1WGUA

Solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords amyloid beta (A4) precursor protein-binding, family B, membe
total genus 18
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wguA01
2I5FA 2N0YA 2YS5A 2DTCA 4D0NB 4A5KA 1P6SA 2N23A 1DYNA 2LG1A 3TW1A 4IOYX 1FB8A 4F7HA 5C5BB 3MDBC 1PFJA 2Y8FA 1MK9B 2AL6A 5D3YA 4PQ0A 5CLQB 4HAXB 1RJ2A 1ZC4B 3FEHA 3MPXA 5HE3A 3TCAA 5KQ4A 2BCJA 3PSCA 4HAZB 1MAIA 3SUZA 2D9ZA 3VOQA 1FHWA 5C5BA 2CY5A 2D9YA 5HE2A 1KZ7A 4K2OA 2OQBA 3HW2B 3OANA 4YONA 3AU5A 1MIXA 1X1GA 4HAUB 2DHIA 2LYDA 3QBVB 1Z87A 4WJ7A 4HB0B 1MK7B 3TVVA 1V61A 1XCGA 2L1CA 3KRWA 4HB3B 4CHJA 1UNQA 2Z0QA 4EJNA 1EGXA 2D11A 1J19A 3FSSA 2KGXB 1M7EA 2OTXA 2V76A 2ROVA 2DHJA 1OMWA 4HDOA 2D9VA 1XR0B 2YRYA 1V5PA 2EMTA 2FJLA 1V89A 2QKLA 3F0WA 4HB2B 3ML4A 5HE0A 5DH9B 2MKRA 2IFSA 3UZTA 1W1GA 2RNRB 2DKPA 2GJYA 4WSFA 5GOWB 1U5FA 2HE7A 4KAXB 5FI1A 3N7CA 4XWXA 1MIZB 4K17A 5FI0A 2ROZB 1P3RA 1U29A 4F7UP 2D10A 1ZM0A 3HK0A 4KHOA 1QC6A 3BJIA 2ADZA 4EKUA 1I7AA 1UPQA 4GN1A 2I1JA 1WJ1A 2K2UA 1OQNA 5D3WA 1SHCA 1EAZA 2QKMA 5EFXA 3PVLA 1DDMA 3KRXA 1U5DA 2JP2A 2J0JA 1FGZA 2DHKA 4MT7A 4KVGB 4Z2MB 2J0KA 4HAVB 2D9XA 1WG7A 3WYFB 2RLOA 1X11A 1TQZA 4HDQA 2VSZA 3SNHA 2CAYA 4K2PA 4DXAB 1X05A 4IAPA 1E5WA 1U5EA 1NTYA 3PVUA 5DHFB 3QIJA 1H4RA 2H7DA 1SGHA 1ZVRA 2HTHB 3DXDA 1I2HA 2MWNB 2VRWB 3D8DA 5J3QA 4HB4B 2P0FA 4HAWB 1K5DB 2NZ8B 3CXBB 3SV1A 2DA0A 1WVHA 3AJ4A 2DX1A 2PZ1A 3PG7A 4CYEA 3ODOA 1EVHA 4EMOA 3PZDA 4C0AA 2EMSA 1M7RA 2KUPA 2MFQA 3A8QA 2DLWA 2Y8GA 1X86A 1J0WA 1MKEA 5KCVA 1UNRA 4DBBA 3X23A 4GXBA 1N3HA 3LJUX 5CLLB 4A6KA 3G9WA 2CY4A 1TXDA 2M14A 3WA0A 1UPRA 2EC1A 1FOEA 2EJ8A 3U8ZA 1PLSA 3P7ZA 1AWEA 1QQGA 2M38A 1DDVA 1Q67A 2K2JA 2UZSA 1DROA 5C6RA 5D27A 2COAA 2GS0A 4MK0A 2L2IA 4TKNA 1P5TA 2P0DA 4KHAA 5J3YA 1W1DA 1XX0A 3O96A 1Y19B 1WJMA 3F5RA 5JP4A 2D2QA 2R09A 1OY2A 2COFA 4F7GA 1GG3A 2G35A 3DXCA 2D4QA 4B6HA 2RUKB 1BWNA 2COCA 4CHMA 2AEHA 2NMBA 2ELAA 4TYZA 2RVBB 3A98B 2R0DA 4BBKA 5HE1A 1FAOA 1BTNA 1FGYA 2DYNA 5DI9B 2DYQA 1TJ6A 2LKOA 4KHBB 2Z0OA 1W1HA 2LOZA 2I1KA 3RCPA 1EF1A 3KY9A 4IFSA 1PMSA 2P0HA 3ULCA 5LONB 3GYOA 1ZC3B 4MY6A 4ZRJA 4Z2NA 3U7DA 3V5WA 3NSUA 1NTVA 1H10A 5C79A 4HATB 3M1IB 2KCJA 1NU2A 2YVCA 3P6AA 2K00A 1XD4A 1GC7A 1NI2A 2RGNB 3TO1A 2H7EA 2DFKA 1KI1B 3ZDTA 1FHXA 2Q13A 2LOXA 1IRSA 1UEFA 1X1FA 2GCJA 1V88A 3KZ1A 3T06A 2IYBA 4A6FA 2UVMA 3PVWA 1ISNA 2W2XC 3ULBA 5D3VA 1DDWA 3DXEA 4WVFB 3D8FA 1KZGA 3SYXA 3PP2A 2CRFA 5JLJB 1XKEA 2LULA 3ODWA 2RSGA 1V5UA 2ZPYA 4ZRKA 4DX8A 2Z0PA 1RRPB 2YT1A 1WGQA 5C16A 4H8SA 5KQ1A 4GMVA 4HAYB 2DKQA 2W2XD 1U27A 3GYPA 2YS3A 4PNKA 4HHVA 4GPTB 5JHGA 5J3TA 2DN6A 4ZRIA 2CODA 3CIKA 3HQCA 2YF0A 3ODXA 5L81A 4GMXB 3AU4A 2I5CA 4GZUA 2XQNM 1LW3A 1UNPA 2Y7BA 1U5GA 3IVFA 5D3XA 2P8VA 2YT0A 4L6EA 2X18A 2J0MA 3A8PA 1LB1A 1U2BA 2J59M 5DHAB 3PEGA 4NSWA 1K5GB 4YL8A 2D9WA 2YS1A 2GCLA 1B55A 3VIAA 4DX90 1BAKA 4A6HA 1XODA 1AQCA 1ZSQA 4K81A 1WI1A 2W2WA 2DX5A 3ZVRA 3FM8C 1DBHA 4Y94A 3TFMA 4P7IA 1Y5OA 1BTKA 4A6FB 4NY0A 1V5MA 5JHHA 1WGUA 3D8EA 3BINA 2ELBA 3SO6A 3KSYA 5LOPB 2E2XA 2MDXA 1FHOA 2UZRA 3QWMA 2VKIA 1GC6A 5DIFB 1MPHA 2YSZA
chains in the Genus database with same CATH superfamily
2I5FA 2N0YA 2YS5A 2DTCA 2FJUB 4D0NB 4A5KA 2GUMA 1P6SA 2N23A 1DYNA 2LG1A 3TW1A 3B77A 1MI1A 4IOYX 1FB8A 4F7HA 4OSNA 5C5BB 3A58A 3MDBC 1PFJA 2Y8FA 1MK9B 2AL6A 5D3YA 4PQ0A 5CLQB 4HAXB 1RJ2A 1ZC4B 4OT1A 3DCXA 3FEHA 3MPXA 5HE3A 3TCAA 5KQ4A 2BCJA 3PSCA 4HAZB 1MAIA 3SUZA 2D9ZA 3VOQA 1FHWA 3OHMB 5C5BA 2CY5A 2D9YA 5HE2A 1KZ7A 4K2OA 2OQBA 3HW2B 3OANA 4YONA 3AU5A 1MIXA 1X1GA 4HAUB 2DHIA 2LYDA 3QBVB 1Z87A 4WJ7A 4HB0B 1MK7B 3TVVA 1V61A 1XCGA 2L1CA 3KRWA 4HB3B 4CHJA 1UNQA 2Z0QA 4EJNA 1EGXA 2D11A 1J19A 3FSSA 2KGXB 1M7EA 2OTXA 2V76A 2ROVA 2DHJA 1OMWA 4HDOA 2D9VA 1XR0B 2YRYA 1V5PA 2EMTA 2RRFA 2FJLA 1V89A 2QKLA 3F0WA 4HB2B 3ML4A 5HE0A 5DH9B 2MKRA 2IFSA 3UZTA 1W1GA 3NWAA 4DIXA 2RNRB 2DKPA 2GJYA 4WSFA 5GOWB 1U5FA 2HE7A 4KAXB 2YT2A 5FI1A 3N7CA 4XWXA 2Z14A 1MIZB 4K17A 5FI0A 2ROZB 1P3RA 1U29A 4F7UP 2D10A 1ZM0A 3HK0A 4KHOA 1QC6A 3BJIA 2ADZA 2KR0A 4EKUA 1I7AA 1UPQA 2Z4DA 4GN1A 2I1JA 1WJ1A 2K2UA 1OQNA 5D3WA 1SHCA 1EAZA 2QKMA 5EFXA 4KHBA 3PVLA 1DDMA 3KRXA 1U5DA 2JP2A 2J0JA 1FGZA 2DHKA 4MT7A 4KVGB 4Z2MB 2J0KA 2Z13A 4HAVB 2D9XA 1WG7A 3WYFB 2RLOA 1X11A 1TQZA 4HDQA 2VSZA 3SNHA 2CAYA 4K2PA 4GNKB 4DXAB 1X05A 4IAPA 1E5WA 4CSQA 1U5EA 1NTYA 3PVUA 5DHFB 3QIJA 1H4RA 2H7DA 1SGHA 1ZVRA 2HTHB 3DXDA 1I2HA 2MWNB 2VRWB 3D8DA 5J3QA 4HB4B 2P0FA 4HAWB 1K5DB 2NZ8B 3CXBB 3SV1A 2DA0A 5IRSA 1WVHA 2R2YA 3AJ4A 2DX1A 2PZ1A 3PG7A 4CYEA 4QJ4B 3ODOA 1EVHA 4EMOA 3PZDA 4C0AA 2EMSA 1M7RA 2KUPA 2MFQA 3A8QA 2DLWA 2Y8GA 1X86A 1J0WA 1MKEA 5KCVA 1UNRA 4DBBA 3X23A 3FVCA 4GXBA 1N3HA 3LJUX 5CLLB 4A6KA 3G9WA 2CY4A 3HSAA 1TXDA 2M14A 3WA0A 1UPRA 2EC1A 1FOEA 2KUQA 2EJ8A 3U8ZA 1PLSA 3P7ZA 1AWEA 1QQGA 2M38A 1DDVA 1Q67A 2K2JA 2UZSA 1DROA 5C6RA 5D27A 2COAA 2GS0A 4MK0A 2L2IA 4TKNA 1P5TA 2P0DA 4KHAA 5J3YA 1W1DA 2ZKMX 1XX0A 3O96A 1Y19B 1WJMA 3F5RA 5JP4A 4GOUA 2D2QA 2R09A 1OY2A 2COFA 4F7GA 1GG3A 2G35A 1T77A 3DXCA 2D4QA 4B6HA 2RUKB 1BWNA 2COCA 4CHMA 4HSIA 2AEHA 2NMBA 2ELAA 4TYZA 2RVBB 3A98B 2R0DA 4BBKA 3NWFA 5HE1A 3HIEA 1FAOA 1BTNA 1FGYA 2DYNA 5DI9B 2DYQA 1TJ6A 2LKOA 4KHBB 2Z0OA 1W1HA 2LOZA 2I1KA 3RCPA 1EF1A 3KY9A 4IFSA 1PMSA 2P0HA 3ULCA 5LONB 3GYOA 1ZC3B 4MY6A 4ZRJA 4QXAB 4Z2NA 3U7DA 3V5WA 3NSUA 1NTVA 2KIGA 1H10A 5C79A 4HATB 3M1IB 2KCJA 1NU2A 2NBVA 2YVCA 3P6AA 2K00A 1XD4A 1GC7A 1NI2A 2RGNB 3TO1A 2H7EA 5LG4B 2DFKA 1KI1B 3ZDTA 3U12A 1FHXA 2Q13A 2LOXA 1IRSA 1UEFA 1X1FA 2GCJA 1V88A 3KZ1A 3T06A 2IYBA 4A6FA 2UVMA 3PVWA 1ISNA 2W2XC 3ULBA 5D3VA 5I2MA 1DDWA 4D6WA 3DXEA 2K49A 4WVFB 3D8FA 1KZGA 3SYXA 3PP2A 2CRFA 5JLJB 1XKEA 2LULA 3ODWA 2RSGA 1V5UA 2ZPYA 5I2SA 4ZRKA 4DX8A 2Z0PA 4QJ5B 1RRPB 2YT1A 1WGQA 5C16A 4H8SA 5KQ1A 4GMVA 4HAYB 2DKQA 2W2XD 1U27A 3GYPA 2YS3A 2KIEA 3NWDA 4PNKA 4HHVA 4GPTB 5JHGA 5J3TA 2DN6A 4ZRIA 2CODA 3CIKA 3HQCA 2Z59A 2YF0A 3ODXA 5L81A 4GMXB 3AU4A 2I5CA 4GZUA 2XQNM 1LW3A 1UNPA 2Y7BA 1U5GA 3IVFA 5D3XA 2P8VA 2YT0A 4L6EA 2X18A 2J0MA 3A8PA 1LB1A 1U2BA 2J59M 5DHAB 3PEGA 4NSWA 1K5GB 2K8EA 4YL8A 2D9WA 2YS1A 2GCLA 1ZYIA 1B55A 5M4YB 3VIAA 4DX90 1BAKA 4L1RA 4A6HA 1XODA 1AQCA 1ZSQA 4K81A 1WI1A 2W2WA 2DX5A 3ZVRA 3FM8C 1DBHA 4Y94A 3TFMA 4P7IA 1Y5OA 1BTKA 4A6FB 4NY0A 1V5MA 5JHHA 1WGUA 3D8EA 3BINA 2ELBA 3SO6A 3KSYA 5LOPB 2E2XA 2MDXA 3NW8A 1FHOA 2UZRA 3QWMA 2VKIA 1GC6A 5DIFB 1MPHA 2YSZA 4QJ3B
chains in the Genus database with same CATH topology
2I5FA 2N0YA 2YS5A 2DTCA 4D0NB 4A5KA 1P6SA 2N23A 1DYNA 2LG1A 3TW1A 4IOYX 1FB8A 4F7HA 5C5BB 3MDBC 1PFJA 2Y8FA 1MK9B 2AL6A 5D3YA 4PQ0A 5CLQB 4HAXB 1RJ2A 1ZC4B 3FEHA 3MPXA 5HE3A 3TCAA 5KQ4A 2BCJA 3PSCA 4HAZB 1MAIA 3SUZA 2D9ZA 3VOQA 1FHWA 5C5BA 2CY5A 2D9YA 5HE2A 1KZ7A 4K2OA 2OQBA 3HW2B 3OANA 4YONA 3AU5A 1MIXA 1X1GA 4HAUB 2DHIA 2LYDA 3QBVB 1Z87A 4WJ7A 4HB0B 1MK7B 3TVVA 1V61A 1XCGA 2L1CA 3KRWA 4HB3B 4CHJA 1UNQA 2Z0QA 4EJNA 1EGXA 2D11A 1J19A 3FSSA 2KGXB 1M7EA 2OTXA 2V76A 2ROVA 2DHJA 1OMWA 4HDOA 2D9VA 1XR0B 2YRYA 1V5PA 2EMTA 2FJLA 1V89A 2QKLA 3F0WA 4HB2B 3ML4A 5HE0A 5DH9B 2MKRA 2IFSA 3UZTA 1W1GA 2RNRB 2DKPA 2GJYA 4WSFA 5GOWB 1U5FA 2HE7A 4KAXB 5FI1A 3N7CA 4XWXA 1MIZB 4K17A 5FI0A 2ROZB 1P3RA 1U29A 4F7UP 2D10A 1ZM0A 3HK0A 4KHOA 1QC6A 3BJIA 2ADZA 4EKUA 1I7AA 1UPQA 4GN1A 2I1JA 1WJ1A 2K2UA 1OQNA 5D3WA 1SHCA 1EAZA 2QKMA 5EFXA 3PVLA 1DDMA 3KRXA 1U5DA 2JP2A 2J0JA 1FGZA 2DHKA 4MT7A 4KVGB 4Z2MB 2J0KA 4HAVB 2D9XA 1WG7A 3WYFB 2RLOA 1X11A 1TQZA 4HDQA 2VSZA 3SNHA 2CAYA 4K2PA 4DXAB 1X05A 4IAPA 1E5WA 1U5EA 1NTYA 3PVUA 5DHFB 3QIJA 1H4RA 2H7DA 1SGHA 1ZVRA 2HTHB 3DXDA 1I2HA 2MWNB 2VRWB 3D8DA 5J3QA 4HB4B 2P0FA 4HAWB 1K5DB 2NZ8B 3CXBB 3SV1A 2DA0A 1WVHA 3AJ4A 2DX1A 2PZ1A 3PG7A 4CYEA 3ODOA 1EVHA 4EMOA 3PZDA 4C0AA 2EMSA 1M7RA 2KUPA 2MFQA 3A8QA 2DLWA 2Y8GA 1X86A 1J0WA 1MKEA 5KCVA 1UNRA 4DBBA 3X23A 4GXBA 1N3HA 3LJUX 5CLLB 4A6KA 3G9WA 2CY4A 1TXDA 2M14A 3WA0A 1UPRA 2EC1A 1FOEA 2EJ8A 3U8ZA 1PLSA 3P7ZA 1AWEA 1QQGA 2M38A 1DDVA 1Q67A 2K2JA 2UZSA 1DROA 5C6RA 5D27A 2COAA 2GS0A 4MK0A 2L2IA 4TKNA 1P5TA 2P0DA 4KHAA 5J3YA 1W1DA 1XX0A 3O96A 1Y19B 1WJMA 3F5RA 5JP4A 2D2QA 2R09A 1OY2A 2COFA 4F7GA 1GG3A 2G35A 3DXCA 2D4QA 4B6HA 2RUKB 1BWNA 2COCA 4CHMA 2AEHA 2NMBA 2ELAA 4TYZA 2RVBB 3A98B 2R0DA 4BBKA 5HE1A 1FAOA 1BTNA 1FGYA 2DYNA 5DI9B 2DYQA 1TJ6A 2LKOA 4KHBB 2Z0OA 1W1HA 2LOZA 2I1KA 3RCPA 1EF1A 3KY9A 4IFSA 1PMSA 2P0HA 3ULCA 5LONB 3GYOA 1ZC3B 4MY6A 4ZRJA 4Z2NA 3U7DA 3V5WA 3NSUA 1NTVA 1H10A 5C79A 4HATB 3M1IB 2KCJA 1NU2A 2YVCA 3P6AA 2K00A 1XD4A 1GC7A 1NI2A 2RGNB 3TO1A 2H7EA 2DFKA 1KI1B 3ZDTA 1FHXA 2Q13A 2LOXA 1IRSA 1UEFA 1X1FA 2GCJA 1V88A 3KZ1A 3T06A 2IYBA 4A6FA 2UVMA 3PVWA 1ISNA 2W2XC 3ULBA 5D3VA 1DDWA 3DXEA 4WVFB 3D8FA 1KZGA 3SYXA 3PP2A 2CRFA 5JLJB 1XKEA 2LULA 3ODWA 2RSGA 1V5UA 2ZPYA 4ZRKA 4DX8A 2Z0PA 1RRPB 2YT1A 1WGQA 5C16A 4H8SA 5KQ1A 4GMVA 4HAYB 2DKQA 2W2XD 1U27A 3GYPA 2YS3A 4PNKA 4HHVA 4GPTB 5JHGA 5J3TA 2DN6A 4ZRIA 2CODA 3CIKA 3HQCA 2YF0A 3ODXA 5L81A 4GMXB 3AU4A 2I5CA 4GZUA 2XQNM 1LW3A 1UNPA 2Y7BA 1U5GA 3IVFA 5D3XA 2P8VA 2YT0A 4L6EA 2X18A 2J0MA 3A8PA 1LB1A 1U2BA 2J59M 5DHAB 3PEGA 4NSWA 1K5GB 4YL8A 2D9WA 2YS1A 2GCLA 1B55A 3VIAA 4DX90 1BAKA 4A6HA 1XODA 1AQCA 1ZSQA 4K81A 1WI1A 2W2WA 2DX5A 3ZVRA 3FM8C 1DBHA 4Y94A 3TFMA 4P7IA 1Y5OA 1BTKA 4A6FB 4NY0A 1V5MA 5JHHA 1WGUA 3D8EA 3BINA 2ELBA 3SO6A 3KSYA 5LOPB 2E2XA 2MDXA 1FHOA 2UZRA 3QWMA 2VKIA 1GC6A 5DIFB 1MPHA 2YSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  2N0Y A;  2YS5 A;  2DTC A;  4D0N B;  4A5K A;  1P6S A;  2N23 A;  1DYN A;  2LG1 A;  3TW1 A;  4IOY X;  1FB8 A;  4F7H A;  5C5B B;  3MDB C;  1PFJ A;  2Y8F A;  1MK9 B;  2AL6 A;  5D3Y A;  4PQ0 A;  5CLQ B;  4HAX B;  1RJ2 A;  1ZC4 B;  3FEH A;  3MPX A;  5HE3 A;  3TCA A;  5KQ4 A;  2BCJ A;  3PSC A;  4HAZ B;  1MAI A;  3SUZ A;  2D9Z A;  3VOQ A;  1FHW A;  5C5B A;  2CY5 A;  2D9Y A;  5HE2 A;  1KZ7 A;  4K2O A;  2OQB A;  3HW2 B;  3OAN A;  4YON A;  3AU5 A;  1MIX A;  1X1G A;  4HAU B;  2DHI A;  2LYD A;  3QBV B;  1Z87 A;  4WJ7 A;  4HB0 B;  1MK7 B;  3TVV A;  1V61 A;  1XCG A;  2L1C A;  3KRW A;  4HB3 B;  4CHJ A;  1UNQ A;  2Z0Q A;  4EJN A;  1EGX A;  2D11 A;  1J19 A;  3FSS A;  2KGX B;  1M7E A;  2OTX A;  2V76 A;  2ROV A;  2DHJ A;  1OMW A;  4HDO A;  2D9V A;  1XR0 B;  2YRY A;  1V5P A;  2EMT A;  2FJL A;  1V89 A;  2QKL A;  3F0W A;  4HB2 B;  3ML4 A;  5HE0 A;  5DH9 B;  2MKR A;  2IFS A;  3UZT A;  1W1G A;  2RNR B;  2DKP A;  2GJY A;  4WSF A;  5GOW B;  1U5F A;  2HE7 A;  4KAX B;  5FI1 A;  3N7C A;  4XWX A;  1MIZ B;  4K17 A;  5FI0 A;  2ROZ B;  1P3R A;  1U29 A;  4F7U P;  2D10 A;  1ZM0 A;  3HK0 A;  4KHO A;  1QC6 A;  3BJI A;  2ADZ A;  4EKU A;  1I7A A;  1UPQ A;  4GN1 A;  2I1J A;  1WJ1 A;  2K2U A;  1OQN A;  5D3W A;  1SHC A;  1EAZ A;  2QKM A;  5EFX A;  3PVL A;  1DDM A;  3KRX A;  1U5D A;  2JP2 A;  2J0J A;  1FGZ A;  2DHK A;  4MT7 A;  4KVG B;  4Z2M B;  2J0K A;  4HAV B;  2D9X A;  1WG7 A;  3WYF B;  2RLO A;  1X11 A;  1TQZ A;  4HDQ A;  2VSZ A;  3SNH A;  2CAY A;  4K2P A;  4DXA B;  1X05 A;  4IAP A;  1E5W A;  1U5E A;  1NTY A;  3PVU A;  5DHF B;  3QIJ A;  1H4R A;  2H7D A;  1SGH A;  1ZVR A;  2HTH B;  3DXD A;  1I2H A;  2MWN B;  2VRW B;  3D8D A;  5J3Q A;  4HB4 B;  2P0F A;  4HAW B;  1K5D B;  2NZ8 B;  3CXB B;  3SV1 A;  2DA0 A;  1WVH A;  3AJ4 A;  2DX1 A;  2PZ1 A;  3PG7 A;  4CYE A;  3ODO A;  1EVH A;  4EMO A;  3PZD A;  4C0A A;  2EMS A;  1M7R A;  2KUP A;  2MFQ A;  3A8Q A;  2DLW A;  2Y8G A;  1X86 A;  1J0W A;  1MKE A;  5KCV A;  1UNR A;  4DBB A;  3X23 A;  4GXB A;  1N3H A;  3LJU X;  5CLL B;  4A6K A;  3G9W A;  2CY4 A;  1TXD A;  2M14 A;  3WA0 A;  1UPR A;  2EC1 A;  1FOE A;  2EJ8 A;  3U8Z A;  1PLS A;  3P7Z A;  1AWE A;  1QQG A;  2M38 A;  1DDV A;  1Q67 A;  2K2J A;  2UZS A;  1DRO A;  5C6R A;  5D27 A;  2COA A;  2GS0 A;  4MK0 A;  2L2I A;  4TKN A;  1P5T A;  2P0D A;  4KHA A;  5J3Y A;  1W1D A;  1XX0 A;  3O96 A;  1Y19 B;  1WJM A;  3F5R A;  5JP4 A;  2D2Q A;  2R09 A;  1OY2 A;  2COF A;  4F7G A;  1GG3 A;  2G35 A;  3DXC A;  2D4Q A;  4B6H A;  2RUK B;  1BWN A;  2COC A;  4CHM A;  2AEH A;  2NMB A;  2ELA A;  4TYZ A;  2RVB B;  3A98 B;  2R0D A;  4BBK A;  5HE1 A;  1FAO A;  1BTN A;  1FGY A;  2DYN A;  5DI9 B;  2DYQ A;  1TJ6 A;  2LKO A;  4KHB B;  2Z0O A;  1W1H A;  2LOZ A;  2I1K A;  3RCP A;  1EF1 A;  3KY9 A;  4IFS A;  1PMS A;  2P0H A;  3ULC A;  5LON B;  3GYO A;  1ZC3 B;  4MY6 A;  4ZRJ A;  4Z2N A;  3U7D A;  3V5W A;  3NSU A;  1NTV A;  1H10 A;  5C79 A;  4HAT B;  3M1I B;  2KCJ A;  1NU2 A;  2YVC A;  3P6A A;  2K00 A;  1XD4 A;  1GC7 A;  1NI2 A;  2RGN B;  3TO1 A;  2H7E A;  2DFK A;  1KI1 B;  3ZDT A;  1FHX A;  2Q13 A;  2LOX A;  1IRS A;  1UEF A;  1X1F A;  2GCJ A;  1V88 A;  3KZ1 A;  3T06 A;  2IYB A;  4A6F A;  2UVM A;  3PVW A;  1ISN A;  2W2X C;  3ULB A;  5D3V A;  1DDW A;  3DXE A;  4WVF B;  3D8F A;  1KZG A;  3SYX A;  3PP2 A;  2CRF A;  5JLJ B;  1XKE A;  2LUL A;  3ODW A;  2RSG A;  1V5U A;  2ZPY A;  4ZRK A;  4DX8 A;  2Z0P A;  1RRP B;  2YT1 A;  1WGQ A;  5C16 A;  4H8S A;  5KQ1 A;  4GMV A;  4HAY B;  2DKQ A;  2W2X D;  1U27 A;  3GYP A;  2YS3 A;  4PNK A;  4HHV A;  4GPT B;  5JHG A;  5J3T A;  2DN6 A;  4ZRI A;  2COD A;  3CIK A;  3HQC A;  2YF0 A;  3ODX A;  5L81 A;  4GMX B;  3AU4 A;  2I5C A;  4GZU A;  2XQN M;  1LW3 A;  1UNP A;  2Y7B A;  1U5G A;  3IVF A;  5D3X A;  2P8V A;  2YT0 A;  4L6E A;  2X18 A;  2J0M A;  3A8P A;  1LB1 A;  1U2B A;  2J59 M;  5DHA B;  3PEG A;  4NSW A;  1K5G B;  4YL8 A;  2D9W A;  2YS1 A;  2GCL A;  1B55 A;  3VIA A;  4DX9 0;  1BAK A;  4A6H A;  1XOD A;  1AQC A;  1ZSQ A;  4K81 A;  1WI1 A;  2W2W A;  2DX5 A;  3ZVR A;  3FM8 C;  1DBH A;  4Y94 A;  3TFM A;  4P7I A;  1Y5O A;  1BTK A;  4A6F B;  4NY0 A;  1V5M A;  5JHH A;  1WGU A;  3D8E A;  3BIN A;  2ELB A;  3SO6 A;  3KSY A;  5LOP B;  2E2X A;  2MDX A;  1FHO A;  2UZR A;  3QWM A;  2VKI A;  1GC6 A;  5DIF B;  1MPH A;  2YSZ A; 
#chains in the Genus database with same CATH topology
 2I5F A;  2N0Y A;  2YS5 A;  2DTC A;  2FJU B;  4D0N B;  4A5K A;  2GUM A;  1P6S A;  2N23 A;  1DYN A;  2LG1 A;  3TW1 A;  3B77 A;  1MI1 A;  4IOY X;  1FB8 A;  4F7H A;  4OSN A;  5C5B B;  3A58 A;  3MDB C;  1PFJ A;  2Y8F A;  1MK9 B;  2AL6 A;  5D3Y A;  4PQ0 A;  5CLQ B;  4HAX B;  1RJ2 A;  1ZC4 B;  4OT1 A;  3DCX A;  3FEH A;  3MPX A;  5HE3 A;  3TCA A;  5KQ4 A;  2BCJ A;  3PSC A;  4HAZ B;  1MAI A;  3SUZ A;  2D9Z A;  3VOQ A;  1FHW A;  3OHM B;  5C5B A;  2CY5 A;  2D9Y A;  5HE2 A;  1KZ7 A;  4K2O A;  2OQB A;  3HW2 B;  3OAN A;  4YON A;  3AU5 A;  1MIX A;  1X1G A;  4HAU B;  2DHI A;  2LYD A;  3QBV B;  1Z87 A;  4WJ7 A;  4HB0 B;  1MK7 B;  3TVV A;  1V61 A;  1XCG A;  2L1C A;  3KRW A;  4HB3 B;  4CHJ A;  1UNQ A;  2Z0Q A;  4EJN A;  1EGX A;  2D11 A;  1J19 A;  3FSS A;  2KGX B;  1M7E A;  2OTX A;  2V76 A;  2ROV A;  2DHJ A;  1OMW A;  4HDO A;  2D9V A;  1XR0 B;  2YRY A;  1V5P A;  2EMT A;  2RRF A;  2FJL A;  1V89 A;  2QKL A;  3F0W A;  4HB2 B;  3ML4 A;  5HE0 A;  5DH9 B;  2MKR A;  2IFS A;  3UZT A;  1W1G A;  3NWA A;  4DIX A;  2RNR B;  2DKP A;  2GJY A;  4WSF A;  5GOW B;  1U5F A;  2HE7 A;  4KAX B;  2YT2 A;  5FI1 A;  3N7C A;  4XWX A;  2Z14 A;  1MIZ B;  4K17 A;  5FI0 A;  2ROZ B;  1P3R A;  1U29 A;  4F7U P;  2D10 A;  1ZM0 A;  3HK0 A;  4KHO A;  1QC6 A;  3BJI A;  2ADZ A;  2KR0 A;  4EKU A;  1I7A A;  1UPQ A;  2Z4D A;  4GN1 A;  2I1J A;  1WJ1 A;  2K2U A;  1OQN A;  5D3W A;  1SHC A;  1EAZ A;  2QKM A;  5EFX A;  4KHB A;  3PVL A;  1DDM A;  3KRX A;  1U5D A;  2JP2 A;  2J0J A;  1FGZ A;  2DHK A;  4MT7 A;  4KVG B;  4Z2M B;  2J0K A;  2Z13 A;  4HAV B;  2D9X A;  1WG7 A;  3WYF B;  2RLO A;  1X11 A;  1TQZ A;  4HDQ A;  2VSZ A;  3SNH A;  2CAY A;  4K2P A;  4GNK B;  4DXA B;  1X05 A;  4IAP A;  1E5W A;  4CSQ A;  1U5E A;  1NTY A;  3PVU A;  5DHF B;  3QIJ A;  1H4R A;  2H7D A;  1SGH A;  1ZVR A;  2HTH B;  3DXD A;  1I2H A;  2MWN B;  2VRW B;  3D8D A;  5J3Q A;  4HB4 B;  2P0F A;  4HAW B;  1K5D B;  2NZ8 B;  3CXB B;  3SV1 A;  2DA0 A;  5IRS A;  1WVH A;  2R2Y A;  3AJ4 A;  2DX1 A;  2PZ1 A;  3PG7 A;  4CYE A;  4QJ4 B;  3ODO A;  1EVH A;  4EMO A;  3PZD A;  4C0A A;  2EMS A;  1M7R A;  2KUP A;  2MFQ A;  3A8Q A;  2DLW A;  2Y8G A;  1X86 A;  1J0W A;  1MKE A;  5KCV A;  1UNR A;  4DBB A;  3X23 A;  3FVC A;  4GXB A;  1N3H A;  3LJU X;  5CLL B;  4A6K A;  3G9W A;  2CY4 A;  3HSA A;  1TXD A;  2M14 A;  3WA0 A;  1UPR A;  2EC1 A;  1FOE A;  2KUQ A;  2EJ8 A;  3U8Z A;  1PLS A;  3P7Z A;  1AWE A;  1QQG A;  2M38 A;  1DDV A;  1Q67 A;  2K2J A;  2UZS A;  1DRO A;  5C6R A;  5D27 A;  2COA A;  2GS0 A;  4MK0 A;  2L2I A;  4TKN A;  1P5T A;  2P0D A;  4KHA A;  5J3Y A;  1W1D A;  2ZKM X;  1XX0 A;  3O96 A;  1Y19 B;  1WJM A;  3F5R A;  5JP4 A;  4GOU A;  2D2Q A;  2R09 A;  1OY2 A;  2COF A;  4F7G A;  1GG3 A;  2G35 A;  1T77 A;  3DXC A;  2D4Q A;  4B6H A;  2RUK B;  1BWN A;  2COC A;  4CHM A;  4HSI A;  2AEH A;  2NMB A;  2ELA A;  4TYZ A;  2RVB B;  3A98 B;  2R0D A;  4BBK A;  3NWF A;  5HE1 A;  3HIE A;  1FAO A;  1BTN A;  1FGY A;  2DYN A;  5DI9 B;  2DYQ A;  1TJ6 A;  2LKO A;  4KHB B;  2Z0O A;  1W1H A;  2LOZ A;  2I1K A;  3RCP A;  1EF1 A;  3KY9 A;  4IFS A;  1PMS A;  2P0H A;  3ULC A;  5LON B;  3GYO A;  1ZC3 B;  4MY6 A;  4ZRJ A;  4QXA B;  4Z2N A;  3U7D A;  3V5W A;  3NSU A;  1NTV A;  2KIG A;  1H10 A;  5C79 A;  4HAT B;  3M1I B;  2KCJ A;  1NU2 A;  2NBV A;  2YVC A;  3P6A A;  2K00 A;  1XD4 A;  1GC7 A;  1NI2 A;  2RGN B;  3TO1 A;  2H7E A;  5LG4 B;  2DFK A;  1KI1 B;  3ZDT A;  3U12 A;  1FHX A;  2Q13 A;  2LOX A;  1IRS A;  1UEF A;  1X1F A;  2GCJ A;  1V88 A;  3KZ1 A;  3T06 A;  2IYB A;  4A6F A;  2UVM A;  3PVW A;  1ISN A;  2W2X C;  3ULB A;  5D3V A;  5I2M A;  1DDW A;  4D6W A;  3DXE A;  2K49 A;  4WVF B;  3D8F A;  1KZG A;  3SYX A;  3PP2 A;  2CRF A;  5JLJ B;  1XKE A;  2LUL A;  3ODW A;  2RSG A;  1V5U A;  2ZPY A;  5I2S A;  4ZRK A;  4DX8 A;  2Z0P A;  4QJ5 B;  1RRP B;  2YT1 A;  1WGQ A;  5C16 A;  4H8S A;  5KQ1 A;  4GMV A;  4HAY B;  2DKQ A;  2W2X D;  1U27 A;  3GYP A;  2YS3 A;  2KIE A;  3NWD A;  4PNK A;  4HHV A;  4GPT B;  5JHG A;  5J3T A;  2DN6 A;  4ZRI A;  2COD A;  3CIK A;  3HQC A;  2Z59 A;  2YF0 A;  3ODX A;  5L81 A;  4GMX B;  3AU4 A;  2I5C A;  4GZU A;  2XQN M;  1LW3 A;  1UNP A;  2Y7B A;  1U5G A;  3IVF A;  5D3X A;  2P8V A;  2YT0 A;  4L6E A;  2X18 A;  2J0M A;  3A8P A;  1LB1 A;  1U2B A;  2J59 M;  5DHA B;  3PEG A;  4NSW A;  1K5G B;  2K8E A;  4YL8 A;  2D9W A;  2YS1 A;  2GCL A;  1ZYI A;  1B55 A;  5M4Y B;  3VIA A;  4DX9 0;  1BAK A;  4L1R A;  4A6H A;  1XOD A;  1AQC A;  1ZSQ A;  4K81 A;  1WI1 A;  2W2W A;  2DX5 A;  3ZVR A;  3FM8 C;  1DBH A;  4Y94 A;  3TFM A;  4P7I A;  1Y5O A;  1BTK A;  4A6F B;  4NY0 A;  1V5M A;  5JHH A;  1WGU A;  3D8E A;  3BIN A;  2ELB A;  3SO6 A;  3KSY A;  5LOP B;  2E2X A;  2MDX A;  3NW8 A;  1FHO A;  2UZR A;  3QWM A;  2VKI A;  1GC6 A;  5DIF B;  1MPH A;  2YSZ A;  4QJ3 B; 
#chains in the Genus database with same CATH homology
 2I5F A;  2N0Y A;  2YS5 A;  2DTC A;  4D0N B;  4A5K A;  1P6S A;  2N23 A;  1DYN A;  2LG1 A;  3TW1 A;  4IOY X;  1FB8 A;  4F7H A;  5C5B B;  3MDB C;  1PFJ A;  2Y8F A;  1MK9 B;  2AL6 A;  5D3Y A;  4PQ0 A;  5CLQ B;  4HAX B;  1RJ2 A;  1ZC4 B;  3FEH A;  3MPX A;  5HE3 A;  3TCA A;  5KQ4 A;  2BCJ A;  3PSC A;  4HAZ B;  1MAI A;  3SUZ A;  2D9Z A;  3VOQ A;  1FHW A;  5C5B A;  2CY5 A;  2D9Y A;  5HE2 A;  1KZ7 A;  4K2O A;  2OQB A;  3HW2 B;  3OAN A;  4YON A;  3AU5 A;  1MIX A;  1X1G A;  4HAU B;  2DHI A;  2LYD A;  3QBV B;  1Z87 A;  4WJ7 A;  4HB0 B;  1MK7 B;  3TVV A;  1V61 A;  1XCG A;  2L1C A;  3KRW A;  4HB3 B;  4CHJ A;  1UNQ A;  2Z0Q A;  4EJN A;  1EGX A;  2D11 A;  1J19 A;  3FSS A;  2KGX B;  1M7E A;  2OTX A;  2V76 A;  2ROV A;  2DHJ A;  1OMW A;  4HDO A;  2D9V A;  1XR0 B;  2YRY A;  1V5P A;  2EMT A;  2FJL A;  1V89 A;  2QKL A;  3F0W A;  4HB2 B;  3ML4 A;  5HE0 A;  5DH9 B;  2MKR A;  2IFS A;  3UZT A;  1W1G A;  2RNR B;  2DKP A;  2GJY A;  4WSF A;  5GOW B;  1U5F A;  2HE7 A;  4KAX B;  5FI1 A;  3N7C A;  4XWX A;  1MIZ B;  4K17 A;  5FI0 A;  2ROZ B;  1P3R A;  1U29 A;  4F7U P;  2D10 A;  1ZM0 A;  3HK0 A;  4KHO A;  1QC6 A;  3BJI A;  2ADZ A;  4EKU A;  1I7A A;  1UPQ A;  4GN1 A;  2I1J A;  1WJ1 A;  2K2U A;  1OQN A;  5D3W A;  1SHC A;  1EAZ A;  2QKM A;  5EFX A;  3PVL A;  1DDM A;  3KRX A;  1U5D A;  2JP2 A;  2J0J A;  1FGZ A;  2DHK A;  4MT7 A;  4KVG B;  4Z2M B;  2J0K A;  4HAV B;  2D9X A;  1WG7 A;  3WYF B;  2RLO A;  1X11 A;  1TQZ A;  4HDQ A;  2VSZ A;  3SNH A;  2CAY A;  4K2P A;  4DXA B;  1X05 A;  4IAP A;  1E5W A;  1U5E A;  1NTY A;  3PVU A;  5DHF B;  3QIJ A;  1H4R A;  2H7D A;  1SGH A;  1ZVR A;  2HTH B;  3DXD A;  1I2H A;  2MWN B;  2VRW B;  3D8D A;  5J3Q A;  4HB4 B;  2P0F A;  4HAW B;  1K5D B;  2NZ8 B;  3CXB B;  3SV1 A;  2DA0 A;  1WVH A;  3AJ4 A;  2DX1 A;  2PZ1 A;  3PG7 A;  4CYE A;  3ODO A;  1EVH A;  4EMO A;  3PZD A;  4C0A A;  2EMS A;  1M7R A;  2KUP A;  2MFQ A;  3A8Q A;  2DLW A;  2Y8G A;  1X86 A;  1J0W A;  1MKE A;  5KCV A;  1UNR A;  4DBB A;  3X23 A;  4GXB A;  1N3H A;  3LJU X;  5CLL B;  4A6K A;  3G9W A;  2CY4 A;  1TXD A;  2M14 A;  3WA0 A;  1UPR A;  2EC1 A;  1FOE A;  2EJ8 A;  3U8Z A;  1PLS A;  3P7Z A;  1AWE A;  1QQG A;  2M38 A;  1DDV A;  1Q67 A;  2K2J A;  2UZS A;  1DRO A;  5C6R A;  5D27 A;  2COA A;  2GS0 A;  4MK0 A;  2L2I A;  4TKN A;  1P5T A;  2P0D A;  4KHA A;  5J3Y A;  1W1D A;  1XX0 A;  3O96 A;  1Y19 B;  1WJM A;  3F5R A;  5JP4 A;  2D2Q A;  2R09 A;  1OY2 A;  2COF A;  4F7G A;  1GG3 A;  2G35 A;  3DXC A;  2D4Q A;  4B6H A;  2RUK B;  1BWN A;  2COC A;  4CHM A;  2AEH A;  2NMB A;  2ELA A;  4TYZ A;  2RVB B;  3A98 B;  2R0D A;  4BBK A;  5HE1 A;  1FAO A;  1BTN A;  1FGY A;  2DYN A;  5DI9 B;  2DYQ A;  1TJ6 A;  2LKO A;  4KHB B;  2Z0O A;  1W1H A;  2LOZ A;  2I1K A;  3RCP A;  1EF1 A;  3KY9 A;  4IFS A;  1PMS A;  2P0H A;  3ULC A;  5LON B;  3GYO A;  1ZC3 B;  4MY6 A;  4ZRJ A;  4Z2N A;  3U7D A;  3V5W A;  3NSU A;  1NTV A;  1H10 A;  5C79 A;  4HAT B;  3M1I B;  2KCJ A;  1NU2 A;  2YVC A;  3P6A A;  2K00 A;  1XD4 A;  1GC7 A;  1NI2 A;  2RGN B;  3TO1 A;  2H7E A;  2DFK A;  1KI1 B;  3ZDT A;  1FHX A;  2Q13 A;  2LOX A;  1IRS A;  1UEF A;  1X1F A;  2GCJ A;  1V88 A;  3KZ1 A;  3T06 A;  2IYB A;  4A6F A;  2UVM A;  3PVW A;  1ISN A;  2W2X C;  3ULB A;  5D3V A;  1DDW A;  3DXE A;  4WVF B;  3D8F A;  1KZG A;  3SYX A;  3PP2 A;  2CRF A;  5JLJ B;  1XKE A;  2LUL A;  3ODW A;  2RSG A;  1V5U A;  2ZPY A;  4ZRK A;  4DX8 A;  2Z0P A;  1RRP B;  2YT1 A;  1WGQ A;  5C16 A;  4H8S A;  5KQ1 A;  4GMV A;  4HAY B;  2DKQ A;  2W2X D;  1U27 A;  3GYP A;  2YS3 A;  4PNK A;  4HHV A;  4GPT B;  5JHG A;  5J3T A;  2DN6 A;  4ZRI A;  2COD A;  3CIK A;  3HQC A;  2YF0 A;  3ODX A;  5L81 A;  4GMX B;  3AU4 A;  2I5C A;  4GZU A;  2XQN M;  1LW3 A;  1UNP A;  2Y7B A;  1U5G A;  3IVF A;  5D3X A;  2P8V A;  2YT0 A;  4L6E A;  2X18 A;  2J0M A;  3A8P A;  1LB1 A;  1U2B A;  2J59 M;  5DHA B;  3PEG A;  4NSW A;  1K5G B;  4YL8 A;  2D9W A;  2YS1 A;  2GCL A;  1B55 A;  3VIA A;  4DX9 0;  1BAK A;  4A6H A;  1XOD A;  1AQC A;  1ZSQ A;  4K81 A;  1WI1 A;  2W2W A;  2DX5 A;  3ZVR A;  3FM8 C;  1DBH A;  4Y94 A;  3TFM A;  4P7I A;  1Y5O A;  1BTK A;  4A6F B;  4NY0 A;  1V5M A;  5JHH A;  1WGU A;  3D8E A;  3BIN A;  2ELB A;  3SO6 A;  3KSY A;  5LOP B;  2E2X A;  2MDX A;  1FHO A;  2UZR A;  3QWM A;  2VKI A;  1GC6 A;  5DIF B;  1MPH A;  2YSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...