1WGKA

Solution structure of mouse hypothetical protein 2900073h19rik
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
114
structure length
114
Chain Sequence
GSSGSSGMAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Mouse Hypothetical Protein 2900073H19RIK
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2900073H19 protein
total genus 12
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wgkA01
3CWIA 1FFUA 1JALA 1XO3A 3AE5B 3HUIA 1RFKA 3ZYYX 1FMAD 1DGJA 3AM9A 1WYGA 1DOYA 4N58A 2L83A 1ZUD2 1FIQA 2PVGC 1FRDA 3AEDB 4HROA 4JWUC 3VRBB 3EUB2 3NRZA 2B76B 5H8YE 3AMZA 3AEEB 3P4QB 1RYJA 4YTPB 3NVWA 4YSYB 4YTNB 1KFYB 1DOXA 2CU3A 2WLBA 3HRDD 1RM6C 2WDVB 3VR8B 2QIEB 1YJJA 3W5VB 3CIRB 1B9RA 3B2FA 1J7CA 3AE6B 1JWAD 1N62A 1QOBA 2WDQB 1PUTA 1RWSA 1N60A 2W54A 1E7PB 1I7HA 1CJEA 3AE4B 3NVYA 3P63A 1EWYC 4WWMA 1GPXA 1XLPA 5G5HA 4WQMA 2OHFA 3AN1A 1JW9D 2JQRB 1R7SA 3AH7A 3ABVB 4N59A 2WU5B 3KWLA 1YQ3B 1FM0D 3AE8B 1TJEA 1SB3C 2MJEA 2M56B 3LB8C 3NVZA 4P6VF 2DWQA 5EE3A 4LTUA 1OQRA 1QOFA 3AE2B 1TKEA 2FBWB 2H89B 2PIAA 2WQYB 1FRRA 2BS2B 2WP9B 5GXGB 3SFDB 1E0ZA 3P4PB 1YQ4B 2H88B 3AV8A 3P4RB 1OFFA 3DWGC 1L5PA 4ZOHC 3P4SB 3AECB 1TKGA 3VRAB 4YTMB 4ZHOA 1DOIA 4USAA 3W5UB 1SIJA 1XLOA 4ITKA 1JROA 5EE0A 1TYGB 2KAJA 3FC4A 4FXCA 5G5GA 2LEKA 1VJKA 1VDVA 3LXFA 1QF6A 1V97A 2EKIA 2Y5CA 1E10A 2N0SB 1L6VA 5C3JB 1FFVA 1N5XA 1WXQA 2KMMA 1IUEA 1FXAA 1KRHA 1ZXIA 2K9XA 2BS4B 1FO4A 4C7YA 4A9AA 1VLBA 1E6EB 4YT0B 4HRSA 3AE7B 4N6EB 1WGKA 1NI3A 1N63A 2QJLA 2WU2B 1N61A 1ZP0B 2M19A 3AE1B 1A70A 3FAHA 5AUKA 3WCQA 1ROEA 2E3TA 4ZHPA 1NEKB 1NVID 1QLBB 1AWDA 2Q5WD 3AEFB 2K22A 4IDIA 4KX6B 3AEBB 4JX1C 2MJDA 4YSZB 1NYQA 2PKOA 1XLNA 3SFEB 1V8CA 3W9CB 1N5WA 3B9JA 3VR9B 5MPOA 1PFDA 1QOGA 1SF0A 4C80A 3AEGB 1T3QA 5EE9A 1KF6B 1FXIA 3SR6A 2CJOA 2L52A 5C2TB 1PDXA 1CZPA 4US8A 1E9MA 2WS3B 3AE9B 2PVOD 3B2GA 5AUIA 2WDRB 3NVVA 1GAQB 1OQQA 1XLQA 2MJ3A 2W55A 4C7ZA 2BS3B 1QOAA 2JX5A 3NS1A 5H92C 1NYRA 1AYFA 1J7BA 3DWMA 3AEAB 1F0ZA 1YJIA 1QT9A 3AE3B 4YSXB 2BT6A 2MH7A 1JWBD 5EE1A 4JWSC 3RPFC 2W3SA 1J7AA 1JQ4A 2CJNA 2G1EA 3P1MA 2AX5A 1ZOYB 3HVZA 1TKYA 2DBYA 4US9A 3L4PA 3BIID 2W3RA 1WWTA 1WRIA 1NENB 3PO0A 1L6UA 3ETRA 4YXDB 1UWMA 2HTME 1JRPA 2ACZB 3AB5A 2K5PA 1L0VB
chains in the Genus database with same CATH superfamily
1V81A 4NQKE 1DGJA 2AEHA 4N58A 1WM3A 1WX7A 2VH2A 4DK5A 1RYJA 5I4DA 2WLBA 1V1OA 1YJJA 2EMTA 4OVZA 2MW5A 2XNAC 2N4FA 4W9DA 1WR6E 3SDLC 4K81A 2D2QA 3A1QB 4DDGD 4GU2A 4N59A 4DXGA 4EEWA 4JIOU 1XCTL 2WX0A 5D3DA 4GDLB 2A5UA 2K0PA 4OZCA 2V3NA 3Q6BA 3PLVA 2DAFA 4NAWB 1K51A 3AECB 3Q3NC 1IBXA 1TYGB 3KUCB 2KD0A 3EFCA 3U7ZA 2K8BA 1F2RC 4A90A 2ASQA 2L8JA 2O2VB 2QEJC 2WU2B 4WWOA 4ANUA 3AE1B 2LD9A 3EC8A 4WWPA 1NEKB 1PGXA 4KX6B 3AEBB 2JU6X 3SFEB 1E8XA 2PJHA 2L32A 2OJRA 3TSSA 2HJ1A 4CYEA 2LHDA 4TV3A 2XN9C 1UGMA 2PVOD 3DHIC 1GAQB 2MX2A 4II3B 4GDKB 3RMKC 1MFWA 4GDLA 4GN1A 3MC9A 3BYTB 3X0WA 5HKHA 1IGDA 3N1XC 1JRPA 3GP7A 2IY0B 2X38A 3AE5B 1JALA 3N32A 3BVMA 3QHTA 1WYGA 2JF5A 4PYZA 1FRDA 1T0QC 4DWFA 1YOVB 1KFYB 1ACCA 3T3OA 3LJ3A 4NJ6A 1JWAD 1N62A 1PUTA 3TEXA 3Q8CA 2O6VB 1FD6A 4RGMA 4MJSB 4LJOB 3UGBB 3NS8A 2BF8B 4HCPB 2M56B 1YJ1A 2FCQA 5GXGB 5BMHA 4TQ1A 3JYUA 2R2OA 4FJVB 4LNOA 2KWVB 3I5JC 1XLOA 4AWJA 1HE8A 2ZJDA 1BXTA 4XE0A 4EE2A 2Y5CA 2BQQA 3R2IA 1FEHA 2BYVE 4NJ7A 3VHTC 4TSSA 2AWTA 5D7GA 2LVOA 4REZA 3BWUD 1N63A 2M19A 4IWQA 4GLSC 1WFYA 2LXCA 2RD0A 1SF0A 2BGFA 2G4DB 3GZNB 3N1ZC 1V2YA 2WDRB 1QOAA 2NPTA 4XC2A 1F0ZA 2MH7A 1J0GA 3O65B 3RPFC 5IO9A 1CMXB 3ZNGC 3H9DA 1R4NI 1UWXA 2N9EB 3I63C 1K53A 1QKZA 4DBGA 2XK5A 1EO6A 2AL3A 2BVCA 2HTME 3L10B 2MRPA 4K3BA 1FCLA 1L0VB 2ZNVC 2LUMA 4RM8A 1HZ5A 4MH0E 2ZVNA 2RGFA 2YEPB 2KTFA 3A4RA 3K9OB 2KZRA 1T0SC 1KLGD 3CIRB 2L1AA 2KXJA 3P63A 2WXFA 4LNFA 3UQBA 2N1VA 5JXVA 3MJWA 1H4RA 4KGTA 3APDA 4ANXA 1QOFA 4DXFA 4IM3A 3M95A 4BOZB 3U4EG 4C4VA 5D3IB 2IO0B 3AU4A 1R4MI 4EOYA 4ZRJA 1VDVA 1KJTA 4EKUA 3Q3FA 1FXAA 1QILA 1V6EA 3H7PB 3NZSA 4MSMB 1WXSA 4B0EA 2NTSA 1N61A 1ZPSA 1Z2MA 3WCQA 4MT5A 1XD3B 5FR3A 4RH6A 1NVID 1FXTB 1Q10A 1MHXA 1Y56A 2KN5A 4IDIA 3FKYA 1EM7A 2LGSA 5IKCM 1ET6A 3I3TB 4W9CA 2XK5B 4OZBA 3M62B 3NG0A 2LGXA 1C4CA 1Q5WB 3ML8A 2GLSA 4C7ZA 1LO5D 4CQNA 2RSUA 3AE3B 5DPSA 2V4IB 3VAWA 1JWBD 5LXHA 2WHIA 4HPMB 2OEDA 2E6XA 4WH4A 1TKYA 4DXAB 2KTRB 4RNAA 3WAOA 2KOXA 2ACZB 1IPGA 3HHMA 1GJZA 3QWZB 3V60A 2DLBA 1VCBA 2GBKA 4WAFA 1VZ6A 2IGDA 2PVGC 3KYCD 3IT6B 3MTNB 4KKIA 4M0WB 2L76A 3EUB2 5HG2A 1UNSA 4IC7B 2IO2B 3W2DA 4ZYNA 1PGAA 3WA0A 4GIVA 3KUZA 1EWYC 5HI1A 3QIJA 5IAAC 2JQRB 4RGOS 3ZNHB 4BBNC 1P0RA 1WMHB 3PT2B 1E8ZA 3AE8B 2MJEA 4WJOA 1ENFA 2HD5B 2YVCA 2BYTA 2FCNA 4HDQA 3VTWA 4GDKA 1T0YA 3EGRA 3IG3A 2RR9A 4LNIA 4PS3A 3P4PB 4JL9A 4EUTA 3TIXA 1G6JA 1TKGA 5GMVA 2M0AA 4FXCA 3ZO5B 1VR9A 5D94A 4ICVA 4B6WA 3GOEA 3VFKA 3JSVA 2SAKA 3VTUA 3Q2AC 1NI3A 4BOSC 3ZJTA 3DBLB 4ZHPA 2M4NA 1P7EA 4JX1C 3B9JA 3VR9B 2K3UA 4LDTB 4EFOA 3PLUA 1H8CA 1SSNA 3Q3JA 2J4XA 2N7DA 2NBVB 2W82A 2LGYA 3DBHI 2C5LC 2D3GA 1UZXB 2DENB 5EE1A 3Q8BA 2VH1A 4KDIC 2AL6A 3B1LX 2DZKA 4E71A 1YX6B 4LJPB 1E8YA 3CSFA 2KDIA 1XEEA 4MGYE 1FFUA 3JSVB 2G3QB 3I9V1 4N9F4 5DCNA 3WAMA 2INDC 2JSVX 5C23A 3PHWB 3GS2A 2DAJA 2M17A 3IHPC 1TGZB 1L0XB 3H1UA 2FUHB 1RWSA 1E7PB 5AZHA 4BKTA 3OWEB 4O1NA 1P3QU 2V9HA 4KZ0A 3J9CA 2C60A 3MFGA 2KDMA 2ZVOA 3Q8EA 2JWZA 3IFWB 1FRRA 3ZNZB 4FN2A 2SEBD 4RF0A 3U52E 1D5ZC 4LLGM 4BKSD 2LFIA 4H2AA 1IUEA 1KM7A 4A9AA 1VLBA 4HRSA 2QHOA 4IM2A 3A9KA 2ZZPB 4LNKA 2RPQA 4L23A 2JXTA 5MPOA 4C80A 2L0FA 1KF6B 2L52A 3U2SC 4I6NB 4W9FA 3BK2A 3TCAA 4MH8A 1NYRA 1LFDA 1F1HA 2KWCA 1V86A 1VZ8A 1WGYA 4QAYA 2G1EA 1SE2A 3R66C 1GB4A 3CF6E 3L16A 1ZKHA 2KWUB 3L4PA 2L05A 3CWIA 2DZMA 1HA5A 1ZW7A 5BMIA 4WJPA 1LM8B 1UD7A 4ZRPA 2ICIA 5H8YE 4M8NA 4PS8A 1JWMD 4NPNA 1DOXA 1RM6C 2WDVB 5J17A 5KHQA 5IOIA 3AE6B 2WDQB 2I2YA 4A3OA 2D11A 1IP9A 1IGCA 5IP4D 1WIAA 3EFUA 3HVDA 4RM9A 1V9JA 3BK1A 3KQ4A 2D3BA 5JHBA 1FM0D 3PZ8A 2JPHA 1GG3A 2DWQA 4OW0A 5EE3A 3T3NA 2FBWB 1HTOA 3EA6A 1Y8RC 1YQ4B 2XEWA 3VRAB 2HJ8A 2WYQA 2V3SA 4FLHA 2KO3A 3VVWB 2JZPA 4HXDA 4W9EA 2QJLA 5AEKB 1ZP0B 3TJPA 4JQWC 2D10A 1TIFA 3HK0A 3VUXA 3ZRCA 1FXIA 1J19A 4MEMA 3U7DA 4ANWA 5HFYA 3ZKJC 1XLQA 3AU5A 4KKJA 4AS1A 1XT9B 2G4SA 3DWMA 4OVUA 2CHZA 3APCA 1B1ZA 1Q0WB 1D5MC 5C1ZA 5IA7A 1D4BA 2ZPYA 3ZTCA 2Y3AA 4EZLA 1IBXB 2AX5A 2PE9A 2QC8A 1YN4A 3ETRA 3W1SC 3PVLA 3PV1A 3OLMD 4TMAB 1OEYA 2R2QA 2MLBA 4KGRA 4L1BA 1XO3A 3WANA 1DOYA 2DZJA 3AMZA 3APFA 3WALA 3H7PA 4LNNA 3L13A 5T8IA 3VR8B 1XCQL 2MSED 3VDZA 3VUYA 2AQ1B 4RGNA 5BYSA 3ZGZA 2KMCA 3VUWA 2NCNA 2KDBA 1R7SA 2PE6B 2LI5A 3DVGX 2D07B 1MG8A 1K8RB 2FIFA 3QQ8B 1TKEA 2KK8A 2LMCA 1C9FA 4HPPA 1LXDA 2ZPNA 2Y5PA 3RD2A 3PS6A 4C4VB 1F77A 5C3JB 4GMVA 4DDID 2GBNA 5DPWA 1FO4A 1SBBB 2QDFA 3FAHA 2CS4A 2K1FA 4I6PA 1T6BX 2MJDA 1OGWA 3ZDTA 2KC1A 2J7QB 3FILB 4DHZB 1V49A 1L7YA 1T3QA 1LGRA 1OEYJ 4ARIA 1OQYA 1UH6A 4MGKE 1E9MA 3AE9B 3CSTA 1JMLA 4IWOA 2INPE 2QSDA 3AEAB 1I35A 4M0WA 4BBNF 1TBEA 3ZXVA 2R61A 2CJNA 2RDHA 2LVPA 1C76A 1NENB 2WXHA 4NQLB 4FHKA 2N9PC 2J53A 1FIQA 4JWUC 3VTVA 2K25A 2AQ2B 3IVFA 3KYDD 3Q14C 1V1PA 2FCMA 3RNEC 4S17A 2CU3A 3PRZA 2BYEA 2N9LA 1FCCC 3B2FA 3SU8X 3H6NA 3A1QA 3ZTDA 3MP9A 2LWPA 5G5HA 1JW9D 5AZFA 3Q3MC 3NOBA 1EF5A 2EKEC 1ZXHA 4KV2A 3ENEA 4KVGB 2Z0DB 1L0YB 3N1YC 4K1RB 2JZZA 1C3TA 4W9GA 3BY4B 3KUDB 3LYYA 3V3XA 2ZEQA 1WRDB 4L2YA 3QAQA 3DWGC 4YTMB 4ZHOA 1DOIA 4A55A 4ITKA 5EE0A 3FC4A 1WE6A 2K8CA 2I1JA 3LXFA 1E10A 2JRIB 2MBOA 4KIKB 2L00B 4AP4C 5DPRA 1KTKA 1GC6A 4GOCA 1AN8A 2KYWA 2LZ6A 3PSEB 2JYTA 2BTEA 4R3DA 2IGGA 2C7NB 2CHXA 4E74A 1NYQA 3DVNV 3UIOB 4LDTD 4P1BC 4HLEA 3TEZA 3AEGB 2Y5BB 3SR6A 1L2NA 4HPLB 1WXAA 1OQQA 2MJ3A 5H92C 2KKCA 3Q69A 4FJZA 4HWIB 2KFKA 4HDOA 4DHJD 1JQ4A 3JVZX 1WF9A 2L0TA 4MDKE 2V1YA 2NBWB 4DQOC 3RCZA 3L54A 1YN5A 1TS4A 1U4AA 4ZDVA 2KX0A 1E8WA 4HJKA 3V62A 2CU1A 2IDYA 3NUHB 4ZYSA 1ZUD2 2KLGA 2MHJA 3C19A 3NJTA 3UINB 1K52A 1UUPA 2WXJA 3D32A 1C1YB 4ARCA 2WNMA 2W54A 3AE4B 4PK1A 1I4XA 1XLPA 3ABVB 1WX8A 4IW0A 3AXCA 3IT4B 4BKSA 2K39A 3QA8A 3P4RB 2IO1B 4KSLC 1S3SG 3P4SB 3R7QA 3BZDB 3C0RB 3W5UB 1T5XD 1PQSA 2TSSA 1M94A 1JROA 2KAJA 1F52A 2EELA 2BKRB 2IGHA 1QF6A 2EKIA 2AYOB 2JT4B 4TUUA 4FBJB 3H7SA 1E6EB 3V61A 1P9DU 3QC8B 5KHOA 4B95A 4F8CB 2E3TA 2BB6A 2JXXA 1QLBB 5BYQA 4HEA1 3R7RA 2WWZA 4YSZB 2PKOA 3ALBA 5D6JB 2CJOA 2KX3A 1PDXA 3PHXB 3WIMA 4JE3B 3R8BA 1VD2A 4MGIE 2MEKA 1C77A 5D2MB 3ZJVA 2KC2A 2ONQA 1OTRB 1J7BA 1WY8A 3ZNID 1YJIA 2WXIA 2W3SA 1WJNA 1KOTA 2WXLA 2MCNB 3N9YC 3CMMB 1HTQA 3W1YA 3T8MA 1SJHD 4GB9A 2GBRA 2NPTB 1NI2A 1YN3A 2KQSA 3TEYA 3U30A 3IAM1 2IBIB 2G45B 3RT3B 4YTNB 5TR5A 1XF5L 2WXMA 3IBEA 1WXMA 2NR2A 2IPKD 2MP2B 2N9KA 2QILA 1E5WA 2DNFA 1VZ7A 4ASWC 4LK0M 1TJEA 5IN7A 3LB8C 2GRIA 4P6VF 1JWUD 3AE2B 4KDLB 2WQYB 2H89B 2PIAA 3SEBA 4C00A 2WP9B 3SFDB 4DHZE 2MBHA 4WWNA 4NAMA 3TEWA 2KJRA 1KH0A 2MQJA 3DBSA 2IY1B 2GBMA 4OHJA 2J0KA 1V97A 2KMMA 3HM3A 1KRHA 1ZXIA 4G3XB 4W9LA 4C7YA 4XWWA 4HJGE 1I4PA 1YNTE 2FAZA 3OG5A 3RNBC 3KWVA 3V6CB 3SD5A 3FILA 1JCKB 2ZCBA 4ZRKA 4TKNA 3W9CB 3C8YA 1TZ1A 4WURA 4US8A 3DVGY 3IXSA 4BAXA 3NS1A 2FE8A 1E7VA 2K6QA 3DQVA 4MACA 1I4QA 1CQVA 2KQ4X 3B0AA 1MJDA 2WX1A 4IM0A 1YIWA 1J7AA 3GE8C 2IZVB 2MP2A 1ZDVA 3Q3OC 3ZXRA 2C7HA 1ZOYB 1WGHA 4A3PA 2DBYA 3E9SA 2QMTA 3BIID 2REXA 3PO0A 1AW7A 3ECIA 4YXDB 1IYFA 3AB5A 2UWQA 2GMIC 3ZYYX 3I57A 1V5OA 5AZGA 1MPEA 1Q1OA 1WX9A 3NRZA 3AEEB 4C56C 3NVWA 1ZDXA 3M63B 4M00A 1T0RC 5CX3A 4OZAA 4NNJB 2KDEB 2W9NA 3DBRI 3W5VB 1EU4A 3TL5A 4MGZE 2M1MA 1C4PA 3ZW3A 2RDGA 4EZKA 1C79A 4PS7A 1SE3A 1D6EC 4HKZE 2WU5B 2JYEA 2V4LA 2C7MB 1SB3C 4ICUA 2J0JA 1GB1A 3URYA 4AQ7A 2AQ3B 3AV8A 5E6NA 1L5PA 5E6PA 2JY6A 4USAA 4ZRQA 4UDUC 2C9WB 2NTTA 1SE9A 2I1KA 3S2AA 2FIDA 3O13A 4JGHB 4BVUC 4XZ4A 5BO4B 5CHVC 2MBEA 2Q5WD 2KJ6A 4MELA 2EMSA 1WH3A 4KSKC 2DX5B 3PZ7A 1PFDA 1ZE3D 1J8CA 3GE3C 5C2TB 3QK0A 1CZPA 5E6OA 1VRAB 4AJWA 3KW5B 3DHHC 3MC0B 1TS2A 3RULA 3BYYB 1RRBA 2ZW0A 2LGDA 4WAAA 1GNUA 4GXBA 2KVRA 5G2NA 1RFAA 1WE7A 3PGEA 2FNJB 5EDSA 1BT0A 1F2RI 1TS5A 2J52A 4HROA 1P7FA 2B76B 3SHQA 3Q8FA 2WXRA 4ACFA 1MG4A 1L4ZB 3ZQ4A 2JWUA 3EHVA 3L08A 3RZFA 1B9RA 1J7CA 3LDZE 4FULA 3KH0A 2LXAA 1I42A 4PT5A 4RFBA 1QZEA 4E3CA 1GPXA 4TQ0A 4P1CC 1YQ3B 4G11A 1I4RA 5JZEB 4W9JA 5LNK1 3V05A 1EWCA 2DYMA 3OAWA 3U8ZA 3A4SC 1UBQA 3ML9A 3JW0X 2JUOA 2MWSB 3NZ3A 4IOIE 1AARA 3EECA 1WGGA 3K9PB 2N0SB 4A8XC 1FFVA 1Z5SB 2WXGA 3RNAC 2BS4B 3A9KB 4II2B 3ZUNA 4XDDA 2XBBC 2KANA 4KIKA 5J18A 4MM3A 1AWDA 2HDEA 4GGQA 5BMGA 4K7UA 3RFZB 2PW9A 4RCOA 3QX1A 4NY0A 1UGJA 4K3CA 4EZJA 2LHEA 4BFRA 2UU7A 1CK1A 4CHKA 4JPSA 2KJHB 1FNVA 1QT9A 2L7RA 2YEPF 1RLFA 1SEBD 2BYFA 5FK9C 3UIPB 2GI9A 2W3RA 1SGHA 4XGAB 4RMAA 3HIZA 5DPTA 2NS5A 3HUIA 3L0WB 2A4ZA 2PEAA 3AM9A 4I6LB 1WYWB 1LQBA 3AEDB 3T9LA 2KFKB 3B08A 4YTPB 1SJED 2RMMA 4YSYB 2RPVA 3RNGC 1KLVA 3RUIB 4XDCA 4HK2A 1GOZA 2BB5A 2INNE 2PMVA 3QJZA 4M8MA 3UQAA 5E6JA 3PZDA 2N7JA 3QCAA 3ZLZA 4Q2JA 2KNBA 4LTUA 3BVGA 2WXNA 2ON8A 5G55A 4ZOHC 1KLUD 2O6VD 1WJUA 3V6EB 2LEKA 1WM2A 2DHZA 1L6VA 1WXQA 2WXOA 1V1PB 2WXKA 2CKHB 3AE7B 4S0RA 2BBCA 4FJYA 4F1SA 1WXVA 1YMHE 1P98A 2FCSA 4P7IA 5L95C 2WDTB 2INCC 4NJCA 2KFJA 2GBJA 2LRWA 3PPAA 5CHWA 4WJNA 1PGBA 3VH4B 2G9HD 4HKQA 3N3KB 3P42A 1JWSD 2OJWA 3H8HA 4YWGG 1XQQA 2LVQA 2IYDB 3HVZA 4US9A 1C78A 4RF1A 1UWMA 5FR6A 3R2TA 2MBBB 2K5PA 1BMLC 2WGSA 5BYRA 4X57B 2L83A 3VRBB 3DDCB 1UELA 1D5XC 3IAS1 3HRDD 1V5TA 2ZW1A 2KMAA 3ZJUA 1E7UA 1TT5B 4YL8A 3PRMB 4WWMA 1I7HA 1XXGA 4WQMA 3AN1A 3DPDA 3DOWA 4GSWA 4P16A 1YD8U 1N6ZA 2DYBA 2KHWB 3ZVVA 3RI7C 4XYCA 1TY0A 2NBUA 1E0ZA 2H88B 1FPYA 1OFFA 3W1SA 2WXPA 2V0GA 1A5RA 1SIJA 1GC7A 4AOFA 1HZ6A 2M0XA 1VJKA 3KVFB 1WGRA 1EUVB 4OVVA 4A20A 4CO7A 3DCGA 2K9XA 2Z8LA 2IO3B 4KGSA 2K6DB 3HM6X 4N6EB 4YT0B 5JH5C 5AUKA 4G50A 1ROEA 3P2BA 2D5GA 1R4MB 4W9KA 1L4DB 3AEFB 1C4AA 2K22A 4IUMB 4IG7B 2BKFA 2O6VA 1V8CA 3KLSX 1FNWA 5EE9A 1ISNA 1ZGUB 3MJ5A 2BWES 3B2GA 1ESFA 3R3MA 1F9JA 5AUIA 3NVVA 1S1QB 2KACA 3ZDMC 2JX5A 4PYUA 2M8SA 4FHJA 2N7EA 3DBHB 1UBIA 3VQIA 2KN4A 1WZ0A 2VZKD 3NY5A 1I4GA 1WWTA 1WRIA 1RAXA 4WQOB 2VRRB 2J0MA 3A33B 3RZWC 2D3CA 1TZOA 3ONSA 3QARA 1WSPA 5CHFA 5FKAC 3TBLD 1ET9A 2KDFB 2KVZA 2N1WA 2QIEB 2I38A 1YX5B 3NHEB 1HXYD 1QOBA 3NVYA 3DBRB 3E56A 3WAPA 1WJ6A 1STEA 4D2KA 2LJIA 4MSQB 4J6IA 3UF8A 1NBFC 4XX5A 5J2RA 2PLPA 1TTNA 1SIFA 3PRPB 1M4VA 2JZ3B 1HQRD 2BS2B 2VZKB 2FUG1 1GUAB 1TS3A 2X8XX 2KQ7A 3N20C 4LCDE 2NMQA 3BINA 2KWDA 5G5GA 3RN9C 2LUEA 4BZAA 1N5XA 1HEZE 1WJ4A 4IKGA 1SXTA 1WGDA 1YQBA 3TUOA 4WIPA 3OJ4B 4BKGA 1WGKA 3PREA 1QQRA 3BVZA 4M02A 2DYOA 2NVUI 2KLCA 2MBQA 2QCZA 2LJ5A 5CTRC 1N5WA 3OJ3A 4FA6A 1PYWD 2Z59B 2BWFA 3L17A 3VH3B 4A6QA 1FNUA 2KTRA 1EF1A 2V3PA 3M3JA 4K7WA 3PTFC 3X23A 4J3OD 1MHHE 2WXQA 3DVNU 2N9XA 4HVBA 2IJ0A 5LXIB 2J42A 1DYQA 1SE4A 3GZNI 4ANVA 1TY2A 2KT7A 4HCNB 3TMPB 5HHDG 5TSSA 4K7SA 2GOWA 4AUQC 4NZLB 1RFKA 1BUIC 1FMAD 3A9JB 4URKA 4M01A 1WI0A 3UI3A 3P4QB 3RNCC 2LRUA 1WMHA 4W9IA 3ZIMA 2PPHA 2HTHA 2OOBB 2LGIA 3NZUA 2MA9B 2BW2A 1N60A 4MJSA 1CJEA 1NDDA 2UYZB 2Z0EB 2OHFA 3AH7A 2CR5A 4AJYB 3VXWA 3RNFC 3KWLA 2ZCCA 3MHZA 2D3AA 2DZIA 3NVZA 5L83A 4IWPA 1OQRA 2CHWA 3MHSD 2B3AA 4B0MA 3AULA 2LASA 4WJQA 2RDBC 3ZRFA 2BPSA 3N30A 2JRHA 4FADA 1I4HA 1WZ3A 4F7ZA 1K50A 1P1AA 3AI5A 1MVKA 4MM3B 2HE7A 2ZNVB 3GB1A 4DHJB 1A70A 4ZRIA 1V80A 4B9KA 1WR1A 1MI0A 3DBLI 1XLNA 2YLMA 4JLCA 1QOGA 1E90A 2GB1A 1X1MA 5JHAA 2WS3B 3MC8A 3DHGC 1EU3A 3Q8AA 2JVCA 2W55A 4XWTA 1JRUA 2BS3B 4W9HA 1UF0A 2L3ZA 2PTLA 1AYFA 2K8HA 4YSXB 3A9JA 2BT6A 1D3ZA 1R4NB 4JWSC 4KZCA 2O2VA 5LLIA 3P1MA 4G0NB 1L6UA 4RGTA 4NAWA 3RYTA
chains in the Genus database with same CATH topology
1FFUA 3HUIA 1DGJA 3AM9A 2IDYA 3NUHB 4ZYSA 4N58A 1ZUD2 3I9V1 3AEDB 2JSVX 1RYJA 4YTPB 1SJED 2RMMA 5I4DA 4YSYB 2WLBA 2RPVA 3GS2A 1V1OA 1YJJA 1K52A 1UUPA 4OVZA 2XNAC 1L0XB 2WXJA 4XDCA 4ARCA 2WNMA 1RWSA 2W54A 3AE4B 1E7PB 1I4XA 1GOZA 1XLPA 3ABVB 3OWEB 4O1NA 2BB5A 2INNE 2PMVA 4N59A 4DXGA 3J9CA 1XCTL 5E6JA 3MFGA 5D3DA 4GDLB 2N7JA 2KDMA 2K0PA 4LTUA 4OZCA 3BVGA 4Q2JA 2V3NA 2WXNA 3Q8EA 3IT4B 1FRRA 2ON8A 4NAWB 1K51A 3P4RB 4ZOHC 3P4SB 3AECB 3BZDB 1KLUD 3W5UB 1T5XD 2SEBD 2TSSA 4RF0A 1JROA 1IBXA 1TYGB 2KAJA 2EELA 2LEKA 3U52E 2IGHA 1D5ZC 1QF6A 3U7ZA 2EKIA 1L6VA 4LLGM 2LFIA 1WXQA 2WXOA 4H2AA 1IUEA 1F2RC 1V1PB 4A90A 2WXKA 4A9AA 1VLBA 1E6EB 4HRSA 3AE7B 2QEJC 2WU2B 3AE1B 2BBCA 2E3TA 2BB6A 5BYQA 1NEKB 1QLBB 1PGXA 4HEA1 4KX6B 3AEBB 2JU6X 4YSZB 2PKOA 3SFEB 1YMHE 4L23A 2JXTA 5MPOA 4C80A 2L32A 3TSSA 1KF6B 2CJOA 2L52A 3U2SC 1PDXA 2LHDA 2XN9C 4NJCA 4JE3B 2PVOD 3BK2A 3R8BA 1GAQB 4MH8A 2MEKA 1C77A 1PGBA 3ZJVA 2ONQA 4GDKB 1NYRA 1J7BA 2G9HD 4HKQA 1YJIA 3P42A 2WXIA 1JWSD 3H8HA 1VZ8A 2W3SA 3BYTB 2G1EA 4YWGG 1SE2A 1GB4A 3HVZA 4US9A 1C78A 3L4PA 2WXLA 4RF1A 1IGDA 3N9YC 1UWMA 1JRPA 3R2TA 2K5PA 1BMLC 3GP7A 1SJHD 2X38A 3AE5B 1JALA 3CWIA 3BVMA 1HA5A 1WYGA 5BYRA 5BMIA 1YN3A 2L83A 4ZRPA 1FRDA 3VRBB 2ICIA 3TEYA 5H8YE 3IAM1 1D5XC 3IAS1 1JWMD 4YTNB 1KFYB 1ACCA 3T3OA 1XF5L 1DOXA 3HRDD 1RM6C 2WDVB 2ZW1A 2WXMA 3ZJUA 3AE6B 1JWAD 1N62A 2WDQB 2I2YA 1PUTA 3TEXA 2IPKD 4WWMA 1I7HA 3Q8CA 1XXGA 2N9KA 2QILA 1IGCA 3AN1A 4WQMA 1FD6A 3HVDA 4RGMA 3BK1A 1VZ7A 3KQ4A 4P16A 4LK0M 1FM0D 1TJEA 3PZ8A 2M56B 3LB8C 2GRIA 4P6VF 2DWQA 1JWUD 4OW0A 5EE3A 3AE2B 3T3NA 2FBWB 2H89B 2PIAA 2WQYB 3SEBA 2WP9B 5GXGB 5BMHA 3SFDB 4TQ1A 1TY0A 3EA6A 1E0ZA 1YQ4B 2H88B 1OFFA 4NAMA 3VRAB 3TEWA 3W1SA 2WXPA 2V0GA 1SIJA 1XLOA 1KH0A 1HZ6A 1VJKA 4OHJA 1BXTA 4XE0A 1V97A 4EE2A 2Y5CA 2KMMA 3R2IA 1FEHA 1KRHA 1ZXIA 2K9XA 4TSSA 2Z8LA 2JZPA 4KGSA 4C7YA 5D7GA 4XWWA 4REZA 4YT0B 4N6EB 3BWUD 1N63A 2QJLA 1I4PA 1YNTE 1ZP0B 2M19A 4HJGE 5AUKA 3KWVA 1ROEA 2D5GA 1L4DB 4GLSC 3FILA 3AEFB 1C4AA 2K22A 1JCKB 1V8CA 3KLSX 3W9CB 1FNWA 3C8YA 1SF0A 5EE9A 1FXIA 4WURA 3MJ5A 4US8A 5AUIA 3B2GA 1ESFA 2WDRB 3IXSA 3NVVA 5HFYA 1XLQA 4KKJA 2KACA 3NS1A 1QOAA 2JX5A 4AS1A 2FE8A 4MACA 3DWMA 1I4QA 1F0ZA 1CQVA 2KQ4X 2MH7A 1B1ZA 3RPFC 1D5MC 1D4BA 1J7AA 3VQIA 2KN4A 2Y3AA 1ZDVA 1IBXB 2AX5A 2VZKD 1ZOYB 1UWXA 2DBYA 3E9SA 1I4GA 2QMTA 3BIID 1YN4A 1K53A 1QKZA 1WRIA 1WWTA 1AW7A 3ETRA 3PO0A 4YXDB 2HTME 3AB5A 4TMAB 1FCLA 1L0VB 4KGRA 2LUMA 4L1BA 1XO3A 1HZ5A 3ZYYX 1TZOA 1DOYA 1WSPA 3I57A 1MPEA 5FKAC 2YEPB 3NRZA 3AMZA 3AEEB 4C56C 3NVWA 1ZDXA 1ET9A 4OZAA 5T8IA 3VR8B 2QIEB 1KLGD 3W5VB 3CIRB 2I38A 1XCQL 2L1AA 1EU4A 2AQ1B 1HXYD 4RGNA 1QOBA 5BYSA 1C4PA 3NVYA 3P63A 3ZGZA 3E56A 2WXFA 2RDGA 1STEA 1C79A 4D2KA 1R7SA 2LJIA 1SE3A 5JXVA 1D6EC 4HKZE 2WU5B 2JYEA 1SB3C 2PLPA 4KGTA 1QOFA 1M4VA 4DXFA 1TKEA 3URYA 1GB1A 4AQ7A 1HQRD 2AQ3B 2BS2B 2LMCA 2VZKB 1C9FA 3U4EG 2Y5PA 2FUG1 3AV8A 1TS3A 1L5PA 4USAA 5D3IB 2NMQA 2KWDA 5G5GA 4ZRQA 4UDUC 2NTTA 1VDVA 1F77A 5C3JB 1N5XA 1HEZE 1FXAA 3O13A 1QILA 4IKGA 1FO4A 1SXTA 3TUOA 4WIPA 1SBBB 1WGKA 4B0EA 2NTSA 1N61A 1ZPSA 3FAHA 3WCQA 4MT5A 1QQRA 3BVZA 4RH6A 2DYOA 5FR3A 1NVID 1Q10A 1Y56A 1MHXA 2Q5WD 4IDIA 1T6BX 1EM7A 2MJDA 1ET6A 3PZ7A 1N5WA 1PFDA 3FILB 1T3QA 1ZE3D 1PYWD 4ARIA 5C2TB 4A6QA 1CZPA 1E9MA 1VRAB 4OZBA 1FNUA 3AE9B 1JMLA 3MC0B 1C4CA 1TS2A 3BYYB 2V3PA 4C7ZA 1LO5D 2ZW0A 2INPE 1MHHE 2WXQA 2QSDA 4J3OD 3AEAB 4CQNA 3AE3B 4M0WA 2V4IB 2IJ0A 1JWBD 2J42A 1DYQA 1SE4A 2R61A 2CJNA 2OEDA 1TY2A 2E6XA 2RDHA 1C76A 4WH4A 1TKYA 1NENB 4RNAA 5HHDG 5TSSA 2WXHA 2ACZB 4NZLB 2J53A 1RFKA 1BUIC 1FMAD 2DLBA 1F2RI 1TS5A 2J52A 1VZ6A 4WAFA 2IGDA 1FIQA 2PVGC 4JWUC 3IT6B 4HROA 4KKIA 1P7FA 2AQ2B 3EUB2 2B76B 3UI3A 1V1PA 3P4QB 3Q8FA 2WXRA 5HG2A 2CU3A 1L4ZB 1UNSA 3ZQ4A 2JWUA 2N9LA 3W2DA 1FCCC 1B9RA 2LGIA 3B2FA 1PGAA 1J7CA 4PT5A 2BW2A 4RFBA 1N60A 1GPXA 1CJEA 3MP9A 1EWYC 5HI1A 5G5HA 4TQ0A 2OHFA 1JW9D 2JQRB 3AH7A 4RGOS 3KWLA 1YQ3B 3AE8B 1ZXHA 3MHZA 2MJEA 1ENFA 1I4RA 3NVZA 2BYTA 1L0YB 1OQRA 4B0MA 5LNK1 3LYYA 3V05A 3EGRA 3V3XA 1EWCA 2DYMA 3P4PB 4L2YA 3DWGC 4YTMB 4ZHOA 1TKGA 1DOIA 1I4HA 3NZ3A 4A55A 4ITKA 4IOIE 2M0AA 5EE0A 3FC4A 4FXCA 3LXFA 1VR9A 1K50A 1E10A 2N0SB 4A8XC 1FFVA 1MVKA 2WXGA 4MM3B 2BS4B 4XDDA 3GB1A 1KTKA 2SAKA 1NI3A 3ZJTA 1A70A 1AN8A 4ZHPA 2JYTA 2BTEA 1AWDA 2HDEA 1P7EA 4R3DA 2IGGA 1MI0A 4JX1C 1NYQA 5BMGA 1XLNA 3B9JA 3VR9B 3TEZA 1QOGA 3RFZB 3AEGB 2K3UA 2GB1A 2PW9A 3SR6A 4RCOA 1SSNA 1UGJA 2WS3B 2J4XA 1EU3A 1OQQA 2MJ3A 3Q8AA 2LHEA 2W55A 2W82A 4XWTA 2BS3B 5H92C 1CK1A 3Q69A 4JPSA 2PTLA 1AYFA 1FNVA 1QT9A 4YSXB 2BT6A 5EE1A 4JWSC 3Q8BA 2YEPF 1JQ4A 3P1MA 1SEBD 5FK9C 4DQOC 2GI9A 2W3RA 1L6UA 4RGTA 1YN5A 1TS4A 1XEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWI A;  1FFU A;  1JAL A;  1XO3 A;  3AE5 B;  3HUI A;  1RFK A;  3ZYY X;  1FMA D;  1DGJ A;  3AM9 A;  1WYG A;  1DOY A;  4N58 A;  2L83 A;  1ZUD 2;  1FIQ A;  2PVG C;  1FRD A;  3AED B;  4HRO A;  4JWU C;  3VRB B;  3EUB 2;  3NRZ A;  2B76 B;  5H8Y E;  3AMZ A;  3AEE B;  3P4Q B;  1RYJ A;  4YTP B;  3NVW A;  4YSY B;  4YTN B;  1KFY B;  1DOX A;  2CU3 A;  2WLB A;  3HRD D;  1RM6 C;  2WDV B;  3VR8 B;  2QIE B;  1YJJ A;  3W5V B;  3CIR B;  1B9R A;  3B2F A;  1J7C A;  3AE6 B;  1JWA D;  1N62 A;  1QOB A;  2WDQ B;  1PUT A;  1RWS A;  1N60 A;  2W54 A;  1E7P B;  1I7H A;  1CJE A;  3AE4 B;  3NVY A;  3P63 A;  1EWY C;  4WWM A;  1GPX A;  1XLP A;  5G5H A;  4WQM A;  2OHF A;  3AN1 A;  1JW9 D;  2JQR B;  1R7S A;  3AH7 A;  3ABV B;  4N59 A;  2WU5 B;  3KWL A;  1YQ3 B;  1FM0 D;  3AE8 B;  1TJE A;  1SB3 C;  2MJE A;  2M56 B;  3LB8 C;  3NVZ A;  4P6V F;  2DWQ A;  5EE3 A;  4LTU A;  1OQR A;  1QOF A;  3AE2 B;  1TKE A;  2FBW B;  2H89 B;  2PIA A;  2WQY B;  1FRR A;  2BS2 B;  2WP9 B;  5GXG B;  3SFD B;  1E0Z A;  3P4P B;  1YQ4 B;  2H88 B;  3AV8 A;  3P4R B;  1OFF A;  3DWG C;  1L5P A;  4ZOH C;  3P4S B;  3AEC B;  1TKG A;  3VRA B;  4YTM B;  4ZHO A;  1DOI A;  4USA A;  3W5U B;  1SIJ A;  1XLO A;  4ITK A;  1JRO A;  5EE0 A;  1TYG B;  2KAJ A;  3FC4 A;  4FXC A;  5G5G A;  2LEK A;  1VJK A;  1VDV A;  3LXF A;  1QF6 A;  1V97 A;  2EKI A;  2Y5C A;  1E10 A;  2N0S B;  1L6V A;  5C3J B;  1FFV A;  1N5X A;  1WXQ A;  2KMM A;  1IUE A;  1FXA A;  1KRH A;  1ZXI A;  2K9X A;  2BS4 B;  1FO4 A;  4C7Y A;  4A9A A;  1VLB A;  1E6E B;  4YT0 B;  4HRS A;  3AE7 B;  4N6E B;  1WGK A;  1NI3 A;  1N63 A;  2QJL A;  2WU2 B;  1N61 A;  1ZP0 B;  2M19 A;  3AE1 B;  1A70 A;  3FAH A;  5AUK A;  3WCQ A;  1ROE A;  2E3T A;  4ZHP A;  1NEK B;  1NVI D;  1QLB B;  1AWD A;  2Q5W D;  3AEF B;  2K22 A;  4IDI A;  4KX6 B;  3AEB B;  4JX1 C;  2MJD A;  4YSZ B;  1NYQ A;  2PKO A;  1XLN A;  3SFE B;  1V8C A;  3W9C B;  1N5W A;  3B9J A;  3VR9 B;  5MPO A;  1PFD A;  1QOG A;  1SF0 A;  4C80 A;  3AEG B;  1T3Q A;  5EE9 A;  1KF6 B;  1FXI A;  3SR6 A;  2CJO A;  2L52 A;  5C2T B;  1PDX A;  1CZP A;  4US8 A;  1E9M A;  2WS3 B;  3AE9 B;  2PVO D;  3B2G A;  5AUI A;  2WDR B;  3NVV A;  1GAQ B;  1OQQ A;  1XLQ A;  2MJ3 A;  2W55 A;  4C7Z A;  2BS3 B;  1QOA A;  2JX5 A;  3NS1 A;  5H92 C;  1NYR A;  1AYF A;  1J7B A;  3DWM A;  3AEA B;  1F0Z A;  1YJI A;  1QT9 A;  3AE3 B;  4YSX B;  2BT6 A;  2MH7 A;  1JWB D;  5EE1 A;  4JWS C;  3RPF C;  2W3S A;  1J7A A;  1JQ4 A;  2CJN A;  2G1E A;  3P1M A;  2AX5 A;  1ZOY B;  3HVZ A;  1TKY A;  2DBY A;  4US9 A;  3L4P A;  3BII D;  2W3R A;  1WWT A;  1WRI A;  1NEN B;  3PO0 A;  1L6U A;  3ETR A;  4YXD B;  1UWM A;  2HTM E;  1JRP A;  2ACZ B;  3AB5 A;  2K5P A;  1L0V B; 
#chains in the Genus database with same CATH topology
 1V81 A;  4NQK E;  1DGJ A;  2AEH A;  4N58 A;  1WM3 A;  1WX7 A;  2VH2 A;  4DK5 A;  1RYJ A;  5I4D A;  2WLB A;  1V1O A;  1YJJ A;  2EMT A;  4OVZ A;  2MW5 A;  2XNA C;  2N4F A;  4W9D A;  1WR6 E;  3SDL C;  4K81 A;  2D2Q A;  3A1Q B;  4DDG D;  4GU2 A;  4N59 A;  4DXG A;  4EEW A;  4JIO U;  1XCT L;  2WX0 A;  5D3D A;  4GDL B;  2A5U A;  2K0P A;  4OZC A;  2V3N A;  3Q6B A;  3PLV A;  2DAF A;  4NAW B;  1K51 A;  3AEC B;  3Q3N C;  1IBX A;  1TYG B;  3KUC B;  2KD0 A;  3EFC A;  3U7Z A;  2K8B A;  1F2R C;  4A90 A;  2ASQ A;  2L8J A;  2O2V B;  2QEJ C;  2WU2 B;  4WWO A;  4ANU A;  3AE1 B;  2LD9 A;  3EC8 A;  4WWP A;  1NEK B;  1PGX A;  4KX6 B;  3AEB B;  2JU6 X;  3SFE B;  1E8X A;  2PJH A;  2L32 A;  2OJR A;  3TSS A;  2HJ1 A;  4CYE A;  2LHD A;  4TV3 A;  2XN9 C;  1UGM A;  2PVO D;  3DHI C;  1GAQ B;  2MX2 A;  4II3 B;  4GDK B;  3RMK C;  1MFW A;  4GDL A;  4GN1 A;  3MC9 A;  3BYT B;  3X0W A;  5HKH A;  1IGD A;  3N1X C;  1JRP A;  3GP7 A;  2IY0 B;  2X38 A;  3AE5 B;  1JAL A;  3N32 A;  3BVM A;  3QHT A;  1WYG A;  2JF5 A;  4PYZ A;  1FRD A;  1T0Q C;  4DWF A;  1YOV B;  1KFY B;  1ACC A;  3T3O A;  3LJ3 A;  4NJ6 A;  1JWA D;  1N62 A;  1PUT A;  3TEX A;  3Q8C A;  2O6V B;  1FD6 A;  4RGM A;  4MJS B;  4LJO B;  3UGB B;  3NS8 A;  2BF8 B;  4HCP B;  2M56 B;  1YJ1 A;  2FCQ A;  5GXG B;  5BMH A;  4TQ1 A;  3JYU A;  2R2O A;  4FJV B;  4LNO A;  2KWV B;  3I5J C;  1XLO A;  4AWJ A;  1HE8 A;  2ZJD A;  1BXT A;  4XE0 A;  4EE2 A;  2Y5C A;  2BQQ A;  3R2I A;  1FEH A;  2BYV E;  4NJ7 A;  3VHT C;  4TSS A;  2AWT A;  5D7G A;  2LVO A;  4REZ A;  3BWU D;  1N63 A;  2M19 A;  4IWQ A;  4GLS C;  1WFY A;  2LXC A;  2RD0 A;  1SF0 A;  2BGF A;  2G4D B;  3GZN B;  3N1Z C;  1V2Y A;  2WDR B;  1QOA A;  2NPT A;  4XC2 A;  1F0Z A;  2MH7 A;  1J0G A;  3O65 B;  3RPF C;  5IO9 A;  1CMX B;  3ZNG C;  3H9D A;  1R4N I;  1UWX A;  2N9E B;  3I63 C;  1K53 A;  1QKZ A;  4DBG A;  2XK5 A;  1EO6 A;  2AL3 A;  2BVC A;  2HTM E;  3L10 B;  2MRP A;  4K3B A;  1FCL A;  1L0V B;  2ZNV C;  2LUM A;  4RM8 A;  1HZ5 A;  4MH0 E;  2ZVN A;  2RGF A;  2YEP B;  2KTF A;  3A4R A;  3K9O B;  2KZR A;  1T0S C;  1KLG D;  3CIR B;  2L1A A;  2KXJ A;  3P63 A;  2WXF A;  4LNF A;  3UQB A;  2N1V A;  5JXV A;  3MJW A;  1H4R A;  4KGT A;  3APD A;  4ANX A;  1QOF A;  4DXF A;  4IM3 A;  3M95 A;  4BOZ B;  3U4E G;  4C4V A;  5D3I B;  2IO0 B;  3AU4 A;  1R4M I;  4EOY A;  4ZRJ A;  1VDV A;  1KJT A;  4EKU A;  3Q3F A;  1FXA A;  1QIL A;  1V6E A;  3H7P B;  3NZS A;  4MSM B;  1WXS A;  4B0E A;  2NTS A;  1N61 A;  1ZPS A;  1Z2M A;  3WCQ A;  4MT5 A;  1XD3 B;  5FR3 A;  4RH6 A;  1NVI D;  1FXT B;  1Q10 A;  1MHX A;  1Y56 A;  2KN5 A;  4IDI A;  3FKY A;  1EM7 A;  2LGS A;  5IKC M;  1ET6 A;  3I3T B;  4W9C A;  2XK5 B;  4OZB A;  3M62 B;  3NG0 A;  2LGX A;  1C4C A;  1Q5W B;  3ML8 A;  2GLS A;  4C7Z A;  1LO5 D;  4CQN A;  2RSU A;  3AE3 B;  5DPS A;  2V4I B;  3VAW A;  1JWB D;  5LXH A;  2WHI A;  4HPM B;  2OED A;  2E6X A;  4WH4 A;  1TKY A;  4DXA B;  2KTR B;  4RNA A;  3WAO A;  2KOX A;  2ACZ B;  1IPG A;  3HHM A;  1GJZ A;  3QWZ B;  3V60 A;  2DLB A;  1VCB A;  2GBK A;  4WAF A;  1VZ6 A;  2IGD A;  2PVG C;  3KYC D;  3IT6 B;  3MTN B;  4KKI A;  4M0W B;  2L76 A;  3EUB 2;  5HG2 A;  1UNS A;  4IC7 B;  2IO2 B;  3W2D A;  4ZYN A;  1PGA A;  3WA0 A;  4GIV A;  3KUZ A;  1EWY C;  5HI1 A;  3QIJ A;  5IAA C;  2JQR B;  4RGO S;  3ZNH B;  4BBN C;  1P0R A;  1WMH B;  3PT2 B;  1E8Z A;  3AE8 B;  2MJE A;  4WJO A;  1ENF A;  2HD5 B;  2YVC A;  2BYT A;  2FCN A;  4HDQ A;  3VTW A;  4GDK A;  1T0Y A;  3EGR A;  3IG3 A;  2RR9 A;  4LNI A;  4PS3 A;  3P4P B;  4JL9 A;  4EUT A;  3TIX A;  1G6J A;  1TKG A;  5GMV A;  2M0A A;  4FXC A;  3ZO5 B;  1VR9 A;  5D94 A;  4ICV A;  4B6W A;  3GOE A;  3VFK A;  3JSV A;  2SAK A;  3VTU A;  3Q2A C;  1NI3 A;  4BOS C;  3ZJT A;  3DBL B;  4ZHP A;  2M4N A;  1P7E A;  4JX1 C;  3B9J A;  3VR9 B;  2K3U A;  4LDT B;  4EFO A;  3PLU A;  1H8C A;  1SSN A;  3Q3J A;  2J4X A;  2N7D A;  2NBV B;  2W82 A;  2LGY A;  3DBH I;  2C5L C;  2D3G A;  1UZX B;  2DEN B;  5EE1 A;  3Q8B A;  2VH1 A;  4KDI C;  2AL6 A;  3B1L X;  2DZK A;  4E71 A;  1YX6 B;  4LJP B;  1E8Y A;  3CSF A;  2KDI A;  1XEE A;  4MGY E;  1FFU A;  3JSV B;  2G3Q B;  3I9V 1;  4N9F 4;  5DCN A;  3WAM A;  2IND C;  2JSV X;  5C23 A;  3PHW B;  3GS2 A;  2DAJ A;  2M17 A;  3IHP C;  1TGZ B;  1L0X B;  3H1U A;  2FUH B;  1RWS A;  1E7P B;  5AZH A;  4BKT A;  3OWE B;  4O1N A;  1P3Q U;  2V9H A;  4KZ0 A;  3J9C A;  2C60 A;  3MFG A;  2KDM A;  2ZVO A;  3Q8E A;  2JWZ A;  3IFW B;  1FRR A;  3ZNZ B;  4FN2 A;  2SEB D;  4RF0 A;  3U52 E;  1D5Z C;  4LLG M;  4BKS D;  2LFI A;  4H2A A;  1IUE A;  1KM7 A;  4A9A A;  1VLB A;  4HRS A;  2QHO A;  4IM2 A;  3A9K A;  2ZZP B;  4LNK A;  2RPQ A;  4L23 A;  2JXT A;  5MPO A;  4C80 A;  2L0F A;  1KF6 B;  2L52 A;  3U2S C;  4I6N B;  4W9F A;  3BK2 A;  3TCA A;  4MH8 A;  1NYR A;  1LFD A;  1F1H A;  2KWC A;  1V86 A;  1VZ8 A;  1WGY A;  4QAY A;  2G1E A;  1SE2 A;  3R66 C;  1GB4 A;  3CF6 E;  3L16 A;  1ZKH A;  2KWU B;  3L4P A;  2L05 A;  3CWI A;  2DZM A;  1HA5 A;  1ZW7 A;  5BMI A;  4WJP A;  1LM8 B;  1UD7 A;  4ZRP A;  2ICI A;  5H8Y E;  4M8N A;  4PS8 A;  1JWM D;  4NPN A;  1DOX A;  1RM6 C;  2WDV B;  5J17 A;  5KHQ A;  5IOI A;  3AE6 B;  2WDQ B;  2I2Y A;  4A3O A;  2D11 A;  1IP9 A;  1IGC A;  5IP4 D;  1WIA A;  3EFU A;  3HVD A;  4RM9 A;  1V9J A;  3BK1 A;  3KQ4 A;  2D3B A;  5JHB A;  1FM0 D;  3PZ8 A;  2JPH A;  1GG3 A;  2DWQ A;  4OW0 A;  5EE3 A;  3T3N A;  2FBW B;  1HTO A;  3EA6 A;  1Y8R C;  1YQ4 B;  2XEW A;  3VRA B;  2HJ8 A;  2WYQ A;  2V3S A;  4FLH A;  2KO3 A;  3VVW B;  2JZP A;  4HXD A;  4W9E A;  2QJL A;  5AEK B;  1ZP0 B;  3TJP A;  4JQW C;  2D10 A;  1TIF A;  3HK0 A;  3VUX A;  3ZRC A;  1FXI A;  1J19 A;  4MEM A;  3U7D A;  4ANW A;  5HFY A;  3ZKJ C;  1XLQ A;  3AU5 A;  4KKJ A;  4AS1 A;  1XT9 B;  2G4S A;  3DWM A;  4OVU A;  2CHZ A;  3APC A;  1B1Z A;  1Q0W B;  1D5M C;  5C1Z A;  5IA7 A;  1D4B A;  2ZPY A;  3ZTC A;  2Y3A A;  4EZL A;  1IBX B;  2AX5 A;  2PE9 A;  2QC8 A;  1YN4 A;  3ETR A;  3W1S C;  3PVL A;  3PV1 A;  3OLM D;  4TMA B;  1OEY A;  2R2Q A;  2MLB A;  4KGR A;  4L1B A;  1XO3 A;  3WAN A;  1DOY A;  2DZJ A;  3AMZ A;  3APF A;  3WAL A;  3H7P A;  4LNN A;  3L13 A;  5T8I A;  3VR8 B;  1XCQ L;  2MSE D;  3VDZ A;  3VUY A;  2AQ1 B;  4RGN A;  5BYS A;  3ZGZ A;  2KMC A;  3VUW A;  2NCN A;  2KDB A;  1R7S A;  2PE6 B;  2LI5 A;  3DVG X;  2D07 B;  1MG8 A;  1K8R B;  2FIF A;  3QQ8 B;  1TKE A;  2KK8 A;  2LMC A;  1C9F A;  4HPP A;  1LXD A;  2ZPN A;  2Y5P A;  3RD2 A;  3PS6 A;  4C4V B;  1F77 A;  5C3J B;  4GMV A;  4DDI D;  2GBN A;  5DPW A;  1FO4 A;  1SBB B;  2QDF A;  3FAH A;  2CS4 A;  2K1F A;  4I6P A;  1T6B X;  2MJD A;  1OGW A;  3ZDT A;  2KC1 A;  2J7Q B;  3FIL B;  4DHZ B;  1V49 A;  1L7Y A;  1T3Q A;  1LGR A;  1OEY J;  4ARI A;  1OQY A;  1UH6 A;  4MGK E;  1E9M A;  3AE9 B;  3CST A;  1JML A;  4IWO A;  2INP E;  2QSD A;  3AEA B;  1I35 A;  4M0W A;  4BBN F;  1TBE A;  3ZXV A;  2R61 A;  2CJN A;  2RDH A;  2LVP A;  1C76 A;  1NEN B;  2WXH A;  4NQL B;  4FHK A;  2N9P C;  2J53 A;  1FIQ A;  4JWU C;  3VTV A;  2K25 A;  2AQ2 B;  3IVF A;  3KYD D;  3Q14 C;  1V1P A;  2FCM A;  3RNE C;  4S17 A;  2CU3 A;  3PRZ A;  2BYE A;  2N9L A;  1FCC C;  3B2F A;  3SU8 X;  3H6N A;  3A1Q A;  3ZTD A;  3MP9 A;  2LWP A;  5G5H A;  1JW9 D;  5AZF A;  3Q3M C;  3NOB A;  1EF5 A;  2EKE C;  1ZXH A;  4KV2 A;  3ENE A;  4KVG B;  2Z0D B;  1L0Y B;  3N1Y C;  4K1R B;  2JZZ A;  1C3T A;  4W9G A;  3BY4 B;  3KUD B;  3LYY A;  3V3X A;  2ZEQ A;  1WRD B;  4L2Y A;  3QAQ A;  3DWG C;  4YTM B;  4ZHO A;  1DOI A;  4A55 A;  4ITK A;  5EE0 A;  3FC4 A;  1WE6 A;  2K8C A;  2I1J A;  3LXF A;  1E10 A;  2JRI B;  2MBO A;  4KIK B;  2L00 B;  4AP4 C;  5DPR A;  1KTK A;  1GC6 A;  4GOC A;  1AN8 A;  2KYW A;  2LZ6 A;  3PSE B;  2JYT A;  2BTE A;  4R3D A;  2IGG A;  2C7N B;  2CHX A;  4E74 A;  1NYQ A;  3DVN V;  3UIO B;  4LDT D;  4P1B C;  4HLE A;  3TEZ A;  3AEG B;  2Y5B B;  3SR6 A;  1L2N A;  4HPL B;  1WXA A;  1OQQ A;  2MJ3 A;  5H92 C;  2KKC A;  3Q69 A;  4FJZ A;  4HWI B;  2KFK A;  4HDO A;  4DHJ D;  1JQ4 A;  3JVZ X;  1WF9 A;  2L0T A;  4MDK E;  2V1Y A;  2NBW B;  4DQO C;  3RCZ A;  3L54 A;  1YN5 A;  1TS4 A;  1U4A A;  4ZDV A;  2KX0 A;  1E8W A;  4HJK A;  3V62 A;  2CU1 A;  2IDY A;  3NUH B;  4ZYS A;  1ZUD 2;  2KLG A;  2MHJ A;  3C19 A;  3NJT A;  3UIN B;  1K52 A;  1UUP A;  2WXJ A;  3D32 A;  1C1Y B;  4ARC A;  2WNM A;  2W54 A;  3AE4 B;  4PK1 A;  1I4X A;  1XLP A;  3ABV B;  1WX8 A;  4IW0 A;  3AXC A;  3IT4 B;  4BKS A;  2K39 A;  3QA8 A;  3P4R B;  2IO1 B;  4KSL C;  1S3S G;  3P4S B;  3R7Q A;  3BZD B;  3C0R B;  3W5U B;  1T5X D;  1PQS A;  2TSS A;  1M94 A;  1JRO A;  2KAJ A;  1F52 A;  2EEL A;  2BKR B;  2IGH A;  1QF6 A;  2EKI A;  2AYO B;  2JT4 B;  4TUU A;  4FBJ B;  3H7S A;  1E6E B;  3V61 A;  1P9D U;  3QC8 B;  5KHO A;  4B95 A;  4F8C B;  2E3T A;  2BB6 A;  2JXX A;  1QLB B;  5BYQ A;  4HEA 1;  3R7R A;  2WWZ A;  4YSZ B;  2PKO A;  3ALB A;  5D6J B;  2CJO A;  2KX3 A;  1PDX A;  3PHX B;  3WIM A;  4JE3 B;  3R8B A;  1VD2 A;  4MGI E;  2MEK A;  1C77 A;  5D2M B;  3ZJV A;  2KC2 A;  2ONQ A;  1OTR B;  1J7B A;  1WY8 A;  3ZNI D;  1YJI A;  2WXI A;  2W3S A;  1WJN A;  1KOT A;  2WXL A;  2MCN B;  3N9Y C;  3CMM B;  1HTQ A;  3W1Y A;  3T8M A;  1SJH D;  4GB9 A;  2GBR A;  2NPT B;  1NI2 A;  1YN3 A;  2KQS A;  3TEY A;  3U30 A;  3IAM 1;  2IBI B;  2G45 B;  3RT3 B;  4YTN B;  5TR5 A;  1XF5 L;  2WXM A;  3IBE A;  1WXM A;  2NR2 A;  2IPK D;  2MP2 B;  2N9K A;  2QIL A;  1E5W A;  2DNF A;  1VZ7 A;  4ASW C;  4LK0 M;  1TJE A;  5IN7 A;  3LB8 C;  2GRI A;  4P6V F;  1JWU D;  3AE2 B;  4KDL B;  2WQY B;  2H89 B;  2PIA A;  3SEB A;  4C00 A;  2WP9 B;  3SFD B;  4DHZ E;  2MBH A;  4WWN A;  4NAM A;  3TEW A;  2KJR A;  1KH0 A;  2MQJ A;  3DBS A;  2IY1 B;  2GBM A;  4OHJ A;  2J0K A;  1V97 A;  2KMM A;  3HM3 A;  1KRH A;  1ZXI A;  4G3X B;  4W9L A;  4C7Y A;  4XWW A;  4HJG E;  1I4P A;  1YNT E;  2FAZ A;  3OG5 A;  3RNB C;  3KWV A;  3V6C B;  3SD5 A;  3FIL A;  1JCK B;  2ZCB A;  4ZRK A;  4TKN A;  3W9C B;  3C8Y A;  1TZ1 A;  4WUR A;  4US8 A;  3DVG Y;  3IXS A;  4BAX A;  3NS1 A;  2FE8 A;  1E7V A;  2K6Q A;  3DQV A;  4MAC A;  1I4Q A;  1CQV A;  2KQ4 X;  3B0A A;  1MJD A;  2WX1 A;  4IM0 A;  1YIW A;  1J7A A;  3GE8 C;  2IZV B;  2MP2 A;  1ZDV A;  3Q3O C;  3ZXR A;  2C7H A;  1ZOY B;  1WGH A;  4A3P A;  2DBY A;  3E9S A;  2QMT A;  3BII D;  2REX A;  3PO0 A;  1AW7 A;  3ECI A;  4YXD B;  1IYF A;  3AB5 A;  2UWQ A;  2GMI C;  3ZYY X;  3I57 A;  1V5O A;  5AZG A;  1MPE A;  1Q1O A;  1WX9 A;  3NRZ A;  3AEE B;  4C56 C;  3NVW A;  1ZDX A;  3M63 B;  4M00 A;  1T0R C;  5CX3 A;  4OZA A;  4NNJ B;  2KDE B;  2W9N A;  3DBR I;  3W5V B;  1EU4 A;  3TL5 A;  4MGZ E;  2M1M A;  1C4P A;  3ZW3 A;  2RDG A;  4EZK A;  1C79 A;  4PS7 A;  1SE3 A;  1D6E C;  4HKZ E;  2WU5 B;  2JYE A;  2V4L A;  2C7M B;  1SB3 C;  4ICU A;  2J0J A;  1GB1 A;  3URY A;  4AQ7 A;  2AQ3 B;  3AV8 A;  5E6N A;  1L5P A;  5E6P A;  2JY6 A;  4USA A;  4ZRQ A;  4UDU C;  2C9W B;  2NTT A;  1SE9 A;  2I1K A;  3S2A A;  2FID A;  3O13 A;  4JGH B;  4BVU C;  4XZ4 A;  5BO4 B;  5CHV C;  2MBE A;  2Q5W D;  2KJ6 A;  4MEL A;  2EMS A;  1WH3 A;  4KSK C;  2DX5 B;  3PZ7 A;  1PFD A;  1ZE3 D;  1J8C A;  3GE3 C;  5C2T B;  3QK0 A;  1CZP A;  5E6O A;  1VRA B;  4AJW A;  3KW5 B;  3DHH C;  3MC0 B;  1TS2 A;  3RUL A;  3BYY B;  1RRB A;  2ZW0 A;  2LGD A;  4WAA A;  1GNU A;  4GXB A;  2KVR A;  5G2N A;  1RFA A;  1WE7 A;  3PGE A;  2FNJ B;  5EDS A;  1BT0 A;  1F2R I;  1TS5 A;  2J52 A;  4HRO A;  1P7F A;  2B76 B;  3SHQ A;  3Q8F A;  2WXR A;  4ACF A;  1MG4 A;  1L4Z B;  3ZQ4 A;  2JWU A;  3EHV A;  3L08 A;  3RZF A;  1B9R A;  1J7C A;  3LDZ E;  4FUL A;  3KH0 A;  2LXA A;  1I42 A;  4PT5 A;  4RFB A;  1QZE A;  4E3C A;  1GPX A;  4TQ0 A;  4P1C C;  1YQ3 B;  4G11 A;  1I4R A;  5JZE B;  4W9J A;  5LNK 1;  3V05 A;  1EWC A;  2DYM A;  3OAW A;  3U8Z A;  3A4S C;  1UBQ A;  3ML9 A;  3JW0 X;  2JUO A;  2MWS B;  3NZ3 A;  4IOI E;  1AAR A;  3EEC A;  1WGG A;  3K9P B;  2N0S B;  4A8X C;  1FFV A;  1Z5S B;  2WXG A;  3RNA C;  2BS4 B;  3A9K B;  4II2 B;  3ZUN A;  4XDD A;  2XBB C;  2KAN A;  4KIK A;  5J18 A;  4MM3 A;  1AWD A;  2HDE A;  4GGQ A;  5BMG A;  4K7U A;  3RFZ B;  2PW9 A;  4RCO A;  3QX1 A;  4NY0 A;  1UGJ A;  4K3C A;  4EZJ A;  2LHE A;  4BFR A;  2UU7 A;  1CK1 A;  4CHK A;  4JPS A;  2KJH B;  1FNV A;  1QT9 A;  2L7R A;  2YEP F;  1RLF A;  1SEB D;  2BYF A;  5FK9 C;  3UIP B;  2GI9 A;  2W3R A;  1SGH A;  4XGA B;  4RMA A;  3HIZ A;  5DPT A;  2NS5 A;  3HUI A;  3L0W B;  2A4Z A;  2PEA A;  3AM9 A;  4I6L B;  1WYW B;  1LQB A;  3AED B;  3T9L A;  2KFK B;  3B08 A;  4YTP B;  1SJE D;  2RMM A;  4YSY B;  2RPV A;  3RNG C;  1KLV A;  3RUI B;  4XDC A;  4HK2 A;  1GOZ A;  2BB5 A;  2INN E;  2PMV A;  3QJZ A;  4M8M A;  3UQA A;  5E6J A;  3PZD A;  2N7J A;  3QCA A;  3ZLZ A;  4Q2J A;  2KNB A;  4LTU A;  3BVG A;  2WXN A;  2ON8 A;  5G55 A;  4ZOH C;  1KLU D;  2O6V D;  1WJU A;  3V6E B;  2LEK A;  1WM2 A;  2DHZ A;  1L6V A;  1WXQ A;  2WXO A;  1V1P B;  2WXK A;  2CKH B;  3AE7 B;  4S0R A;  2BBC A;  4FJY A;  4F1S A;  1WXV A;  1YMH E;  1P98 A;  2FCS A;  4P7I A;  5L95 C;  2WDT B;  2INC C;  4NJC A;  2KFJ A;  2GBJ A;  2LRW A;  3PPA A;  5CHW A;  4WJN A;  1PGB A;  3VH4 B;  2G9H D;  4HKQ A;  3N3K B;  3P42 A;  1JWS D;  2OJW A;  3H8H A;  4YWG G;  1XQQ A;  2LVQ A;  2IYD B;  3HVZ A;  4US9 A;  1C78 A;  4RF1 A;  1UWM A;  5FR6 A;  3R2T A;  2MBB B;  2K5P A;  1BML C;  2WGS A;  5BYR A;  4X57 B;  2L83 A;  3VRB B;  3DDC B;  1UEL A;  1D5X C;  3IAS 1;  3HRD D;  1V5T A;  2ZW1 A;  2KMA A;  3ZJU A;  1E7U A;  1TT5 B;  4YL8 A;  3PRM B;  4WWM A;  1I7H A;  1XXG A;  4WQM A;  3AN1 A;  3DPD A;  3DOW A;  4GSW A;  4P16 A;  1YD8 U;  1N6Z A;  2DYB A;  2KHW B;  3ZVV A;  3RI7 C;  4XYC A;  1TY0 A;  2NBU A;  1E0Z A;  2H88 B;  1FPY A;  1OFF A;  3W1S A;  2WXP A;  2V0G A;  1A5R A;  1SIJ A;  1GC7 A;  4AOF A;  1HZ6 A;  2M0X A;  1VJK A;  3KVF B;  1WGR A;  1EUV B;  4OVV A;  4A20 A;  4CO7 A;  3DCG A;  2K9X A;  2Z8L A;  2IO3 B;  4KGS A;  2K6D B;  3HM6 X;  4N6E B;  4YT0 B;  5JH5 C;  5AUK A;  4G50 A;  1ROE A;  3P2B A;  2D5G A;  1R4M B;  4W9K A;  1L4D B;  3AEF B;  1C4A A;  2K22 A;  4IUM B;  4IG7 B;  2BKF A;  2O6V A;  1V8C A;  3KLS X;  1FNW A;  5EE9 A;  1ISN A;  1ZGU B;  3MJ5 A;  2BWE S;  3B2G A;  1ESF A;  3R3M A;  1F9J A;  5AUI A;  3NVV A;  1S1Q B;  2KAC A;  3ZDM C;  2JX5 A;  4PYU A;  2M8S A;  4FHJ A;  2N7E A;  3DBH B;  1UBI A;  3VQI A;  2KN4 A;  1WZ0 A;  2VZK D;  3NY5 A;  1I4G A;  1WWT A;  1WRI A;  1RAX A;  4WQO B;  2VRR B;  2J0M A;  3A33 B;  3RZW C;  2D3C A;  1TZO A;  3ONS A;  3QAR A;  1WSP A;  5CHF A;  5FKA C;  3TBL D;  1ET9 A;  2KDF B;  2KVZ A;  2N1W A;  2QIE B;  2I38 A;  1YX5 B;  3NHE B;  1HXY D;  1QOB A;  3NVY A;  3DBR B;  3E56 A;  3WAP A;  1WJ6 A;  1STE A;  4D2K A;  2LJI A;  4MSQ B;  4J6I A;  3UF8 A;  1NBF C;  4XX5 A;  5J2R A;  2PLP A;  1TTN A;  1SIF A;  3PRP B;  1M4V A;  2JZ3 B;  1HQR D;  2BS2 B;  2VZK B;  2FUG 1;  1GUA B;  1TS3 A;  2X8X X;  2KQ7 A;  3N20 C;  4LCD E;  2NMQ A;  3BIN A;  2KWD A;  5G5G A;  3RN9 C;  2LUE A;  4BZA A;  1N5X A;  1HEZ E;  1WJ4 A;  4IKG A;  1SXT A;  1WGD A;  1YQB A;  3TUO A;  4WIP A;  3OJ4 B;  4BKG A;  1WGK A;  3PRE A;  1QQR A;  3BVZ A;  4M02 A;  2DYO A;  2NVU I;  2KLC A;  2MBQ A;  2QCZ A;  2LJ5 A;  5CTR C;  1N5W A;  3OJ3 A;  4FA6 A;  1PYW D;  2Z59 B;  2BWF A;  3L17 A;  3VH3 B;  4A6Q A;  1FNU A;  2KTR A;  1EF1 A;  2V3P A;  3M3J A;  4K7W A;  3PTF C;  3X23 A;  4J3O D;  1MHH E;  2WXQ A;  3DVN U;  2N9X A;  4HVB A;  2IJ0 A;  5LXI B;  2J42 A;  1DYQ A;  1SE4 A;  3GZN I;  4ANV A;  1TY2 A;  2KT7 A;  4HCN B;  3TMP B;  5HHD G;  5TSS A;  4K7S A;  2GOW A;  4AUQ C;  4NZL B;  1RFK A;  1BUI C;  1FMA D;  3A9J B;  4URK A;  4M01 A;  1WI0 A;  3UI3 A;  3P4Q B;  3RNC C;  2LRU A;  1WMH A;  4W9I A;  3ZIM A;  2PPH A;  2HTH A;  2OOB B;  2LGI A;  3NZU A;  2MA9 B;  2BW2 A;  1N60 A;  4MJS A;  1CJE A;  1NDD A;  2UYZ B;  2Z0E B;  2OHF A;  3AH7 A;  2CR5 A;  4AJY B;  3VXW A;  3RNF C;  3KWL A;  2ZCC A;  3MHZ A;  2D3A A;  2DZI A;  3NVZ A;  5L83 A;  4IWP A;  1OQR A;  2CHW A;  3MHS D;  2B3A A;  4B0M A;  3AUL A;  2LAS A;  4WJQ A;  2RDB C;  3ZRF A;  2BPS A;  3N30 A;  2JRH A;  4FAD A;  1I4H A;  1WZ3 A;  4F7Z A;  1K50 A;  1P1A A;  3AI5 A;  1MVK A;  4MM3 B;  2HE7 A;  2ZNV B;  3GB1 A;  4DHJ B;  1A70 A;  4ZRI A;  1V80 A;  4B9K A;  1WR1 A;  1MI0 A;  3DBL I;  1XLN A;  2YLM A;  4JLC A;  1QOG A;  1E90 A;  2GB1 A;  1X1M A;  5JHA A;  2WS3 B;  3MC8 A;  3DHG C;  1EU3 A;  3Q8A A;  2JVC A;  2W55 A;  4XWT A;  1JRU A;  2BS3 B;  4W9H A;  1UF0 A;  2L3Z A;  2PTL A;  1AYF A;  2K8H A;  4YSX B;  3A9J A;  2BT6 A;  1D3Z A;  1R4N B;  4JWS C;  4KZC A;  2O2V A;  5LLI A;  3P1M A;  4G0N B;  1L6U A;  4RGT A;  4NAW A;  3RYT A; 
#chains in the Genus database with same CATH homology
 1FFU A;  3HUI A;  1DGJ A;  3AM9 A;  2IDY A;  3NUH B;  4ZYS A;  4N58 A;  1ZUD 2;  3I9V 1;  3AED B;  2JSV X;  1RYJ A;  4YTP B;  1SJE D;  2RMM A;  5I4D A;  4YSY B;  2WLB A;  2RPV A;  3GS2 A;  1V1O A;  1YJJ A;  1K52 A;  1UUP A;  4OVZ A;  2XNA C;  1L0X B;  2WXJ A;  4XDC A;  4ARC A;  2WNM A;  1RWS A;  2W54 A;  3AE4 B;  1E7P B;  1I4X A;  1GOZ A;  1XLP A;  3ABV B;  3OWE B;  4O1N A;  2BB5 A;  2INN E;  2PMV A;  4N59 A;  4DXG A;  3J9C A;  1XCT L;  5E6J A;  3MFG A;  5D3D A;  4GDL B;  2N7J A;  2KDM A;  2K0P A;  4LTU A;  4OZC A;  3BVG A;  4Q2J A;  2V3N A;  2WXN A;  3Q8E A;  3IT4 B;  1FRR A;  2ON8 A;  4NAW B;  1K51 A;  3P4R B;  4ZOH C;  3P4S B;  3AEC B;  3BZD B;  1KLU D;  3W5U B;  1T5X D;  2SEB D;  2TSS A;  4RF0 A;  1JRO A;  1IBX A;  1TYG B;  2KAJ A;  2EEL A;  2LEK A;  3U52 E;  2IGH A;  1D5Z C;  1QF6 A;  3U7Z A;  2EKI A;  1L6V A;  4LLG M;  2LFI A;  1WXQ A;  2WXO A;  4H2A A;  1IUE A;  1F2R C;  1V1P B;  4A90 A;  2WXK A;  4A9A A;  1VLB A;  1E6E B;  4HRS A;  3AE7 B;  2QEJ C;  2WU2 B;  3AE1 B;  2BBC A;  2E3T A;  2BB6 A;  5BYQ A;  1NEK B;  1QLB B;  1PGX A;  4HEA 1;  4KX6 B;  3AEB B;  2JU6 X;  4YSZ B;  2PKO A;  3SFE B;  1YMH E;  4L23 A;  2JXT A;  5MPO A;  4C80 A;  2L32 A;  3TSS A;  1KF6 B;  2CJO A;  2L52 A;  3U2S C;  1PDX A;  2LHD A;  2XN9 C;  4NJC A;  4JE3 B;  2PVO D;  3BK2 A;  3R8B A;  1GAQ B;  4MH8 A;  2MEK A;  1C77 A;  1PGB A;  3ZJV A;  2ONQ A;  4GDK B;  1NYR A;  1J7B A;  2G9H D;  4HKQ A;  1YJI A;  3P42 A;  2WXI A;  1JWS D;  3H8H A;  1VZ8 A;  2W3S A;  3BYT B;  2G1E A;  4YWG G;  1SE2 A;  1GB4 A;  3HVZ A;  4US9 A;  1C78 A;  3L4P A;  2WXL A;  4RF1 A;  1IGD A;  3N9Y C;  1UWM A;  1JRP A;  3R2T A;  2K5P A;  1BML C;  3GP7 A;  1SJH D;  2X38 A;  3AE5 B;  1JAL A;  3CWI A;  3BVM A;  1HA5 A;  1WYG A;  5BYR A;  5BMI A;  1YN3 A;  2L83 A;  4ZRP A;  1FRD A;  3VRB B;  2ICI A;  3TEY A;  5H8Y E;  3IAM 1;  1D5X C;  3IAS 1;  1JWM D;  4YTN B;  1KFY B;  1ACC A;  3T3O A;  1XF5 L;  1DOX A;  3HRD D;  1RM6 C;  2WDV B;  2ZW1 A;  2WXM A;  3ZJU A;  3AE6 B;  1JWA D;  1N62 A;  2WDQ B;  2I2Y A;  1PUT A;  3TEX A;  2IPK D;  4WWM A;  1I7H A;  3Q8C A;  1XXG A;  2N9K A;  2QIL A;  1IGC A;  3AN1 A;  4WQM A;  1FD6 A;  3HVD A;  4RGM A;  3BK1 A;  1VZ7 A;  3KQ4 A;  4P16 A;  4LK0 M;  1FM0 D;  1TJE A;  3PZ8 A;  2M56 B;  3LB8 C;  2GRI A;  4P6V F;  2DWQ A;  1JWU D;  4OW0 A;  5EE3 A;  3AE2 B;  3T3N A;  2FBW B;  2H89 B;  2PIA A;  2WQY B;  3SEB A;  2WP9 B;  5GXG B;  5BMH A;  3SFD B;  4TQ1 A;  1TY0 A;  3EA6 A;  1E0Z A;  1YQ4 B;  2H88 B;  1OFF A;  4NAM A;  3VRA B;  3TEW A;  3W1S A;  2WXP A;  2V0G A;  1SIJ A;  1XLO A;  1KH0 A;  1HZ6 A;  1VJK A;  4OHJ A;  1BXT A;  4XE0 A;  1V97 A;  4EE2 A;  2Y5C A;  2KMM A;  3R2I A;  1FEH A;  1KRH A;  1ZXI A;  2K9X A;  4TSS A;  2Z8L A;  2JZP A;  4KGS A;  4C7Y A;  5D7G A;  4XWW A;  4REZ A;  4YT0 B;  4N6E B;  3BWU D;  1N63 A;  2QJL A;  1I4P A;  1YNT E;  1ZP0 B;  2M19 A;  4HJG E;  5AUK A;  3KWV A;  1ROE A;  2D5G A;  1L4D B;  4GLS C;  3FIL A;  3AEF B;  1C4A A;  2K22 A;  1JCK B;  1V8C A;  3KLS X;  3W9C B;  1FNW A;  3C8Y A;  1SF0 A;  5EE9 A;  1FXI A;  4WUR A;  3MJ5 A;  4US8 A;  5AUI A;  3B2G A;  1ESF A;  2WDR B;  3IXS A;  3NVV A;  5HFY A;  1XLQ A;  4KKJ A;  2KAC A;  3NS1 A;  1QOA A;  2JX5 A;  4AS1 A;  2FE8 A;  4MAC A;  3DWM A;  1I4Q A;  1F0Z A;  1CQV A;  2KQ4 X;  2MH7 A;  1B1Z A;  3RPF C;  1D5M C;  1D4B A;  1J7A A;  3VQI A;  2KN4 A;  2Y3A A;  1ZDV A;  1IBX B;  2AX5 A;  2VZK D;  1ZOY B;  1UWX A;  2DBY A;  3E9S A;  1I4G A;  2QMT A;  3BII D;  1YN4 A;  1K53 A;  1QKZ A;  1WRI A;  1WWT A;  1AW7 A;  3ETR A;  3PO0 A;  4YXD B;  2HTM E;  3AB5 A;  4TMA B;  1FCL A;  1L0V B;  4KGR A;  2LUM A;  4L1B A;  1XO3 A;  1HZ5 A;  3ZYY X;  1TZO A;  1DOY A;  1WSP A;  3I57 A;  1MPE A;  5FKA C;  2YEP B;  3NRZ A;  3AMZ A;  3AEE B;  4C56 C;  3NVW A;  1ZDX A;  1ET9 A;  4OZA A;  5T8I A;  3VR8 B;  2QIE B;  1KLG D;  3W5V B;  3CIR B;  2I38 A;  1XCQ L;  2L1A A;  1EU4 A;  2AQ1 B;  1HXY D;  4RGN A;  1QOB A;  5BYS A;  1C4P A;  3NVY A;  3P63 A;  3ZGZ A;  3E56 A;  2WXF A;  2RDG A;  1STE A;  1C79 A;  4D2K A;  1R7S A;  2LJI A;  1SE3 A;  5JXV A;  1D6E C;  4HKZ E;  2WU5 B;  2JYE A;  1SB3 C;  2PLP A;  4KGT A;  1QOF A;  1M4V A;  4DXF A;  1TKE A;  3URY A;  1GB1 A;  4AQ7 A;  1HQR D;  2AQ3 B;  2BS2 B;  2LMC A;  2VZK B;  1C9F A;  3U4E G;  2Y5P A;  2FUG 1;  3AV8 A;  1TS3 A;  1L5P A;  4USA A;  5D3I B;  2NMQ A;  2KWD A;  5G5G A;  4ZRQ A;  4UDU C;  2NTT A;  1VDV A;  1F77 A;  5C3J B;  1N5X A;  1HEZ E;  1FXA A;  3O13 A;  1QIL A;  4IKG A;  1FO4 A;  1SXT A;  3TUO A;  4WIP A;  1SBB B;  1WGK A;  4B0E A;  2NTS A;  1N61 A;  1ZPS A;  3FAH A;  3WCQ A;  4MT5 A;  1QQR A;  3BVZ A;  4RH6 A;  2DYO A;  5FR3 A;  1NVI D;  1Q10 A;  1Y56 A;  1MHX A;  2Q5W D;  4IDI A;  1T6B X;  1EM7 A;  2MJD A;  1ET6 A;  3PZ7 A;  1N5W A;  1PFD A;  3FIL B;  1T3Q A;  1ZE3 D;  1PYW D;  4ARI A;  5C2T B;  4A6Q A;  1CZP A;  1E9M A;  1VRA B;  4OZB A;  1FNU A;  3AE9 B;  1JML A;  3MC0 B;  1C4C A;  1TS2 A;  3BYY B;  2V3P A;  4C7Z A;  1LO5 D;  2ZW0 A;  2INP E;  1MHH E;  2WXQ A;  2QSD A;  4J3O D;  3AEA B;  4CQN A;  3AE3 B;  4M0W A;  2V4I B;  2IJ0 A;  1JWB D;  2J42 A;  1DYQ A;  1SE4 A;  2R61 A;  2CJN A;  2OED A;  1TY2 A;  2E6X A;  2RDH A;  1C76 A;  4WH4 A;  1TKY A;  1NEN B;  4RNA A;  5HHD G;  5TSS A;  2WXH A;  2ACZ B;  4NZL B;  2J53 A;  1RFK A;  1BUI C;  1FMA D;  2DLB A;  1F2R I;  1TS5 A;  2J52 A;  1VZ6 A;  4WAF A;  2IGD A;  1FIQ A;  2PVG C;  4JWU C;  3IT6 B;  4HRO A;  4KKI A;  1P7F A;  2AQ2 B;  3EUB 2;  2B76 B;  3UI3 A;  1V1P A;  3P4Q B;  3Q8F A;  2WXR A;  5HG2 A;  2CU3 A;  1L4Z B;  1UNS A;  3ZQ4 A;  2JWU A;  2N9L A;  3W2D A;  1FCC C;  1B9R A;  2LGI A;  3B2F A;  1PGA A;  1J7C A;  4PT5 A;  2BW2 A;  4RFB A;  1N60 A;  1GPX A;  1CJE A;  3MP9 A;  1EWY C;  5HI1 A;  5G5H A;  4TQ0 A;  2OHF A;  1JW9 D;  2JQR B;  3AH7 A;  4RGO S;  3KWL A;  1YQ3 B;  3AE8 B;  1ZXH A;  3MHZ A;  2MJE A;  1ENF A;  1I4R A;  3NVZ A;  2BYT A;  1L0Y B;  1OQR A;  4B0M A;  5LNK 1;  3LYY A;  3V05 A;  3EGR A;  3V3X A;  1EWC A;  2DYM A;  3P4P B;  4L2Y A;  3DWG C;  4YTM B;  4ZHO A;  1TKG A;  1DOI A;  1I4H A;  3NZ3 A;  4A55 A;  4ITK A;  4IOI E;  2M0A A;  5EE0 A;  3FC4 A;  4FXC A;  3LXF A;  1VR9 A;  1K50 A;  1E10 A;  2N0S B;  4A8X C;  1FFV A;  1MVK A;  2WXG A;  4MM3 B;  2BS4 B;  4XDD A;  3GB1 A;  1KTK A;  2SAK A;  1NI3 A;  3ZJT A;  1A70 A;  1AN8 A;  4ZHP A;  2JYT A;  2BTE A;  1AWD A;  2HDE A;  1P7E A;  4R3D A;  2IGG A;  1MI0 A;  4JX1 C;  1NYQ A;  5BMG A;  1XLN A;  3B9J A;  3VR9 B;  3TEZ A;  1QOG A;  3RFZ B;  3AEG B;  2K3U A;  2GB1 A;  2PW9 A;  3SR6 A;  4RCO A;  1SSN A;  1UGJ A;  2WS3 B;  2J4X A;  1EU3 A;  1OQQ A;  2MJ3 A;  3Q8A A;  2LHE A;  2W55 A;  2W82 A;  4XWT A;  2BS3 B;  5H92 C;  1CK1 A;  3Q69 A;  4JPS A;  2PTL A;  1AYF A;  1FNV A;  1QT9 A;  4YSX B;  2BT6 A;  5EE1 A;  4JWS C;  3Q8B A;  2YEP F;  1JQ4 A;  3P1M A;  1SEB D;  5FK9 C;  4DQO C;  2GI9 A;  2W3R A;  1L6U A;  4RGT A;  1YN5 A;  1TS4 A;  1XEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...