A 4EE2A 1E0ZA 4YTPB 1UNSA 4L1BA 3VQIA 5D3IB 2CJNA 5I4DA 1HEZE 1FRDA 1SJED 2GRIA 2AX5A 3NVWA 4FXCA 1YN5A 5LNK1 1GB4A 1TS2A 1N63A 1OQRA 3BWUD 5T8IA 1XLPA 2BS2B 4A6QA 3OWEB 3NS1A 2WXQA 4LLGM 5G5GA 1FNVA 3R8BA 3DWMA 4GDKB 1FXAA 4XWWA 4RCOA 3R2TA 1L6UA 2FBWB 2HTME 4ZOHC 4GLSC 2K0PA 2WXOA 1JWUD 4JE3B 2CU3A 1FIQA 1CK1A 3DWGC 1TKYA 3PZ8A 3TEXA 3HVZA 1DOYA 1UWMA 3NVYA 1UUPA 1PFDA 1B1ZA 3P63A 3VRAB 4C7ZA 5C2TB 4NAWB 5BMIA 1PUTA 1MVKA 5HG2A 1XF5L 1TJEA 3URYA 1MHXA 1AYFA 1TS5A 1F0ZA 3Q8AA 4N58A 2KN4A 4DQOC 4HJGE 4XWTA 2L52A 4M0WA 5C3JB 1L0XB 3NVZA 2V0GA 5BMGA 1YJIA 1OQQA 3B2GA 1B9RA 1N5XA 2K22A 1YN4A 5HI1A 1J7CA 1FM0D 3CWIA 2WXRA 4CQNA 3HRDD 1GOZA 2IGDA 2BB5A 3BK2A 1VJKA 1Q10A 3FILA 3RFZB 4PT5A 1DYQA 1C9FA 1GAQB 2YEPF 1NYRA 4IOIE 3V3XA 2ONQA 1FEHA 4RGOS 2WXIA 2DWQA 2JZPA 4ARCA 1WSPA 2NTTA 4XDDA 2K3UA 2E3TA 4O1NA 2PTLA 1N61A 4DXFA 1E10A 3TSSA 3FC4A 4L2YA 1AW7A 2WXJA 3AB5A 1FNWA 1NYQA 4RH6A 3VR9B 2GI9A 3P4QB 4D2KA 1ZP0B 1TY2A 1K53A 2ICIA 1ZDVA 4C80A 3L4PA 1XEEA 4MACA 2MJ3A 5H92C 4KGSA 4P16A 1NENB 4ZRPA 1ROEA 3BVZA 3GP7A 1DOXA 3Q8BA 3SEBA 1VZ6A 3IT6B 2OEDA 4C7YA 5AUIA 1QQRA 4NAMA 5EE3A 5BMHA 3VR8B 4ITKA 2PLPA 3W5VB 1KF6B 2EELA 1XCTL 2KMMA 4ZHPA 2ON8A 3BIID 4L23A 3P42A 2CJOA 1XXGA 3BK1A 2RMMA 1L0VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  3LB8 C;  1IUE A;  3AV8 A;  1FXA A;  4ZHO A;  1ZOY B;  2WDR B;  3ZYY X;  1T3Q A;  1KRH A;  3KWL A;  4ZOH C;  1A70 A;  1L6U A;  2FBW B;  2HTM E;  3AE8 B;  4IDI A;  2JQR B;  3FAH A;  4JWU C;  1N5W A;  3AE1 B;  3AM9 A;  2CU3 A;  2H88 B;  3AEE B;  2PVG C;  1FIQ A;  1TKE A;  2K9X A;  3B2F A;  3DWG C;  1TKY A;  3PO0 A;  1VDV A;  3RPF C;  4US9 A;  1QOB A;  4HRS A;  1FO4 A;  2PKO A;  3HVZ A;  3P1M A;  1UWM A;  2G1E A;  4YSY B;  1DOY A;  1SF0 A;  3NVY A;  1WWT A;  3W5U B;  1JWA D;  1JRO A;  1V97 A;  4YTN B;  5MPO A;  4N6E B;  4YSZ B;  4WQM A;  1QLB B;  2H89 B;  1TYG B;  1PFD A;  2MH7 A;  2KAJ A;  2WLB A;  3P63 A;  3VRA B;  4C7Z A;  3NVV A;  5C2T B;  4A9A A;  3NRZ A;  1PUT A;  1NEK B;  1J7A A;  1WXQ A;  1JQ4 A;  1JRP A;  1TJE A;  2WQY B;  1AYF A;  1F0Z A;  3AE7 B;  3EUB 2;  1FRR A;  2OHF A;  4N58 A;  1YQ3 B;  4LTU A;  2QJL A;  1ZUD 2;  4YTM B;  2L52 A;  2WU2 B;  5C3J B;  1JAL A;  2Q5W D;  3NVZ A;  1OFF A;  1DOI A;  3SR6 A;  2L83 A;  1YJI A;  1OQQ A;  3B2G A;  2W55 A;  3AEC B;  3ETR A;  1N5X A;  1B9R A;  2K22 A;  1ZXI A;  1RFK A;  4P6V F;  1J7C A;  1FM0 D;  1JWB D;  3AEB B;  1J7B A;  3CWI A;  1QOF A;  1QF6 A;  2B76 B;  2W3R A;  4YT0 B;  3HRD D;  1QOG A;  3AMZ A;  3SFD B;  1VJK A;  5AUK A;  1TKG A;  2BS3 B;  5EE9 A;  1VLB A;  1E7P B;  3SFE B;  2M19 A;  1FFU A;  1GAQ B;  3WCQ A;  1XLN A;  1NYR A;  4JWS C;  1L6V A;  3P4S B;  2DWQ A;  3AH7 A;  2WP9 B;  1RM6 C;  1N62 A;  2BT6 A;  2MJE A;  5EE1 A;  3AEF B;  1GPX A;  1YJJ A;  2E3T A;  1WRI A;  2ACZ B;  3AE5 B;  2WU5 B;  3ABV B;  4JX1 C;  1N61 A;  2JX5 A;  1E10 A;  1CZP A;  1DGJ A;  2Y5C A;  3AE9 B;  2WS3 B;  3FC4 A;  1RYJ A;  1PDX A;  3AB5 A;  3CIR B;  1R7S A;  3AED B;  4YSX B;  1NYQ A;  2M56 B;  3AEA B;  3VR9 B;  3AE2 B;  3P4Q B;  5H8Y E;  1RWS A;  1ZP0 B;  3AEG B;  1WYG A;  1QT9 A;  2PVO D;  3AE3 B;  1XLO A;  1L5P A;  1SIJ A;  3B9J A;  4WWM A;  4US8 A;  1AWD A;  1V8C A;  3AE4 B;  1NVI D;  3VRB B;  3LXF A;  4USA A;  1WGK A;  4C80 A;  2W54 A;  3L4P A;  1XLQ A;  3P4R B;  1E9M A;  2MJ3 A;  5H92 C;  1XO3 A;  2PIA A;  3W9C B;  1YQ4 B;  1NEN B;  2BS4 B;  2MJD A;  1QOA A;  4KX6 B;  1FFV A;  2DBY A;  2WDQ B;  1ROE A;  1KFY B;  1N60 A;  2W3S A;  5EE0 A;  2K5P A;  1NI3 A;  3HUI A;  1DOX A;  2QIE B;  1E0Z A;  5G5H A;  4YTP B;  4YXD B;  4C7Y A;  5AUI A;  2CJN A;  2WDV B;  5EE3 A;  5GXG B;  3P4P B;  4HRO A;  1FRD A;  4FXC A;  2AX5 A;  3NVW A;  4ITK A;  1E6E B;  1FXI A;  1KF6 B;  2KMM A;  2N0S B;  3VR8 B;  3W5V B;  4ZHP A;  1EWY C;  1JW9 D;  1N63 A;  1FMA D;  1OQR A;  1XLP A;  1I7H A;  2BS2 B;  2LEK A;  1CJE A;  3BII D;  2CJO A;  3NS1 A;  5G5G A;  3AN1 A;  2EKI A;  4N59 A;  3DWM A;  3AE6 B;  1L0V B; 
#chains in the Genus database with same CATH topology
 2LHE A;  3DQV A;  3GZN I;  4FJZ A;  2GBN A;  2K8B A;  1VCB A;  1P7E A;  2A5U A;  3AEE B;  3RZF A;  3MFG A;  4K7U A;  1M94 A;  2QSD A;  1VDV A;  4HRS A;  3QQ8 B;  4YSY B;  5D7G A;  1R4N I;  2PEA A;  2OJW A;  1C77 A;  3RD2 A;  2MBH A;  2C60 A;  1OEY A;  4BOZ B;  3DBS A;  1FNU A;  1J7A A;  1JRP A;  1UGJ A;  5FKA C;  4A3P A;  1S1Q B;  1I4R A;  1OEY J;  3MTN B;  1D6E C;  3ZXV A;  1P9D U;  1LGR A;  1OGW A;  4FLH A;  1UWX A;  1RFK A;  4GB9 A;  3ZJT A;  3A1Q A;  4K3B A;  4M0W B;  1V6E A;  3R7R A;  4ZDV A;  2GBM A;  2WP9 B;  3UQA A;  1CQV A;  1E7V A;  3W2D A;  1WRI A;  5CTR C;  2IGG A;  3PT2 B;  3AE9 B;  3U4E G;  1PDX A;  2Z8L A;  2C5L C;  2MP2 B;  2M56 B;  1F2R I;  2LUM A;  3H6N A;  5H8Y E;  3UIO B;  5JH5 C;  2KDM A;  3B9J A;  1XLO A;  1WX9 A;  1NVI D;  3P4R B;  1XLQ A;  3TMP B;  2L76 A;  2V4I B;  4IM3 A;  3WAO A;  1OTR B;  2BS4 B;  1FXT B;  3DBL I;  4BKS A;  2J7Q B;  2WDQ B;  3QX1 A;  2R61 A;  1K50 A;  5IP4 D;  1F52 A;  1R4M I;  2DYB A;  1UD7 A;  3DDC B;  1X1M A;  2D3C A;  2KWC A;  1JWM D;  3S2A A;  2LEK A;  3PSE B;  2RGF A;  3A9J A;  4B0M A;  2PW9 A;  3AN1 A;  4TV3 A;  2WXF A;  2LGD A;  5IAA C;  2GBJ A;  3UI3 A;  1T3Q A;  4W9C A;  4REZ A;  1WMH A;  4JWU C;  3Q8F A;  1VZ8 A;  3ZXR A;  4BZA A;  2L3Z A;  4R3D A;  2JPH A;  3PO0 A;  2MBE A;  2N9L A;  3TJP A;  3MHS D;  1YN3 A;  1KJT A;  1V49 A;  2I38 A;  2C7N B;  3CST A;  3I63 C;  4LDT D;  1TYG B;  3NRZ A;  3ZLZ A;  2DYO A;  3ZRF A;  3QJZ A;  1C1Y B;  2R2O A;  3BVG A;  2QJL A;  4S0R A;  4FUL A;  3Q69 A;  1YMH E;  1MFW A;  3OJ4 B;  1I35 A;  1GG3 A;  1F77 A;  4P6V F;  3DPD A;  4HLE A;  2L0T A;  2FID A;  2B76 B;  2DAF A;  3EEC A;  2GMI C;  5EE9 A;  5CX3 A;  2KWD A;  2ZPY A;  1EU4 A;  3PRZ A;  2MX2 A;  1RM6 C;  4RF0 A;  4K81 A;  3EC8 A;  1TS3 A;  4MM3 A;  2ACZ B;  2WU5 B;  3RI7 C;  2G45 B;  1HE8 A;  2KFK A;  5AZH A;  4MT5 A;  3AEA B;  1QKZ A;  1RWS A;  2J0J A;  1L5P A;  1WJ6 A;  3VRB B;  1GNU A;  1L2N A;  2JVC A;  1ZDX A;  2Z59 B;  2AL3 A;  2WXG A;  3IBE A;  2W3S A;  4NNJ B;  2RPV A;  5HFY A;  3UIN B;  2XK5 A;  2N7D A;  4HPL B;  4PYZ A;  2NBW B;  4IWQ A;  4EZJ A;  2RDH A;  1I7H A;  5L95 C;  2KDI A;  2J0M A;  4AUQ C;  1EUV B;  1L0Y B;  2DLB A;  4IC7 B;  4NJC A;  2JZZ A;  2V3N A;  3N20 C;  3ZRC A;  4TUU A;  4US9 A;  3N30 A;  2I1K A;  1BT0 A;  5BYQ A;  5TR5 A;  3V05 A;  4CYE A;  1WGR A;  1YQ3 B;  4DBG A;  2LVQ A;  2J4X A;  4KVG B;  3DCG A;  1ZPS A;  3SR6 A;  2I1J A;  2WXM A;  4HDO A;  1D5Z C;  1QOF A;  1HXY D;  3MC0 B;  3AMZ A;  3PZ7 A;  3KUZ A;  4MH0 E;  1WGH A;  1IPG A;  2Z0D B;  4E74 A;  5EE1 A;  3KUC B;  2HDE A;  2MEK A;  4M00 A;  1UBQ A;  2JU6 X;  3CIR B;  1ISN A;  1ZE3 D;  1V5O A;  4PS8 A;  4USA A;  5LXI B;  4GU2 A;  4GGQ A;  2PMV A;  3Q2A C;  4WH4 A;  1RAX A;  1T0Q C;  1I42 A;  1QIL A;  2M4N A;  2AWT A;  3C0R B;  3RUI B;  1N60 A;  2K5P A;  2QIE B;  4EE2 A;  3GOE A;  4YTP B;  4L1B A;  3VUW A;  5I4D A;  1HEZ E;  1FRD A;  2GRI A;  5LNK 1;  2AX5 A;  1WGG A;  1XLP A;  4A6Q A;  2LWP A;  3NS1 A;  3T9L A;  1T0Y A;  2KQS A;  4GDK B;  4EUT A;  4XWW A;  2O6V D;  1TZ1 A;  2K0P A;  2WXO A;  3V61 A;  3U8Z A;  2D3B A;  4JE3 B;  2Y5B B;  4AWJ A;  2EMS A;  4DDI D;  4AP4 C;  1UWM A;  2LAS A;  4KDI C;  4DXA B;  1B1Z A;  4JLC A;  2KC1 A;  4M8N A;  2WX0 A;  3URY A;  2LUE A;  1TS5 A;  2KWV B;  2KN4 A;  3HHM A;  4DDG D;  3RNA C;  4II2 B;  4XWT A;  1Q0W B;  4KDL B;  4M0W A;  3RZW C;  3PRE A;  1L0X B;  2KNB A;  5BMG A;  4ICV A;  4IW0 A;  2KHW B;  2K22 A;  1WGD A;  4W9E A;  2ZCC A;  3EHV A;  1GOZ A;  3T8M A;  2BB5 A;  1D3Z A;  1SE9 A;  2MCN B;  4IG7 B;  2D07 B;  2FCN A;  5IOI A;  2YEP F;  2ONQ A;  1FEH A;  2WXI A;  2KX0 A;  1TT5 B;  4ARC A;  1WSP A;  2MP2 A;  4XDD A;  2VH1 A;  4O1N A;  3BIN A;  1N61 A;  4ANV A;  4W9H A;  3FC4 A;  4L2Y A;  3AB5 A;  3FKY A;  2ICI A;  1XEE A;  4M01 A;  4MAC A;  3RUL A;  2ZJD A;  2O6V B;  1WR1 A;  1WXS A;  1VZ6 A;  2ZEQ A;  1V9J A;  4BVU C;  4W9D A;  5AUI A;  4K7W A;  3W5V B;  4BBN C;  2KMM A;  5KHQ A;  3BII D;  2MRP A;  3PHW B;  1ZOY B;  2WDR B;  2BVC A;  2BGF A;  1BXT A;  3A4R A;  3MP9 A;  2CHX A;  3J9C A;  1MG8 A;  2JQR B;  2UYZ B;  5AEK B;  2KDF B;  2D3G A;  3B2F A;  3VVW B;  2DAJ A;  2L00 B;  4J3O D;  1C4C A;  4F7Z A;  4AQ7 A;  1HQR D;  1F9J A;  2ZPN A;  2MHJ A;  4IM2 A;  3U2S C;  4W9G A;  4HPP A;  3MC9 A;  2IZV B;  1WI0 A;  3ZW3 A;  1HZ6 A;  2VH2 A;  2OHF A;  2IO1 B;  3AUL A;  3I5J C;  3X0W A;  1ZGU B;  3L08 A;  3RCZ A;  2WU2 B;  1N6Z A;  3VXW A;  4DXG A;  1JAL A;  4OW0 A;  4ZRK A;  3R2I A;  4KZ0 A;  1U4A A;  1ZXI A;  5FR6 A;  3AEB B;  2W3R A;  1C3T A;  2XN9 C;  3Q6B A;  3GE3 C;  4A55 A;  1GUA B;  2M19 A;  1FFU A;  2JRI B;  2L8J A;  1L6V A;  4WJQ A;  4WIP A;  3W1Y A;  2VZK B;  5HHD G;  3W1S C;  2NPT B;  2BKR B;  2PJH A;  3KVF B;  1GC7 A;  2FUH B;  4B95 A;  3APD A;  2Y3A A;  2RR9 A;  3WAN A;  2LGY A;  1I4P A;  1VZ7 A;  2L1A A;  3GB1 A;  4B9K A;  1AWD A;  3VTU A;  1STE A;  4MJS B;  2FCQ A;  2KMC A;  3JSV B;  1C76 A;  1KLG D;  4GSW A;  2HE7 A;  2KTF A;  3KWV A;  3M62 B;  4S17 A;  3ONS A;  2IPK D;  1NI3 A;  2C9W B;  2XEW A;  1RLF A;  4G11 A;  1PQS A;  2X8X X;  4HRO A;  1KTK A;  1Z5S B;  3N9Y C;  1V1O A;  4DHZ E;  1FMA D;  1UBI A;  1WR6 E;  3ENE A;  4W9K A;  2JWU A;  4N59 A;  3AE6 B;  1C4A A;  2KK8 A;  3HVD A;  1IBX A;  4IDI A;  4WUR A;  2V1Y A;  4FJV B;  3ZIM A;  2BW2 A;  1ET6 A;  1V2Y A;  4ZRI A;  2IYD B;  4WQM A;  2MH7 A;  4WJN A;  4WJP A;  4XZ4 A;  1WRD B;  5J17 A;  3KW5 B;  1JQ4 A;  3C8Y A;  5LLI A;  2N9P C;  2KKC A;  4JPS A;  2JT4 B;  3N1X C;  2Q5W D;  1I4X A;  1KOT A;  4UDU C;  1V1P B;  1WJU A;  3ETR A;  5DPS A;  4XDC A;  1J7B A;  2KVZ A;  3NHE B;  2IO2 B;  3ZTD A;  2DYM A;  2KDB A;  1VLB A;  2IY0 B;  3T3O A;  1AAR A;  2J52 A;  4JWS C;  2WWZ A;  2JX5 A;  2KJH B;  4IM0 A;  2G9H D;  3JW0 X;  4ACF A;  1MPE A;  4W9J A;  2JXT A;  5E6P A;  3P1M A;  1WYG A;  4PS3 A;  3VTW A;  2O2V B;  3LJ3 A;  1I4G A;  1ZXH A;  4CHK A;  1YQ4 B;  4QAY A;  2MJD A;  2MQJ A;  3HUI A;  2WYQ A;  3DBH B;  1SE3 A;  2WDV B;  4Q2J A;  1KH0 A;  3VFK A;  1EWY C;  2YEP B;  2LGI A;  5TSS A;  3LB8 C;  3AV8 A;  2IDY A;  4W9I A;  4RGT A;  3U7D A;  3OLM D;  3FAH A;  4TKN A;  3Q3M C;  1YX5 B;  1G6J A;  3IVF A;  3RPF C;  2FIF A;  2PKO A;  4KZC A;  2XBB C;  4JQW C;  3VTV A;  1V97 A;  3MJ5 A;  3IAM 1;  3H7P A;  4YSZ B;  2WLB A;  1VR9 A;  2KAJ A;  3QC8 B;  1JCK B;  4MGI E;  4DK5 A;  3ZQ4 A;  2FNJ B;  4GDL B;  2J42 A;  4RFB A;  2ZVO A;  3Q8E A;  3VUY A;  4KV2 A;  3B1L X;  3L54 A;  2UWQ A;  4LNO A;  3DHG C;  1ZKH A;  2INC C;  1SBB B;  3EA6 A;  2W55 A;  2WNM A;  1JWB D;  2WXH A;  2MBQ A;  3N32 A;  5FR3 A;  1TBE A;  4FJY A;  1QOG A;  1YNT E;  3T3N A;  5AUK A;  4RNA A;  2SEB D;  1SSN A;  3WCQ A;  2KYW A;  2GBR A;  4WWN A;  1PGB A;  3IAS 1;  1YJJ A;  5DPW A;  1OQY A;  4GXB A;  1CZP A;  1DGJ A;  2AQ2 B;  1M4V A;  3V6E B;  3PGE A;  2BWF A;  4KIK B;  2BPS A;  1C79 A;  1P7F A;  2BQQ A;  2R2Q A;  2O6V A;  1V86 A;  4LJO B;  1E9M A;  3QIJ A;  4OZC A;  2PIA A;  2MWS B;  3DBR I;  3A9K A;  4KKJ A;  4DHZ B;  1SXT A;  3QA8 A;  3KQ4 A;  1UNS A;  2QC8 A;  3NVW A;  3KH0 A;  2KWU B;  1TS2 A;  3BWU D;  2BS2 B;  2FAZ A;  5JHB A;  4LLG M;  4N9F 4;  5G55 A;  1WE7 A;  3GZN B;  1E7U A;  4C4V A;  3RNB C;  2HD5 B;  2ZVN A;  2A4Z A;  1JWU D;  1H8C A;  2BWE S;  1FIQ A;  4MSM B;  3DWG C;  2NBU A;  3TEX A;  3HVZ A;  2CR5 A;  1R4N B;  4IWP A;  4K7S A;  2G3Q B;  2KZR A;  3P63 A;  3IG3 A;  4NAW B;  4ICU A;  1TJE A;  2AEH A;  2LXC A;  4M8M A;  1F0Z A;  3Q8A A;  2RDB C;  1WJN A;  4HJG E;  1MG4 A;  2L52 A;  1WM3 A;  2DX5 B;  3B2G A;  1OQQ A;  4NJ6 A;  1N5X A;  1P1A A;  2UU7 A;  2BYV E;  2LRW A;  4CQN A;  2NPT A;  1VJK A;  1Q10 A;  1C9F A;  3HM3 A;  3PRP B;  4RGO S;  4BBN F;  2JZP A;  4FN2 A;  2E3T A;  2MW5 A;  4MJS A;  2J0K A;  4P1C C;  4NJ7 A;  1FNW A;  1P98 A;  2NR2 A;  3VR9 B;  2GI9 A;  3P4Q B;  1NI2 A;  3UF8 A;  4D2K A;  1ZP0 B;  3SHQ A;  1K53 A;  3LDZ E;  4C80 A;  3L4P A;  1WF9 A;  2V3S A;  1E8W A;  4KGS A;  4P16 A;  1SIF A;  4ZRP A;  4K3C A;  3DBL B;  3I3T B;  1ROE A;  4FBJ B;  3NZU A;  1DOX A;  2NBV B;  3Q8B A;  5D2M B;  1R4M B;  4NAM A;  3ZUN A;  2EMT A;  1HTQ A;  4HVB A;  2PLP A;  1KF6 B;  2B3A A;  3PS6 A;  4ZHP A;  4EZK A;  2CJO A;  3KYD D;  2GBK A;  4AJY B;  2RMM A;  1FO4 A;  2KX3 A;  3UGB B;  3W1S A;  3AM9 A;  1TKE A;  4KSK C;  2BBC A;  2QDF A;  1UGM A;  1IP9 A;  2WXL A;  1E8X A;  5IKC M;  1JWA D;  4GOC A;  4HJK A;  2QEJ C;  3BZD B;  4HEA 1;  2YVC A;  3IHP C;  3B0A A;  4HKQ A;  3GE8 C;  1K8R B;  1WXQ A;  3A1Q B;  1HZ5 A;  1PGX A;  1FPY A;  3ZGZ A;  3SDL C;  3Q3O C;  2DHZ A;  2BYF A;  3ZKJ C;  1TS4 A;  3AEC B;  2LI5 A;  4OVU A;  2NVU I;  2CS4 A;  3VDZ A;  3ZO5 B;  2CHW A;  1TKG A;  3NY5 A;  3TCA A;  1EF1 A;  3AI5 A;  1YQB A;  3P4S B;  5D3D A;  5FK9 C;  3PLV A;  4I6P A;  2OJR A;  3VH3 B;  4IKG A;  1A5R A;  1E5W A;  2O2V A;  4HXD A;  3ZDT A;  1UEL A;  2KQ4 X;  4OHJ A;  4W9F A;  3AEG B;  1Q1O A;  1QT9 A;  3Q8C A;  4FAD A;  4US8 A;  2DEN B;  2KDE B;  4HCN B;  2AL6 A;  2DZJ A;  3H1U A;  1WGK A;  2JYE A;  4MGZ E;  2NS5 A;  1JWS D;  5E6J A;  3W9C B;  4HPM B;  3A9J B;  4A20 A;  1QOA A;  3PRM B;  4KGR A;  2KAC A;  1K52 A;  2LFI A;  3HIZ A;  3V6C B;  1IYF A;  4YXD B;  1WMH B;  1BUI C;  2N0S B;  2WXK A;  2V4L A;  2KQ7 A;  2RSU A;  1CJE A;  3IFW B;  5IN7 A;  4J6I A;  3Q14 C;  2ZW0 A;  1IUE A;  2VZK D;  1TIF A;  2J53 A;  3DHI C;  3B08 A;  1SJH D;  3RN9 C;  3I57 A;  3WAM A;  3L13 A;  2K9X A;  3VH4 B;  1AN8 A;  1SF0 A;  1WWT A;  2N9X A;  3ZTC A;  5MPO A;  1D4B A;  4RM8 A;  4XYC A;  1EO6 A;  2BB6 A;  3AU4 A;  4LK0 M;  4JIO U;  4A9A A;  3RMK C;  2LGS A;  2CHZ A;  4OVZ A;  2KLG A;  1V80 A;  3EUB 2;  1V5T A;  4LNK A;  3KUD B;  4MM3 B;  2EKE C;  2KFK B;  3X23 A;  5E6O A;  1EM7 A;  5CHW A;  4NY0 A;  1WFY A;  5BYS A;  2REX A;  1L4Z B;  2M0A A;  2PPH A;  4KIK A;  2MBB B;  2N1W A;  3APF A;  2INP E;  1EWC A;  2Z0E B;  3DBH I;  4DWF A;  1R7S A;  3AE2 B;  2JXX A;  4MGY E;  1EU3 A;  2XK5 B;  4TSS A;  3LXF A;  2LJI A;  3WA0 A;  3RNC C;  3A33 B;  4RGM A;  3OAW A;  2XNA C;  3MHZ A;  3P4P B;  1TTN A;  3KLS X;  3M3J A;  5EDS A;  2LMC A;  4I6L B;  2GLS A;  2EKI A;  3GS2 A;  3AU5 A;  2LVP A;  2KFJ A;  2V3P A;  3KWL A;  1E8Z A;  3DVG Y;  4ANW A;  1BML C;  4G3X B;  1WZ0 A;  4WAF A;  3PPA A;  2NCN A;  5AZF A;  1EF5 A;  4HKZ E;  1SGH A;  2WGS A;  4WWO A;  1QOB A;  1XT9 B;  3PV1 A;  4MH8 A;  5E6N A;  1Q5W B;  4AS1 A;  2LGX A;  2H89 B;  2WX1 A;  1ENF A;  3IXS A;  2D2Q A;  2JRH A;  2FE8 A;  4XE0 A;  3H7S A;  3O65 B;  1ET9 A;  3AE7 B;  1FRR A;  3DHH C;  4LTU A;  1IGC A;  1ZUD 2;  4FHK A;  3APC A;  2KTR B;  1PGA A;  2JY6 A;  3RYT A;  2L83 A;  3D32 A;  4C56 C;  2AYO B;  3SD5 A;  2D10 A;  3E9S A;  4YT0 B;  4KKI A;  1WGY A;  2N9K A;  3K9P B;  4BKT A;  3IT4 B;  1XLN A;  2NTS A;  3AH7 A;  2FUG 1;  2M1M A;  2KC2 A;  3QK0 A;  2LVO A;  1T5X D;  3NZS A;  4XX5 A;  2Y5C A;  3VHT C;  1J19 A;  1D5X C;  2CU1 A;  3AED B;  4YSX B;  4A3O A;  3AE3 B;  4WWM A;  4RMA A;  2N7E A;  3VUX A;  2N7J A;  4AJW A;  2MLB A;  4AOF A;  2W54 A;  2RDG A;  1Z2M A;  2C7H A;  2ZCB A;  4KX6 B;  1XCQ L;  3Q3N C;  1F1H A;  1HA5 A;  3N1Z C;  4B6W A;  3ECI A;  1J8C A;  4EFO A;  2M0X A;  2CJN A;  1SJE D;  1GB4 A;  2KJ6 A;  5T8I A;  3DOW A;  2WXQ A;  1WH3 A;  1FXA A;  4PS7 A;  4ZOH C;  5CHF A;  2CU3 A;  4EEW A;  3NG0 A;  2KOX A;  3PZ8 A;  4GDK A;  1DOY A;  1LXD A;  2KMA A;  3NVY A;  4FHJ A;  1MJD A;  1PFD A;  1KLV A;  5C2T B;  2WHI A;  3UIP B;  1MHX A;  2D11 A;  4NPN A;  3MJW A;  3WIM A;  4DQO C;  2BKF A;  3TBL D;  5C3J B;  3NVZ A;  1YJI A;  3AXC A;  1J7C A;  3ZNZ B;  2WXR A;  4E71 A;  2W9N A;  2K1F A;  3BK2 A;  5AZG A;  4HDQ A;  4PT5 A;  1GAQ B;  5DPT A;  3V3X A;  4JGH B;  4G0N B;  2PTL A;  4DXF A;  4BFR A;  2WXJ A;  3V62 A;  2HJ8 A;  4FA6 A;  1TY2 A;  1ZDV A;  1GJZ A;  1YX6 B;  5H92 C;  3R3M A;  2M17 A;  3BVZ A;  2DZK A;  3IT6 B;  1WXV A;  4W9L A;  4LNF A;  2OED A;  1XQQ A;  2MA9 B;  2D3A A;  1XCT L;  2KO3 A;  2DNF A;  3ZYY X;  4JL9 A;  4MEL A;  4X57 B;  1WXA A;  2WDT B;  2IND C;  2KXJ A;  1N5W A;  2N4F A;  3AE1 B;  3RT3 B;  2LZ6 A;  3C19 A;  2H88 B;  1YD8 U;  2L32 A;  2NMQ A;  3BYY B;  1C78 A;  1WIA A;  5G2N A;  3W5U B;  2RPQ A;  3K9O B;  4PYU A;  1P0R A;  4N6E B;  3Q3F A;  1L7Y A;  3NVV A;  5D6J B;  4YWG G;  1KLU D;  4YTM B;  4OZB A;  3ZNG C;  1F2R C;  1KM7 A;  4NQL B;  1OFF A;  1DOI A;  4MDK E;  2LD9 A;  1WZ3 A;  1QF6 A;  3U30 A;  4TQ1 A;  5JHA A;  3RNF C;  3QAR A;  4LJP B;  1TGZ B;  2BT6 A;  3BYT B;  2W82 A;  1FD6 A;  2GB1 A;  3DVN U;  4ARI A;  2K25 A;  3FIL B;  3AE5 B;  3ABV B;  1TZO A;  1LO5 D;  1L4D B;  2MSE D;  1V8C A;  3AE4 B;  2JYT A;  4LDT B;  4IWO A;  1XO3 A;  1I4Q A;  3PLU A;  3EFC A;  5IO9 A;  3M63 B;  1IGD A;  1FFV A;  3ZNI D;  3TEW A;  1LFD A;  4OVV A;  2G4S A;  5EE0 A;  2V9H A;  4BKG A;  4LNI A;  5HKH A;  3U52 E;  4LCD E;  1IBX B;  1T6B X;  4XGA B;  1GB1 A;  3JSV A;  5JXV A;  4M02 A;  3I9V 1;  1E8Y A;  2JZ3 B;  1I4H A;  3L16 A;  1SB3 C;  3VAW A;  4ZHO A;  2BYE A;  1A70 A;  5DPR A;  3R7Q A;  1SE2 A;  3Q3J A;  4DHJ D;  3H9D A;  4F8C B;  4RGN A;  4HWI B;  2PVG C;  4BKS D;  2KJR A;  2D5G A;  1FCC C;  4K1R B;  1K51 A;  5C1Z A;  2IO3 B;  2SAK A;  2G1E A;  2RD0 A;  4GIV A;  2ZW1 A;  4YTN B;  4G50 A;  4HK2 A;  3LYY A;  2AQ3 B;  1Y56 A;  4ANX A;  5BO4 B;  2KTR A;  5KHO A;  1NEK B;  2ZNV C;  3NS8 A;  4HCP B;  3MC8 A;  2JSV X;  2PE6 B;  3NZ3 A;  4ZYS A;  4URK A;  2IY1 B;  4H2A A;  1NBF C;  1VRA B;  2BS3 B;  4MGK E;  4ZRQ A;  1FCL A;  5GMV A;  2QMT A;  2L05 A;  1NDD A;  3EFU A;  4RF1 A;  2IBI B;  1JML A;  4WWP A;  2LXA A;  3DVG X;  3KYC D;  3ZJV A;  1V1P A;  3TEY A;  2MJE A;  1VD2 A;  3AEF B;  1YOV B;  4MEM A;  4KGT A;  1WYW B;  2PE9 A;  2QIL A;  1RRB A;  2FCM A;  3EGR A;  1RYJ A;  2KAN A;  2M8S A;  3PHX B;  1UF0 A;  1SIJ A;  4P7I A;  3UQB A;  2K8C A;  3P2B A;  4IUM B;  1V81 A;  5J18 A;  2I2Y A;  4A90 A;  3DBR B;  3SU8 X;  2IO0 B;  3CF6 E;  3BVM A;  3PVL A;  1KFY B;  3HM6 X;  1XD3 B;  3HK0 A;  2Y5P A;  3O13 A;  4BAX A;  5G5H A;  2ZNV B;  4DHJ B;  1E90 A;  1RFA A;  3TEZ A;  1YIW A;  5GXG B;  1J0G A;  1PYW D;  2LHD A;  3NUH B;  1E6E B;  1FXI A;  1D5M C;  2N1V A;  2WXP A;  4WQO B;  1JW9 D;  1C4P A;  2X38 A;  3QAQ A;  3ZDM C;  1TY0 A;  2YLM A;  5BYR A;  1KRH A;  3U7Z A;  3AE8 B;  4TQ0 A;  2MBO A;  4OZA A;  1LQB A;  1WJ4 A;  3H7P B;  3ML8 A;  3TUO A;  1WX7 A;  5C23 A;  1T0S C;  3V60 A;  4B0E A;  2IGH A;  1WE6 A;  2BYT A;  1SEB D;  5DCN A;  4A8X C;  1UH6 A;  2INN E;  3JVZ X;  1JRO A;  2TSS A;  1LM8 B;  1QLB B;  4GMV A;  5D94 A;  4F1S A;  2AQ1 B;  2WQY B;  5J2R A;  2KD0 A;  1T0R C;  1WY8 A;  4NZL B;  3NOB A;  3RNE C;  2JF5 A;  3CSF A;  4GDL A;  2JUO A;  3QWZ B;  2BTE A;  3DVN V;  4TMA B;  5IA7 A;  2KT7 A;  3ML9 A;  3SFD B;  2DZI A;  3PTF C;  1QZE A;  2OOB B;  1E7P B;  2LRU A;  3SFE B;  4BOS C;  1ZW7 A;  2LJ5 A;  2HJ1 A;  3M95 A;  1N62 A;  2IJ0 A;  3E56 A;  1GPX A;  2KLC A;  4JX1 C;  1HTO A;  1ACC A;  1S3S G;  3L17 A;  2C7M B;  4NQK E;  1MHH E;  2WS3 B;  3A9K B;  1SE4 A;  4YL8 A;  4EKU A;  2WXN A;  2PVO D;  3L0W B;  3ZJU A;  3ZNH B;  4EZL A;  3WAP A;  2E6X A;  1GC6 A;  4XC2 A;  4P1B C;  4GN1 A;  1UZX B;  2CKH B;  2VRR B;  3H8H A;  3NJT A;  1ESF A;  2DBY A;  1MI0 A;  3JYU A;  4PK1 A;  1E0Z A;  1YJ1 A;  3VQI A;  5D3I B;  4C4V B;  4FXC A;  1YN5 A;  4ZRJ A;  1N63 A;  1OQR A;  3OWE B;  1H4R A;  4ANU A;  4C00 A;  5G5G A;  1FNV A;  3R8B A;  3DWM A;  2KN5 A;  1JRU A;  4ZYN A;  4RCO A;  3R2T A;  1L6U A;  2FBW B;  2HTM E;  4KSL C;  4GLS C;  4RM9 A;  1WM2 A;  1WXM A;  2K6Q A;  3BY4 B;  1CK1 A;  2QCZ A;  1CMX B;  2G4D B;  1TKY A;  4WAA A;  2HTH A;  2QHO A;  2BF8 B;  3WAL A;  2K6D B;  1UUP A;  2FCS A;  3PZD A;  3ALB A;  4LNN A;  5LXH A;  3VRA B;  4C7Z A;  3ZVV A;  3L10 B;  4I6N B;  2L0F A;  5BMI A;  1PUT A;  1MVK A;  3OJ3 A;  5HG2 A;  1XF5 L;  1AYF A;  2L7R A;  4N58 A;  3N1Y C;  2V0G A;  2GOW A;  3A4S C;  1B9R A;  1P3Q U;  3QCA A;  2ZZP B;  4CO7 A;  2K39 A;  2K8H A;  4NAW A;  1YN4 A;  5HI1 A;  3TL5 A;  1FM0 D;  3TIX A;  3CWI A;  3R66 C;  3HRD D;  2IGD A;  3FIL A;  3QHT A;  2ASQ A;  3RFZ B;  1DYQ A;  1NYR A;  4IOI E;  1WX8 A;  2DWQ A;  2NTT A;  2K3U A;  4EOY A;  1E10 A;  3TSS A;  1AW7 A;  3OG5 A;  4II3 B;  4WJO A;  3RNG C;  1NYQ A;  4RH6 A;  5CHV C;  2JWZ A;  4MSQ B;  5JZE B;  1Y8R C;  2MJ3 A;  5L83 A;  1NEN B;  2N9E B;  3GP7 A;  3SEB A;  3N3K B;  4ASW C;  4C7Y A;  1QQR A;  5EE3 A;  4E3C A;  2DZM A;  5BMH A;  3VR8 B;  4ITK A;  2EEL A;  2ON8 A;  4L23 A;  3P42 A;  1XXG A;  3CMM B;  3BK1 A;  2KVR A;  1L0V B; 
#chains in the Genus database with same CATH homology
 2LHE A;  1ZOY B;  2WDR B;  3ZYY X;  1BXT A;  3MP9 A;  3W1S A;  3J9C A;  2JQR B;  1N5W A;  1P7E A;  3AE1 B;  3AM9 A;  2H88 B;  2L32 A;  2NMQ A;  3AEE B;  1TKE A;  3B2F A;  3MFG A;  2BBC A;  2QSD A;  1VDV A;  2WXL A;  3BYY B;  4J3O D;  4HRS A;  1C4C A;  4AQ7 A;  1HQR D;  1C78 A;  4YSY B;  5D7G A;  3W5U B;  1JWA D;  4N6E B;  1C77 A;  2QEJ C;  3BZD B;  3U2S C;  4HEA 1;  3NVV A;  1FNU A;  1HZ6 A;  4YWG G;  4HKQ A;  1J7A A;  1WXQ A;  1JRP A;  1HZ5 A;  1KLU D;  1UGJ A;  2OHF A;  1PGX A;  5FKA C;  3ZGZ A;  1I4R A;  4YTM B;  4OZB A;  2WU2 B;  1D6E C;  1F2R C;  4DXG A;  1JAL A;  4OW0 A;  1OFF A;  1DOI A;  1TS4 A;  3AEC B;  1UWX A;  3R2I A;  1ZXI A;  1RFK A;  3AEB B;  3ZJT A;  1QF6 A;  2W3R A;  2XN9 C;  4A55 A;  1TKG A;  4TQ1 A;  2M19 A;  1FFU A;  1L6V A;  3P4S B;  5D3D A;  5FK9 C;  2WP9 B;  2BT6 A;  3BYT B;  2W82 A;  2VZK B;  4WIP A;  4IKG A;  1CQV A;  5HHD G;  2GB1 A;  3W2D A;  1FD6 A;  4ARI A;  3FIL B;  1WRI A;  3AE5 B;  3ABV B;  2IGG A;  1TZO A;  2KQ4 X;  1LO5 D;  3AE9 B;  3U4E G;  1PDX A;  2Z8L A;  1L4D B;  4OHJ A;  2Y3A A;  2M56 B;  1F2R I;  2LUM A;  5H8Y E;  1I4P A;  3AEG B;  2KDM A;  1QT9 A;  3B9J A;  3Q8C A;  1XLO A;  4US8 A;  1VZ7 A;  2L1A A;  3GB1 A;  1AWD A;  1V8C A;  3AE4 B;  1NVI D;  1STE A;  2JYT A;  1WGK A;  2JYE A;  3P4R B;  1XLQ A;  2V4I B;  1XO3 A;  1I4Q A;  1C76 A;  1JWS D;  1KLG D;  5E6J A;  2BS4 B;  3W9C B;  1IGD A;  3KWV A;  1QOA A;  4KGR A;  1FFV A;  3TEW A;  2WDQ B;  2KAC A;  2IPK D;  5EE0 A;  1K52 A;  1NI3 A;  2LFI A;  4YXD B;  2R61 A;  3U52 E;  1K50 A;  1IBX B;  1T6B X;  1BUI C;  4HRO A;  1KTK A;  1GB1 A;  3N9Y C;  2N0S B;  2WXK A;  1V1O A;  1JWM D;  2LEK A;  1FMA D;  1CJE A;  4B0M A;  5JXV A;  3I9V 1;  2PW9 A;  3AN1 A;  2WXF A;  2JWU A;  1I4H A;  4N59 A;  2ZW0 A;  1C4A A;  3AE6 B;  3HVD A;  1SB3 C;  1IUE A;  4ZHO A;  3UI3 A;  1T3Q A;  2VZK D;  1IBX A;  4REZ A;  1A70 A;  4IDI A;  2J53 A;  4JWU C;  1SE2 A;  3Q8F A;  1SJH D;  4WUR A;  1VZ8 A;  4RGN A;  3I57 A;  2PVG C;  2K9X A;  4R3D A;  2D5G A;  2BW2 A;  3PO0 A;  1ET6 A;  1FCC C;  2N9L A;  1K51 A;  1YN3 A;  2SAK A;  1AN8 A;  2G1E A;  1SF0 A;  2I38 A;  1WWT A;  2ZW1 A;  4YTN B;  5MPO A;  1D4B A;  4WQM A;  3LYY A;  1TYG B;  2MH7 A;  2AQ3 B;  1Y56 A;  2BB6 A;  4LK0 M;  4A9A A;  3NRZ A;  2DYO A;  1NEK B;  4OVZ A;  1JQ4 A;  3C8Y A;  3EUB 2;  3BVG A;  4JPS A;  2QJL A;  3Q69 A;  1YMH E;  2JSV X;  2Q5W D;  1I4X A;  4UDU C;  1V1P B;  3NZ3 A;  3ETR A;  4ZYS A;  1F77 A;  4MM3 B;  4P6V F;  4XDC A;  1J7B A;  4H2A A;  2B76 B;  1VRA B;  2DYM A;  2BS3 B;  5EE9 A;  1VLB A;  4ZRQ A;  2KWD A;  1EM7 A;  3T3O A;  1FCL A;  2J52 A;  2QMT A;  5BYS A;  4RF1 A;  1JML A;  4JWS C;  1EU4 A;  1L4Z B;  3ZJV A;  2M0A A;  1V1P A;  1RM6 C;  3TEY A;  2MJE A;  4RF0 A;  3AEF B;  1TS3 A;  4KGT A;  2ACZ B;  2WU5 B;  2JX5 A;  2INP E;  1EWC A;  2G9H D;  2QIL A;  3EGR A;  1RYJ A;  1R7S A;  1MPE A;  2JXT A;  4MT5 A;  3AEA B;  3AE2 B;  1QKZ A;  1RWS A;  3P1M A;  1WYG A;  1L5P A;  1EU3 A;  1SIJ A;  4TSS A;  3VRB B;  1I4G A;  3LXF A;  1ZXH A;  2LJI A;  2I2Y A;  1ZDX A;  4A90 A;  1YQ4 B;  2WXG A;  2MJD A;  3BVM A;  1KFY B;  2W3S A;  2RPV A;  3HUI A;  2Y5P A;  3O13 A;  4RGM A;  5G5H A;  5HFY A;  4Q2J A;  1SE3 A;  2WDV B;  2XNA C;  3TEZ A;  3MHZ A;  3P4P B;  5GXG B;  1KH0 A;  1PYW D;  2LHD A;  3NUH B;  1E6E B;  1FXI A;  1D5M C;  2RDH A;  3KLS X;  2WXP A;  1EWY C;  1JW9 D;  2YEP B;  1I7H A;  1C4P A;  2LMC A;  2LGI A;  2EKI A;  2X38 A;  5TSS A;  3GS2 A;  1TY0 A;  3LB8 C;  3AV8 A;  5BYR A;  2IDY A;  1KRH A;  3U7Z A;  2V3P A;  3KWL A;  4RGT A;  1L0Y B;  3AE8 B;  4TQ0 A;  2DLB A;  4OZA A;  3FAH A;  3TUO A;  4B0E A;  2IGH A;  1BML C;  4NJC A;  4WAF A;  2V3N A;  2BYT A;  1SEB D;  4HKZ E;  4A8X C;  3RPF C;  4US9 A;  1QOB A;  4MH8 A;  1FO4 A;  2PKO A;  2INN E;  4AS1 A;  1JRO A;  1V97 A;  2TSS A;  3MJ5 A;  3IAM 1;  5BYQ A;  4YSZ B;  1QLB B;  2H89 B;  2WLB A;  1VR9 A;  2KAJ A;  1ENF A;  3IXS A;  1JCK B;  2AQ1 B;  3ZQ4 A;  4GDL B;  2FE8 A;  4XE0 A;  3V05 A;  2J42 A;  2WQY B;  4RFB A;  1ET9 A;  3AE7 B;  3Q8E A;  1FRR A;  1YQ3 B;  4LTU A;  1IGC A;  2J4X A;  1ZUD 2;  4NZL B;  1PGA A;  1SBB B;  1ZPS A;  3EA6 A;  3SR6 A;  2L83 A;  2W55 A;  4C56 C;  2WNM A;  2WXM A;  1JWB D;  2WXH A;  3E9S A;  1D5Z C;  1QOF A;  1HXY D;  3MC0 B;  5FR3 A;  4TMA B;  2BTE A;  4YT0 B;  1QOG A;  3AMZ A;  3PZ7 A;  4KKI A;  1YNT E;  3SFD B;  2N9K A;  3T3N A;  5AUK A;  3IT4 B;  4RNA A;  1E7P B;  2SEB D;  3SFE B;  1SSN A;  1XLN A;  3WCQ A;  2NTS A;  1PGB A;  3AH7 A;  1N62 A;  5EE1 A;  2FUG 1;  2IJ0 A;  3E56 A;  1GPX A;  3IAS 1;  1YJJ A;  2HDE A;  4JX1 C;  1T5X D;  2MEK A;  1ACC A;  1CZP A;  1DGJ A;  2Y5C A;  2AQ2 B;  1MHH E;  1M4V A;  2JU6 X;  2WS3 B;  1D5X C;  3CIR B;  3AED B;  4YSX B;  1SE4 A;  1ZE3 D;  1C79 A;  1P7F A;  2WXN A;  2PVO D;  3AE3 B;  3ZJU A;  4WWM A;  2N7J A;  2E6X A;  4USA A;  2W54 A;  1E9M A;  2RDG A;  4OZC A;  2PIA A;  2PMV A;  4WH4 A;  3H8H A;  1QIL A;  1ESF A;  4KX6 B;  4KKJ A;  2DBY A;  1SXT A;  1XCQ L;  1N60 A;  2K5P A;  1MI0 A;  1HA5 A;  2QIE B;  3KQ4 A;  4EE2 A;  1E0Z A;  4YTP B;  1UNS A;  4L1B A;  3VQI A;  5D3I B;  2CJN A;  5I4D A;  1HEZ E;  1FRD A;  1SJE D;  2GRI A;  2AX5 A;  3NVW A;  4FXC A;  1YN5 A;  5LNK 1;  1GB4 A;  1TS2 A;  1N63 A;  1OQR A;  3BWU D;  5T8I A;  1XLP A;  2BS2 B;  4A6Q A;  3OWE B;  3NS1 A;  2WXQ A;  4LLG M;  5G5G A;  1FNV A;  3R8B A;  3DWM A;  4GDK B;  1FXA A;  4XWW A;  4RCO A;  3R2T A;  1L6U A;  2FBW B;  2HTM E;  4ZOH C;  4GLS C;  2K0P A;  2WXO A;  1JWU D;  4JE3 B;  2CU3 A;  1FIQ A;  1CK1 A;  3DWG C;  1TKY A;  3PZ8 A;  3TEX A;  3HVZ A;  1DOY A;  1UWM A;  3NVY A;  1UUP A;  1PFD A;  1B1Z A;  3P63 A;  3VRA B;  4C7Z A;  5C2T B;  4NAW B;  5BMI A;  1PUT A;  1MVK A;  5HG2 A;  1XF5 L;  1TJE A;  3URY A;  1MHX A;  1AYF A;  1TS5 A;  1F0Z A;  3Q8A A;  4N58 A;  2KN4 A;  4DQO C;  4HJG E;  4XWT A;  2L52 A;  4M0W A;  5C3J B;  1L0X B;  3NVZ A;  2V0G A;  5BMG A;  1YJI A;  1OQQ A;  3B2G A;  1B9R A;  1N5X A;  2K22 A;  1YN4 A;  5HI1 A;  1J7C A;  1FM0 D;  3CWI A;  2WXR A;  4CQN A;  3HRD D;  1GOZ A;  2IGD A;  2BB5 A;  3BK2 A;  1VJK A;  1Q10 A;  3FIL A;  3RFZ B;  4PT5 A;  1DYQ A;  1C9F A;  1GAQ B;  2YEP F;  1NYR A;  4IOI E;  3V3X A;  2ONQ A;  1FEH A;  4RGO S;  2WXI A;  2DWQ A;  2JZP A;  4ARC A;  1WSP A;  2NTT A;  4XDD A;  2K3U A;  2E3T A;  4O1N A;  2PTL A;  1N61 A;  4DXF A;  1E10 A;  3TSS A;  3FC4 A;  4L2Y A;  1AW7 A;  2WXJ A;  3AB5 A;  1FNW A;  1NYQ A;  4RH6 A;  3VR9 B;  2GI9 A;  3P4Q B;  4D2K A;  1ZP0 B;  1TY2 A;  1K53 A;  2ICI A;  1ZDV A;  4C80 A;  3L4P A;  1XEE A;  4MAC A;  2MJ3 A;  5H92 C;  4KGS A;  4P16 A;  1NEN B;  4ZRP A;  1ROE A;  3BVZ A;  3GP7 A;  1DOX A;  3Q8B A;  3SEB A;  1VZ6 A;  3IT6 B;  2OED A;  4C7Y A;  5AUI A;  1QQR A;  4NAM A;  5EE3 A;  5BMH A;  3VR8 B;  4ITK A;  2PLP A;  3W5V B;  1KF6 B;  2EEL A;  1XCT L;  2KMM A;  4ZHP A;  2ON8 A;  3BII D;  4L23 A;  3P42 A;  2CJO A;  1XXG A;  3BK1 A;  2RMM A;  1L0V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...