1WGUA

Solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amyloid beta (A4) precursor protein-binding, family B, membe
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wguA01
4HDOA 2YSZA 4ZRJA 2GS0A 2RGNB 2J0JA 2COCA 2KGXB 2BCJA 4KHAA 1SHCA 2J0MA 3PG7A 5FI1A 4HB3B 2G35A 2K00A 1UNQA 2PZ1A 4GPTB 2DA0A 4F7GA 5D27A 2I1KA 2DHJA 2DFKA 5LOPB 1DDWA 1M7EA 2IFSA 2COAA 2MKRA 3NSUA 5D3XA 1UPRA 2H7EA 1MIZB 3SV1A 1ZSQA 2X18A 3SNHA 5DH9B 4GXBA 2Y8FA 3BINA 3ZDTA 1NI2A 2J59M 2H7DA 2RNRB 1RJ2A 3F5RA 2AL6A 1AQCA 4HB0B 4GN1A 4HB2B 4Y94A 3UZTA 2D2QA 2LOXA 1NU2A 1GC6A 4NSWA 5D3YA 1H10A 2I5CA 1XR0B 4WVFB 1UEFA 2FJLA 1V5PA 1X86A 2KCJA 2YT0A 3P7ZA 2RUKB 5JP4A 1DDMA 2HE7A 1DROA 5HE3A 4A6HA 3X23A 1XODA 1ISNA 1TJ6A 1PFJA 2OTXA 2OQBA 4WJ7A 4DX8A 5CLQB 1FHXA 4MT7A 2YVCA 1K5DB 1MKEA 2CODA 1Z87A 1V89A 2D9ZA 3ULBA 2QKLA 2D9YA 3A98B 1M7RA 1FOEA 1U5DA 4CHJA 3A8PA 2D9XA 1FHWA 1MK9B 4BBKA 1PLSA 1KZGA 1WJ1A 1FB8A 1U27A 3O96A 2AEHA 2RVBB 1X1FA 3G9WA 3MPXA 2Y8GA 3M1IB 1Y5OA 4GMVA 4H8SA 2DYNA 2YF0A 2P0HA 5D3WA 3ZVRA 2VKIA 5HE1A 1MK7B 2EJ8A 1Y19B 2Y7BA 2P0FA 2VRWB 4K2PA 3P6AA 4MK0A 3ODWA 1U5FA 1J0WA 4F7UP 4TKNA 3HQCA 1DBHA 5CLLB 3ODOA 2YS1A 2HTHB 2Z0QA 4HB4B 5JHHA 1WJMA 4F7HA 1MAIA 2P0DA 3PVLA 3U7DA 2UVMA 1X05A 2YS5A 1FHOA 4DBBA 1GG3A 3LJUX 2COFA 3D8FA 1WI1A 3PZDA 3WYFB 3PEGA 2IYBA 2GJYA 1V5MA 3KRWA 4CYEA 2QKMA 3HW2B 1RRPB 2W2WA 1H4RA 4KVGB 2LOZA 5KCVA 2I1JA 1ZC3B 3FEHA 2UZSA 2MDXA 1UPQA 3FSSA 1UNPA 4EJNA 1K5GB 3QBVB 4A6KA 1EF1A 4B6HA 1QQGA 1OMWA 3CIKA 4HAUB 1W1DA 5C5BA 4YL8A 4HAXB 2ELAA 1V88A 2DTCA 2YRYA 3DXCA 2DN6A 5DHAB 1SGHA 1X11A 5LONB 2GCJA 3ML4A 4XWXA 2D9VA 1MPHA 3KZ1A 2J0KA 2CY4A 3F0WA 3A8QA 3V5WA 2D11A 1J19A 2K2JA 2LKOA 1PMSA 3TFMA 2LULA 1NTVA 5L81A 2VSZA 3MDBC 3ODXA 1LW3A 1E5WA 3GYOA 1DDVA 1P5TA 2EMSA 1WG7A 5J3YA 4DXAB 4TYZA 3VIAA 4PNKA 1V5UA 3SO6A 3VOQA 1N3HA 3QWMA 2DKQA 2E2XA 1U5GA 2EMTA 3HK0A 2D9WA 2L2IA 5HE0A 1XD4A 1FAOA 1P6SA 1MIXA 2M38A 2ZPYA 4A6FB 5KQ4A 2CRFA 1ZC4B 5JLJB 2NZ8B 2W2XD 4NY0A 4HAZB 1I7AA 1W1HA 2L1CA 1TXDA 2YS3A 2K2UA 1U5EA 5FI0A 1TQZA 1FGYA 4YONA 4D0NB 1WGUA 1EAZA 2ELBA 4PQ0A 2Z0OA 3TW1A 2CAYA 2LYDA 2V76A 3AU5A 4HAVB 5EFXA 2RLOA 4A6FA 3IVFA 4K81A 5DHFB 2DYQA 5JHGA 5C5BB 4IFSA 3TCAA 2DHKA 3PVUA 2R09A 4GMXB 2KUPA 2JP2A 2NMBA 4P7IA 1OQNA 2ROZB 2UZRA 3DXEA 3QIJA 5D3VA 2I5FA 4DX90 3KY9A 2N0YA 2DLWA 2MWNB 2RSGA 3D8EA 5C6RA 4WSFA 1OY2A 1QC6A 3T06A 3KRXA 4ZRIA 5J3TA 1BAKA 3DXDA 1FGZA 3ULCA 5KQ1A 4Z2MB 2ROVA 1UNRA 1BWNA 1AWEA 1U29A 2DHIA 1XCGA 2GCLA 1BTNA 5DIFB 1I2HA 2Q13A 2DKPA 5HE2A 2ADZA 1W1GA 4K17A 4A5KA 1ZM0A 4KHBB 4KAXB 1NTYA 2Z0PA 2D4QA 1XKEA 4HAWB 2P8VA 4IOYX 1DYNA 2DX1A 2MFQA 1IRSA 4EKUA 4CHMA 2YT1A 1XX0A 4K2OA 3N7CA 3SUZA 3D8DA 1X1GA 3AU4A 1BTKA 4C0AA 2D10A 4HHVA 2DX5A 5DI9B 4EMOA 4IAPA 2CY5A 3BJIA 1GC7A 5J3QA 4KHOA 1EVHA 2LG1A 3U8ZA 3CXBB 5C16A 1V61A 3FM8C 3WA0A 1U2BA 3TO1A 4HDQA 5GOWB 3OANA 3KSYA 1Q67A 1WVHA 3RCPA 3TVVA 1ZVRA 1KI1B 1EGXA 3PP2A 2N23A 3AJ4A 1KZ7A 2R0DA 4ZRKA 2W2XC 4L6EA 2XQNM 2M14A 3SYXA 1LB1A 3PVWA 4MY6A 5C79A 1B55A 4GZUA 4HATB 1P3RA 2EC1A 3PSCA 3GYPA 4HAYB 1WGQA 4Z2NA
chains in the Genus database with same CATH superfamily
4HDOA 2YSZA 4ZRJA 2GS0A 2RGNB 2J0JA 2COCA 2KGXB 2BCJA 4OSNA 4KHAA 1SHCA 2J0MA 3PG7A 5FI1A 4HB3B 2G35A 2K00A 1UNQA 2PZ1A 4GPTB 2DA0A 4F7GA 5D27A 2I1KA 2DHJA 2DFKA 5LOPB 1DDWA 1M7EA 2IFSA 2COAA 2MKRA 3NSUA 5D3XA 1UPRA 2H7EA 1MIZB 3SV1A 1ZSQA 2X18A 3SNHA 5DH9B 4GXBA 2Y8FA 3BINA 3ZDTA 1NI2A 2J59M 2H7DA 2RNRB 1RJ2A 3F5RA 2AL6A 1AQCA 4HB0B 4GN1A 4HB2B 4Y94A 3UZTA 2D2QA 2LOXA 3HSAA 1NU2A 1GC6A 4NSWA 5D3YA 1H10A 4GNKB 2I5CA 1XR0B 4WVFB 1UEFA 2FJLA 1V5PA 1X86A 2KCJA 2YT0A 3P7ZA 2RUKB 5JP4A 1DDMA 2HE7A 1DROA 5HE3A 4A6HA 3X23A 1XODA 1ISNA 1TJ6A 1PFJA 2OTXA 2OQBA 4WJ7A 4DX8A 5CLQB 1FHXA 4MT7A 2YVCA 1K5DB 1MKEA 2CODA 4GOUA 1Z87A 1V89A 2D9ZA 3ULBA 2QKLA 2D9YA 3A98B 1M7RA 1FOEA 1U5DA 4CHJA 3A8PA 2D9XA 1FHWA 1MK9B 4BBKA 1PLSA 1KZGA 1WJ1A 1FB8A 1U27A 5I2SA 3O96A 2AEHA 2KUQA 2RVBB 1X1FA 3NWFA 3U12A 2KIEA 3G9WA 3MPXA 2Y8GA 3M1IB 1Y5OA 4GMVA 3FVCA 4H8SA 2DYNA 2YF0A 2Z4DA 2P0HA 5D3WA 3ZVRA 2VKIA 5HE1A 3NWDA 1MK7B 2EJ8A 4DIXA 1Y19B 2Y7BA 2P0FA 2VRWB 4K2PA 3P6AA 4MK0A 3ODWA 1U5FA 1J0WA 4F7UP 4TKNA 3HQCA 1DBHA 5CLLB 3ODOA 2YS1A 2HTHB 2Z0QA 4HB4B 5JHHA 1WJMA 4F7HA 4HSIA 1MAIA 2P0DA 3PVLA 3U7DA 2UVMA 1X05A 2YS5A 1FHOA 4DBBA 1GG3A 3LJUX 2RRFA 2COFA 3D8FA 1WI1A 3PZDA 3WYFB 3PEGA 3NWAA 2IYBA 2GJYA 2Z14A 1V5MA 3KRWA 4CYEA 2QKMA 3HW2B 1T77A 1RRPB 2W2WA 1H4RA 4KVGB 2NBVA 2LOZA 2ZKMX 5KCVA 2I1JA 1ZC3B 3FEHA 2UZSA 2MDXA 1UPQA 3FSSA 1UNPA 4EJNA 1K5GB 3QBVB 4A6KA 1EF1A 5LG4B 4B6HA 1QQGA 1OMWA 3CIKA 4HAUB 1W1DA 5C5BA 4YL8A 4HAXB 2ELAA 1V88A 2DTCA 2YRYA 3DXCA 2DN6A 5DHAB 1SGHA 2K8EA 5IRSA 1X11A 5LONB 2GCJA 3ML4A 4XWXA 2D9VA 4QXAB 3A58A 1MPHA 3KZ1A 2J0KA 2CY4A 3F0WA 3HIEA 3A8QA 3V5WA 2D11A 1J19A 2K2JA 2LKOA 1PMSA 3TFMA 2LULA 1NTVA 5L81A 2VSZA 3MDBC 3ODXA 2Z13A 1LW3A 1E5WA 3GYOA 4L1RA 1DDVA 1P5TA 2EMSA 1WG7A 5J3YA 4DXAB 4TYZA 3VIAA 4PNKA 1V5UA 3SO6A 3VOQA 1N3HA 3QWMA 4D6WA 2DKQA 2E2XA 1U5GA 2EMTA 4QJ5B 3HK0A 2D9WA 2L2IA 5HE0A 1XD4A 1FAOA 1P6SA 1MIXA 2M38A 2ZPYA 4A6FB 5KQ4A 2CRFA 1ZC4B 5JLJB 2NZ8B 2W2XD 4NY0A 4HAZB 2R2YA 1I7AA 1W1HA 2L1CA 1TXDA 2YS3A 2K2UA 1U5EA 5FI0A 1TQZA 1FGYA 4YONA 4D0NB 1WGUA 1EAZA 2ELBA 2KR0A 4PQ0A 2Z0OA 3TW1A 2CAYA 2LYDA 2V76A 3AU5A 4HAVB 5EFXA 2RLOA 4A6FA 3IVFA 4K81A 5DHFB 5M4YB 2DYQA 5JHGA 5C5BB 4IFSA 3TCAA 2DHKA 3PVUA 2R09A 4GMXB 4QJ3B 2KUPA 2JP2A 2NMBA 4P7IA 1OQNA 2ROZB 2UZRA 3DXEA 3QIJA 5D3VA 2I5FA 4CSQA 5I2MA 4DX90 3KY9A 2N0YA 2DLWA 2MWNB 2RSGA 3D8EA 5C6RA 4WSFA 1OY2A 1QC6A 3T06A 2KIGA 2Z59A 3KRXA 4ZRIA 5J3TA 1BAKA 3DXDA 1FGZA 1ZYIA 3ULCA 5KQ1A 3NW8A 4Z2MB 2ROVA 1UNRA 1BWNA 1AWEA 1U29A 2DHIA 1XCGA 2GCLA 1BTNA 5DIFB 1I2HA 2Q13A 2DKPA 5HE2A 2ADZA 1W1GA 4K17A 3B77A 4A5KA 1ZM0A 4KHBB 4KAXB 1NTYA 2Z0PA 2D4QA 1XKEA 4HAWB 2P8VA 4OT1A 4IOYX 1DYNA 2DX1A 1MI1A 2MFQA 1IRSA 4EKUA 4CHMA 2YT1A 2GUMA 1XX0A 4K2OA 3N7CA 3SUZA 3D8DA 1X1GA 3AU4A 2FJUB 1BTKA 4C0AA 3OHMB 2D10A 4HHVA 2DX5A 4KHBA 5DI9B 4EMOA 4IAPA 2CY5A 3BJIA 1GC7A 5J3QA 4KHOA 1EVHA 2LG1A 3U8ZA 3CXBB 5C16A 1V61A 3FM8C 3WA0A 1U2BA 3TO1A 4HDQA 5GOWB 3OANA 3KSYA 1Q67A 1WVHA 3RCPA 3TVVA 1ZVRA 2K49A 1KI1B 1EGXA 3PP2A 2N23A 3AJ4A 1KZ7A 2R0DA 4ZRKA 2W2XC 4L6EA 2XQNM 2M14A 2YT2A 3SYXA 1LB1A 3PVWA 4MY6A 5C79A 1B55A 4GZUA 4HATB 1P3RA 4QJ4B 2EC1A 3PSCA 3GYPA 4HAYB 1WGQA 4Z2NA 3DCXA
chains in the Genus database with same CATH topology
4HDOA 2YSZA 4ZRJA 2GS0A 2RGNB 2J0JA 2COCA 2KGXB 2BCJA 4KHAA 1SHCA 2J0MA 3PG7A 5FI1A 4HB3B 2G35A 2K00A 1UNQA 2PZ1A 4GPTB 2DA0A 4F7GA 5D27A 2I1KA 2DHJA 2DFKA 5LOPB 1DDWA 1M7EA 2IFSA 2COAA 2MKRA 3NSUA 5D3XA 1UPRA 2H7EA 1MIZB 3SV1A 1ZSQA 2X18A 3SNHA 5DH9B 4GXBA 2Y8FA 3BINA 3ZDTA 1NI2A 2J59M 2H7DA 2RNRB 1RJ2A 3F5RA 2AL6A 1AQCA 4HB0B 4GN1A 4HB2B 4Y94A 3UZTA 2D2QA 2LOXA 1NU2A 1GC6A 4NSWA 5D3YA 1H10A 2I5CA 1XR0B 4WVFB 1UEFA 2FJLA 1V5PA 1X86A 2KCJA 2YT0A 3P7ZA 2RUKB 5JP4A 1DDMA 2HE7A 1DROA 5HE3A 4A6HA 3X23A 1XODA 1ISNA 1TJ6A 1PFJA 2OTXA 2OQBA 4WJ7A 4DX8A 5CLQB 1FHXA 4MT7A 2YVCA 1K5DB 1MKEA 2CODA 1Z87A 1V89A 2D9ZA 3ULBA 2QKLA 2D9YA 3A98B 1M7RA 1FOEA 1U5DA 4CHJA 3A8PA 2D9XA 1FHWA 1MK9B 4BBKA 1PLSA 1KZGA 1WJ1A 1FB8A 1U27A 3O96A 2AEHA 2RVBB 1X1FA 3G9WA 3MPXA 2Y8GA 3M1IB 1Y5OA 4GMVA 4H8SA 2DYNA 2YF0A 2P0HA 5D3WA 3ZVRA 2VKIA 5HE1A 1MK7B 2EJ8A 1Y19B 2Y7BA 2P0FA 2VRWB 4K2PA 3P6AA 4MK0A 3ODWA 1U5FA 1J0WA 4F7UP 4TKNA 3HQCA 1DBHA 5CLLB 3ODOA 2YS1A 2HTHB 2Z0QA 4HB4B 5JHHA 1WJMA 4F7HA 1MAIA 2P0DA 3PVLA 3U7DA 2UVMA 1X05A 2YS5A 1FHOA 4DBBA 1GG3A 3LJUX 2COFA 3D8FA 1WI1A 3PZDA 3WYFB 3PEGA 2IYBA 2GJYA 1V5MA 3KRWA 4CYEA 2QKMA 3HW2B 1RRPB 2W2WA 1H4RA 4KVGB 2LOZA 5KCVA 2I1JA 1ZC3B 3FEHA 2UZSA 2MDXA 1UPQA 3FSSA 1UNPA 4EJNA 1K5GB 3QBVB 4A6KA 1EF1A 4B6HA 1QQGA 1OMWA 3CIKA 4HAUB 1W1DA 5C5BA 4YL8A 4HAXB 2ELAA 1V88A 2DTCA 2YRYA 3DXCA 2DN6A 5DHAB 1SGHA 1X11A 5LONB 2GCJA 3ML4A 4XWXA 2D9VA 1MPHA 3KZ1A 2J0KA 2CY4A 3F0WA 3A8QA 3V5WA 2D11A 1J19A 2K2JA 2LKOA 1PMSA 3TFMA 2LULA 1NTVA 5L81A 2VSZA 3MDBC 3ODXA 1LW3A 1E5WA 3GYOA 1DDVA 1P5TA 2EMSA 1WG7A 5J3YA 4DXAB 4TYZA 3VIAA 4PNKA 1V5UA 3SO6A 3VOQA 1N3HA 3QWMA 2DKQA 2E2XA 1U5GA 2EMTA 3HK0A 2D9WA 2L2IA 5HE0A 1XD4A 1FAOA 1P6SA 1MIXA 2M38A 2ZPYA 4A6FB 5KQ4A 2CRFA 1ZC4B 5JLJB 2NZ8B 2W2XD 4NY0A 4HAZB 1I7AA 1W1HA 2L1CA 1TXDA 2YS3A 2K2UA 1U5EA 5FI0A 1TQZA 1FGYA 4YONA 4D0NB 1WGUA 1EAZA 2ELBA 4PQ0A 2Z0OA 3TW1A 2CAYA 2LYDA 2V76A 3AU5A 4HAVB 5EFXA 2RLOA 4A6FA 3IVFA 4K81A 5DHFB 2DYQA 5JHGA 5C5BB 4IFSA 3TCAA 2DHKA 3PVUA 2R09A 4GMXB 2KUPA 2JP2A 2NMBA 4P7IA 1OQNA 2ROZB 2UZRA 3DXEA 3QIJA 5D3VA 2I5FA 4DX90 3KY9A 2N0YA 2DLWA 2MWNB 2RSGA 3D8EA 5C6RA 4WSFA 1OY2A 1QC6A 3T06A 3KRXA 4ZRIA 5J3TA 1BAKA 3DXDA 1FGZA 3ULCA 5KQ1A 4Z2MB 2ROVA 1UNRA 1BWNA 1AWEA 1U29A 2DHIA 1XCGA 2GCLA 1BTNA 5DIFB 1I2HA 2Q13A 2DKPA 5HE2A 2ADZA 1W1GA 4K17A 4A5KA 1ZM0A 4KHBB 4KAXB 1NTYA 2Z0PA 2D4QA 1XKEA 4HAWB 2P8VA 4IOYX 1DYNA 2DX1A 2MFQA 1IRSA 4EKUA 4CHMA 2YT1A 1XX0A 4K2OA 3N7CA 3SUZA 3D8DA 1X1GA 3AU4A 1BTKA 4C0AA 2D10A 4HHVA 2DX5A 5DI9B 4EMOA 4IAPA 2CY5A 3BJIA 1GC7A 5J3QA 4KHOA 1EVHA 2LG1A 3U8ZA 3CXBB 5C16A 1V61A 3FM8C 3WA0A 1U2BA 3TO1A 4HDQA 5GOWB 3OANA 3KSYA 1Q67A 1WVHA 3RCPA 3TVVA 1ZVRA 1KI1B 1EGXA 3PP2A 2N23A 3AJ4A 1KZ7A 2R0DA 4ZRKA 2W2XC 4L6EA 2XQNM 2M14A 3SYXA 1LB1A 3PVWA 4MY6A 5C79A 1B55A 4GZUA 4HATB 1P3RA 2EC1A 3PSCA 3GYPA 4HAYB 1WGQA 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  2YSZ A;  4ZRJ A;  2GS0 A;  2RGN B;  2J0J A;  2COC A;  2KGX B;  2BCJ A;  4KHA A;  1SHC A;  2J0M A;  3PG7 A;  5FI1 A;  4HB3 B;  2G35 A;  2K00 A;  1UNQ A;  2PZ1 A;  4GPT B;  2DA0 A;  4F7G A;  5D27 A;  2I1K A;  2DHJ A;  2DFK A;  5LOP B;  1DDW A;  1M7E A;  2IFS A;  2COA A;  2MKR A;  3NSU A;  5D3X A;  1UPR A;  2H7E A;  1MIZ B;  3SV1 A;  1ZSQ A;  2X18 A;  3SNH A;  5DH9 B;  4GXB A;  2Y8F A;  3BIN A;  3ZDT A;  1NI2 A;  2J59 M;  2H7D A;  2RNR B;  1RJ2 A;  3F5R A;  2AL6 A;  1AQC A;  4HB0 B;  4GN1 A;  4HB2 B;  4Y94 A;  3UZT A;  2D2Q A;  2LOX A;  1NU2 A;  1GC6 A;  4NSW A;  5D3Y A;  1H10 A;  2I5C A;  1XR0 B;  4WVF B;  1UEF A;  2FJL A;  1V5P A;  1X86 A;  2KCJ A;  2YT0 A;  3P7Z A;  2RUK B;  5JP4 A;  1DDM A;  2HE7 A;  1DRO A;  5HE3 A;  4A6H A;  3X23 A;  1XOD A;  1ISN A;  1TJ6 A;  1PFJ A;  2OTX A;  2OQB A;  4WJ7 A;  4DX8 A;  5CLQ B;  1FHX A;  4MT7 A;  2YVC A;  1K5D B;  1MKE A;  2COD A;  1Z87 A;  1V89 A;  2D9Z A;  3ULB A;  2QKL A;  2D9Y A;  3A98 B;  1M7R A;  1FOE A;  1U5D A;  4CHJ A;  3A8P A;  2D9X A;  1FHW A;  1MK9 B;  4BBK A;  1PLS A;  1KZG A;  1WJ1 A;  1FB8 A;  1U27 A;  3O96 A;  2AEH A;  2RVB B;  1X1F A;  3G9W A;  3MPX A;  2Y8G A;  3M1I B;  1Y5O A;  4GMV A;  4H8S A;  2DYN A;  2YF0 A;  2P0H A;  5D3W A;  3ZVR A;  2VKI A;  5HE1 A;  1MK7 B;  2EJ8 A;  1Y19 B;  2Y7B A;  2P0F A;  2VRW B;  4K2P A;  3P6A A;  4MK0 A;  3ODW A;  1U5F A;  1J0W A;  4F7U P;  4TKN A;  3HQC A;  1DBH A;  5CLL B;  3ODO A;  2YS1 A;  2HTH B;  2Z0Q A;  4HB4 B;  5JHH A;  1WJM A;  4F7H A;  1MAI A;  2P0D A;  3PVL A;  3U7D A;  2UVM A;  1X05 A;  2YS5 A;  1FHO A;  4DBB A;  1GG3 A;  3LJU X;  2COF A;  3D8F A;  1WI1 A;  3PZD A;  3WYF B;  3PEG A;  2IYB A;  2GJY A;  1V5M A;  3KRW A;  4CYE A;  2QKM A;  3HW2 B;  1RRP B;  2W2W A;  1H4R A;  4KVG B;  2LOZ A;  5KCV A;  2I1J A;  1ZC3 B;  3FEH A;  2UZS A;  2MDX A;  1UPQ A;  3FSS A;  1UNP A;  4EJN A;  1K5G B;  3QBV B;  4A6K A;  1EF1 A;  4B6H A;  1QQG A;  1OMW A;  3CIK A;  4HAU B;  1W1D A;  5C5B A;  4YL8 A;  4HAX B;  2ELA A;  1V88 A;  2DTC A;  2YRY A;  3DXC A;  2DN6 A;  5DHA B;  1SGH A;  1X11 A;  5LON B;  2GCJ A;  3ML4 A;  4XWX A;  2D9V A;  1MPH A;  3KZ1 A;  2J0K A;  2CY4 A;  3F0W A;  3A8Q A;  3V5W A;  2D11 A;  1J19 A;  2K2J A;  2LKO A;  1PMS A;  3TFM A;  2LUL A;  1NTV A;  5L81 A;  2VSZ A;  3MDB C;  3ODX A;  1LW3 A;  1E5W A;  3GYO A;  1DDV A;  1P5T A;  2EMS A;  1WG7 A;  5J3Y A;  4DXA B;  4TYZ A;  3VIA A;  4PNK A;  1V5U A;  3SO6 A;  3VOQ A;  1N3H A;  3QWM A;  2DKQ A;  2E2X A;  1U5G A;  2EMT A;  3HK0 A;  2D9W A;  2L2I A;  5HE0 A;  1XD4 A;  1FAO A;  1P6S A;  1MIX A;  2M38 A;  2ZPY A;  4A6F B;  5KQ4 A;  2CRF A;  1ZC4 B;  5JLJ B;  2NZ8 B;  2W2X D;  4NY0 A;  4HAZ B;  1I7A A;  1W1H A;  2L1C A;  1TXD A;  2YS3 A;  2K2U A;  1U5E A;  5FI0 A;  1TQZ A;  1FGY A;  4YON A;  4D0N B;  1WGU A;  1EAZ A;  2ELB A;  4PQ0 A;  2Z0O A;  3TW1 A;  2CAY A;  2LYD A;  2V76 A;  3AU5 A;  4HAV B;  5EFX A;  2RLO A;  4A6F A;  3IVF A;  4K81 A;  5DHF B;  2DYQ A;  5JHG A;  5C5B B;  4IFS A;  3TCA A;  2DHK A;  3PVU A;  2R09 A;  4GMX B;  2KUP A;  2JP2 A;  2NMB A;  4P7I A;  1OQN A;  2ROZ B;  2UZR A;  3DXE A;  3QIJ A;  5D3V A;  2I5F A;  4DX9 0;  3KY9 A;  2N0Y A;  2DLW A;  2MWN B;  2RSG A;  3D8E A;  5C6R A;  4WSF A;  1OY2 A;  1QC6 A;  3T06 A;  3KRX A;  4ZRI A;  5J3T A;  1BAK A;  3DXD A;  1FGZ A;  3ULC A;  5KQ1 A;  4Z2M B;  2ROV A;  1UNR A;  1BWN A;  1AWE A;  1U29 A;  2DHI A;  1XCG A;  2GCL A;  1BTN A;  5DIF B;  1I2H A;  2Q13 A;  2DKP A;  5HE2 A;  2ADZ A;  1W1G A;  4K17 A;  4A5K A;  1ZM0 A;  4KHB B;  4KAX B;  1NTY A;  2Z0P A;  2D4Q A;  1XKE A;  4HAW B;  2P8V A;  4IOY X;  1DYN A;  2DX1 A;  2MFQ A;  1IRS A;  4EKU A;  4CHM A;  2YT1 A;  1XX0 A;  4K2O A;  3N7C A;  3SUZ A;  3D8D A;  1X1G A;  3AU4 A;  1BTK A;  4C0A A;  2D10 A;  4HHV A;  2DX5 A;  5DI9 B;  4EMO A;  4IAP A;  2CY5 A;  3BJI A;  1GC7 A;  5J3Q A;  4KHO A;  1EVH A;  2LG1 A;  3U8Z A;  3CXB B;  5C16 A;  1V61 A;  3FM8 C;  3WA0 A;  1U2B A;  3TO1 A;  4HDQ A;  5GOW B;  3OAN A;  3KSY A;  1Q67 A;  1WVH A;  3RCP A;  3TVV A;  1ZVR A;  1KI1 B;  1EGX A;  3PP2 A;  2N23 A;  3AJ4 A;  1KZ7 A;  2R0D A;  4ZRK A;  2W2X C;  4L6E A;  2XQN M;  2M14 A;  3SYX A;  1LB1 A;  3PVW A;  4MY6 A;  5C79 A;  1B55 A;  4GZU A;  4HAT B;  1P3R A;  2EC1 A;  3PSC A;  3GYP A;  4HAY B;  1WGQ A;  4Z2N A; 
#chains in the Genus database with same CATH topology
 4HDO A;  2YSZ A;  4ZRJ A;  2GS0 A;  2RGN B;  2J0J A;  2COC A;  2KGX B;  2BCJ A;  4OSN A;  4KHA A;  1SHC A;  2J0M A;  3PG7 A;  5FI1 A;  4HB3 B;  2G35 A;  2K00 A;  1UNQ A;  2PZ1 A;  4GPT B;  2DA0 A;  4F7G A;  5D27 A;  2I1K A;  2DHJ A;  2DFK A;  5LOP B;  1DDW A;  1M7E A;  2IFS A;  2COA A;  2MKR A;  3NSU A;  5D3X A;  1UPR A;  2H7E A;  1MIZ B;  3SV1 A;  1ZSQ A;  2X18 A;  3SNH A;  5DH9 B;  4GXB A;  2Y8F A;  3BIN A;  3ZDT A;  1NI2 A;  2J59 M;  2H7D A;  2RNR B;  1RJ2 A;  3F5R A;  2AL6 A;  1AQC A;  4HB0 B;  4GN1 A;  4HB2 B;  4Y94 A;  3UZT A;  2D2Q A;  2LOX A;  3HSA A;  1NU2 A;  1GC6 A;  4NSW A;  5D3Y A;  1H10 A;  4GNK B;  2I5C A;  1XR0 B;  4WVF B;  1UEF A;  2FJL A;  1V5P A;  1X86 A;  2KCJ A;  2YT0 A;  3P7Z A;  2RUK B;  5JP4 A;  1DDM A;  2HE7 A;  1DRO A;  5HE3 A;  4A6H A;  3X23 A;  1XOD A;  1ISN A;  1TJ6 A;  1PFJ A;  2OTX A;  2OQB A;  4WJ7 A;  4DX8 A;  5CLQ B;  1FHX A;  4MT7 A;  2YVC A;  1K5D B;  1MKE A;  2COD A;  4GOU A;  1Z87 A;  1V89 A;  2D9Z A;  3ULB A;  2QKL A;  2D9Y A;  3A98 B;  1M7R A;  1FOE A;  1U5D A;  4CHJ A;  3A8P A;  2D9X A;  1FHW A;  1MK9 B;  4BBK A;  1PLS A;  1KZG A;  1WJ1 A;  1FB8 A;  1U27 A;  5I2S A;  3O96 A;  2AEH A;  2KUQ A;  2RVB B;  1X1F A;  3NWF A;  3U12 A;  2KIE A;  3G9W A;  3MPX A;  2Y8G A;  3M1I B;  1Y5O A;  4GMV A;  3FVC A;  4H8S A;  2DYN A;  2YF0 A;  2Z4D A;  2P0H A;  5D3W A;  3ZVR A;  2VKI A;  5HE1 A;  3NWD A;  1MK7 B;  2EJ8 A;  4DIX A;  1Y19 B;  2Y7B A;  2P0F A;  2VRW B;  4K2P A;  3P6A A;  4MK0 A;  3ODW A;  1U5F A;  1J0W A;  4F7U P;  4TKN A;  3HQC A;  1DBH A;  5CLL B;  3ODO A;  2YS1 A;  2HTH B;  2Z0Q A;  4HB4 B;  5JHH A;  1WJM A;  4F7H A;  4HSI A;  1MAI A;  2P0D A;  3PVL A;  3U7D A;  2UVM A;  1X05 A;  2YS5 A;  1FHO A;  4DBB A;  1GG3 A;  3LJU X;  2RRF A;  2COF A;  3D8F A;  1WI1 A;  3PZD A;  3WYF B;  3PEG A;  3NWA A;  2IYB A;  2GJY A;  2Z14 A;  1V5M A;  3KRW A;  4CYE A;  2QKM A;  3HW2 B;  1T77 A;  1RRP B;  2W2W A;  1H4R A;  4KVG B;  2NBV A;  2LOZ A;  2ZKM X;  5KCV A;  2I1J A;  1ZC3 B;  3FEH A;  2UZS A;  2MDX A;  1UPQ A;  3FSS A;  1UNP A;  4EJN A;  1K5G B;  3QBV B;  4A6K A;  1EF1 A;  5LG4 B;  4B6H A;  1QQG A;  1OMW A;  3CIK A;  4HAU B;  1W1D A;  5C5B A;  4YL8 A;  4HAX B;  2ELA A;  1V88 A;  2DTC A;  2YRY A;  3DXC A;  2DN6 A;  5DHA B;  1SGH A;  2K8E A;  5IRS A;  1X11 A;  5LON B;  2GCJ A;  3ML4 A;  4XWX A;  2D9V A;  4QXA B;  3A58 A;  1MPH A;  3KZ1 A;  2J0K A;  2CY4 A;  3F0W A;  3HIE A;  3A8Q A;  3V5W A;  2D11 A;  1J19 A;  2K2J A;  2LKO A;  1PMS A;  3TFM A;  2LUL A;  1NTV A;  5L81 A;  2VSZ A;  3MDB C;  3ODX A;  2Z13 A;  1LW3 A;  1E5W A;  3GYO A;  4L1R A;  1DDV A;  1P5T A;  2EMS A;  1WG7 A;  5J3Y A;  4DXA B;  4TYZ A;  3VIA A;  4PNK A;  1V5U A;  3SO6 A;  3VOQ A;  1N3H A;  3QWM A;  4D6W A;  2DKQ A;  2E2X A;  1U5G A;  2EMT A;  4QJ5 B;  3HK0 A;  2D9W A;  2L2I A;  5HE0 A;  1XD4 A;  1FAO A;  1P6S A;  1MIX A;  2M38 A;  2ZPY A;  4A6F B;  5KQ4 A;  2CRF A;  1ZC4 B;  5JLJ B;  2NZ8 B;  2W2X D;  4NY0 A;  4HAZ B;  2R2Y A;  1I7A A;  1W1H A;  2L1C A;  1TXD A;  2YS3 A;  2K2U A;  1U5E A;  5FI0 A;  1TQZ A;  1FGY A;  4YON A;  4D0N B;  1WGU A;  1EAZ A;  2ELB A;  2KR0 A;  4PQ0 A;  2Z0O A;  3TW1 A;  2CAY A;  2LYD A;  2V76 A;  3AU5 A;  4HAV B;  5EFX A;  2RLO A;  4A6F A;  3IVF A;  4K81 A;  5DHF B;  5M4Y B;  2DYQ A;  5JHG A;  5C5B B;  4IFS A;  3TCA A;  2DHK A;  3PVU A;  2R09 A;  4GMX B;  4QJ3 B;  2KUP A;  2JP2 A;  2NMB A;  4P7I A;  1OQN A;  2ROZ B;  2UZR A;  3DXE A;  3QIJ A;  5D3V A;  2I5F A;  4CSQ A;  5I2M A;  4DX9 0;  3KY9 A;  2N0Y A;  2DLW A;  2MWN B;  2RSG A;  3D8E A;  5C6R A;  4WSF A;  1OY2 A;  1QC6 A;  3T06 A;  2KIG A;  2Z59 A;  3KRX A;  4ZRI A;  5J3T A;  1BAK A;  3DXD A;  1FGZ A;  1ZYI A;  3ULC A;  5KQ1 A;  3NW8 A;  4Z2M B;  2ROV A;  1UNR A;  1BWN A;  1AWE A;  1U29 A;  2DHI A;  1XCG A;  2GCL A;  1BTN A;  5DIF B;  1I2H A;  2Q13 A;  2DKP A;  5HE2 A;  2ADZ A;  1W1G A;  4K17 A;  3B77 A;  4A5K A;  1ZM0 A;  4KHB B;  4KAX B;  1NTY A;  2Z0P A;  2D4Q A;  1XKE A;  4HAW B;  2P8V A;  4OT1 A;  4IOY X;  1DYN A;  2DX1 A;  1MI1 A;  2MFQ A;  1IRS A;  4EKU A;  4CHM A;  2YT1 A;  2GUM A;  1XX0 A;  4K2O A;  3N7C A;  3SUZ A;  3D8D A;  1X1G A;  3AU4 A;  2FJU B;  1BTK A;  4C0A A;  3OHM B;  2D10 A;  4HHV A;  2DX5 A;  4KHB A;  5DI9 B;  4EMO A;  4IAP A;  2CY5 A;  3BJI A;  1GC7 A;  5J3Q A;  4KHO A;  1EVH A;  2LG1 A;  3U8Z A;  3CXB B;  5C16 A;  1V61 A;  3FM8 C;  3WA0 A;  1U2B A;  3TO1 A;  4HDQ A;  5GOW B;  3OAN A;  3KSY A;  1Q67 A;  1WVH A;  3RCP A;  3TVV A;  1ZVR A;  2K49 A;  1KI1 B;  1EGX A;  3PP2 A;  2N23 A;  3AJ4 A;  1KZ7 A;  2R0D A;  4ZRK A;  2W2X C;  4L6E A;  2XQN M;  2M14 A;  2YT2 A;  3SYX A;  1LB1 A;  3PVW A;  4MY6 A;  5C79 A;  1B55 A;  4GZU A;  4HAT B;  1P3R A;  4QJ4 B;  2EC1 A;  3PSC A;  3GYP A;  4HAY B;  1WGQ A;  4Z2N A;  3DCX A; 
#chains in the Genus database with same CATH homology
 4HDO A;  2YSZ A;  4ZRJ A;  2GS0 A;  2RGN B;  2J0J A;  2COC A;  2KGX B;  2BCJ A;  4KHA A;  1SHC A;  2J0M A;  3PG7 A;  5FI1 A;  4HB3 B;  2G35 A;  2K00 A;  1UNQ A;  2PZ1 A;  4GPT B;  2DA0 A;  4F7G A;  5D27 A;  2I1K A;  2DHJ A;  2DFK A;  5LOP B;  1DDW A;  1M7E A;  2IFS A;  2COA A;  2MKR A;  3NSU A;  5D3X A;  1UPR A;  2H7E A;  1MIZ B;  3SV1 A;  1ZSQ A;  2X18 A;  3SNH A;  5DH9 B;  4GXB A;  2Y8F A;  3BIN A;  3ZDT A;  1NI2 A;  2J59 M;  2H7D A;  2RNR B;  1RJ2 A;  3F5R A;  2AL6 A;  1AQC A;  4HB0 B;  4GN1 A;  4HB2 B;  4Y94 A;  3UZT A;  2D2Q A;  2LOX A;  1NU2 A;  1GC6 A;  4NSW A;  5D3Y A;  1H10 A;  2I5C A;  1XR0 B;  4WVF B;  1UEF A;  2FJL A;  1V5P A;  1X86 A;  2KCJ A;  2YT0 A;  3P7Z A;  2RUK B;  5JP4 A;  1DDM A;  2HE7 A;  1DRO A;  5HE3 A;  4A6H A;  3X23 A;  1XOD A;  1ISN A;  1TJ6 A;  1PFJ A;  2OTX A;  2OQB A;  4WJ7 A;  4DX8 A;  5CLQ B;  1FHX A;  4MT7 A;  2YVC A;  1K5D B;  1MKE A;  2COD A;  1Z87 A;  1V89 A;  2D9Z A;  3ULB A;  2QKL A;  2D9Y A;  3A98 B;  1M7R A;  1FOE A;  1U5D A;  4CHJ A;  3A8P A;  2D9X A;  1FHW A;  1MK9 B;  4BBK A;  1PLS A;  1KZG A;  1WJ1 A;  1FB8 A;  1U27 A;  3O96 A;  2AEH A;  2RVB B;  1X1F A;  3G9W A;  3MPX A;  2Y8G A;  3M1I B;  1Y5O A;  4GMV A;  4H8S A;  2DYN A;  2YF0 A;  2P0H A;  5D3W A;  3ZVR A;  2VKI A;  5HE1 A;  1MK7 B;  2EJ8 A;  1Y19 B;  2Y7B A;  2P0F A;  2VRW B;  4K2P A;  3P6A A;  4MK0 A;  3ODW A;  1U5F A;  1J0W A;  4F7U P;  4TKN A;  3HQC A;  1DBH A;  5CLL B;  3ODO A;  2YS1 A;  2HTH B;  2Z0Q A;  4HB4 B;  5JHH A;  1WJM A;  4F7H A;  1MAI A;  2P0D A;  3PVL A;  3U7D A;  2UVM A;  1X05 A;  2YS5 A;  1FHO A;  4DBB A;  1GG3 A;  3LJU X;  2COF A;  3D8F A;  1WI1 A;  3PZD A;  3WYF B;  3PEG A;  2IYB A;  2GJY A;  1V5M A;  3KRW A;  4CYE A;  2QKM A;  3HW2 B;  1RRP B;  2W2W A;  1H4R A;  4KVG B;  2LOZ A;  5KCV A;  2I1J A;  1ZC3 B;  3FEH A;  2UZS A;  2MDX A;  1UPQ A;  3FSS A;  1UNP A;  4EJN A;  1K5G B;  3QBV B;  4A6K A;  1EF1 A;  4B6H A;  1QQG A;  1OMW A;  3CIK A;  4HAU B;  1W1D A;  5C5B A;  4YL8 A;  4HAX B;  2ELA A;  1V88 A;  2DTC A;  2YRY A;  3DXC A;  2DN6 A;  5DHA B;  1SGH A;  1X11 A;  5LON B;  2GCJ A;  3ML4 A;  4XWX A;  2D9V A;  1MPH A;  3KZ1 A;  2J0K A;  2CY4 A;  3F0W A;  3A8Q A;  3V5W A;  2D11 A;  1J19 A;  2K2J A;  2LKO A;  1PMS A;  3TFM A;  2LUL A;  1NTV A;  5L81 A;  2VSZ A;  3MDB C;  3ODX A;  1LW3 A;  1E5W A;  3GYO A;  1DDV A;  1P5T A;  2EMS A;  1WG7 A;  5J3Y A;  4DXA B;  4TYZ A;  3VIA A;  4PNK A;  1V5U A;  3SO6 A;  3VOQ A;  1N3H A;  3QWM A;  2DKQ A;  2E2X A;  1U5G A;  2EMT A;  3HK0 A;  2D9W A;  2L2I A;  5HE0 A;  1XD4 A;  1FAO A;  1P6S A;  1MIX A;  2M38 A;  2ZPY A;  4A6F B;  5KQ4 A;  2CRF A;  1ZC4 B;  5JLJ B;  2NZ8 B;  2W2X D;  4NY0 A;  4HAZ B;  1I7A A;  1W1H A;  2L1C A;  1TXD A;  2YS3 A;  2K2U A;  1U5E A;  5FI0 A;  1TQZ A;  1FGY A;  4YON A;  4D0N B;  1WGU A;  1EAZ A;  2ELB A;  4PQ0 A;  2Z0O A;  3TW1 A;  2CAY A;  2LYD A;  2V76 A;  3AU5 A;  4HAV B;  5EFX A;  2RLO A;  4A6F A;  3IVF A;  4K81 A;  5DHF B;  2DYQ A;  5JHG A;  5C5B B;  4IFS A;  3TCA A;  2DHK A;  3PVU A;  2R09 A;  4GMX B;  2KUP A;  2JP2 A;  2NMB A;  4P7I A;  1OQN A;  2ROZ B;  2UZR A;  3DXE A;  3QIJ A;  5D3V A;  2I5F A;  4DX9 0;  3KY9 A;  2N0Y A;  2DLW A;  2MWN B;  2RSG A;  3D8E A;  5C6R A;  4WSF A;  1OY2 A;  1QC6 A;  3T06 A;  3KRX A;  4ZRI A;  5J3T A;  1BAK A;  3DXD A;  1FGZ A;  3ULC A;  5KQ1 A;  4Z2M B;  2ROV A;  1UNR A;  1BWN A;  1AWE A;  1U29 A;  2DHI A;  1XCG A;  2GCL A;  1BTN A;  5DIF B;  1I2H A;  2Q13 A;  2DKP A;  5HE2 A;  2ADZ A;  1W1G A;  4K17 A;  4A5K A;  1ZM0 A;  4KHB B;  4KAX B;  1NTY A;  2Z0P A;  2D4Q A;  1XKE A;  4HAW B;  2P8V A;  4IOY X;  1DYN A;  2DX1 A;  2MFQ A;  1IRS A;  4EKU A;  4CHM A;  2YT1 A;  1XX0 A;  4K2O A;  3N7C A;  3SUZ A;  3D8D A;  1X1G A;  3AU4 A;  1BTK A;  4C0A A;  2D10 A;  4HHV A;  2DX5 A;  5DI9 B;  4EMO A;  4IAP A;  2CY5 A;  3BJI A;  1GC7 A;  5J3Q A;  4KHO A;  1EVH A;  2LG1 A;  3U8Z A;  3CXB B;  5C16 A;  1V61 A;  3FM8 C;  3WA0 A;  1U2B A;  3TO1 A;  4HDQ A;  5GOW B;  3OAN A;  3KSY A;  1Q67 A;  1WVH A;  3RCP A;  3TVV A;  1ZVR A;  1KI1 B;  1EGX A;  3PP2 A;  2N23 A;  3AJ4 A;  1KZ7 A;  2R0D A;  4ZRK A;  2W2X C;  4L6E A;  2XQN M;  2M14 A;  3SYX A;  1LB1 A;  3PVW A;  4MY6 A;  5C79 A;  1B55 A;  4GZU A;  4HAT B;  1P3R A;  2EC1 A;  3PSC A;  3GYP A;  4HAY B;  1WGQ A;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...