1WGUA

Solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amyloid beta (A4) precursor protein-binding, family B, membe
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wguA01
2DHIA 2LULA 1U5FA 1WGUA 1W1HA 3DXCA 1GC6A 2JP2A 1NTVA 1MKEA 1U2BA 2LOZA 3PVLA 2BCJA 3P6AA 2FJLA 2HTHB 1NTYA 2EJ8A 1XODA 5CLQB 3ODOA 1BAKA 1PLSA 3M1IB 2W2WA 3V5WA 3MPXA 1DDMA 5DHFB 4DXAB 2M38A 2RUKB 2RLOA 1EF1A 2EC1A 3F0WA 1LB1A 4L6EA 1Y5OA 2YS5A 4GMXB 4WVFB 3KSYA 2COCA 2QKLA 4YL8A 1P6SA 2VRWB 2HE7A 1FB8A 3HK0A 2YS1A 2YT0A 5KQ1A 4HB0B 4YONA 1X11A 5FI1A 2LOXA 3SNHA 4PQ0A 2D4QA 5JLJB 3OANA 2ZPYA 1MK7B 1MPHA 2Q13A 1SGHA 3HQCA 2DFKA 3QBVB 4K2PA 2DKQA 3WA0A 1EVHA 2OQBA 3PZDA 4ZRJA 5DIFB 2D2QA 3G9WA 2Z0QA 4HAYB 4A6HA 2YVCA 5JHHA 2W2XD 2CY5A 5HE1A 4Y94A 2R09A 4HB2B 3FM8C 1WG7A 2P0FA 1X1GA 3ULBA 3SYXA 3HW2B 1V89A 3F5RA 2UVMA 1LW3A 1I7AA 3IVFA 1PMSA 2COFA 1RJ2A 2DX1A 1UNPA 1XCGA 2Y8GA 1GG3A 4MT7A 4XWXA 1DYNA 5HE0A 4TKNA 5L81A 4BBKA 2V76A 2M14A 1MAIA 3PVWA 2D10A 1V61A 4GMVA 3TCAA 5D3WA 4A6KA 2CODA 1M7RA 5HE2A 1NI2A 3T06A 3CXBB 4IAPA 3TVVA 3ULCA 1AQCA 2G35A 3TO1A 2KGXB 1PFJA 4CYEA 1UNRA 5D3VA 1DBHA 2XQNM 2P8VA 3QWMA 5CLLB 3GYOA 4KHOA 4MY6A 4K81A 2J0JA 4PNKA 1U5GA 4GZUA 4HAWB 3UZTA 2I1KA 4ZRKA 4DX90 3D8DA 4A6FA 1FHOA 1W1DA 2D9ZA 5J3TA 1KI1B 1ZVRA 2PZ1A 2NZ8B 2GCLA 2RNRB 2VSZA 3A8QA 4Z2MB 5D3YA 5C16A 3PEGA 4A6FB 1OY2A 1ZC4B 1X05A 2UZSA 2VKIA 2J0MA 3SO6A 4IFSA 2LKOA 2Y7BA 3A8PA 4HDOA 3ZVRA 4GXBA 2AL6A 2KCJA 2DKPA 3RCPA 2D9YA 1H4RA 3ODWA 3PSCA 4CHMA 1J19A 5KCVA 4A5KA 2Y8FA 2LG1A 1OQNA 3GYPA 1Y19B 2EMTA 2NMBA 2Z0OA 1ISNA 1BTNA 3PG7A 1FHXA 1UEFA 3TW1A 1WJ1A 1FGZA 2LYDA 1UPRA 3PP2A 4GN1A 5DH9B 4F7GA 1I2HA 3P7ZA 1V5PA 4NY0A 2OTXA 1QQGA 1U5EA 2P0HA 2K00A 3VOQA 2K2UA 3DXEA 5DI9B 2DTCA 4DX8A 2IYBA 4HAXB 3QIJA 1TQZA 5C6RA 2MWNB 2RGNB 4DBBA 3FEHA 1BTKA 2I1JA 2DA0A 1QC6A 3DXDA 2D9WA 2I5CA 2ELAA 2YRYA 4CHJA 3BINA 1XX0A 2R0DA 1W1GA 1P3RA 5D3XA 2IFSA 1EAZA 4HATB 3A98B 1XKEA 2K2JA 1H10A 2H7DA 1WJMA 4KVGB 5J3QA 2DLWA 2X18A 4HB3B 1IRSA 1MK9B 2L2IA 1FGYA 2RSGA 3WYFB 2MDXA 4HAVB 2AEHA 5HE3A 1Q67A 4ZRIA 2YS3A 4IOYX 2DYQA 2L1CA 4WJ7A 4WSFA 2DYNA 1DDVA 3KRWA 3VIAA 3ML4A 1EGXA 1P5TA 4HAZB 1Z87A 1N3HA 1XD4A 3N7CA 1UNQA 2E2XA 3X23A 2DN6A 4KAXB 1KZGA 2D9VA 2DHKA 1B55A 3U8ZA 2ADZA 3FSSA 4P7IA 1U27A 2YSZA 5FI0A 3KZ1A 3LJUX 4MK0A 2ROVA 3D8EA 3PVUA 2DHJA 2N23A 5LONB 1M7EA 4F7UP 2MFQA 1NU2A 3O96A 4KHBB 2ELBA 1ZSQA 2Z0PA 5D27A 2KUPA 4GPTB 1WI1A 2EMSA 4HHVA 1WGQA 2ROZB 2J59M 4H8SA 4HDQA 5KQ4A 4Z2NA 1E5WA 4K2OA 1ZC3B 1AWEA 2CAYA 1U29A 5EFXA 4KHAA 1GC7A 1DROA 1SHCA 2DX5A 1OMWA 3AJ4A 5GOWB 4HAUB 1TXDA 2N0YA 5JP4A 1BWNA 2GJYA 3U7DA 1MIXA 1ZM0A 1X86A 4F7HA 2MKRA 3BJIA 3SUZA 2YF0A 3KY9A 1XR0B 2I5FA 2RVBB 5DHAB 2CRFA 1TJ6A 4EKUA 1J0WA 2UZRA 3KRXA 5LOPB 1FHWA 1U5DA 2H7EA 4EJNA 3D8FA 3AU5A 1K5GB 1FOEA 2D9XA 4EMOA 4NSWA 3ZDTA 1K5DB 4HB4B 5C5BA 2W2XC 4D0NB 4K17A 1UPQA 1V5UA 2GCJA 1WVHA 1KZ7A 5JHGA 3SV1A 5C79A 2COAA 1V88A 2CY4A 2J0KA 2D11A 5J3YA 5C5BB 4C0AA 1MIZB 2GS0A 1FAOA 3MDBC 2P0DA 1DDWA 1RRPB 4B6HA 3ODXA 3CIKA 1V5MA 4TYZA 3TFMA 2QKMA 1X1FA 3AU4A 2YT1A 3NSUA
chains in the Genus database with same CATH superfamily
2DHIA 2LULA 1U5FA 1WGUA 1W1HA 3DXCA 1GC6A 2JP2A 1NTVA 1MKEA 1U2BA 2LOZA 3PVLA 2BCJA 3P6AA 2FJLA 2HTHB 1NTYA 2EJ8A 1XODA 5CLQB 3ODOA 1BAKA 4D6WA 1PLSA 3M1IB 1T77A 2W2WA 3HIEA 3V5WA 3MPXA 1DDMA 5DHFB 4DXAB 2M38A 2RUKB 2RLOA 1EF1A 2EC1A 3F0WA 1LB1A 4L6EA 5I2MA 1Y5OA 2YS5A 4GMXB 4WVFB 3KSYA 2COCA 2QKLA 4YL8A 1P6SA 2VRWB 2HE7A 1FB8A 3HK0A 2GUMA 2YT0A 2YS1A 5KQ1A 4HB0B 4YONA 1X11A 5FI1A 2LOXA 2RRFA 3SNHA 4PQ0A 4CSQA 2D4QA 5JLJB 3OANA 2ZPYA 1MK7B 1MPHA 2R2YA 2Q13A 1SGHA 3HQCA 2DFKA 1ZYIA 3QBVB 4K2PA 4QJ3B 2DKQA 3WA0A 1EVHA 2OQBA 4QJ5B 3PZDA 2K8EA 4ZRJA 4QXAB 5DIFB 2D2QA 3G9WA 2Z0QA 4HAYB 4A6HA 2YVCA 5JHHA 2W2XD 2CY5A 5HE1A 4Y94A 2R09A 4HB2B 3FM8C 1WG7A 2P0FA 1X1GA 3ULBA 3SYXA 3HW2B 1V89A 3F5RA 2UVMA 1LW3A 1I7AA 3IVFA 4GOUA 1PMSA 2COFA 2Z59A 4HSIA 1RJ2A 2DX1A 1UNPA 1XCGA 2Y8GA 1GG3A 4MT7A 4XWXA 1DYNA 5HE0A 4TKNA 5L81A 3NW8A 4BBKA 2V76A 2M14A 1MAIA 3PVWA 2D10A 1V61A 4GMVA 4L1RA 5D3WA 3TCAA 4A6KA 2CODA 1M7RA 5HE2A 1NI2A 3T06A 3CXBB 4IAPA 3TVVA 3ULCA 1AQCA 4GNKB 2G35A 3TO1A 2KGXB 1PFJA 4CYEA 1UNRA 5D3VA 1DBHA 2XQNM 3U12A 2P8VA 3QWMA 5CLLB 3GYOA 4KHOA 4MY6A 4K81A 2J0JA 4PNKA 1U5GA 4GZUA 4HAWB 3UZTA 2I1KA 3B77A 4ZRKA 4DX90 3D8DA 4A6FA 1FHOA 1W1DA 2D9ZA 5J3TA 1KI1B 2KR0A 1ZVRA 2PZ1A 2NZ8B 2GCLA 2RNRB 2VSZA 3A8QA 4Z2MB 4OT1A 5D3YA 5C16A 3PEGA 4A6FB 1OY2A 1ZC4B 1X05A 2UZSA 2VKIA 2J0MA 3SO6A 4IFSA 2LKOA 2Y7BA 3A8PA 4HDOA 3ZVRA 4GXBA 2YT2A 2AL6A 2KCJA 3FVCA 2DKPA 3RCPA 3NWFA 2D9YA 1H4RA 3ODWA 3PSCA 4CHMA 1J19A 5KCVA 4A5KA 2Y8FA 2LG1A 1OQNA 3GYPA 1Y19B 2EMTA 2NMBA 2Z0OA 1ISNA 1BTNA 3PG7A 1FHXA 1UEFA 3TW1A 1WJ1A 3NWAA 1FGZA 2LYDA 5M4YB 1UPRA 3PP2A 4GN1A 5DH9B 4F7GA 1I2HA 3P7ZA 1V5PA 4NY0A 2OTXA 4DIXA 1QQGA 1U5EA 2P0HA 2K00A 3VOQA 2K2UA 3DXEA 5DI9B 2DTCA 2NBVA 4DX8A 2IYBA 4HAXB 3QIJA 1TQZA 5C6RA 2MWNB 2RGNB 2Z14A 4DBBA 3FEHA 1BTKA 2I1JA 2DA0A 1QC6A 3DXDA 2D9WA 2I5CA 2ELAA 2YRYA 4CHJA 3BINA 1XX0A 2R0DA 1W1GA 1P3RA 5D3XA 2IFSA 1EAZA 4HATB 3A98B 1XKEA 2K2JA 1H10A 2H7DA 1WJMA 4KVGB 5J3QA 5I2SA 2DLWA 2X18A 4HB3B 1IRSA 1MK9B 2L2IA 1FGYA 2RSGA 3WYFB 2FJUB 2MDXA 4HAVB 2AEHA 5HE3A 1Q67A 4ZRIA 2YS3A 4IOYX 3OHMB 2DYQA 2L1CA 2KUQA 4WJ7A 4WSFA 2DYNA 2KIEA 1DDVA 3KRWA 3VIAA 3ML4A 1EGXA 1P5TA 4HAZB 1Z87A 1N3HA 1XD4A 3N7CA 1UNQA 2E2XA 3X23A 5IRSA 2DN6A 4KAXB 1KZGA 2D9VA 2DHKA 1B55A 3U8ZA 2ADZA 3FSSA 4P7IA 1U27A 2YSZA 5FI0A 3KZ1A 4KHBA 3LJUX 4OSNA 3NWDA 4MK0A 2ROVA 1MI1A 3D8EA 3PVUA 2DHJA 2N23A 5LONB 2ZKMX 2KIGA 1M7EA 4F7UP 2MFQA 1NU2A 3O96A 4KHBB 2ELBA 1ZSQA 2Z0PA 5D27A 2KUPA 4GPTB 1WI1A 2EMSA 4HHVA 1WGQA 2ROZB 2J59M 4H8SA 4HDQA 5KQ4A 4Z2NA 1E5WA 4K2OA 1ZC3B 1AWEA 2CAYA 1U29A 5EFXA 2Z13A 4KHAA 1GC7A 1DROA 1SHCA 2DX5A 1OMWA 3AJ4A 5GOWB 4HAUB 1TXDA 2N0YA 5JP4A 1BWNA 2GJYA 2Z4DA 3U7DA 1MIXA 1ZM0A 1X86A 4F7HA 2MKRA 3BJIA 3SUZA 2YF0A 3KY9A 1XR0B 2I5FA 2RVBB 5DHAB 2CRFA 1TJ6A 4EKUA 1J0WA 2UZRA 3KRXA 5LOPB 1FHWA 1U5DA 2H7EA 4EJNA 2K49A 3D8FA 3AU5A 1K5GB 3A58A 1FOEA 2D9XA 4EMOA 5LG4B 4NSWA 3ZDTA 4QJ4B 1K5DB 4HB4B 5C5BA 2W2XC 4D0NB 4K17A 1UPQA 1V5UA 3DCXA 2GCJA 1WVHA 1KZ7A 5JHGA 3SV1A 5C79A 2COAA 3HSAA 1V88A 2CY4A 2J0KA 2D11A 5J3YA 5C5BB 4C0AA 1MIZB 2GS0A 1FAOA 3MDBC 2P0DA 1DDWA 1RRPB 4B6HA 3ODXA 3CIKA 1V5MA 4TYZA 3TFMA 2QKMA 1X1FA 3AU4A 2YT1A 3NSUA
chains in the Genus database with same CATH topology
2DHIA 2LULA 1U5FA 1WGUA 1W1HA 3DXCA 1GC6A 2JP2A 1NTVA 1MKEA 1U2BA 2LOZA 3PVLA 2BCJA 3P6AA 2FJLA 2HTHB 1NTYA 2EJ8A 1XODA 5CLQB 3ODOA 1BAKA 1PLSA 3M1IB 2W2WA 3V5WA 3MPXA 1DDMA 5DHFB 4DXAB 2M38A 2RUKB 2RLOA 1EF1A 2EC1A 3F0WA 1LB1A 4L6EA 1Y5OA 2YS5A 4GMXB 4WVFB 3KSYA 2COCA 2QKLA 4YL8A 1P6SA 2VRWB 2HE7A 1FB8A 3HK0A 2YS1A 2YT0A 5KQ1A 4HB0B 4YONA 1X11A 5FI1A 2LOXA 3SNHA 4PQ0A 2D4QA 5JLJB 3OANA 2ZPYA 1MK7B 1MPHA 2Q13A 1SGHA 3HQCA 2DFKA 3QBVB 4K2PA 2DKQA 3WA0A 1EVHA 2OQBA 3PZDA 4ZRJA 5DIFB 2D2QA 3G9WA 2Z0QA 4HAYB 4A6HA 2YVCA 5JHHA 2W2XD 2CY5A 5HE1A 4Y94A 2R09A 4HB2B 3FM8C 1WG7A 2P0FA 1X1GA 3ULBA 3SYXA 3HW2B 1V89A 3F5RA 2UVMA 1LW3A 1I7AA 3IVFA 1PMSA 2COFA 1RJ2A 2DX1A 1UNPA 1XCGA 2Y8GA 1GG3A 4MT7A 4XWXA 1DYNA 5HE0A 4TKNA 5L81A 4BBKA 2V76A 2M14A 1MAIA 3PVWA 2D10A 1V61A 4GMVA 3TCAA 5D3WA 4A6KA 2CODA 1M7RA 5HE2A 1NI2A 3T06A 3CXBB 4IAPA 3TVVA 3ULCA 1AQCA 2G35A 3TO1A 2KGXB 1PFJA 4CYEA 1UNRA 5D3VA 1DBHA 2XQNM 2P8VA 3QWMA 5CLLB 3GYOA 4KHOA 4MY6A 4K81A 2J0JA 4PNKA 1U5GA 4GZUA 4HAWB 3UZTA 2I1KA 4ZRKA 4DX90 3D8DA 4A6FA 1FHOA 1W1DA 2D9ZA 5J3TA 1KI1B 1ZVRA 2PZ1A 2NZ8B 2GCLA 2RNRB 2VSZA 3A8QA 4Z2MB 5D3YA 5C16A 3PEGA 4A6FB 1OY2A 1ZC4B 1X05A 2UZSA 2VKIA 2J0MA 3SO6A 4IFSA 2LKOA 2Y7BA 3A8PA 4HDOA 3ZVRA 4GXBA 2AL6A 2KCJA 2DKPA 3RCPA 2D9YA 1H4RA 3ODWA 3PSCA 4CHMA 1J19A 5KCVA 4A5KA 2Y8FA 2LG1A 1OQNA 3GYPA 1Y19B 2EMTA 2NMBA 2Z0OA 1ISNA 1BTNA 3PG7A 1FHXA 1UEFA 3TW1A 1WJ1A 1FGZA 2LYDA 1UPRA 3PP2A 4GN1A 5DH9B 4F7GA 1I2HA 3P7ZA 1V5PA 4NY0A 2OTXA 1QQGA 1U5EA 2P0HA 2K00A 3VOQA 2K2UA 3DXEA 5DI9B 2DTCA 4DX8A 2IYBA 4HAXB 3QIJA 1TQZA 5C6RA 2MWNB 2RGNB 4DBBA 3FEHA 1BTKA 2I1JA 2DA0A 1QC6A 3DXDA 2D9WA 2I5CA 2ELAA 2YRYA 4CHJA 3BINA 1XX0A 2R0DA 1W1GA 1P3RA 5D3XA 2IFSA 1EAZA 4HATB 3A98B 1XKEA 2K2JA 1H10A 2H7DA 1WJMA 4KVGB 5J3QA 2DLWA 2X18A 4HB3B 1IRSA 1MK9B 2L2IA 1FGYA 2RSGA 3WYFB 2MDXA 4HAVB 2AEHA 5HE3A 1Q67A 4ZRIA 2YS3A 4IOYX 2DYQA 2L1CA 4WJ7A 4WSFA 2DYNA 1DDVA 3KRWA 3VIAA 3ML4A 1EGXA 1P5TA 4HAZB 1Z87A 1N3HA 1XD4A 3N7CA 1UNQA 2E2XA 3X23A 2DN6A 4KAXB 1KZGA 2D9VA 2DHKA 1B55A 3U8ZA 2ADZA 3FSSA 4P7IA 1U27A 2YSZA 5FI0A 3KZ1A 3LJUX 4MK0A 2ROVA 3D8EA 3PVUA 2DHJA 2N23A 5LONB 1M7EA 4F7UP 2MFQA 1NU2A 3O96A 4KHBB 2ELBA 1ZSQA 2Z0PA 5D27A 2KUPA 4GPTB 1WI1A 2EMSA 4HHVA 1WGQA 2ROZB 2J59M 4H8SA 4HDQA 5KQ4A 4Z2NA 1E5WA 4K2OA 1ZC3B 1AWEA 2CAYA 1U29A 5EFXA 4KHAA 1GC7A 1DROA 1SHCA 2DX5A 1OMWA 3AJ4A 5GOWB 4HAUB 1TXDA 2N0YA 5JP4A 1BWNA 2GJYA 3U7DA 1MIXA 1ZM0A 1X86A 4F7HA 2MKRA 3BJIA 3SUZA 2YF0A 3KY9A 1XR0B 2I5FA 2RVBB 5DHAB 2CRFA 1TJ6A 4EKUA 1J0WA 2UZRA 3KRXA 5LOPB 1FHWA 1U5DA 2H7EA 4EJNA 3D8FA 3AU5A 1K5GB 1FOEA 2D9XA 4EMOA 4NSWA 3ZDTA 1K5DB 4HB4B 5C5BA 2W2XC 4D0NB 4K17A 1UPQA 1V5UA 2GCJA 1WVHA 1KZ7A 5JHGA 3SV1A 5C79A 2COAA 1V88A 2CY4A 2J0KA 2D11A 5J3YA 5C5BB 4C0AA 1MIZB 2GS0A 1FAOA 3MDBC 2P0DA 1DDWA 1RRPB 4B6HA 3ODXA 3CIKA 1V5MA 4TYZA 3TFMA 2QKMA 1X1FA 3AU4A 2YT1A 3NSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHI A;  2LUL A;  1U5F A;  1WGU A;  1W1H A;  3DXC A;  1GC6 A;  2JP2 A;  1NTV A;  1MKE A;  1U2B A;  2LOZ A;  3PVL A;  2BCJ A;  3P6A A;  2FJL A;  2HTH B;  1NTY A;  2EJ8 A;  1XOD A;  5CLQ B;  3ODO A;  1BAK A;  1PLS A;  3M1I B;  2W2W A;  3V5W A;  3MPX A;  1DDM A;  5DHF B;  4DXA B;  2M38 A;  2RUK B;  2RLO A;  1EF1 A;  2EC1 A;  3F0W A;  1LB1 A;  4L6E A;  1Y5O A;  2YS5 A;  4GMX B;  4WVF B;  3KSY A;  2COC A;  2QKL A;  4YL8 A;  1P6S A;  2VRW B;  2HE7 A;  1FB8 A;  3HK0 A;  2YS1 A;  2YT0 A;  5KQ1 A;  4HB0 B;  4YON A;  1X11 A;  5FI1 A;  2LOX A;  3SNH A;  4PQ0 A;  2D4Q A;  5JLJ B;  3OAN A;  2ZPY A;  1MK7 B;  1MPH A;  2Q13 A;  1SGH A;  3HQC A;  2DFK A;  3QBV B;  4K2P A;  2DKQ A;  3WA0 A;  1EVH A;  2OQB A;  3PZD A;  4ZRJ A;  5DIF B;  2D2Q A;  3G9W A;  2Z0Q A;  4HAY B;  4A6H A;  2YVC A;  5JHH A;  2W2X D;  2CY5 A;  5HE1 A;  4Y94 A;  2R09 A;  4HB2 B;  3FM8 C;  1WG7 A;  2P0F A;  1X1G A;  3ULB A;  3SYX A;  3HW2 B;  1V89 A;  3F5R A;  2UVM A;  1LW3 A;  1I7A A;  3IVF A;  1PMS A;  2COF A;  1RJ2 A;  2DX1 A;  1UNP A;  1XCG A;  2Y8G A;  1GG3 A;  4MT7 A;  4XWX A;  1DYN A;  5HE0 A;  4TKN A;  5L81 A;  4BBK A;  2V76 A;  2M14 A;  1MAI A;  3PVW A;  2D10 A;  1V61 A;  4GMV A;  3TCA A;  5D3W A;  4A6K A;  2COD A;  1M7R A;  5HE2 A;  1NI2 A;  3T06 A;  3CXB B;  4IAP A;  3TVV A;  3ULC A;  1AQC A;  2G35 A;  3TO1 A;  2KGX B;  1PFJ A;  4CYE A;  1UNR A;  5D3V A;  1DBH A;  2XQN M;  2P8V A;  3QWM A;  5CLL B;  3GYO A;  4KHO A;  4MY6 A;  4K81 A;  2J0J A;  4PNK A;  1U5G A;  4GZU A;  4HAW B;  3UZT A;  2I1K A;  4ZRK A;  4DX9 0;  3D8D A;  4A6F A;  1FHO A;  1W1D A;  2D9Z A;  5J3T A;  1KI1 B;  1ZVR A;  2PZ1 A;  2NZ8 B;  2GCL A;  2RNR B;  2VSZ A;  3A8Q A;  4Z2M B;  5D3Y A;  5C16 A;  3PEG A;  4A6F B;  1OY2 A;  1ZC4 B;  1X05 A;  2UZS A;  2VKI A;  2J0M A;  3SO6 A;  4IFS A;  2LKO A;  2Y7B A;  3A8P A;  4HDO A;  3ZVR A;  4GXB A;  2AL6 A;  2KCJ A;  2DKP A;  3RCP A;  2D9Y A;  1H4R A;  3ODW A;  3PSC A;  4CHM A;  1J19 A;  5KCV A;  4A5K A;  2Y8F A;  2LG1 A;  1OQN A;  3GYP A;  1Y19 B;  2EMT A;  2NMB A;  2Z0O A;  1ISN A;  1BTN A;  3PG7 A;  1FHX A;  1UEF A;  3TW1 A;  1WJ1 A;  1FGZ A;  2LYD A;  1UPR A;  3PP2 A;  4GN1 A;  5DH9 B;  4F7G A;  1I2H A;  3P7Z A;  1V5P A;  4NY0 A;  2OTX A;  1QQG A;  1U5E A;  2P0H A;  2K00 A;  3VOQ A;  2K2U A;  3DXE A;  5DI9 B;  2DTC A;  4DX8 A;  2IYB A;  4HAX B;  3QIJ A;  1TQZ A;  5C6R A;  2MWN B;  2RGN B;  4DBB A;  3FEH A;  1BTK A;  2I1J A;  2DA0 A;  1QC6 A;  3DXD A;  2D9W A;  2I5C A;  2ELA A;  2YRY A;  4CHJ A;  3BIN A;  1XX0 A;  2R0D A;  1W1G A;  1P3R A;  5D3X A;  2IFS A;  1EAZ A;  4HAT B;  3A98 B;  1XKE A;  2K2J A;  1H10 A;  2H7D A;  1WJM A;  4KVG B;  5J3Q A;  2DLW A;  2X18 A;  4HB3 B;  1IRS A;  1MK9 B;  2L2I A;  1FGY A;  2RSG A;  3WYF B;  2MDX A;  4HAV B;  2AEH A;  5HE3 A;  1Q67 A;  4ZRI A;  2YS3 A;  4IOY X;  2DYQ A;  2L1C A;  4WJ7 A;  4WSF A;  2DYN A;  1DDV A;  3KRW A;  3VIA A;  3ML4 A;  1EGX A;  1P5T A;  4HAZ B;  1Z87 A;  1N3H A;  1XD4 A;  3N7C A;  1UNQ A;  2E2X A;  3X23 A;  2DN6 A;  4KAX B;  1KZG A;  2D9V A;  2DHK A;  1B55 A;  3U8Z A;  2ADZ A;  3FSS A;  4P7I A;  1U27 A;  2YSZ A;  5FI0 A;  3KZ1 A;  3LJU X;  4MK0 A;  2ROV A;  3D8E A;  3PVU A;  2DHJ A;  2N23 A;  5LON B;  1M7E A;  4F7U P;  2MFQ A;  1NU2 A;  3O96 A;  4KHB B;  2ELB A;  1ZSQ A;  2Z0P A;  5D27 A;  2KUP A;  4GPT B;  1WI1 A;  2EMS A;  4HHV A;  1WGQ A;  2ROZ B;  2J59 M;  4H8S A;  4HDQ A;  5KQ4 A;  4Z2N A;  1E5W A;  4K2O A;  1ZC3 B;  1AWE A;  2CAY A;  1U29 A;  5EFX A;  4KHA A;  1GC7 A;  1DRO A;  1SHC A;  2DX5 A;  1OMW A;  3AJ4 A;  5GOW B;  4HAU B;  1TXD A;  2N0Y A;  5JP4 A;  1BWN A;  2GJY A;  3U7D A;  1MIX A;  1ZM0 A;  1X86 A;  4F7H A;  2MKR A;  3BJI A;  3SUZ A;  2YF0 A;  3KY9 A;  1XR0 B;  2I5F A;  2RVB B;  5DHA B;  2CRF A;  1TJ6 A;  4EKU A;  1J0W A;  2UZR A;  3KRX A;  5LOP B;  1FHW A;  1U5D A;  2H7E A;  4EJN A;  3D8F A;  3AU5 A;  1K5G B;  1FOE A;  2D9X A;  4EMO A;  4NSW A;  3ZDT A;  1K5D B;  4HB4 B;  5C5B A;  2W2X C;  4D0N B;  4K17 A;  1UPQ A;  1V5U A;  2GCJ A;  1WVH A;  1KZ7 A;  5JHG A;  3SV1 A;  5C79 A;  2COA A;  1V88 A;  2CY4 A;  2J0K A;  2D11 A;  5J3Y A;  5C5B B;  4C0A A;  1MIZ B;  2GS0 A;  1FAO A;  3MDB C;  2P0D A;  1DDW A;  1RRP B;  4B6H A;  3ODX A;  3CIK A;  1V5M A;  4TYZ A;  3TFM A;  2QKM A;  1X1F A;  3AU4 A;  2YT1 A;  3NSU A; 
#chains in the Genus database with same CATH topology
 2DHI A;  2LUL A;  1U5F A;  1WGU A;  1W1H A;  3DXC A;  1GC6 A;  2JP2 A;  1NTV A;  1MKE A;  1U2B A;  2LOZ A;  3PVL A;  2BCJ A;  3P6A A;  2FJL A;  2HTH B;  1NTY A;  2EJ8 A;  1XOD A;  5CLQ B;  3ODO A;  1BAK A;  4D6W A;  1PLS A;  3M1I B;  1T77 A;  2W2W A;  3HIE A;  3V5W A;  3MPX A;  1DDM A;  5DHF B;  4DXA B;  2M38 A;  2RUK B;  2RLO A;  1EF1 A;  2EC1 A;  3F0W A;  1LB1 A;  4L6E A;  5I2M A;  1Y5O A;  2YS5 A;  4GMX B;  4WVF B;  3KSY A;  2COC A;  2QKL A;  4YL8 A;  1P6S A;  2VRW B;  2HE7 A;  1FB8 A;  3HK0 A;  2GUM A;  2YT0 A;  2YS1 A;  5KQ1 A;  4HB0 B;  4YON A;  1X11 A;  5FI1 A;  2LOX A;  2RRF A;  3SNH A;  4PQ0 A;  4CSQ A;  2D4Q A;  5JLJ B;  3OAN A;  2ZPY A;  1MK7 B;  1MPH A;  2R2Y A;  2Q13 A;  1SGH A;  3HQC A;  2DFK A;  1ZYI A;  3QBV B;  4K2P A;  4QJ3 B;  2DKQ A;  3WA0 A;  1EVH A;  2OQB A;  4QJ5 B;  3PZD A;  2K8E A;  4ZRJ A;  4QXA B;  5DIF B;  2D2Q A;  3G9W A;  2Z0Q A;  4HAY B;  4A6H A;  2YVC A;  5JHH A;  2W2X D;  2CY5 A;  5HE1 A;  4Y94 A;  2R09 A;  4HB2 B;  3FM8 C;  1WG7 A;  2P0F A;  1X1G A;  3ULB A;  3SYX A;  3HW2 B;  1V89 A;  3F5R A;  2UVM A;  1LW3 A;  1I7A A;  3IVF A;  4GOU A;  1PMS A;  2COF A;  2Z59 A;  4HSI A;  1RJ2 A;  2DX1 A;  1UNP A;  1XCG A;  2Y8G A;  1GG3 A;  4MT7 A;  4XWX A;  1DYN A;  5HE0 A;  4TKN A;  5L81 A;  3NW8 A;  4BBK A;  2V76 A;  2M14 A;  1MAI A;  3PVW A;  2D10 A;  1V61 A;  4GMV A;  4L1R A;  5D3W A;  3TCA A;  4A6K A;  2COD A;  1M7R A;  5HE2 A;  1NI2 A;  3T06 A;  3CXB B;  4IAP A;  3TVV A;  3ULC A;  1AQC A;  4GNK B;  2G35 A;  3TO1 A;  2KGX B;  1PFJ A;  4CYE A;  1UNR A;  5D3V A;  1DBH A;  2XQN M;  3U12 A;  2P8V A;  3QWM A;  5CLL B;  3GYO A;  4KHO A;  4MY6 A;  4K81 A;  2J0J A;  4PNK A;  1U5G A;  4GZU A;  4HAW B;  3UZT A;  2I1K A;  3B77 A;  4ZRK A;  4DX9 0;  3D8D A;  4A6F A;  1FHO A;  1W1D A;  2D9Z A;  5J3T A;  1KI1 B;  2KR0 A;  1ZVR A;  2PZ1 A;  2NZ8 B;  2GCL A;  2RNR B;  2VSZ A;  3A8Q A;  4Z2M B;  4OT1 A;  5D3Y A;  5C16 A;  3PEG A;  4A6F B;  1OY2 A;  1ZC4 B;  1X05 A;  2UZS A;  2VKI A;  2J0M A;  3SO6 A;  4IFS A;  2LKO A;  2Y7B A;  3A8P A;  4HDO A;  3ZVR A;  4GXB A;  2YT2 A;  2AL6 A;  2KCJ A;  3FVC A;  2DKP A;  3RCP A;  3NWF A;  2D9Y A;  1H4R A;  3ODW A;  3PSC A;  4CHM A;  1J19 A;  5KCV A;  4A5K A;  2Y8F A;  2LG1 A;  1OQN A;  3GYP A;  1Y19 B;  2EMT A;  2NMB A;  2Z0O A;  1ISN A;  1BTN A;  3PG7 A;  1FHX A;  1UEF A;  3TW1 A;  1WJ1 A;  3NWA A;  1FGZ A;  2LYD A;  5M4Y B;  1UPR A;  3PP2 A;  4GN1 A;  5DH9 B;  4F7G A;  1I2H A;  3P7Z A;  1V5P A;  4NY0 A;  2OTX A;  4DIX A;  1QQG A;  1U5E A;  2P0H A;  2K00 A;  3VOQ A;  2K2U A;  3DXE A;  5DI9 B;  2DTC A;  2NBV A;  4DX8 A;  2IYB A;  4HAX B;  3QIJ A;  1TQZ A;  5C6R A;  2MWN B;  2RGN B;  2Z14 A;  4DBB A;  3FEH A;  1BTK A;  2I1J A;  2DA0 A;  1QC6 A;  3DXD A;  2D9W A;  2I5C A;  2ELA A;  2YRY A;  4CHJ A;  3BIN A;  1XX0 A;  2R0D A;  1W1G A;  1P3R A;  5D3X A;  2IFS A;  1EAZ A;  4HAT B;  3A98 B;  1XKE A;  2K2J A;  1H10 A;  2H7D A;  1WJM A;  4KVG B;  5J3Q A;  5I2S A;  2DLW A;  2X18 A;  4HB3 B;  1IRS A;  1MK9 B;  2L2I A;  1FGY A;  2RSG A;  3WYF B;  2FJU B;  2MDX A;  4HAV B;  2AEH A;  5HE3 A;  1Q67 A;  4ZRI A;  2YS3 A;  4IOY X;  3OHM B;  2DYQ A;  2L1C A;  2KUQ A;  4WJ7 A;  4WSF A;  2DYN A;  2KIE A;  1DDV A;  3KRW A;  3VIA A;  3ML4 A;  1EGX A;  1P5T A;  4HAZ B;  1Z87 A;  1N3H A;  1XD4 A;  3N7C A;  1UNQ A;  2E2X A;  3X23 A;  5IRS A;  2DN6 A;  4KAX B;  1KZG A;  2D9V A;  2DHK A;  1B55 A;  3U8Z A;  2ADZ A;  3FSS A;  4P7I A;  1U27 A;  2YSZ A;  5FI0 A;  3KZ1 A;  4KHB A;  3LJU X;  4OSN A;  3NWD A;  4MK0 A;  2ROV A;  1MI1 A;  3D8E A;  3PVU A;  2DHJ A;  2N23 A;  5LON B;  2ZKM X;  2KIG A;  1M7E A;  4F7U P;  2MFQ A;  1NU2 A;  3O96 A;  4KHB B;  2ELB A;  1ZSQ A;  2Z0P A;  5D27 A;  2KUP A;  4GPT B;  1WI1 A;  2EMS A;  4HHV A;  1WGQ A;  2ROZ B;  2J59 M;  4H8S A;  4HDQ A;  5KQ4 A;  4Z2N A;  1E5W A;  4K2O A;  1ZC3 B;  1AWE A;  2CAY A;  1U29 A;  5EFX A;  2Z13 A;  4KHA A;  1GC7 A;  1DRO A;  1SHC A;  2DX5 A;  1OMW A;  3AJ4 A;  5GOW B;  4HAU B;  1TXD A;  2N0Y A;  5JP4 A;  1BWN A;  2GJY A;  2Z4D A;  3U7D A;  1MIX A;  1ZM0 A;  1X86 A;  4F7H A;  2MKR A;  3BJI A;  3SUZ A;  2YF0 A;  3KY9 A;  1XR0 B;  2I5F A;  2RVB B;  5DHA B;  2CRF A;  1TJ6 A;  4EKU A;  1J0W A;  2UZR A;  3KRX A;  5LOP B;  1FHW A;  1U5D A;  2H7E A;  4EJN A;  2K49 A;  3D8F A;  3AU5 A;  1K5G B;  3A58 A;  1FOE A;  2D9X A;  4EMO A;  5LG4 B;  4NSW A;  3ZDT A;  4QJ4 B;  1K5D B;  4HB4 B;  5C5B A;  2W2X C;  4D0N B;  4K17 A;  1UPQ A;  1V5U A;  3DCX A;  2GCJ A;  1WVH A;  1KZ7 A;  5JHG A;  3SV1 A;  5C79 A;  2COA A;  3HSA A;  1V88 A;  2CY4 A;  2J0K A;  2D11 A;  5J3Y A;  5C5B B;  4C0A A;  1MIZ B;  2GS0 A;  1FAO A;  3MDB C;  2P0D A;  1DDW A;  1RRP B;  4B6H A;  3ODX A;  3CIK A;  1V5M A;  4TYZ A;  3TFM A;  2QKM A;  1X1F A;  3AU4 A;  2YT1 A;  3NSU A; 
#chains in the Genus database with same CATH homology
 2DHI A;  2LUL A;  1U5F A;  1WGU A;  1W1H A;  3DXC A;  1GC6 A;  2JP2 A;  1NTV A;  1MKE A;  1U2B A;  2LOZ A;  3PVL A;  2BCJ A;  3P6A A;  2FJL A;  2HTH B;  1NTY A;  2EJ8 A;  1XOD A;  5CLQ B;  3ODO A;  1BAK A;  1PLS A;  3M1I B;  2W2W A;  3V5W A;  3MPX A;  1DDM A;  5DHF B;  4DXA B;  2M38 A;  2RUK B;  2RLO A;  1EF1 A;  2EC1 A;  3F0W A;  1LB1 A;  4L6E A;  1Y5O A;  2YS5 A;  4GMX B;  4WVF B;  3KSY A;  2COC A;  2QKL A;  4YL8 A;  1P6S A;  2VRW B;  2HE7 A;  1FB8 A;  3HK0 A;  2YS1 A;  2YT0 A;  5KQ1 A;  4HB0 B;  4YON A;  1X11 A;  5FI1 A;  2LOX A;  3SNH A;  4PQ0 A;  2D4Q A;  5JLJ B;  3OAN A;  2ZPY A;  1MK7 B;  1MPH A;  2Q13 A;  1SGH A;  3HQC A;  2DFK A;  3QBV B;  4K2P A;  2DKQ A;  3WA0 A;  1EVH A;  2OQB A;  3PZD A;  4ZRJ A;  5DIF B;  2D2Q A;  3G9W A;  2Z0Q A;  4HAY B;  4A6H A;  2YVC A;  5JHH A;  2W2X D;  2CY5 A;  5HE1 A;  4Y94 A;  2R09 A;  4HB2 B;  3FM8 C;  1WG7 A;  2P0F A;  1X1G A;  3ULB A;  3SYX A;  3HW2 B;  1V89 A;  3F5R A;  2UVM A;  1LW3 A;  1I7A A;  3IVF A;  1PMS A;  2COF A;  1RJ2 A;  2DX1 A;  1UNP A;  1XCG A;  2Y8G A;  1GG3 A;  4MT7 A;  4XWX A;  1DYN A;  5HE0 A;  4TKN A;  5L81 A;  4BBK A;  2V76 A;  2M14 A;  1MAI A;  3PVW A;  2D10 A;  1V61 A;  4GMV A;  3TCA A;  5D3W A;  4A6K A;  2COD A;  1M7R A;  5HE2 A;  1NI2 A;  3T06 A;  3CXB B;  4IAP A;  3TVV A;  3ULC A;  1AQC A;  2G35 A;  3TO1 A;  2KGX B;  1PFJ A;  4CYE A;  1UNR A;  5D3V A;  1DBH A;  2XQN M;  2P8V A;  3QWM A;  5CLL B;  3GYO A;  4KHO A;  4MY6 A;  4K81 A;  2J0J A;  4PNK A;  1U5G A;  4GZU A;  4HAW B;  3UZT A;  2I1K A;  4ZRK A;  4DX9 0;  3D8D A;  4A6F A;  1FHO A;  1W1D A;  2D9Z A;  5J3T A;  1KI1 B;  1ZVR A;  2PZ1 A;  2NZ8 B;  2GCL A;  2RNR B;  2VSZ A;  3A8Q A;  4Z2M B;  5D3Y A;  5C16 A;  3PEG A;  4A6F B;  1OY2 A;  1ZC4 B;  1X05 A;  2UZS A;  2VKI A;  2J0M A;  3SO6 A;  4IFS A;  2LKO A;  2Y7B A;  3A8P A;  4HDO A;  3ZVR A;  4GXB A;  2AL6 A;  2KCJ A;  2DKP A;  3RCP A;  2D9Y A;  1H4R A;  3ODW A;  3PSC A;  4CHM A;  1J19 A;  5KCV A;  4A5K A;  2Y8F A;  2LG1 A;  1OQN A;  3GYP A;  1Y19 B;  2EMT A;  2NMB A;  2Z0O A;  1ISN A;  1BTN A;  3PG7 A;  1FHX A;  1UEF A;  3TW1 A;  1WJ1 A;  1FGZ A;  2LYD A;  1UPR A;  3PP2 A;  4GN1 A;  5DH9 B;  4F7G A;  1I2H A;  3P7Z A;  1V5P A;  4NY0 A;  2OTX A;  1QQG A;  1U5E A;  2P0H A;  2K00 A;  3VOQ A;  2K2U A;  3DXE A;  5DI9 B;  2DTC A;  4DX8 A;  2IYB A;  4HAX B;  3QIJ A;  1TQZ A;  5C6R A;  2MWN B;  2RGN B;  4DBB A;  3FEH A;  1BTK A;  2I1J A;  2DA0 A;  1QC6 A;  3DXD A;  2D9W A;  2I5C A;  2ELA A;  2YRY A;  4CHJ A;  3BIN A;  1XX0 A;  2R0D A;  1W1G A;  1P3R A;  5D3X A;  2IFS A;  1EAZ A;  4HAT B;  3A98 B;  1XKE A;  2K2J A;  1H10 A;  2H7D A;  1WJM A;  4KVG B;  5J3Q A;  2DLW A;  2X18 A;  4HB3 B;  1IRS A;  1MK9 B;  2L2I A;  1FGY A;  2RSG A;  3WYF B;  2MDX A;  4HAV B;  2AEH A;  5HE3 A;  1Q67 A;  4ZRI A;  2YS3 A;  4IOY X;  2DYQ A;  2L1C A;  4WJ7 A;  4WSF A;  2DYN A;  1DDV A;  3KRW A;  3VIA A;  3ML4 A;  1EGX A;  1P5T A;  4HAZ B;  1Z87 A;  1N3H A;  1XD4 A;  3N7C A;  1UNQ A;  2E2X A;  3X23 A;  2DN6 A;  4KAX B;  1KZG A;  2D9V A;  2DHK A;  1B55 A;  3U8Z A;  2ADZ A;  3FSS A;  4P7I A;  1U27 A;  2YSZ A;  5FI0 A;  3KZ1 A;  3LJU X;  4MK0 A;  2ROV A;  3D8E A;  3PVU A;  2DHJ A;  2N23 A;  5LON B;  1M7E A;  4F7U P;  2MFQ A;  1NU2 A;  3O96 A;  4KHB B;  2ELB A;  1ZSQ A;  2Z0P A;  5D27 A;  2KUP A;  4GPT B;  1WI1 A;  2EMS A;  4HHV A;  1WGQ A;  2ROZ B;  2J59 M;  4H8S A;  4HDQ A;  5KQ4 A;  4Z2N A;  1E5W A;  4K2O A;  1ZC3 B;  1AWE A;  2CAY A;  1U29 A;  5EFX A;  4KHA A;  1GC7 A;  1DRO A;  1SHC A;  2DX5 A;  1OMW A;  3AJ4 A;  5GOW B;  4HAU B;  1TXD A;  2N0Y A;  5JP4 A;  1BWN A;  2GJY A;  3U7D A;  1MIX A;  1ZM0 A;  1X86 A;  4F7H A;  2MKR A;  3BJI A;  3SUZ A;  2YF0 A;  3KY9 A;  1XR0 B;  2I5F A;  2RVB B;  5DHA B;  2CRF A;  1TJ6 A;  4EKU A;  1J0W A;  2UZR A;  3KRX A;  5LOP B;  1FHW A;  1U5D A;  2H7E A;  4EJN A;  3D8F A;  3AU5 A;  1K5G B;  1FOE A;  2D9X A;  4EMO A;  4NSW A;  3ZDT A;  1K5D B;  4HB4 B;  5C5B A;  2W2X C;  4D0N B;  4K17 A;  1UPQ A;  1V5U A;  2GCJ A;  1WVH A;  1KZ7 A;  5JHG A;  3SV1 A;  5C79 A;  2COA A;  1V88 A;  2CY4 A;  2J0K A;  2D11 A;  5J3Y A;  5C5B B;  4C0A A;  1MIZ B;  2GS0 A;  1FAO A;  3MDB C;  2P0D A;  1DDW A;  1RRP B;  4B6H A;  3ODX A;  3CIK A;  1V5M A;  4TYZ A;  3TFM A;  2QKM A;  1X1F A;  3AU4 A;  2YT1 A;  3NSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...