1WGYA

Ra domain of guanine nucleotide exchange factor for rap1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
GSSGSSGEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAEEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RA domain of guanine nucleotide exchange factor for Rap1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rap guanine nucleotide exchange factor 5
total genus 8
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgyA01
2K8BA 3PRMB 2NBVB 3KUDB 1WGHA 4PS7A 2MWSB 3A9KA 3CSTA 1SGHA 1V6EA 2LD9A 1WGYA 4ZYNA 2WDTB 4KSKC 2D07B 2C7MB 4FHJA 2V3SA 1S3SG 2GBNA 2G3QB 3NZUA 3DDCB 4AWJA 2KANA 4JIOU 2FCMA 2N7EA 2KHWB 2FCNA 3L08A 3QWZB 4OVUA 3VTVA 3IVFA 3ZLZA 2K6QA 2KFKA 4BKGA 2KKCA 3PT2B 2OOBB 2KMAA 2LVOA 3N30A 4WJOA 4A20A 1OEYJ 5LXIB 2C9WB 4MGIE 1YX5B 1WMHA 5JZEB 2W9NA 3VVWB 4GN1A 4DWFA 2KN5A 4EEWA 3PREA 4EOYA 2JRIB 4W9HA 4HJKA 5KHOA 4K1RB 1GNUA 3PPAA 2V1YA 4KZCA 1WRDB 3TL5A 2KJHB 3MTNB 2JZ3B 4LDTD 1ZW7A 4FHKA 4WWNA 2K8CA 2LI5A 4HDOA 1KJTA 4E71A 4EUTA 3SU8X 2BWFA 4EFOA 4P7IA 1E8WA 2KQSA 3HIZA 4KVGB 2CHZA 2KWCA 1WJ6A 3KUZA 2KVRA 2MCNB 3B1LX 1RAXA 4II2B 4URKA 3H1UA 3O65B 1WFYA 3NS8A 4B9KA 1JRUA 3HM3A 1V9JA 3IBEA 4IC7B 4IW0A 3WAMA 5J17A 5L95C 1WX7A 3WANA 3APDA 3BY4B 2FCSA 1IPGA 3UINB 1OEYA 1WH3A 4NQKE 4GDLB 4MSQB 1KLVA 3APFA 4M8MA 2QHOA 4AUQC 4DHJD 1M94A 3A33B 3A1QA 2KLGA 2A5UA 2MA9B 3RULA 2DZJA 2KDBA 1NI2A 3H9DA 4IG7B 3OLMD 2CHWA 4NAWB 5AZGA 4NAWA 4KIKB 4BKSD 2ZEQA 4GDKA 2CU1A 2PEAA 2DYBA 2WX0A 4IM2A 2FUHB 3V6EB 4MEMA 4BBNC 2YLMA 2GBJA 3RCZA 3VDZA 1Q5WB 2XK5B 4BOSC 2LVQA 3ZTDA 3ZKJC 4CYEA 4HDQA 5AZHA 3LDZE 4CO7A 4WWPA 2L0TA 2IY1B 4ZRJA 5E6PA 2GOWA 1WJNA 2AL3A 4WQOB 2L0FA 4HK2A 3AXCA 2KX0A 4F1SA 3PLUA 4II3B 4NJ7A 3RZFA 1GC7A 5C23A 3ENEA 1WI0A 4LCDE 2IO1B 2KX3A 3GZNI 4K7SA 4MDKE 3TIXA 4ZDVA 2AYOB 1WGGA 4FJVB 1ZKHA 1GUAB 3R3MA 2G4DB 3JYUA 1H8CA 1EUVB 3DBHI 4GGQA 4TQ0A 3TMPB 4RM8A 1BT0A 1EF5A 3L54A 3ZIMA 1YIWA 5LLIA 5GMVA 2FIDA 1AARA 4IWOA 4G0NB 4NJ6A 1G6JA 5D2MB 2BPSA 2MBQA 4W9IA 1KOTA 2D10A 2GBKA 2K25A 2ZVOA 3ZDMC 2CHXA 1UD7A 5DPSA 3V61A 4DXAB 1WJUA 5D94A 2C5LC 2BGFA 4MM3A 2ZNVB 4I6PA 3JVZX 5J2RA 4E3CA 3IHPC 2KMCA 1YJ1A 1ISNA 2MBOA 2WYQA 2WX1A 2NR2A 4TV3A 3JSVA 4W9DA 3L13A 3X0WA 4DBGA 2MSED 1WR6E 2O2VB 2RD0A 3KVFB 3RYTA 1WXAA 4IM0A 2MBEA 3AULA 4FLHA 2J0MA 2MP2A 3L17A 1VCBA 2O6VB 3UQAA 3AU4A 3DCGA 2NVUI 3VTWA 3QHTA 1P9DU 4FA6A 3ZDTA 1WF9A 5TR5A 4WWOA 2LXCA 1LFDA 4IM3A 2D3GA 2J0JA 2LVPA 3ZNGC 1HE8A 2Y5BB 4ANXA 4WJQA 3ML8A 2UWQA 2LRWA 1J0GA 4CHKA 1R4NI 3VH3B 1P0RA 4DDGD 1RLFA 2NS5A 3SHQA 4F8CB 3NZSA 1WYWB 3NHEB 5G55A 2ASQA 4TKNA 3SDLC 2IYDB 2DYMA 2HD5B 3ALBA 3IG3A 5JH5C 3B08A 4LJPB 4FJZA 4BKTA 4ZRKA 3PGEA 4MGZE 1E90A 2K1FA 1WZ3A 4PS8A 3AU5A 3CSFA 3H6NA 3VUWA 3ZNID 2C7HA 3DPDA 3D32A 2BKRB 4W9EA 4A3PA 3TCAA 2CKHB 2ZVNA 3M95A 2HTHA 3DVGY 4ICUA 2MQJA 1P3QU 4W9GA 4TQ1A 2BKFA 1V49A 2FNJB 4W9CA 3ZNHB 3ZNZB 1C1YB 4M0WB 2NBWB 2K8HA 3DVNV 2HJ8A 3L10B 4KIKA 5C1ZA 1Q0WB 2N7DA 3EFUA 5DCNA 3KYCD 2J0KA 2ZZPB 4HPMB 4DHZE 2UYZB 2KC2A 1E7UA 2C60A 2JUOA 2MBBB 3KH0A 5CHWA 1Z2MA 2FAZA 3HM6X 1UBQA 3DVGX 3N32A 2CS4A 2LZ6A 2L7RA 4MGYE 2C7NB 1EF1A 3L16A 3TBLD 1WX8A 3APCA 1WR1A 4M8NA 2WWZA 4MH0E 2ZPNA 3LJ3A 5CHFA 5E6NA 2GBMA 3CF6E 1V5OA 2L00B 3DOWA 2RGFA 4DHJB 2OJRA 2FIFA 2L76A 2L3ZA 1IYFA 2BYFA 2NPTB 1SE9A 3KW5B 1WM3A 1FXTB 3M3JA 3ZRCA 2BYVE 1WZ0A 3PSEB 3PVLA 1E8XA 4HPLB 2KNBA 1WM2A 1TTNA 1Y8RC 2V4LA 4IWQA 4BFRA 4DHZB 1LQBA 2MLBA 3QCAA 5HKHA 3ZO5B 4IUMB 4ASWC 2ZJDA 3NY5A 1J19A 1XT9B 2XBBC 1R4MI 2KDFB 3K9OB 2MBHA 5J18A 2D2QA 3U30A 1WIAA 2LUEA 2XEWA 3EHVA 3V62A 4NY0A 2DAFA 3WIMA 2DHZA 3C0RB 3H7SA 2VRRB 3UQBA 3BINA 4RM9A 4GSWA 3UGBB 1IP9A 2LASA 2KTFA 2KTRB 3H7PB 1OTRB 5FR6A 1MG8A 3TJPA 3SD5A 4XZ4A 2DX5B 2AWTA 3T9LA 2LGXA 4W9JA 4JGHB 2J7QB 1J8CA 1EO6A 3IFWB 4FJYA 1RFAA 2IO2B 2LWPA 4MSMB 4RMAA 2Z0EB 2LGDA 2JPHA 1OGWA 2KFKB 4PS3A 3W1SC 1UZXB 2I1JA 2DZIA 3PS6A 4NPNA 2ZCCA 3P2BA 1OQYA 5IA7A 3ZW3A 1UBIA 1ZGUB 2IBIB 3ZRFA 4GDLA 2MW5A 3OAWA 3U7DA 4BVUC 4BBNF 2M8SA 3UIOB 2LJ5A 4HCNB 3ZTCA 1SIFA 1TZ1A 1Q1OA 3MHSD 4ANUA 2EMSA 2N1VA 3ML9A 2R2QA 1WXVA 1E5WA 3Q3JA 4WJPA 4XX5A 3L0WB 2PPHA 1S1QB 4KSLC 3KYDD 2YVCA 2KOXA 3QA8A 4ANWA 5LXHA 2BWES 5CHVC 1GG3A 1KM7A 3RZWC 4HWIB 5E6OA 3PLVA 2ZNVC 1YD8U 4MGKE 4AJWA 2LGYA 3WAOA 4E74A 3W1SA 4DDID 5D7GA 1RRBA 1WY8A 3QK0A 5L83A 3JW0X 3DVNU 3R66C 2DAJA 4K7UA 2N9EB 3RUIB 2PE9A 3V6CB 2O2VA 4XC2A 5CTRC 2KWUB 3HK0A 3DBLI 2ZCBA 4HLEA 1TGZB 2MX2A 2O6VA 3QIJA 3PV1A 2JT4B 3EECA 4YL8A 2REXA 1QZEA 2KDIA 3VUXA 1V81A 2FCQA 2KZRA 5DPRA 4EKUA 3Q3FA 4ICVA 4WJNA 5D6JB 3X23A 4FADA 2PE6B 1WE7A 1P98A 3HHMA 1CMXB 1H4RA 4AOFA 1V80A 1YQBA 2N1WA 2KJRA 3S2AA 1L7YA 2M4NA 2RR9A 3GOEA 5EDSA 2EMTA 4I6NB 4AJYB 5AEKB 2GBRA 1GJZA 3WALA 1WE6A 4I6LB 3PHWB 3PRZA 2LXAA 2NBUA 1WGDA 2RSUA 3WAPA 1WX9A 4DK5A 2G4SA 1E8YA 3ECIA 4OVVA 1Z5SB 1WXMA 4LDTB 1I42A 2Z0DB 4JLCA 3VH4B 2BYEA 2IO0B 3QARA 5JHAA 4ANVA 1TBEA 1L2NA 2IY0B 2IZVB 2JXXA 4NQLB 5CX3A 2DYOA 3UF8A 4EZLA 4NNJB 2N4FA 1WGRA 3PHXB 5JHBA 1UH6A 2JWZA 1E8ZA 4HCPB 4N9F4 4PYZA 4EZJA 4KDLB 2AL6A 5DPTA 2MRPA 3ZUNA 2M0XA 4GB9A 3UIPB 4JL9A 4FBJB 3V60A 3PZDA 3U8ZA 3VTUA 4K81A 3R7QA 1PQSA 4FULA 2O6VD 3A1QB 4GOCA 4IWPA 3DBRI 5G2NA 2IO3B 2R2OA 1V2YA 2BF8B 2KC1A 4A3OA 2N9XA 4TUUA 3OJ4B 1C3TA 3N3KB 1K8RB 4GMVA 2JF5A 2B3AA 3R7RA 5IAAC 3WA0A 3H7PA 1GC6A 2KLCA 2JY6A 1F9JA 3VHTC 2KK8A 2KXJA 3JSVB 3ZVVA 2KJ6A 4HXDA 4BOZB 3CMMB 1D3ZA 2D11A 3A9JB 1UELA 2LRUA 1P1AA 1T0YA 2DZKA 4G11A 3VUYA 3QJZA 2CR5A 1WJ4A 2KO3A 3DQVA 2M17A 3A4RA 4JQWC 1WMHB 3QAQA 4K7WA 4W9LA 3NOBA 2KD0A 3B0AA 2PJHA 3MJWA 3W1YA 4KZ0A 3EC8A 1VD2A 4W9FA 2I1KA 3AI5A 3QX1A 2KWVB 1XQQA 2KFJA 2G45B 2L05A 3M63B 3KUCB 3I3TB 3PTFC 3VFKA 2K39A 3RD2A 3QC8B 4J6IA 3T8MA 1V5TA 4EZKA 2JZZA 3OJ3A 4PYUA 2A4ZA 3A9KB 5KHQA 1UGMA 2GMIC 4GIVA 1LM8B 1XD3B 2M1MA 3ONSA 3VAWA 2NCNA 3VQIA 4G50A 2DENB 4GDKB 2KTRA 3PRPB 4HVBA 4GU2A 2NPTA 5DPWA 4X57B 4AP4C 1U4AA 4KDIC 3M62B 3DBSA 4WAAA 2RPQA 4KV2A 4BKSA 1A5RA 5AZFA 2JRHA 3K9PB 2Z59B 3VXWA 4FN2A 2EKEC 2KQ7A 1YX6B 4W9KA 1LXDA 2N9PC 2L8JA 4GXBA 4B95A 1WXSA 2MP2B 2AEHA 2K6DB 3RT3B 2ZPYA 3A4SC 4G3XB 4MJSA 1NBFC 4LJOB 4B6WA 1X1MA 4MJSB 3A9JA 5BO4B 4MELA 3QQ8B 1E7VA 1V86A 1NDDA 4ZRIA 1I35A 4F7ZA 2KDEB 2DZMA 2HE7A 2JVCA 2XK5A
chains in the Genus database with same CATH superfamily
2NBVB 4MM3B 2MWSB 3CSTA 1SGHA 1V6EA 1WGYA 5IKCM 5TSSA 2WDTB 3B2FA 4FXCA 2C7MB 3I63C 2GBNA 3HVZA 1V1OA 2K6QA 2KFKA 3ZLZA 3RNGC 2KMAA 4OHJA 3N30A 1SJED 1YX5B 5JZEB 4MH8A 1R4MB 4EEWA 2ZW0A 2JRIB 3FILB 2AQ2B 3VRAB 1ZW7A 4FHKA 4LNIA 2LI5A 4E71A 4JWSC 2KQSA 4GLSC 2HDEA 4KVGB 4M00A 4WIPA 3B1LX 2N9KA 4B9KA 1FIQA 3IAM1 5L95C 2VZKB 4ARIA 3P63A 4R3DA 2INNE 1WH3A 4MSQB 3ZJTA 1KLVA 4M8MA 2QHOA 2A5UA 2BQQA 1KRHA 3RULA 3OLMD 2L1AA 1RYJA 5AZGA 4BKSD 4C80A 4GDKA 3DWMA 5IOIA 4MEMA 2GBJA 4BOSC 3ZKJC 5AZHA 3LDZE 1PFDA 2L0TA 3FKYA 3Q69A 1WJNA 2GOWA 2L0FA 4HK2A 3AXCA 2KX0A 1GC7A 1JWAD 2KX3A 4MDKE 2HTME 4B0MA 4OZCA 2AYOB 3BK2A 2JWUA 1WGGA 1ZKHA 1GUAB 3R3MA 1EUVB 3DBHI 4GGQA 4TQ0A 4RM8A 1N6ZA 5LLIA 5GMVA 1AARA 1YQ4B 4G0NB 2IGGA 3ZXVA 4W9IA 1KOTA 2D10A 3AE5B 1N5XA 1K50A 5FK9C 1F1HA 3BIID 4XGAB 4DXAB 1HTOA 5D94A 1TZOA 3IHPC 2KMCA 1CQVA 2WX1A 4TV3A 3JSVA 2MSED 3NVYA 3KVFB 3RYTA 4IM0A 4FLHA 3HUIA 1D5ZC 3L17A 3AU4A 2NVUI 3AE6B 3RMKC 2IPKD 3ZNGC 1QF6A 4CHKA 1R4NI 3AE2B 2WDQB 4F8CB 1WYWB 2IGDA 5JH5C 3B08A 4FJZA 4ZRKA 1PGAA 3Q8CA 4BZAA 4PS8A 3AU5A 2KYWA 3CSFA 3H6NA 4PT5A 4A3PA 2CKHB 1MFWA 3R8BA 1E10A 1P3QU 2BKFA 3ZNZB 2K5PA 1WGKA 2K8HA 3NVZA 4KIKA 1Q0WB 3EFUA 3Q3MC 2J0KA 2UYZB 1PUTA 1UF0A 3IT6B 1Z2MA 2FAZA 2L7RA 1TS3A 3L16A 1WX8A 4MH0E 2Y3AA 5BMGA 1C4CA 2L76A 2GB1A 4ZHPA 3KW5B 4K3CA 3PSEB 4YSZB 4BFRA 1WM2A 1TTNA 1LQBA 3QCAA 1C4AA 3N1ZC 1J19A 1XT9B 4ARCA 2MBHA 3U30A 1WIAA 4NY0A 3WIMA 3TEYA 3UGBB 1IP9A 2LASA 1OTRB 3TJPA 3SD5A 4YSXB 4JGHB 2VH2A 4RMAA 4PS3A 1OGWA 2KFKB 3W1SC 4RFBA 4JX1C 2I1JA 4HKZE 3P2BA 2IBIB 1KLUD 4GDLA 2MW5A 3OAWA 3U7DA 2L83A 3PO0A 2M8SA 5D3IB 1MI0A 3Q3JA 2PPHA 4N58A 2BWES 5CHVC 2J4XA 2FUG1 1YD8U 3LXFA 3WAOA 1QQRA 2INDC 4WQMA 2D3AA 1XXGA 1ZDVA 2K0PA 4E74A 1RRBA 3DVNU 2DAJA 2N9EB 5CTRC 4YT0B 1F77A 3HK0A 3P4PB 3DBLI 4HLEA 2O6VA 3QIJA 3I9V1 2WXNA 2D3CA 3IXSA 3Q3FA 4ITKA 4NAMA 2PE6B 3URYA 3AE4B 1YQBA 1TS5A 2N1WA 1L7YA 1ZOYB 2BT6A 4AJYB 4I6NB 2WXHA 4LK0M 2QC8A 5AEKB 1SB3C 3B2GA 3U2SC 2LXAA 1WGDA 2RSUA 2QDFA 1WX9A 1XLNA 4DK5A 1Z5SB 4LDTB 1PDXA 4A8XC 3VH4B 2KACA 3QARA 4ANVA 4XWWA 2JXXA 5CX3A 1L5PA 2WU2B 4YTPB 1UH6A 4XWTA 3W5VB 5DPTA 2MRPA 1IBXA 4GB9A 3UIPB 4JL9A 4FBJB 4RGMA 3VTUA 2MJ3A 4FULA 4IWPA 3A1QB 2BF8B 4AS1A 4XDDA 2PLPA 4GMVA 2JF5A 3R7RA 1T0QC 2M0AA 2KLCA 1F9JA 3JSVB 3PZ7A 5EE0A 4HXDA 1XLOA 4BOZB 3LB8C 3CMMB 3A9JB 2WS3B 1T0YA 3QJZA 2CR5A 3DQVA 3W1YA 3EC8A 1VD2A 4W9FA 2KWVB 2NMQA 4P1CC 1N60A 3V05A 3PTFC 3VFKA 3RD2A 4C7ZA 4DXFA 3HRDD 3OJ3A 2A4ZA 3A9KB 3VR9B 4GIVA 2M1MA 2DENB 4GDKB 1B9RA 2KTRA 2W82A 4X57B 2BYTA 3DBSA 2RPQA 2Z59B 3VXWA 4FN2A 1YX6B 4XE0A 1E9MA 1LXDA 5T8IA 4KKJA 2K6DB 3RI7C 3A4SC 1NBFC 1NYQA 1FRRA 3A9JA 1E7VA 1NDDA 1I35A 4F7ZA 4RF0A 1CK1A 2JVCA 2XK5A 4AUQC 1DOYA 4DQOC 1WGHA 3RNBC 1TY2A 1NVID 2KANA 3VUXA 1C79A 2N7EA 4OVUA 2FCNA 3VTVA 1XLQA 1YJIA 4B0EA 4C7YA 3IVFA 1B1ZA 4BKGA 4YXDB 1HQRD 1SSNA 2LVOA 1OEYJ 2C9WB 1WMHA 1ZPSA 4M02A 2WXGA 3VVWB 4GN1A 3PREA 1L6VA 3R2IA 5KHOA 1LO5D 2V1YA 4RGTA 5MPOA 1EM7A 2LGIA 4LDTD 2K8CA 4P16A 4HDOA 3SU8X 1PYWD 4P7IA 3HIZA 4EE2A 2CHZA 1N62A 2V4IB 3KUZA 1WJ6A 2ON8A 4II2B 3H1UA 1I7HA 3Q8EA 1V1PA 3EFCA 4NZLB 1V9JA 4IW0A 4ACFA 1WX7A 1C78A 3N9YC 3BK1A 5HI1A 1IPGA 4WURA 1HTQA 3BZDB 2KN4A 1M94A 2KLGA 2MA9B 1QT9A 3Q8AA 4IG7B 4RF1A 4KIKB 2PEAA 2WX0A 3V6EB 4BBNC 3VDZA 1Q5WB 2LVQA 3ZTDA 1HXYD 2OEDA 4CO7A 5E6PA 2AL3A 3MHZA 1V97A 4QAYA 3PLUA 3Q8FA 4II3B 3RZFA 3V3XA 3ENEA 4LCDE 3TIXA 2IO1B 3GZNI 3AEGB 2WDRB 4HEA1 3Q6BA 2WXMA 3SEBA 1H8CA 1EF5A 3TEWA 3ZIMA 3OG5A 1V1PB 4IWOA 1G6JA 5HFYA 2MJEA 2MHJA 1UD7A 1BUIC 5DPSA 3V61A 1F52A 3P42A 2AX5A 4MM3A 5J2RA 2Q5WD 1EWCA 2Y5CA 1YJ1A 4W9DA 2PKOA 5C3JB 3L13A 2O2VB 3N1YC 1TY0A 2J0MA 1VJKA 4JWUC 1VCBA 3UQAA 3MC0B 2DWQA 5TR5A 1R4NB 1TIFA 3KQ4A 2D3GA 4IM3A 2YEPF 2J0JA 1HE8A 2LGSA 2Y5BB 4ANXA 1J0GA 1P0RA 4DDGD 2L52A 4DXGA 4TKNA 3IG3A 2HD5B 4BKTA 1FXAA 2K1FA 3RPFC 5EE3A 3VUWA 2C7HA 2BKRB 4IKGA 3DVGY 1I4HA 4TQ1A 2JQRB 3ZNHB 1FNVA 1E6EB 1FCCC 1UWMA 2TSSA 2HJ8A 3L10B 5DCNA 2LMCA 2KC2A 2JUOA 2G1EA 2J42A 3HM6X 3N32A 2K3UA 3N20C 2KT7A 1YQ3B 2L32A 4CQNA 3APCA 5CHFA 5I4DA 3DOWA 4ZOHC 1HA5A 1IYFA 1P7FA 2BYFA 1L4DB 1JW9D 3M3JA 1E7PB 1FXTB 1P7EA 2BYVE 3R2TA 1L0XB 1E8XA 1GB1A 2KNBA 3P4QB 1Y8RC 2V4LA 4IWQA 2KQ4X 2MLBA 5HKHA 3TEXA 3ZO5B 2ZJDA 3L4PA 2KDFB 1XF5L 5J18A 2D2QA 3EHVA 3P4SB 3V62A 2DAFA 3EGRA 4RM9A 4GSWA 1ACCA 5GXGB 3AEDB 4S0RA 2KTRB 1ZE3D 2DBYA 4XZ4A 2JYEA 1VDVA 2LGXA 4W9JA 2WXLA 2IO2B 4C4VA 4MSMB 2LGDA 3NVVA 4LTUA 5IA7A 4NPNA 1WWTA 4RGOS 3ZW3A 1ZGUB 1FPYA 1ET9A 1KH0A 3ZTCA 1TZ1A 3BYTB 3MHSD 2N1VA 2VZKD 3ML9A 1E5WA 2WXRA 4WJPA 2PVOD 4KSLC 3KYDD 1XCQL 1GG3A 4AJWA 5G5GA 2SAKA 4DDID 5D7GA 1WY8A 3QK0A 1J7BA 5L83A 3JW0X 4K7UA 1DYQA 2PE9A 1D5MC 1PGBA 4N59A 5AUIA 1N63A 1Y56A 2IJ0A 2ZCBA 1TGZB 2MX2A 1T3QA 3AECB 3AEAB 2KZRA 2FCQA 3W5UB 5D6JB 1DGJA 1WE7A 1H4RA 1MPEA 5BMHA 1V80A 1UWXA 1SE3A 4YTMB 2RR9A 4O1NA 2GBRA 4LNFA 3PHWB 2NBUA 4A9AA 2X38A 2OJWA 4OVVA 3Q14C 3GE3C 2Z0DB 2BYEA 1VLBA 2IO0B 4NQLB 1VZ7A 3UF8A 4NNJB 1WGRA 1E8ZA 2RDBC 2V9HA 4KDLB 3ZGZA 2RMMA 3DHIC 3R7QA 3P4RB 3DBRI 2R2OA 5H92C 2WXPA 1JROA 4TUUA 4A3OA 1K8RB 1FD6A 2B3AA 2E3TA 5IAAC 1N61A 3FAHA 2JY6A 2LHEA 1TS2A 2KK8A 3ZVVA 3E56A 4A90A 2D11A 2G9HD 1WRIA 4C4VB 1UELA 2LRUA 3I57A 3VUYA 2DZKA 1NEKB 4JQWC 2J53A 4RGNA 1L0YB 2CU3A 3MJWA 4KZ0A 4KGRA 3AI5A 2MJDA 1QILA 1R7SA 4Q2JA 2K39A 3QC8B 2WXFA 4EZKA 2GMIC 1JALA 2FBWB 1LM8B 2NCNA 4JPSA 3PRPB 1MHHE 4HVBA 4GU2A 4L2YA 1IUEA 4KDIC 4BKSA 4RCOA 3EA6A 3K9PB 1SBBB 2EKEC 4ZHOA 2NTTA 2N9PC 2L8JA 4B95A 1WXSA 2AEHA 1YNTE 4G3XB 1YJJA 4B6WA 1KTKA 5BO4B 4ZRIA 1NENB 4REZA 3PRMB 3KUDB 4PS7A 4ZYNA 4FHJA 2V3SA 2H89B 3I5JC 4AWJA 2DLBA 2FCMA 2KHWB 3AEEB 1XO3A 3PT2B 2OOBB 2H88B 5H8YE 4WJOA 4OVZA 5LXIB 4MGIE 2W9NA 1ESFA 4DWFA 4EOYA 1E0ZA 4W9HA 1GNUA 2ONQA 1WRDB 1FCLA 1FRDA 2KJHB 3MTNB 2JZ3B 4EUTA 3KLSX 4PK1A 1E8WA 3DHGC 3DBLB 5JXVA 2KWCA 3RNAC 2KVRA 1KFYB 1QOBA 2RPVA 3HM3A 3IBEA 4IC7B 3WAMA 1JWUD 3WANA 2FCSA 1QKZA 3KWLA 4M01A 3CIRB 1OEYA 4NQKE 2I2YA 1Q10A 4DHJD 3A33B 1TT5B 2DZJA 2KDBA 1UUPA 3H9DA 1KF6B 4LNOA 4NAWB 4NAWA 2GLSA 2DYBA 2B76B 3ZQ4A 2FUHB 2YEPB 1M4VA 4HDQA 4CYEA 1L6UA 2D5GA 2IY1B 4WQOB 4NJ7A 5C23A 1WI0A 2KAJA 1C4PA 1CZPA 1QOFA 2QJLA 2BB5A 2ACZB 1YIWA 2FIDA 3ABVB 1WXQA 4NJ6A 4RH6A 5D2MB 4HKQA 2BPSA 3P1MA 2GBKA 1T0RC 1XLPA 2CHXA 2QEJC 3NZ3A 1L0VB 3AE9B 2C5LC 2BGFA 4RNAA 5EE9A 4I6PA 4E3CA 1I4PA 2MBOA 2WLBA 4DBGA 3AV8A 4XYCA 2RD0A 3VR8B 1YMHE 1WXAA 2MBEA 2MP2A 2O6VB 3VTWA 1P9DU 4FA6A 3ZDTA 1WF9A 2WGSA 2LHDA 2LXCA 1LFDA 4MACA 2LVPA 1GPXA 3ML8A 2UWQA 2LRWA 3WCQA 2WQYB 1A70A 1RLFA 2NS5A 4D2KA 3SHQA 2V0GA 3NZSA 5G55A 3NHEB 2ASQA 2Y5PA 2DYMA 3ALBA 4LJPB 1QOAA 3PGEA 1E90A 3AEBB 1LGRA 3ZNID 3DPDA 4W9EA 2W3SA 1SE4A 3M95A 4ICUA 3SFEB 1DOXA 2MQJA 1V49A 3BYYB 1TKEA 2NBWB 3DVNV 3GZNB 1VR9A 2N7DA 1J7CA 3KYCD 4P6VF 1E7UA 4JE3B 1C77A 1HEZE 2QILA 3DBRB 5G5HA 1UBQA 3DVGX 2CS4A 2LZ6A 4MGYE 2C7NB 4M8NA 2CJOA 3CF6E 1V5OA 3DHHC 2BS4B 1I4GA 1WSPA 4DHJB 1AW7A 2OJRA 2FIFA 2L3ZA 2NPTB 3MJ5A 1WM3A 2BTEA 3PVLA 5FR3A 1PGXA 4KKIA 4ASWC 3AE8B 3NY5A 2XBBC 3IAS1 1R4MI 3K9OB 2BVCA 2LUEA 2XEWA 4K3BA 3C0RB 1ZP0B 3H7SA 3UQBA 1F2RC 3BINA 1UNSA 2KVZA 4ZRPA 1MG8A 2IDYA 3AE3B 4L1BA 2AWTA 2RDHA 2J7QB 1J8CA 1JRPA 1EO6A 1F0ZA 2LWPA 4IDIA 1SJHD 5AUKA 1WYGA 2DZIA 1FFUA 3ZRFA 2BBCA 4KX6B 1VZ8A 3UIOB 2LJ5A 5HG2A 4HCNB 1SIFA 2XNAC 4ANUA 4WWMA 2EMSA 4J3OD 2R2QA 1WXVA 1K52A 4XX5A 1YN4A 1ZUD2 3QA8A 4ANWA 5LXHA 2WDVB 1TS4A 4XDCA 1KM7A 3PLVA 2R61A 2WU5B 4AQ7A 3T3OA 3RUIB 5IN7A 4WAFA 3V6CB 2JU6X 1STEA 1F2RI 3PV1A 3O13A 4HJGE 1JWBD 2REXA 1QZEA 4YSYB 1D5XC 2N7JA 4MT5A 1V81A 4EKUA 3J9CA 1XEEA 4WJNA 1T0SC 3HHMA 4AOFA 3C19A 2KJRA 4YWGG 3S2AA 3RNFC 1KLGD 2M4NA 5EDSA 2EMTA 1OQRA 3WALA 3SFDB 1WE6A 1IGCA 3WAPA 2NTSA 2G4SA 1WXMA 1I42A 1BMLC 2BW2A 4UDUC 1TBEA 1L2NA 2IY0B 2IZVB 1EWYC 2DYOA 2N4FA 2OHFA 5EE1A 5JHBA 2JWZA 4HCPB 1IGDA 4EZJA 2AL6A 1RFKA 2M0XA 4NJCA 1UGJA 2VH1A 3PZDA 3U8ZA 4M0WA 4K81A 1PQSA 5G2NA 1ZDXA 2IO3B 1V2YA 3SR6A 3OJ4B 5C2TB 3ETRA 1GC6A 1ROEA 3VHTC 1FFVA 2KXJA 2RDGA 2KJ6A 5FKAC 1D3ZA 1P1AA 5HHDG 4LNKA 5BYQA 2M17A 3A4RA 1WMHB 4W9LA 3B0AA 1T5XD 1FMAD 2I1KA 3ZYYX 2Z8LA 1C76A 2KFJA 1YN5A 4OZAA 2L05A 4J6IA 1VZ6A 2JXTA 3AMZA 1GOZA 5BMIA 1XD3B 3VAWA 3TUOA 3Q2AC 1HZ6A 5IO9A 3N1XC 5DPWA 4AP4C 4KGSA 2K22A 3E9SA 4KV2A 2JX5A 5AZFA 2JRHA 1YN3A 3LYYA 2QIEB 1CJEA 3AM9A 3EUB2 4KGTA 4OW0A 3UI3A 3RT3B 4MJSA 2ZW1A 1AWDA 4LJOB 4MJSB 2GRIA 4MELA 3AH7A 2DZMA 2WNMA 2HE7A 2K8BA 3GE8C 3A9KA 2LD9A 1TJEA 3RFZB 4KSKC 2D07B 2PIAA 1D6EC 1S3SG 4TSSA 2G3QB 3NZUA 3DDCB 3FILA 4JIOU 3BWUD 3L08A 3QWZB 2KKCA 4TMAB 2PW9A 4A20A 1I4QA 5LNK1 2KN5A 3PZ8A 4HJKA 1XCTL 2W54A 4K1RB 2N0SB 3PPAA 5E6JA 4KZCA 2W3RA 2INCC 3TL5A 4WWNA 2WXIA 1KJTA 2BWFA 3GS2A 5BYSA 1EU3A 4EFOA 4C00A 2J52A 2MCNB 3W9CB 4C56C 4ZRQA 1RAXA 4URKA 3O65B 3T3NA 1WFYA 3NS8A 1JRUA 1K53A 5J17A 3CWIA 2V3NA 3APDA 3BY4B 4A55A 3UINB 3U52E 4GDLB 1FM0D 3APFA 3A1QA 2SEBD 1NI2A 2CHWA 1SF0A 2PVGC 1QLBB 2KWDA 3GB1A 2ZEQA 1MVKA 2LFIA 2CU1A 1D4BA 2V3PA 4IM2A 3RNEC 2YLMA 3RCZA 2XK5B 4A6QA 4S17A 1FNUA 3FC4A 4WWPA 4ZRJA 2M56B 4F1SA 1OQQA 3W2DA 3H8HA 4K7SA 2D3BA 4ZDVA 4HPPA 4FJVB 2G4DB 2EKIA 3JYUA 3MFGA 3TMPB 1BT0A 3L54A 3B9JA 4IOIE 1FO4A 2QCZA 1OFFA 4N6EB 2MBQA 2K25A 1HZ5A 2ZVOA 3ZDMC 1SEBD 2WXOA 1WJUA 3TSSA 2MH7A 3GP7A 2E6XA 2MEKA 2X8XX 2ZNVB 3JVZX 3U4EG 2WYQA 1ISNA 1JMLA 2NR2A 3X0WA 2HJ1A 1SE2A 1WR6E 1AN8A 3AULA 4LNNA 2PTLA 3DCGA 3QHTA 1SIJA 2KDMA 4WWOA 3ZXRA 1NYRA 4WJQA 1JWSD 3VH3B 3BVZA 3SDLC 2IYDB 3OWEB 3BVGA 4MGZE 1WZ3A 1TYGB 3NVWA 3D32A 3TCAA 2JZPA 2ZVNA 2HTHA 1FEHA 4W9GA 3IT4B 1MG4A 2FNJB 4W9CA 1C1YB 4M0WB 5C1ZA 1C9FA 3AN1A 4HPMB 2ZZPB 4DHZE 2C60A 1YOVB 2MBBB 3KH0A 5CHWA 4P1BC 3TBLD 1EF1A 1WR1A 2WWZA 1I4XA 2ZPNA 3LJ3A 5E6NA 3TEZA 2GBMA 3Q8BA 2L00B 2RGFA 2QMTA 1FXIA 3Q3OC 2QSDA 3MC9A 1SE9A 4USAA 3ZRCA 1WZ0A 2W55A 4HPLB 4DHZB 3VRBB 4IUMB 1JQ4A 2INPE 3AEFB 2ICIA 2FE8A 3DBHB 3AB5A 2DHZA 3ZJUA 2VRRB 4H2AA 3C8YA 2EELA 1L4ZB 1T6BX 2KTFA 3H7PB 5FR6A 2AQ3B 2DX5B 3T9LA 4FJYA 3IFWB 1RFAA 1EU4A 2Z0EB 1I4RA 2JPHA 1UZXB 3PS6A 2ZCCA 1DOIA 1FNWA 1OQYA 1UBIA 1RWSA 3RNCC 4US8A 4OZBA 1GAQB 3U7ZA 2WHIA 4BVUC 3KWVA 4BBNF 3Q3NC 1Q1OA 2GI9A 2PMVA 1JCKB 3ZJVA 3L0WB 1S1QB 2I38A 2YVCA 3AE1B 2KOXA 2JSVX 3NS1A 4ZYSA 3RZWC 4HWIB 5E6OA 2ZNVC 4MGKE 2LGYA 3W1SA 3NUHB 2WXQA 3R66C 1QOGA 2O2VA 4XC2A 1SXTA 2KWUB 2XN9C 2JT4B 3EECA 4YL8A 1TKGA 5D3DA 1ENFA 2KDIA 5DPRA 4ICVA 3X23A 4FADA 3BVMA 1P98A 1N5WA 1CMXB 2IGHA 1NI3A 2WXJA 5IP4D 1RM6C 3NG0A 3GOEA 3RN9C 1GJZA 4I6LB 1MJDA 3PRZA 4YTNB 3MC8A 1E8YA 3ECIA 2UU7A 1MHXA 4US9A 4JLCA 5JHAA 2LJIA 4EZLA 2BB6A 1TKYA 3PHXB 4N9F4 2KMMA 4PYZA 1ZXHA 4L23A 3ZUNA 2WP9B 1ZXIA 3V60A 1ET6A 1GB4A 3DWGC 2BS3B 4GOCA 2O6VD 2KC1A 2N9XA 1AYFA 1C3TA 3N3KB 3NJTA 2BS2B 3WA0A 3H7PA 1JWMD 4BAXA 1J7AA 2K9XA 4HRSA 1VRAB 4G11A 2LEKA 2DNFA 1WJ4A 2KO3A 2N9LA 3QAQA 4K7WA 3NOBA 2KD0A 5BYRA 2PJHA 4LLGM 3HVDA 3QX1A 1XQQA 2G45B 1BXTA 3M63B 1IBXB 3KUCB 3I3TB 3T8MA 1V5TA 4HROA 2JZZA 2M19A 4PYUA 5KHQA 1UGMA 2CJNA 3ONSA 1K51A 3VQIA 4G50A 2NPTA 1U4AA 3M62B 4WAAA 3NRZA 1A5RA 1V8CA 2KQ7A 4W9KA 2WXKA 4WH4A 4GXBA 2MP2B 2AQ1B 3MP9A 2ZPYA 1X1MA 3QQ8B 1V86A 3AE7B 2JYTA 2KDEB 2LUMA
chains in the Genus database with same CATH topology
2K8BA 3PRMB 2NBVB 3KUDB 1WGHA 4PS7A 2MWSB 3A9KA 3CSTA 1SGHA 1V6EA 2LD9A 1WGYA 4ZYNA 2WDTB 4KSKC 2D07B 2C7MB 4FHJA 2V3SA 1S3SG 2GBNA 2G3QB 3NZUA 3DDCB 4AWJA 2KANA 4JIOU 2FCMA 2N7EA 2KHWB 2FCNA 3L08A 3QWZB 4OVUA 3VTVA 3IVFA 3ZLZA 2K6QA 2KFKA 4BKGA 2KKCA 3PT2B 2OOBB 2KMAA 2LVOA 3N30A 4WJOA 4A20A 1OEYJ 5LXIB 2C9WB 4MGIE 1YX5B 1WMHA 5JZEB 2W9NA 3VVWB 4GN1A 4DWFA 2KN5A 4EEWA 3PREA 4EOYA 2JRIB 4W9HA 4HJKA 5KHOA 4K1RB 1GNUA 3PPAA 2V1YA 4KZCA 1WRDB 3TL5A 2KJHB 3MTNB 2JZ3B 4LDTD 1ZW7A 4FHKA 4WWNA 2K8CA 2LI5A 4HDOA 1KJTA 4E71A 4EUTA 3SU8X 2BWFA 4EFOA 4P7IA 1E8WA 2KQSA 3HIZA 4KVGB 2CHZA 2KWCA 1WJ6A 3KUZA 2KVRA 2MCNB 3B1LX 1RAXA 4II2B 4URKA 3H1UA 3O65B 1WFYA 3NS8A 4B9KA 1JRUA 3HM3A 1V9JA 3IBEA 4IC7B 4IW0A 3WAMA 5J17A 5L95C 1WX7A 3WANA 3APDA 3BY4B 2FCSA 1IPGA 3UINB 1OEYA 1WH3A 4NQKE 4GDLB 4MSQB 1KLVA 3APFA 4M8MA 2QHOA 4AUQC 4DHJD 1M94A 3A33B 3A1QA 2KLGA 2A5UA 2MA9B 3RULA 2DZJA 2KDBA 1NI2A 3H9DA 4IG7B 3OLMD 2CHWA 4NAWB 5AZGA 4NAWA 4KIKB 4BKSD 2ZEQA 4GDKA 2CU1A 2PEAA 2DYBA 2WX0A 4IM2A 2FUHB 3V6EB 4MEMA 4BBNC 2YLMA 2GBJA 3RCZA 3VDZA 1Q5WB 2XK5B 4BOSC 2LVQA 3ZTDA 3ZKJC 4CYEA 4HDQA 5AZHA 3LDZE 4CO7A 4WWPA 2L0TA 2IY1B 4ZRJA 5E6PA 2GOWA 1WJNA 2AL3A 4WQOB 2L0FA 4HK2A 3AXCA 2KX0A 4F1SA 3PLUA 4II3B 4NJ7A 3RZFA 1GC7A 5C23A 3ENEA 1WI0A 4LCDE 2IO1B 2KX3A 3GZNI 4K7SA 4MDKE 3TIXA 4ZDVA 2AYOB 1WGGA 4FJVB 1ZKHA 1GUAB 3R3MA 2G4DB 3JYUA 1H8CA 1EUVB 3DBHI 4GGQA 4TQ0A 3TMPB 4RM8A 1BT0A 1EF5A 3L54A 3ZIMA 1YIWA 5LLIA 5GMVA 2FIDA 1AARA 4IWOA 4G0NB 4NJ6A 1G6JA 5D2MB 2BPSA 2MBQA 4W9IA 1KOTA 2D10A 2GBKA 2K25A 2ZVOA 3ZDMC 2CHXA 1UD7A 5DPSA 3V61A 4DXAB 1WJUA 5D94A 2C5LC 2BGFA 4MM3A 2ZNVB 4I6PA 3JVZX 5J2RA 4E3CA 3IHPC 2KMCA 1YJ1A 1ISNA 2MBOA 2WYQA 2WX1A 2NR2A 4TV3A 3JSVA 4W9DA 3L13A 3X0WA 4DBGA 2MSED 1WR6E 2O2VB 2RD0A 3KVFB 3RYTA 1WXAA 4IM0A 2MBEA 3AULA 4FLHA 2J0MA 2MP2A 3L17A 1VCBA 2O6VB 3UQAA 3AU4A 3DCGA 2NVUI 3VTWA 3QHTA 1P9DU 4FA6A 3ZDTA 1WF9A 5TR5A 4WWOA 2LXCA 1LFDA 4IM3A 2D3GA 2J0JA 2LVPA 3ZNGC 1HE8A 2Y5BB 4ANXA 4WJQA 3ML8A 2UWQA 2LRWA 1J0GA 4CHKA 1R4NI 3VH3B 1P0RA 4DDGD 1RLFA 2NS5A 3SHQA 4F8CB 3NZSA 1WYWB 3NHEB 5G55A 2ASQA 4TKNA 3SDLC 2IYDB 2DYMA 2HD5B 3ALBA 3IG3A 5JH5C 3B08A 4LJPB 4FJZA 4BKTA 4ZRKA 3PGEA 4MGZE 1E90A 2K1FA 1WZ3A 4PS8A 3AU5A 3CSFA 3H6NA 3VUWA 3ZNID 2C7HA 3DPDA 3D32A 2BKRB 4W9EA 4A3PA 3TCAA 2CKHB 2ZVNA 3M95A 2HTHA 3DVGY 4ICUA 2MQJA 1P3QU 4W9GA 4TQ1A 2BKFA 1V49A 2FNJB 4W9CA 3ZNHB 3ZNZB 1C1YB 4M0WB 2NBWB 2K8HA 3DVNV 2HJ8A 3L10B 4KIKA 5C1ZA 1Q0WB 2N7DA 3EFUA 5DCNA 3KYCD 2J0KA 2ZZPB 4HPMB 4DHZE 2UYZB 2KC2A 1E7UA 2C60A 2JUOA 2MBBB 3KH0A 5CHWA 1Z2MA 2FAZA 3HM6X 1UBQA 3DVGX 3N32A 2CS4A 2LZ6A 2L7RA 4MGYE 2C7NB 1EF1A 3L16A 3TBLD 1WX8A 3APCA 1WR1A 4M8NA 2WWZA 4MH0E 2ZPNA 3LJ3A 5CHFA 5E6NA 2GBMA 3CF6E 1V5OA 2L00B 3DOWA 2RGFA 4DHJB 2OJRA 2FIFA 2L76A 2L3ZA 1IYFA 2BYFA 2NPTB 1SE9A 3KW5B 1WM3A 1FXTB 3M3JA 3ZRCA 2BYVE 1WZ0A 3PSEB 3PVLA 1E8XA 4HPLB 2KNBA 1WM2A 1TTNA 1Y8RC 2V4LA 4IWQA 4BFRA 4DHZB 1LQBA 2MLBA 3QCAA 5HKHA 3ZO5B 4IUMB 4ASWC 2ZJDA 3NY5A 1J19A 1XT9B 2XBBC 1R4MI 2KDFB 3K9OB 2MBHA 5J18A 2D2QA 3U30A 1WIAA 2LUEA 2XEWA 3EHVA 3V62A 4NY0A 2DAFA 3WIMA 2DHZA 3C0RB 3H7SA 2VRRB 3UQBA 3BINA 4RM9A 4GSWA 3UGBB 1IP9A 2LASA 2KTFA 2KTRB 3H7PB 1OTRB 5FR6A 1MG8A 3TJPA 3SD5A 4XZ4A 2DX5B 2AWTA 3T9LA 2LGXA 4W9JA 4JGHB 2J7QB 1J8CA 1EO6A 3IFWB 4FJYA 1RFAA 2IO2B 2LWPA 4MSMB 4RMAA 2Z0EB 2LGDA 2JPHA 1OGWA 2KFKB 4PS3A 3W1SC 1UZXB 2I1JA 2DZIA 3PS6A 4NPNA 2ZCCA 3P2BA 1OQYA 5IA7A 3ZW3A 1UBIA 1ZGUB 2IBIB 3ZRFA 4GDLA 2MW5A 3OAWA 3U7DA 4BVUC 4BBNF 2M8SA 3UIOB 2LJ5A 4HCNB 3ZTCA 1SIFA 1TZ1A 1Q1OA 3MHSD 4ANUA 2EMSA 2N1VA 3ML9A 2R2QA 1WXVA 1E5WA 3Q3JA 4WJPA 4XX5A 3L0WB 2PPHA 1S1QB 4KSLC 3KYDD 2YVCA 2KOXA 3QA8A 4ANWA 5LXHA 2BWES 5CHVC 1GG3A 1KM7A 3RZWC 4HWIB 5E6OA 3PLVA 2ZNVC 1YD8U 4MGKE 4AJWA 2LGYA 3WAOA 4E74A 3W1SA 4DDID 5D7GA 1RRBA 1WY8A 3QK0A 5L83A 3JW0X 3DVNU 3R66C 2DAJA 4K7UA 2N9EB 3RUIB 2PE9A 3V6CB 2O2VA 4XC2A 5CTRC 2KWUB 3HK0A 3DBLI 2ZCBA 4HLEA 1TGZB 2MX2A 2O6VA 3QIJA 3PV1A 2JT4B 3EECA 4YL8A 2REXA 1QZEA 2KDIA 3VUXA 1V81A 2FCQA 2KZRA 5DPRA 4EKUA 3Q3FA 4ICVA 4WJNA 5D6JB 3X23A 4FADA 2PE6B 1WE7A 1P98A 3HHMA 1CMXB 1H4RA 4AOFA 1V80A 1YQBA 2N1WA 2KJRA 3S2AA 1L7YA 2M4NA 2RR9A 3GOEA 5EDSA 2EMTA 4I6NB 4AJYB 5AEKB 2GBRA 1GJZA 3WALA 1WE6A 4I6LB 3PHWB 3PRZA 2LXAA 2NBUA 1WGDA 2RSUA 3WAPA 1WX9A 4DK5A 2G4SA 1E8YA 3ECIA 4OVVA 1Z5SB 1WXMA 4LDTB 1I42A 2Z0DB 4JLCA 3VH4B 2BYEA 2IO0B 3QARA 5JHAA 4ANVA 1TBEA 1L2NA 2IY0B 2IZVB 2JXXA 4NQLB 5CX3A 2DYOA 3UF8A 4EZLA 4NNJB 2N4FA 1WGRA 3PHXB 5JHBA 1UH6A 2JWZA 1E8ZA 4HCPB 4N9F4 4PYZA 4EZJA 4KDLB 2AL6A 5DPTA 2MRPA 3ZUNA 2M0XA 4GB9A 3UIPB 4JL9A 4FBJB 3V60A 3PZDA 3U8ZA 3VTUA 4K81A 3R7QA 1PQSA 4FULA 2O6VD 3A1QB 4GOCA 4IWPA 3DBRI 5G2NA 2IO3B 2R2OA 1V2YA 2BF8B 2KC1A 4A3OA 2N9XA 4TUUA 3OJ4B 1C3TA 3N3KB 1K8RB 4GMVA 2JF5A 2B3AA 3R7RA 5IAAC 3WA0A 3H7PA 1GC6A 2KLCA 2JY6A 1F9JA 3VHTC 2KK8A 2KXJA 3JSVB 3ZVVA 2KJ6A 4HXDA 4BOZB 3CMMB 1D3ZA 2D11A 3A9JB 1UELA 2LRUA 1P1AA 1T0YA 2DZKA 4G11A 3VUYA 3QJZA 2CR5A 1WJ4A 2KO3A 3DQVA 2M17A 3A4RA 4JQWC 1WMHB 3QAQA 4K7WA 4W9LA 3NOBA 2KD0A 3B0AA 2PJHA 3MJWA 3W1YA 4KZ0A 3EC8A 1VD2A 4W9FA 2I1KA 3AI5A 3QX1A 2KWVB 1XQQA 2KFJA 2G45B 2L05A 3M63B 3KUCB 3I3TB 3PTFC 3VFKA 2K39A 3RD2A 3QC8B 4J6IA 3T8MA 1V5TA 4EZKA 2JZZA 3OJ3A 4PYUA 2A4ZA 3A9KB 5KHQA 1UGMA 2GMIC 4GIVA 1LM8B 1XD3B 2M1MA 3ONSA 3VAWA 2NCNA 3VQIA 4G50A 2DENB 4GDKB 2KTRA 3PRPB 4HVBA 4GU2A 2NPTA 5DPWA 4X57B 4AP4C 1U4AA 4KDIC 3M62B 3DBSA 4WAAA 2RPQA 4KV2A 4BKSA 1A5RA 5AZFA 2JRHA 3K9PB 2Z59B 3VXWA 4FN2A 2EKEC 2KQ7A 1YX6B 4W9KA 1LXDA 2N9PC 2L8JA 4GXBA 4B95A 1WXSA 2MP2B 2AEHA 2K6DB 3RT3B 2ZPYA 3A4SC 4G3XB 4MJSA 1NBFC 4LJOB 4B6WA 1X1MA 4MJSB 3A9JA 5BO4B 4MELA 3QQ8B 1E7VA 1V86A 1NDDA 4ZRIA 1I35A 4F7ZA 2KDEB 2DZMA 2HE7A 2JVCA 2XK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8B A;  3PRM B;  2NBV B;  3KUD B;  1WGH A;  4PS7 A;  2MWS B;  3A9K A;  3CST A;  1SGH A;  1V6E A;  2LD9 A;  1WGY A;  4ZYN A;  2WDT B;  4KSK C;  2D07 B;  2C7M B;  4FHJ A;  2V3S A;  1S3S G;  2GBN A;  2G3Q B;  3NZU A;  3DDC B;  4AWJ A;  2KAN A;  4JIO U;  2FCM A;  2N7E A;  2KHW B;  2FCN A;  3L08 A;  3QWZ B;  4OVU A;  3VTV A;  3IVF A;  3ZLZ A;  2K6Q A;  2KFK A;  4BKG A;  2KKC A;  3PT2 B;  2OOB B;  2KMA A;  2LVO A;  3N30 A;  4WJO A;  4A20 A;  1OEY J;  5LXI B;  2C9W B;  4MGI E;  1YX5 B;  1WMH A;  5JZE B;  2W9N A;  3VVW B;  4GN1 A;  4DWF A;  2KN5 A;  4EEW A;  3PRE A;  4EOY A;  2JRI B;  4W9H A;  4HJK A;  5KHO A;  4K1R B;  1GNU A;  3PPA A;  2V1Y A;  4KZC A;  1WRD B;  3TL5 A;  2KJH B;  3MTN B;  2JZ3 B;  4LDT D;  1ZW7 A;  4FHK A;  4WWN A;  2K8C A;  2LI5 A;  4HDO A;  1KJT A;  4E71 A;  4EUT A;  3SU8 X;  2BWF A;  4EFO A;  4P7I A;  1E8W A;  2KQS A;  3HIZ A;  4KVG B;  2CHZ A;  2KWC A;  1WJ6 A;  3KUZ A;  2KVR A;  2MCN B;  3B1L X;  1RAX A;  4II2 B;  4URK A;  3H1U A;  3O65 B;  1WFY A;  3NS8 A;  4B9K A;  1JRU A;  3HM3 A;  1V9J A;  3IBE A;  4IC7 B;  4IW0 A;  3WAM A;  5J17 A;  5L95 C;  1WX7 A;  3WAN A;  3APD A;  3BY4 B;  2FCS A;  1IPG A;  3UIN B;  1OEY A;  1WH3 A;  4NQK E;  4GDL B;  4MSQ B;  1KLV A;  3APF A;  4M8M A;  2QHO A;  4AUQ C;  4DHJ D;  1M94 A;  3A33 B;  3A1Q A;  2KLG A;  2A5U A;  2MA9 B;  3RUL A;  2DZJ A;  2KDB A;  1NI2 A;  3H9D A;  4IG7 B;  3OLM D;  2CHW A;  4NAW B;  5AZG A;  4NAW A;  4KIK B;  4BKS D;  2ZEQ A;  4GDK A;  2CU1 A;  2PEA A;  2DYB A;  2WX0 A;  4IM2 A;  2FUH B;  3V6E B;  4MEM A;  4BBN C;  2YLM A;  2GBJ A;  3RCZ A;  3VDZ A;  1Q5W B;  2XK5 B;  4BOS C;  2LVQ A;  3ZTD A;  3ZKJ C;  4CYE A;  4HDQ A;  5AZH A;  3LDZ E;  4CO7 A;  4WWP A;  2L0T A;  2IY1 B;  4ZRJ A;  5E6P A;  2GOW A;  1WJN A;  2AL3 A;  4WQO B;  2L0F A;  4HK2 A;  3AXC A;  2KX0 A;  4F1S A;  3PLU A;  4II3 B;  4NJ7 A;  3RZF A;  1GC7 A;  5C23 A;  3ENE A;  1WI0 A;  4LCD E;  2IO1 B;  2KX3 A;  3GZN I;  4K7S A;  4MDK E;  3TIX A;  4ZDV A;  2AYO B;  1WGG A;  4FJV B;  1ZKH A;  1GUA B;  3R3M A;  2G4D B;  3JYU A;  1H8C A;  1EUV B;  3DBH I;  4GGQ A;  4TQ0 A;  3TMP B;  4RM8 A;  1BT0 A;  1EF5 A;  3L54 A;  3ZIM A;  1YIW A;  5LLI A;  5GMV A;  2FID A;  1AAR A;  4IWO A;  4G0N B;  4NJ6 A;  1G6J A;  5D2M B;  2BPS A;  2MBQ A;  4W9I A;  1KOT A;  2D10 A;  2GBK A;  2K25 A;  2ZVO A;  3ZDM C;  2CHX A;  1UD7 A;  5DPS A;  3V61 A;  4DXA B;  1WJU A;  5D94 A;  2C5L C;  2BGF A;  4MM3 A;  2ZNV B;  4I6P A;  3JVZ X;  5J2R A;  4E3C A;  3IHP C;  2KMC A;  1YJ1 A;  1ISN A;  2MBO A;  2WYQ A;  2WX1 A;  2NR2 A;  4TV3 A;  3JSV A;  4W9D A;  3L13 A;  3X0W A;  4DBG A;  2MSE D;  1WR6 E;  2O2V B;  2RD0 A;  3KVF B;  3RYT A;  1WXA A;  4IM0 A;  2MBE A;  3AUL A;  4FLH A;  2J0M A;  2MP2 A;  3L17 A;  1VCB A;  2O6V B;  3UQA A;  3AU4 A;  3DCG A;  2NVU I;  3VTW A;  3QHT A;  1P9D U;  4FA6 A;  3ZDT A;  1WF9 A;  5TR5 A;  4WWO A;  2LXC A;  1LFD A;  4IM3 A;  2D3G A;  2J0J A;  2LVP A;  3ZNG C;  1HE8 A;  2Y5B B;  4ANX A;  4WJQ A;  3ML8 A;  2UWQ A;  2LRW A;  1J0G A;  4CHK A;  1R4N I;  3VH3 B;  1P0R A;  4DDG D;  1RLF A;  2NS5 A;  3SHQ A;  4F8C B;  3NZS A;  1WYW B;  3NHE B;  5G55 A;  2ASQ A;  4TKN A;  3SDL C;  2IYD B;  2DYM A;  2HD5 B;  3ALB A;  3IG3 A;  5JH5 C;  3B08 A;  4LJP B;  4FJZ A;  4BKT A;  4ZRK A;  3PGE A;  4MGZ E;  1E90 A;  2K1F A;  1WZ3 A;  4PS8 A;  3AU5 A;  3CSF A;  3H6N A;  3VUW A;  3ZNI D;  2C7H A;  3DPD A;  3D32 A;  2BKR B;  4W9E A;  4A3P A;  3TCA A;  2CKH B;  2ZVN A;  3M95 A;  2HTH A;  3DVG Y;  4ICU A;  2MQJ A;  1P3Q U;  4W9G A;  4TQ1 A;  2BKF A;  1V49 A;  2FNJ B;  4W9C A;  3ZNH B;  3ZNZ B;  1C1Y B;  4M0W B;  2NBW B;  2K8H A;  3DVN V;  2HJ8 A;  3L10 B;  4KIK A;  5C1Z A;  1Q0W B;  2N7D A;  3EFU A;  5DCN A;  3KYC D;  2J0K A;  2ZZP B;  4HPM B;  4DHZ E;  2UYZ B;  2KC2 A;  1E7U A;  2C60 A;  2JUO A;  2MBB B;  3KH0 A;  5CHW A;  1Z2M A;  2FAZ A;  3HM6 X;  1UBQ A;  3DVG X;  3N32 A;  2CS4 A;  2LZ6 A;  2L7R A;  4MGY E;  2C7N B;  1EF1 A;  3L16 A;  3TBL D;  1WX8 A;  3APC A;  1WR1 A;  4M8N A;  2WWZ A;  4MH0 E;  2ZPN A;  3LJ3 A;  5CHF A;  5E6N A;  2GBM A;  3CF6 E;  1V5O A;  2L00 B;  3DOW A;  2RGF A;  4DHJ B;  2OJR A;  2FIF A;  2L76 A;  2L3Z A;  1IYF A;  2BYF A;  2NPT B;  1SE9 A;  3KW5 B;  1WM3 A;  1FXT B;  3M3J A;  3ZRC A;  2BYV E;  1WZ0 A;  3PSE B;  3PVL A;  1E8X A;  4HPL B;  2KNB A;  1WM2 A;  1TTN A;  1Y8R C;  2V4L A;  4IWQ A;  4BFR A;  4DHZ B;  1LQB A;  2MLB A;  3QCA A;  5HKH A;  3ZO5 B;  4IUM B;  4ASW C;  2ZJD A;  3NY5 A;  1J19 A;  1XT9 B;  2XBB C;  1R4M I;  2KDF B;  3K9O B;  2MBH A;  5J18 A;  2D2Q A;  3U30 A;  1WIA A;  2LUE A;  2XEW A;  3EHV A;  3V62 A;  4NY0 A;  2DAF A;  3WIM A;  2DHZ A;  3C0R B;  3H7S A;  2VRR B;  3UQB A;  3BIN A;  4RM9 A;  4GSW A;  3UGB B;  1IP9 A;  2LAS A;  2KTF A;  2KTR B;  3H7P B;  1OTR B;  5FR6 A;  1MG8 A;  3TJP A;  3SD5 A;  4XZ4 A;  2DX5 B;  2AWT A;  3T9L A;  2LGX A;  4W9J A;  4JGH B;  2J7Q B;  1J8C A;  1EO6 A;  3IFW B;  4FJY A;  1RFA A;  2IO2 B;  2LWP A;  4MSM B;  4RMA A;  2Z0E B;  2LGD A;  2JPH A;  1OGW A;  2KFK B;  4PS3 A;  3W1S C;  1UZX B;  2I1J A;  2DZI A;  3PS6 A;  4NPN A;  2ZCC A;  3P2B A;  1OQY A;  5IA7 A;  3ZW3 A;  1UBI A;  1ZGU B;  2IBI B;  3ZRF A;  4GDL A;  2MW5 A;  3OAW A;  3U7D A;  4BVU C;  4BBN F;  2M8S A;  3UIO B;  2LJ5 A;  4HCN B;  3ZTC A;  1SIF A;  1TZ1 A;  1Q1O A;  3MHS D;  4ANU A;  2EMS A;  2N1V A;  3ML9 A;  2R2Q A;  1WXV A;  1E5W A;  3Q3J A;  4WJP A;  4XX5 A;  3L0W B;  2PPH A;  1S1Q B;  4KSL C;  3KYD D;  2YVC A;  2KOX A;  3QA8 A;  4ANW A;  5LXH A;  2BWE S;  5CHV C;  1GG3 A;  1KM7 A;  3RZW C;  4HWI B;  5E6O A;  3PLV A;  2ZNV C;  1YD8 U;  4MGK E;  4AJW A;  2LGY A;  3WAO A;  4E74 A;  3W1S A;  4DDI D;  5D7G A;  1RRB A;  1WY8 A;  3QK0 A;  5L83 A;  3JW0 X;  3DVN U;  3R66 C;  2DAJ A;  4K7U A;  2N9E B;  3RUI B;  2PE9 A;  3V6C B;  2O2V A;  4XC2 A;  5CTR C;  2KWU B;  3HK0 A;  3DBL I;  2ZCB A;  4HLE A;  1TGZ B;  2MX2 A;  2O6V A;  3QIJ A;  3PV1 A;  2JT4 B;  3EEC A;  4YL8 A;  2REX A;  1QZE A;  2KDI A;  3VUX A;  1V81 A;  2FCQ A;  2KZR A;  5DPR A;  4EKU A;  3Q3F A;  4ICV A;  4WJN A;  5D6J B;  3X23 A;  4FAD A;  2PE6 B;  1WE7 A;  1P98 A;  3HHM A;  1CMX B;  1H4R A;  4AOF A;  1V80 A;  1YQB A;  2N1W A;  2KJR A;  3S2A A;  1L7Y A;  2M4N A;  2RR9 A;  3GOE A;  5EDS A;  2EMT A;  4I6N B;  4AJY B;  5AEK B;  2GBR A;  1GJZ A;  3WAL A;  1WE6 A;  4I6L B;  3PHW B;  3PRZ A;  2LXA A;  2NBU A;  1WGD A;  2RSU A;  3WAP A;  1WX9 A;  4DK5 A;  2G4S A;  1E8Y A;  3ECI A;  4OVV A;  1Z5S B;  1WXM A;  4LDT B;  1I42 A;  2Z0D B;  4JLC A;  3VH4 B;  2BYE A;  2IO0 B;  3QAR A;  5JHA A;  4ANV A;  1TBE A;  1L2N A;  2IY0 B;  2IZV B;  2JXX A;  4NQL B;  5CX3 A;  2DYO A;  3UF8 A;  4EZL A;  4NNJ B;  2N4F A;  1WGR A;  3PHX B;  5JHB A;  1UH6 A;  2JWZ A;  1E8Z A;  4HCP B;  4N9F 4;  4PYZ A;  4EZJ A;  4KDL B;  2AL6 A;  5DPT A;  2MRP A;  3ZUN A;  2M0X A;  4GB9 A;  3UIP B;  4JL9 A;  4FBJ B;  3V60 A;  3PZD A;  3U8Z A;  3VTU A;  4K81 A;  3R7Q A;  1PQS A;  4FUL A;  2O6V D;  3A1Q B;  4GOC A;  4IWP A;  3DBR I;  5G2N A;  2IO3 B;  2R2O A;  1V2Y A;  2BF8 B;  2KC1 A;  4A3O A;  2N9X A;  4TUU A;  3OJ4 B;  1C3T A;  3N3K B;  1K8R B;  4GMV A;  2JF5 A;  2B3A A;  3R7R A;  5IAA C;  3WA0 A;  3H7P A;  1GC6 A;  2KLC A;  2JY6 A;  1F9J A;  3VHT C;  2KK8 A;  2KXJ A;  3JSV B;  3ZVV A;  2KJ6 A;  4HXD A;  4BOZ B;  3CMM B;  1D3Z A;  2D11 A;  3A9J B;  1UEL A;  2LRU A;  1P1A A;  1T0Y A;  2DZK A;  4G11 A;  3VUY A;  3QJZ A;  2CR5 A;  1WJ4 A;  2KO3 A;  3DQV A;  2M17 A;  3A4R A;  4JQW C;  1WMH B;  3QAQ A;  4K7W A;  4W9L A;  3NOB A;  2KD0 A;  3B0A A;  2PJH A;  3MJW A;  3W1Y A;  4KZ0 A;  3EC8 A;  1VD2 A;  4W9F A;  2I1K A;  3AI5 A;  3QX1 A;  2KWV B;  1XQQ A;  2KFJ A;  2G45 B;  2L05 A;  3M63 B;  3KUC B;  3I3T B;  3PTF C;  3VFK A;  2K39 A;  3RD2 A;  3QC8 B;  4J6I A;  3T8M A;  1V5T A;  4EZK A;  2JZZ A;  3OJ3 A;  4PYU A;  2A4Z A;  3A9K B;  5KHQ A;  1UGM A;  2GMI C;  4GIV A;  1LM8 B;  1XD3 B;  2M1M A;  3ONS A;  3VAW A;  2NCN A;  3VQI A;  4G50 A;  2DEN B;  4GDK B;  2KTR A;  3PRP B;  4HVB A;  4GU2 A;  2NPT A;  5DPW A;  4X57 B;  4AP4 C;  1U4A A;  4KDI C;  3M62 B;  3DBS A;  4WAA A;  2RPQ A;  4KV2 A;  4BKS A;  1A5R A;  5AZF A;  2JRH A;  3K9P B;  2Z59 B;  3VXW A;  4FN2 A;  2EKE C;  2KQ7 A;  1YX6 B;  4W9K A;  1LXD A;  2N9P C;  2L8J A;  4GXB A;  4B95 A;  1WXS A;  2MP2 B;  2AEH A;  2K6D B;  3RT3 B;  2ZPY A;  3A4S C;  4G3X B;  4MJS A;  1NBF C;  4LJO B;  4B6W A;  1X1M A;  4MJS B;  3A9J A;  5BO4 B;  4MEL A;  3QQ8 B;  1E7V A;  1V86 A;  1NDD A;  4ZRI A;  1I35 A;  4F7Z A;  2KDE B;  2DZM A;  2HE7 A;  2JVC A;  2XK5 A; 
#chains in the Genus database with same CATH topology
 2NBV B;  4MM3 B;  2MWS B;  3CST A;  1SGH A;  1V6E A;  1WGY A;  5IKC M;  5TSS A;  2WDT B;  3B2F A;  4FXC A;  2C7M B;  3I63 C;  2GBN A;  3HVZ A;  1V1O A;  2K6Q A;  2KFK A;  3ZLZ A;  3RNG C;  2KMA A;  4OHJ A;  3N30 A;  1SJE D;  1YX5 B;  5JZE B;  4MH8 A;  1R4M B;  4EEW A;  2ZW0 A;  2JRI B;  3FIL B;  2AQ2 B;  3VRA B;  1ZW7 A;  4FHK A;  4LNI A;  2LI5 A;  4E71 A;  4JWS C;  2KQS A;  4GLS C;  2HDE A;  4KVG B;  4M00 A;  4WIP A;  3B1L X;  2N9K A;  4B9K A;  1FIQ A;  3IAM 1;  5L95 C;  2VZK B;  4ARI A;  3P63 A;  4R3D A;  2INN E;  1WH3 A;  4MSQ B;  3ZJT A;  1KLV A;  4M8M A;  2QHO A;  2A5U A;  2BQQ A;  1KRH A;  3RUL A;  3OLM D;  2L1A A;  1RYJ A;  5AZG A;  4BKS D;  4C80 A;  4GDK A;  3DWM A;  5IOI A;  4MEM A;  2GBJ A;  4BOS C;  3ZKJ C;  5AZH A;  3LDZ E;  1PFD A;  2L0T A;  3FKY A;  3Q69 A;  1WJN A;  2GOW A;  2L0F A;  4HK2 A;  3AXC A;  2KX0 A;  1GC7 A;  1JWA D;  2KX3 A;  4MDK E;  2HTM E;  4B0M A;  4OZC A;  2AYO B;  3BK2 A;  2JWU A;  1WGG A;  1ZKH A;  1GUA B;  3R3M A;  1EUV B;  3DBH I;  4GGQ A;  4TQ0 A;  4RM8 A;  1N6Z A;  5LLI A;  5GMV A;  1AAR A;  1YQ4 B;  4G0N B;  2IGG A;  3ZXV A;  4W9I A;  1KOT A;  2D10 A;  3AE5 B;  1N5X A;  1K50 A;  5FK9 C;  1F1H A;  3BII D;  4XGA B;  4DXA B;  1HTO A;  5D94 A;  1TZO A;  3IHP C;  2KMC A;  1CQV A;  2WX1 A;  4TV3 A;  3JSV A;  2MSE D;  3NVY A;  3KVF B;  3RYT A;  4IM0 A;  4FLH A;  3HUI A;  1D5Z C;  3L17 A;  3AU4 A;  2NVU I;  3AE6 B;  3RMK C;  2IPK D;  3ZNG C;  1QF6 A;  4CHK A;  1R4N I;  3AE2 B;  2WDQ B;  4F8C B;  1WYW B;  2IGD A;  5JH5 C;  3B08 A;  4FJZ A;  4ZRK A;  1PGA A;  3Q8C A;  4BZA A;  4PS8 A;  3AU5 A;  2KYW A;  3CSF A;  3H6N A;  4PT5 A;  4A3P A;  2CKH B;  1MFW A;  3R8B A;  1E10 A;  1P3Q U;  2BKF A;  3ZNZ B;  2K5P A;  1WGK A;  2K8H A;  3NVZ A;  4KIK A;  1Q0W B;  3EFU A;  3Q3M C;  2J0K A;  2UYZ B;  1PUT A;  1UF0 A;  3IT6 B;  1Z2M A;  2FAZ A;  2L7R A;  1TS3 A;  3L16 A;  1WX8 A;  4MH0 E;  2Y3A A;  5BMG A;  1C4C A;  2L76 A;  2GB1 A;  4ZHP A;  3KW5 B;  4K3C A;  3PSE B;  4YSZ B;  4BFR A;  1WM2 A;  1TTN A;  1LQB A;  3QCA A;  1C4A A;  3N1Z C;  1J19 A;  1XT9 B;  4ARC A;  2MBH A;  3U30 A;  1WIA A;  4NY0 A;  3WIM A;  3TEY A;  3UGB B;  1IP9 A;  2LAS A;  1OTR B;  3TJP A;  3SD5 A;  4YSX B;  4JGH B;  2VH2 A;  4RMA A;  4PS3 A;  1OGW A;  2KFK B;  3W1S C;  4RFB A;  4JX1 C;  2I1J A;  4HKZ E;  3P2B A;  2IBI B;  1KLU D;  4GDL A;  2MW5 A;  3OAW A;  3U7D A;  2L83 A;  3PO0 A;  2M8S A;  5D3I B;  1MI0 A;  3Q3J A;  2PPH A;  4N58 A;  2BWE S;  5CHV C;  2J4X A;  2FUG 1;  1YD8 U;  3LXF A;  3WAO A;  1QQR A;  2IND C;  4WQM A;  2D3A A;  1XXG A;  1ZDV A;  2K0P A;  4E74 A;  1RRB A;  3DVN U;  2DAJ A;  2N9E B;  5CTR C;  4YT0 B;  1F77 A;  3HK0 A;  3P4P B;  3DBL I;  4HLE A;  2O6V A;  3QIJ A;  3I9V 1;  2WXN A;  2D3C A;  3IXS A;  3Q3F A;  4ITK A;  4NAM A;  2PE6 B;  3URY A;  3AE4 B;  1YQB A;  1TS5 A;  2N1W A;  1L7Y A;  1ZOY B;  2BT6 A;  4AJY B;  4I6N B;  2WXH A;  4LK0 M;  2QC8 A;  5AEK B;  1SB3 C;  3B2G A;  3U2S C;  2LXA A;  1WGD A;  2RSU A;  2QDF A;  1WX9 A;  1XLN A;  4DK5 A;  1Z5S B;  4LDT B;  1PDX A;  4A8X C;  3VH4 B;  2KAC A;  3QAR A;  4ANV A;  4XWW A;  2JXX A;  5CX3 A;  1L5P A;  2WU2 B;  4YTP B;  1UH6 A;  4XWT A;  3W5V B;  5DPT A;  2MRP A;  1IBX A;  4GB9 A;  3UIP B;  4JL9 A;  4FBJ B;  4RGM A;  3VTU A;  2MJ3 A;  4FUL A;  4IWP A;  3A1Q B;  2BF8 B;  4AS1 A;  4XDD A;  2PLP A;  4GMV A;  2JF5 A;  3R7R A;  1T0Q C;  2M0A A;  2KLC A;  1F9J A;  3JSV B;  3PZ7 A;  5EE0 A;  4HXD A;  1XLO A;  4BOZ B;  3LB8 C;  3CMM B;  3A9J B;  2WS3 B;  1T0Y A;  3QJZ A;  2CR5 A;  3DQV A;  3W1Y A;  3EC8 A;  1VD2 A;  4W9F A;  2KWV B;  2NMQ A;  4P1C C;  1N60 A;  3V05 A;  3PTF C;  3VFK A;  3RD2 A;  4C7Z A;  4DXF A;  3HRD D;  3OJ3 A;  2A4Z A;  3A9K B;  3VR9 B;  4GIV A;  2M1M A;  2DEN B;  4GDK B;  1B9R A;  2KTR A;  2W82 A;  4X57 B;  2BYT A;  3DBS A;  2RPQ A;  2Z59 B;  3VXW A;  4FN2 A;  1YX6 B;  4XE0 A;  1E9M A;  1LXD A;  5T8I A;  4KKJ A;  2K6D B;  3RI7 C;  3A4S C;  1NBF C;  1NYQ A;  1FRR A;  3A9J A;  1E7V A;  1NDD A;  1I35 A;  4F7Z A;  4RF0 A;  1CK1 A;  2JVC A;  2XK5 A;  4AUQ C;  1DOY A;  4DQO C;  1WGH A;  3RNB C;  1TY2 A;  1NVI D;  2KAN A;  3VUX A;  1C79 A;  2N7E A;  4OVU A;  2FCN A;  3VTV A;  1XLQ A;  1YJI A;  4B0E A;  4C7Y A;  3IVF A;  1B1Z A;  4BKG A;  4YXD B;  1HQR D;  1SSN A;  2LVO A;  1OEY J;  2C9W B;  1WMH A;  1ZPS A;  4M02 A;  2WXG A;  3VVW B;  4GN1 A;  3PRE A;  1L6V A;  3R2I A;  5KHO A;  1LO5 D;  2V1Y A;  4RGT A;  5MPO A;  1EM7 A;  2LGI A;  4LDT D;  2K8C A;  4P16 A;  4HDO A;  3SU8 X;  1PYW D;  4P7I A;  3HIZ A;  4EE2 A;  2CHZ A;  1N62 A;  2V4I B;  3KUZ A;  1WJ6 A;  2ON8 A;  4II2 B;  3H1U A;  1I7H A;  3Q8E A;  1V1P A;  3EFC A;  4NZL B;  1V9J A;  4IW0 A;  4ACF A;  1WX7 A;  1C78 A;  3N9Y C;  3BK1 A;  5HI1 A;  1IPG A;  4WUR A;  1HTQ A;  3BZD B;  2KN4 A;  1M94 A;  2KLG A;  2MA9 B;  1QT9 A;  3Q8A A;  4IG7 B;  4RF1 A;  4KIK B;  2PEA A;  2WX0 A;  3V6E B;  4BBN C;  3VDZ A;  1Q5W B;  2LVQ A;  3ZTD A;  1HXY D;  2OED A;  4CO7 A;  5E6P A;  2AL3 A;  3MHZ A;  1V97 A;  4QAY A;  3PLU A;  3Q8F A;  4II3 B;  3RZF A;  3V3X A;  3ENE A;  4LCD E;  3TIX A;  2IO1 B;  3GZN I;  3AEG B;  2WDR B;  4HEA 1;  3Q6B A;  2WXM A;  3SEB A;  1H8C A;  1EF5 A;  3TEW A;  3ZIM A;  3OG5 A;  1V1P B;  4IWO A;  1G6J A;  5HFY A;  2MJE A;  2MHJ A;  1UD7 A;  1BUI C;  5DPS A;  3V61 A;  1F52 A;  3P42 A;  2AX5 A;  4MM3 A;  5J2R A;  2Q5W D;  1EWC A;  2Y5C A;  1YJ1 A;  4W9D A;  2PKO A;  5C3J B;  3L13 A;  2O2V B;  3N1Y C;  1TY0 A;  2J0M A;  1VJK A;  4JWU C;  1VCB A;  3UQA A;  3MC0 B;  2DWQ A;  5TR5 A;  1R4N B;  1TIF A;  3KQ4 A;  2D3G A;  4IM3 A;  2YEP F;  2J0J A;  1HE8 A;  2LGS A;  2Y5B B;  4ANX A;  1J0G A;  1P0R A;  4DDG D;  2L52 A;  4DXG A;  4TKN A;  3IG3 A;  2HD5 B;  4BKT A;  1FXA A;  2K1F A;  3RPF C;  5EE3 A;  3VUW A;  2C7H A;  2BKR B;  4IKG A;  3DVG Y;  1I4H A;  4TQ1 A;  2JQR B;  3ZNH B;  1FNV A;  1E6E B;  1FCC C;  1UWM A;  2TSS A;  2HJ8 A;  3L10 B;  5DCN A;  2LMC A;  2KC2 A;  2JUO A;  2G1E A;  2J42 A;  3HM6 X;  3N32 A;  2K3U A;  3N20 C;  2KT7 A;  1YQ3 B;  2L32 A;  4CQN A;  3APC A;  5CHF A;  5I4D A;  3DOW A;  4ZOH C;  1HA5 A;  1IYF A;  1P7F A;  2BYF A;  1L4D B;  1JW9 D;  3M3J A;  1E7P B;  1FXT B;  1P7E A;  2BYV E;  3R2T A;  1L0X B;  1E8X A;  1GB1 A;  2KNB A;  3P4Q B;  1Y8R C;  2V4L A;  4IWQ A;  2KQ4 X;  2MLB A;  5HKH A;  3TEX A;  3ZO5 B;  2ZJD A;  3L4P A;  2KDF B;  1XF5 L;  5J18 A;  2D2Q A;  3EHV A;  3P4S B;  3V62 A;  2DAF A;  3EGR A;  4RM9 A;  4GSW A;  1ACC A;  5GXG B;  3AED B;  4S0R A;  2KTR B;  1ZE3 D;  2DBY A;  4XZ4 A;  2JYE A;  1VDV A;  2LGX A;  4W9J A;  2WXL A;  2IO2 B;  4C4V A;  4MSM B;  2LGD A;  3NVV A;  4LTU A;  5IA7 A;  4NPN A;  1WWT A;  4RGO S;  3ZW3 A;  1ZGU B;  1FPY A;  1ET9 A;  1KH0 A;  3ZTC A;  1TZ1 A;  3BYT B;  3MHS D;  2N1V A;  2VZK D;  3ML9 A;  1E5W A;  2WXR A;  4WJP A;  2PVO D;  4KSL C;  3KYD D;  1XCQ L;  1GG3 A;  4AJW A;  5G5G A;  2SAK A;  4DDI D;  5D7G A;  1WY8 A;  3QK0 A;  1J7B A;  5L83 A;  3JW0 X;  4K7U A;  1DYQ A;  2PE9 A;  1D5M C;  1PGB A;  4N59 A;  5AUI A;  1N63 A;  1Y56 A;  2IJ0 A;  2ZCB A;  1TGZ B;  2MX2 A;  1T3Q A;  3AEC B;  3AEA B;  2KZR A;  2FCQ A;  3W5U B;  5D6J B;  1DGJ A;  1WE7 A;  1H4R A;  1MPE A;  5BMH A;  1V80 A;  1UWX A;  1SE3 A;  4YTM B;  2RR9 A;  4O1N A;  2GBR A;  4LNF A;  3PHW B;  2NBU A;  4A9A A;  2X38 A;  2OJW A;  4OVV A;  3Q14 C;  3GE3 C;  2Z0D B;  2BYE A;  1VLB A;  2IO0 B;  4NQL B;  1VZ7 A;  3UF8 A;  4NNJ B;  1WGR A;  1E8Z A;  2RDB C;  2V9H A;  4KDL B;  3ZGZ A;  2RMM A;  3DHI C;  3R7Q A;  3P4R B;  3DBR I;  2R2O A;  5H92 C;  2WXP A;  1JRO A;  4TUU A;  4A3O A;  1K8R B;  1FD6 A;  2B3A A;  2E3T A;  5IAA C;  1N61 A;  3FAH A;  2JY6 A;  2LHE A;  1TS2 A;  2KK8 A;  3ZVV A;  3E56 A;  4A90 A;  2D11 A;  2G9H D;  1WRI A;  4C4V B;  1UEL A;  2LRU A;  3I57 A;  3VUY A;  2DZK A;  1NEK B;  4JQW C;  2J53 A;  4RGN A;  1L0Y B;  2CU3 A;  3MJW A;  4KZ0 A;  4KGR A;  3AI5 A;  2MJD A;  1QIL A;  1R7S A;  4Q2J A;  2K39 A;  3QC8 B;  2WXF A;  4EZK A;  2GMI C;  1JAL A;  2FBW B;  1LM8 B;  2NCN A;  4JPS A;  3PRP B;  1MHH E;  4HVB A;  4GU2 A;  4L2Y A;  1IUE A;  4KDI C;  4BKS A;  4RCO A;  3EA6 A;  3K9P B;  1SBB B;  2EKE C;  4ZHO A;  2NTT A;  2N9P C;  2L8J A;  4B95 A;  1WXS A;  2AEH A;  1YNT E;  4G3X B;  1YJJ A;  4B6W A;  1KTK A;  5BO4 B;  4ZRI A;  1NEN B;  4REZ A;  3PRM B;  3KUD B;  4PS7 A;  4ZYN A;  4FHJ A;  2V3S A;  2H89 B;  3I5J C;  4AWJ A;  2DLB A;  2FCM A;  2KHW B;  3AEE B;  1XO3 A;  3PT2 B;  2OOB B;  2H88 B;  5H8Y E;  4WJO A;  4OVZ A;  5LXI B;  4MGI E;  2W9N A;  1ESF A;  4DWF A;  4EOY A;  1E0Z A;  4W9H A;  1GNU A;  2ONQ A;  1WRD B;  1FCL A;  1FRD A;  2KJH B;  3MTN B;  2JZ3 B;  4EUT A;  3KLS X;  4PK1 A;  1E8W A;  3DHG C;  3DBL B;  5JXV A;  2KWC A;  3RNA C;  2KVR A;  1KFY B;  1QOB A;  2RPV A;  3HM3 A;  3IBE A;  4IC7 B;  3WAM A;  1JWU D;  3WAN A;  2FCS A;  1QKZ A;  3KWL A;  4M01 A;  3CIR B;  1OEY A;  4NQK E;  2I2Y A;  1Q10 A;  4DHJ D;  3A33 B;  1TT5 B;  2DZJ A;  2KDB A;  1UUP A;  3H9D A;  1KF6 B;  4LNO A;  4NAW B;  4NAW A;  2GLS A;  2DYB A;  2B76 B;  3ZQ4 A;  2FUH B;  2YEP B;  1M4V A;  4HDQ A;  4CYE A;  1L6U A;  2D5G A;  2IY1 B;  4WQO B;  4NJ7 A;  5C23 A;  1WI0 A;  2KAJ A;  1C4P A;  1CZP A;  1QOF A;  2QJL A;  2BB5 A;  2ACZ B;  1YIW A;  2FID A;  3ABV B;  1WXQ A;  4NJ6 A;  4RH6 A;  5D2M B;  4HKQ A;  2BPS A;  3P1M A;  2GBK A;  1T0R C;  1XLP A;  2CHX A;  2QEJ C;  3NZ3 A;  1L0V B;  3AE9 B;  2C5L C;  2BGF A;  4RNA A;  5EE9 A;  4I6P A;  4E3C A;  1I4P A;  2MBO A;  2WLB A;  4DBG A;  3AV8 A;  4XYC A;  2RD0 A;  3VR8 B;  1YMH E;  1WXA A;  2MBE A;  2MP2 A;  2O6V B;  3VTW A;  1P9D U;  4FA6 A;  3ZDT A;  1WF9 A;  2WGS A;  2LHD A;  2LXC A;  1LFD A;  4MAC A;  2LVP A;  1GPX A;  3ML8 A;  2UWQ A;  2LRW A;  3WCQ A;  2WQY B;  1A70 A;  1RLF A;  2NS5 A;  4D2K A;  3SHQ A;  2V0G A;  3NZS A;  5G55 A;  3NHE B;  2ASQ A;  2Y5P A;  2DYM A;  3ALB A;  4LJP B;  1QOA A;  3PGE A;  1E90 A;  3AEB B;  1LGR A;  3ZNI D;  3DPD A;  4W9E A;  2W3S A;  1SE4 A;  3M95 A;  4ICU A;  3SFE B;  1DOX A;  2MQJ A;  1V49 A;  3BYY B;  1TKE A;  2NBW B;  3DVN V;  3GZN B;  1VR9 A;  2N7D A;  1J7C A;  3KYC D;  4P6V F;  1E7U A;  4JE3 B;  1C77 A;  1HEZ E;  2QIL A;  3DBR B;  5G5H A;  1UBQ A;  3DVG X;  2CS4 A;  2LZ6 A;  4MGY E;  2C7N B;  4M8N A;  2CJO A;  3CF6 E;  1V5O A;  3DHH C;  2BS4 B;  1I4G A;  1WSP A;  4DHJ B;  1AW7 A;  2OJR A;  2FIF A;  2L3Z A;  2NPT B;  3MJ5 A;  1WM3 A;  2BTE A;  3PVL A;  5FR3 A;  1PGX A;  4KKI A;  4ASW C;  3AE8 B;  3NY5 A;  2XBB C;  3IAS 1;  1R4M I;  3K9O B;  2BVC A;  2LUE A;  2XEW A;  4K3B A;  3C0R B;  1ZP0 B;  3H7S A;  3UQB A;  1F2R C;  3BIN A;  1UNS A;  2KVZ A;  4ZRP A;  1MG8 A;  2IDY A;  3AE3 B;  4L1B A;  2AWT A;  2RDH A;  2J7Q B;  1J8C A;  1JRP A;  1EO6 A;  1F0Z A;  2LWP A;  4IDI A;  1SJH D;  5AUK A;  1WYG A;  2DZI A;  1FFU A;  3ZRF A;  2BBC A;  4KX6 B;  1VZ8 A;  3UIO B;  2LJ5 A;  5HG2 A;  4HCN B;  1SIF A;  2XNA C;  4ANU A;  4WWM A;  2EMS A;  4J3O D;  2R2Q A;  1WXV A;  1K52 A;  4XX5 A;  1YN4 A;  1ZUD 2;  3QA8 A;  4ANW A;  5LXH A;  2WDV B;  1TS4 A;  4XDC A;  1KM7 A;  3PLV A;  2R61 A;  2WU5 B;  4AQ7 A;  3T3O A;  3RUI B;  5IN7 A;  4WAF A;  3V6C B;  2JU6 X;  1STE A;  1F2R I;  3PV1 A;  3O13 A;  4HJG E;  1JWB D;  2REX A;  1QZE A;  4YSY B;  1D5X C;  2N7J A;  4MT5 A;  1V81 A;  4EKU A;  3J9C A;  1XEE A;  4WJN A;  1T0S C;  3HHM A;  4AOF A;  3C19 A;  2KJR A;  4YWG G;  3S2A A;  3RNF C;  1KLG D;  2M4N A;  5EDS A;  2EMT A;  1OQR A;  3WAL A;  3SFD B;  1WE6 A;  1IGC A;  3WAP A;  2NTS A;  2G4S A;  1WXM A;  1I42 A;  1BML C;  2BW2 A;  4UDU C;  1TBE A;  1L2N A;  2IY0 B;  2IZV B;  1EWY C;  2DYO A;  2N4F A;  2OHF A;  5EE1 A;  5JHB A;  2JWZ A;  4HCP B;  1IGD A;  4EZJ A;  2AL6 A;  1RFK A;  2M0X A;  4NJC A;  1UGJ A;  2VH1 A;  3PZD A;  3U8Z A;  4M0W A;  4K81 A;  1PQS A;  5G2N A;  1ZDX A;  2IO3 B;  1V2Y A;  3SR6 A;  3OJ4 B;  5C2T B;  3ETR A;  1GC6 A;  1ROE A;  3VHT C;  1FFV A;  2KXJ A;  2RDG A;  2KJ6 A;  5FKA C;  1D3Z A;  1P1A A;  5HHD G;  4LNK A;  5BYQ A;  2M17 A;  3A4R A;  1WMH B;  4W9L A;  3B0A A;  1T5X D;  1FMA D;  2I1K A;  3ZYY X;  2Z8L A;  1C76 A;  2KFJ A;  1YN5 A;  4OZA A;  2L05 A;  4J6I A;  1VZ6 A;  2JXT A;  3AMZ A;  1GOZ A;  5BMI A;  1XD3 B;  3VAW A;  3TUO A;  3Q2A C;  1HZ6 A;  5IO9 A;  3N1X C;  5DPW A;  4AP4 C;  4KGS A;  2K22 A;  3E9S A;  4KV2 A;  2JX5 A;  5AZF A;  2JRH A;  1YN3 A;  3LYY A;  2QIE B;  1CJE A;  3AM9 A;  3EUB 2;  4KGT A;  4OW0 A;  3UI3 A;  3RT3 B;  4MJS A;  2ZW1 A;  1AWD A;  4LJO B;  4MJS B;  2GRI A;  4MEL A;  3AH7 A;  2DZM A;  2WNM A;  2HE7 A;  2K8B A;  3GE8 C;  3A9K A;  2LD9 A;  1TJE A;  3RFZ B;  4KSK C;  2D07 B;  2PIA A;  1D6E C;  1S3S G;  4TSS A;  2G3Q B;  3NZU A;  3DDC B;  3FIL A;  4JIO U;  3BWU D;  3L08 A;  3QWZ B;  2KKC A;  4TMA B;  2PW9 A;  4A20 A;  1I4Q A;  5LNK 1;  2KN5 A;  3PZ8 A;  4HJK A;  1XCT L;  2W54 A;  4K1R B;  2N0S B;  3PPA A;  5E6J A;  4KZC A;  2W3R A;  2INC C;  3TL5 A;  4WWN A;  2WXI A;  1KJT A;  2BWF A;  3GS2 A;  5BYS A;  1EU3 A;  4EFO A;  4C00 A;  2J52 A;  2MCN B;  3W9C B;  4C56 C;  4ZRQ A;  1RAX A;  4URK A;  3O65 B;  3T3N A;  1WFY A;  3NS8 A;  1JRU A;  1K53 A;  5J17 A;  3CWI A;  2V3N A;  3APD A;  3BY4 B;  4A55 A;  3UIN B;  3U52 E;  4GDL B;  1FM0 D;  3APF A;  3A1Q A;  2SEB D;  1NI2 A;  2CHW A;  1SF0 A;  2PVG C;  1QLB B;  2KWD A;  3GB1 A;  2ZEQ A;  1MVK A;  2LFI A;  2CU1 A;  1D4B A;  2V3P A;  4IM2 A;  3RNE C;  2YLM A;  3RCZ A;  2XK5 B;  4A6Q A;  4S17 A;  1FNU A;  3FC4 A;  4WWP A;  4ZRJ A;  2M56 B;  4F1S A;  1OQQ A;  3W2D A;  3H8H A;  4K7S A;  2D3B A;  4ZDV A;  4HPP A;  4FJV B;  2G4D B;  2EKI A;  3JYU A;  3MFG A;  3TMP B;  1BT0 A;  3L54 A;  3B9J A;  4IOI E;  1FO4 A;  2QCZ A;  1OFF A;  4N6E B;  2MBQ A;  2K25 A;  1HZ5 A;  2ZVO A;  3ZDM C;  1SEB D;  2WXO A;  1WJU A;  3TSS A;  2MH7 A;  3GP7 A;  2E6X A;  2MEK A;  2X8X X;  2ZNV B;  3JVZ X;  3U4E G;  2WYQ A;  1ISN A;  1JML A;  2NR2 A;  3X0W A;  2HJ1 A;  1SE2 A;  1WR6 E;  1AN8 A;  3AUL A;  4LNN A;  2PTL A;  3DCG A;  3QHT A;  1SIJ A;  2KDM A;  4WWO A;  3ZXR A;  1NYR A;  4WJQ A;  1JWS D;  3VH3 B;  3BVZ A;  3SDL C;  2IYD B;  3OWE B;  3BVG A;  4MGZ E;  1WZ3 A;  1TYG B;  3NVW A;  3D32 A;  3TCA A;  2JZP A;  2ZVN A;  2HTH A;  1FEH A;  4W9G A;  3IT4 B;  1MG4 A;  2FNJ B;  4W9C A;  1C1Y B;  4M0W B;  5C1Z A;  1C9F A;  3AN1 A;  4HPM B;  2ZZP B;  4DHZ E;  2C60 A;  1YOV B;  2MBB B;  3KH0 A;  5CHW A;  4P1B C;  3TBL D;  1EF1 A;  1WR1 A;  2WWZ A;  1I4X A;  2ZPN A;  3LJ3 A;  5E6N A;  3TEZ A;  2GBM A;  3Q8B A;  2L00 B;  2RGF A;  2QMT A;  1FXI A;  3Q3O C;  2QSD A;  3MC9 A;  1SE9 A;  4USA A;  3ZRC A;  1WZ0 A;  2W55 A;  4HPL B;  4DHZ B;  3VRB B;  4IUM B;  1JQ4 A;  2INP E;  3AEF B;  2ICI A;  2FE8 A;  3DBH B;  3AB5 A;  2DHZ A;  3ZJU A;  2VRR B;  4H2A A;  3C8Y A;  2EEL A;  1L4Z B;  1T6B X;  2KTF A;  3H7P B;  5FR6 A;  2AQ3 B;  2DX5 B;  3T9L A;  4FJY A;  3IFW B;  1RFA A;  1EU4 A;  2Z0E B;  1I4R A;  2JPH A;  1UZX B;  3PS6 A;  2ZCC A;  1DOI A;  1FNW A;  1OQY A;  1UBI A;  1RWS A;  3RNC C;  4US8 A;  4OZB A;  1GAQ B;  3U7Z A;  2WHI A;  4BVU C;  3KWV A;  4BBN F;  3Q3N C;  1Q1O A;  2GI9 A;  2PMV A;  1JCK B;  3ZJV A;  3L0W B;  1S1Q B;  2I38 A;  2YVC A;  3AE1 B;  2KOX A;  2JSV X;  3NS1 A;  4ZYS A;  3RZW C;  4HWI B;  5E6O A;  2ZNV C;  4MGK E;  2LGY A;  3W1S A;  3NUH B;  2WXQ A;  3R66 C;  1QOG A;  2O2V A;  4XC2 A;  1SXT A;  2KWU B;  2XN9 C;  2JT4 B;  3EEC A;  4YL8 A;  1TKG A;  5D3D A;  1ENF A;  2KDI A;  5DPR A;  4ICV A;  3X23 A;  4FAD A;  3BVM A;  1P98 A;  1N5W A;  1CMX B;  2IGH A;  1NI3 A;  2WXJ A;  5IP4 D;  1RM6 C;  3NG0 A;  3GOE A;  3RN9 C;  1GJZ A;  4I6L B;  1MJD A;  3PRZ A;  4YTN B;  3MC8 A;  1E8Y A;  3ECI A;  2UU7 A;  1MHX A;  4US9 A;  4JLC A;  5JHA A;  2LJI A;  4EZL A;  2BB6 A;  1TKY A;  3PHX B;  4N9F 4;  2KMM A;  4PYZ A;  1ZXH A;  4L23 A;  3ZUN A;  2WP9 B;  1ZXI A;  3V60 A;  1ET6 A;  1GB4 A;  3DWG C;  2BS3 B;  4GOC A;  2O6V D;  2KC1 A;  2N9X A;  1AYF A;  1C3T A;  3N3K B;  3NJT A;  2BS2 B;  3WA0 A;  3H7P A;  1JWM D;  4BAX A;  1J7A A;  2K9X A;  4HRS A;  1VRA B;  4G11 A;  2LEK A;  2DNF A;  1WJ4 A;  2KO3 A;  2N9L A;  3QAQ A;  4K7W A;  3NOB A;  2KD0 A;  5BYR A;  2PJH A;  4LLG M;  3HVD A;  3QX1 A;  1XQQ A;  2G45 B;  1BXT A;  3M63 B;  1IBX B;  3KUC B;  3I3T B;  3T8M A;  1V5T A;  4HRO A;  2JZZ A;  2M19 A;  4PYU A;  5KHQ A;  1UGM A;  2CJN A;  3ONS A;  1K51 A;  3VQI A;  4G50 A;  2NPT A;  1U4A A;  3M62 B;  4WAA A;  3NRZ A;  1A5R A;  1V8C A;  2KQ7 A;  4W9K A;  2WXK A;  4WH4 A;  4GXB A;  2MP2 B;  2AQ1 B;  3MP9 A;  2ZPY A;  1X1M A;  3QQ8 B;  1V86 A;  3AE7 B;  2JYT A;  2KDE B;  2LUM A; 
#chains in the Genus database with same CATH homology
 2K8B A;  3PRM B;  2NBV B;  3KUD B;  1WGH A;  4PS7 A;  2MWS B;  3A9K A;  3CST A;  1SGH A;  1V6E A;  2LD9 A;  1WGY A;  4ZYN A;  2WDT B;  4KSK C;  2D07 B;  2C7M B;  4FHJ A;  2V3S A;  1S3S G;  2GBN A;  2G3Q B;  3NZU A;  3DDC B;  4AWJ A;  2KAN A;  4JIO U;  2FCM A;  2N7E A;  2KHW B;  2FCN A;  3L08 A;  3QWZ B;  4OVU A;  3VTV A;  3IVF A;  3ZLZ A;  2K6Q A;  2KFK A;  4BKG A;  2KKC A;  3PT2 B;  2OOB B;  2KMA A;  2LVO A;  3N30 A;  4WJO A;  4A20 A;  1OEY J;  5LXI B;  2C9W B;  4MGI E;  1YX5 B;  1WMH A;  5JZE B;  2W9N A;  3VVW B;  4GN1 A;  4DWF A;  2KN5 A;  4EEW A;  3PRE A;  4EOY A;  2JRI B;  4W9H A;  4HJK A;  5KHO A;  4K1R B;  1GNU A;  3PPA A;  2V1Y A;  4KZC A;  1WRD B;  3TL5 A;  2KJH B;  3MTN B;  2JZ3 B;  4LDT D;  1ZW7 A;  4FHK A;  4WWN A;  2K8C A;  2LI5 A;  4HDO A;  1KJT A;  4E71 A;  4EUT A;  3SU8 X;  2BWF A;  4EFO A;  4P7I A;  1E8W A;  2KQS A;  3HIZ A;  4KVG B;  2CHZ A;  2KWC A;  1WJ6 A;  3KUZ A;  2KVR A;  2MCN B;  3B1L X;  1RAX A;  4II2 B;  4URK A;  3H1U A;  3O65 B;  1WFY A;  3NS8 A;  4B9K A;  1JRU A;  3HM3 A;  1V9J A;  3IBE A;  4IC7 B;  4IW0 A;  3WAM A;  5J17 A;  5L95 C;  1WX7 A;  3WAN A;  3APD A;  3BY4 B;  2FCS A;  1IPG A;  3UIN B;  1OEY A;  1WH3 A;  4NQK E;  4GDL B;  4MSQ B;  1KLV A;  3APF A;  4M8M A;  2QHO A;  4AUQ C;  4DHJ D;  1M94 A;  3A33 B;  3A1Q A;  2KLG A;  2A5U A;  2MA9 B;  3RUL A;  2DZJ A;  2KDB A;  1NI2 A;  3H9D A;  4IG7 B;  3OLM D;  2CHW A;  4NAW B;  5AZG A;  4NAW A;  4KIK B;  4BKS D;  2ZEQ A;  4GDK A;  2CU1 A;  2PEA A;  2DYB A;  2WX0 A;  4IM2 A;  2FUH B;  3V6E B;  4MEM A;  4BBN C;  2YLM A;  2GBJ A;  3RCZ A;  3VDZ A;  1Q5W B;  2XK5 B;  4BOS C;  2LVQ A;  3ZTD A;  3ZKJ C;  4CYE A;  4HDQ A;  5AZH A;  3LDZ E;  4CO7 A;  4WWP A;  2L0T A;  2IY1 B;  4ZRJ A;  5E6P A;  2GOW A;  1WJN A;  2AL3 A;  4WQO B;  2L0F A;  4HK2 A;  3AXC A;  2KX0 A;  4F1S A;  3PLU A;  4II3 B;  4NJ7 A;  3RZF A;  1GC7 A;  5C23 A;  3ENE A;  1WI0 A;  4LCD E;  2IO1 B;  2KX3 A;  3GZN I;  4K7S A;  4MDK E;  3TIX A;  4ZDV A;  2AYO B;  1WGG A;  4FJV B;  1ZKH A;  1GUA B;  3R3M A;  2G4D B;  3JYU A;  1H8C A;  1EUV B;  3DBH I;  4GGQ A;  4TQ0 A;  3TMP B;  4RM8 A;  1BT0 A;  1EF5 A;  3L54 A;  3ZIM A;  1YIW A;  5LLI A;  5GMV A;  2FID A;  1AAR A;  4IWO A;  4G0N B;  4NJ6 A;  1G6J A;  5D2M B;  2BPS A;  2MBQ A;  4W9I A;  1KOT A;  2D10 A;  2GBK A;  2K25 A;  2ZVO A;  3ZDM C;  2CHX A;  1UD7 A;  5DPS A;  3V61 A;  4DXA B;  1WJU A;  5D94 A;  2C5L C;  2BGF A;  4MM3 A;  2ZNV B;  4I6P A;  3JVZ X;  5J2R A;  4E3C A;  3IHP C;  2KMC A;  1YJ1 A;  1ISN A;  2MBO A;  2WYQ A;  2WX1 A;  2NR2 A;  4TV3 A;  3JSV A;  4W9D A;  3L13 A;  3X0W A;  4DBG A;  2MSE D;  1WR6 E;  2O2V B;  2RD0 A;  3KVF B;  3RYT A;  1WXA A;  4IM0 A;  2MBE A;  3AUL A;  4FLH A;  2J0M A;  2MP2 A;  3L17 A;  1VCB A;  2O6V B;  3UQA A;  3AU4 A;  3DCG A;  2NVU I;  3VTW A;  3QHT A;  1P9D U;  4FA6 A;  3ZDT A;  1WF9 A;  5TR5 A;  4WWO A;  2LXC A;  1LFD A;  4IM3 A;  2D3G A;  2J0J A;  2LVP A;  3ZNG C;  1HE8 A;  2Y5B B;  4ANX A;  4WJQ A;  3ML8 A;  2UWQ A;  2LRW A;  1J0G A;  4CHK A;  1R4N I;  3VH3 B;  1P0R A;  4DDG D;  1RLF A;  2NS5 A;  3SHQ A;  4F8C B;  3NZS A;  1WYW B;  3NHE B;  5G55 A;  2ASQ A;  4TKN A;  3SDL C;  2IYD B;  2DYM A;  2HD5 B;  3ALB A;  3IG3 A;  5JH5 C;  3B08 A;  4LJP B;  4FJZ A;  4BKT A;  4ZRK A;  3PGE A;  4MGZ E;  1E90 A;  2K1F A;  1WZ3 A;  4PS8 A;  3AU5 A;  3CSF A;  3H6N A;  3VUW A;  3ZNI D;  2C7H A;  3DPD A;  3D32 A;  2BKR B;  4W9E A;  4A3P A;  3TCA A;  2CKH B;  2ZVN A;  3M95 A;  2HTH A;  3DVG Y;  4ICU A;  2MQJ A;  1P3Q U;  4W9G A;  4TQ1 A;  2BKF A;  1V49 A;  2FNJ B;  4W9C A;  3ZNH B;  3ZNZ B;  1C1Y B;  4M0W B;  2NBW B;  2K8H A;  3DVN V;  2HJ8 A;  3L10 B;  4KIK A;  5C1Z A;  1Q0W B;  2N7D A;  3EFU A;  5DCN A;  3KYC D;  2J0K A;  2ZZP B;  4HPM B;  4DHZ E;  2UYZ B;  2KC2 A;  1E7U A;  2C60 A;  2JUO A;  2MBB B;  3KH0 A;  5CHW A;  1Z2M A;  2FAZ A;  3HM6 X;  1UBQ A;  3DVG X;  3N32 A;  2CS4 A;  2LZ6 A;  2L7R A;  4MGY E;  2C7N B;  1EF1 A;  3L16 A;  3TBL D;  1WX8 A;  3APC A;  1WR1 A;  4M8N A;  2WWZ A;  4MH0 E;  2ZPN A;  3LJ3 A;  5CHF A;  5E6N A;  2GBM A;  3CF6 E;  1V5O A;  2L00 B;  3DOW A;  2RGF A;  4DHJ B;  2OJR A;  2FIF A;  2L76 A;  2L3Z A;  1IYF A;  2BYF A;  2NPT B;  1SE9 A;  3KW5 B;  1WM3 A;  1FXT B;  3M3J A;  3ZRC A;  2BYV E;  1WZ0 A;  3PSE B;  3PVL A;  1E8X A;  4HPL B;  2KNB A;  1WM2 A;  1TTN A;  1Y8R C;  2V4L A;  4IWQ A;  4BFR A;  4DHZ B;  1LQB A;  2MLB A;  3QCA A;  5HKH A;  3ZO5 B;  4IUM B;  4ASW C;  2ZJD A;  3NY5 A;  1J19 A;  1XT9 B;  2XBB C;  1R4M I;  2KDF B;  3K9O B;  2MBH A;  5J18 A;  2D2Q A;  3U30 A;  1WIA A;  2LUE A;  2XEW A;  3EHV A;  3V62 A;  4NY0 A;  2DAF A;  3WIM A;  2DHZ A;  3C0R B;  3H7S A;  2VRR B;  3UQB A;  3BIN A;  4RM9 A;  4GSW A;  3UGB B;  1IP9 A;  2LAS A;  2KTF A;  2KTR B;  3H7P B;  1OTR B;  5FR6 A;  1MG8 A;  3TJP A;  3SD5 A;  4XZ4 A;  2DX5 B;  2AWT A;  3T9L A;  2LGX A;  4W9J A;  4JGH B;  2J7Q B;  1J8C A;  1EO6 A;  3IFW B;  4FJY A;  1RFA A;  2IO2 B;  2LWP A;  4MSM B;  4RMA A;  2Z0E B;  2LGD A;  2JPH A;  1OGW A;  2KFK B;  4PS3 A;  3W1S C;  1UZX B;  2I1J A;  2DZI A;  3PS6 A;  4NPN A;  2ZCC A;  3P2B A;  1OQY A;  5IA7 A;  3ZW3 A;  1UBI A;  1ZGU B;  2IBI B;  3ZRF A;  4GDL A;  2MW5 A;  3OAW A;  3U7D A;  4BVU C;  4BBN F;  2M8S A;  3UIO B;  2LJ5 A;  4HCN B;  3ZTC A;  1SIF A;  1TZ1 A;  1Q1O A;  3MHS D;  4ANU A;  2EMS A;  2N1V A;  3ML9 A;  2R2Q A;  1WXV A;  1E5W A;  3Q3J A;  4WJP A;  4XX5 A;  3L0W B;  2PPH A;  1S1Q B;  4KSL C;  3KYD D;  2YVC A;  2KOX A;  3QA8 A;  4ANW A;  5LXH A;  2BWE S;  5CHV C;  1GG3 A;  1KM7 A;  3RZW C;  4HWI B;  5E6O A;  3PLV A;  2ZNV C;  1YD8 U;  4MGK E;  4AJW A;  2LGY A;  3WAO A;  4E74 A;  3W1S A;  4DDI D;  5D7G A;  1RRB A;  1WY8 A;  3QK0 A;  5L83 A;  3JW0 X;  3DVN U;  3R66 C;  2DAJ A;  4K7U A;  2N9E B;  3RUI B;  2PE9 A;  3V6C B;  2O2V A;  4XC2 A;  5CTR C;  2KWU B;  3HK0 A;  3DBL I;  2ZCB A;  4HLE A;  1TGZ B;  2MX2 A;  2O6V A;  3QIJ A;  3PV1 A;  2JT4 B;  3EEC A;  4YL8 A;  2REX A;  1QZE A;  2KDI A;  3VUX A;  1V81 A;  2FCQ A;  2KZR A;  5DPR A;  4EKU A;  3Q3F A;  4ICV A;  4WJN A;  5D6J B;  3X23 A;  4FAD A;  2PE6 B;  1WE7 A;  1P98 A;  3HHM A;  1CMX B;  1H4R A;  4AOF A;  1V80 A;  1YQB A;  2N1W A;  2KJR A;  3S2A A;  1L7Y A;  2M4N A;  2RR9 A;  3GOE A;  5EDS A;  2EMT A;  4I6N B;  4AJY B;  5AEK B;  2GBR A;  1GJZ A;  3WAL A;  1WE6 A;  4I6L B;  3PHW B;  3PRZ A;  2LXA A;  2NBU A;  1WGD A;  2RSU A;  3WAP A;  1WX9 A;  4DK5 A;  2G4S A;  1E8Y A;  3ECI A;  4OVV A;  1Z5S B;  1WXM A;  4LDT B;  1I42 A;  2Z0D B;  4JLC A;  3VH4 B;  2BYE A;  2IO0 B;  3QAR A;  5JHA A;  4ANV A;  1TBE A;  1L2N A;  2IY0 B;  2IZV B;  2JXX A;  4NQL B;  5CX3 A;  2DYO A;  3UF8 A;  4EZL A;  4NNJ B;  2N4F A;  1WGR A;  3PHX B;  5JHB A;  1UH6 A;  2JWZ A;  1E8Z A;  4HCP B;  4N9F 4;  4PYZ A;  4EZJ A;  4KDL B;  2AL6 A;  5DPT A;  2MRP A;  3ZUN A;  2M0X A;  4GB9 A;  3UIP B;  4JL9 A;  4FBJ B;  3V60 A;  3PZD A;  3U8Z A;  3VTU A;  4K81 A;  3R7Q A;  1PQS A;  4FUL A;  2O6V D;  3A1Q B;  4GOC A;  4IWP A;  3DBR I;  5G2N A;  2IO3 B;  2R2O A;  1V2Y A;  2BF8 B;  2KC1 A;  4A3O A;  2N9X A;  4TUU A;  3OJ4 B;  1C3T A;  3N3K B;  1K8R B;  4GMV A;  2JF5 A;  2B3A A;  3R7R A;  5IAA C;  3WA0 A;  3H7P A;  1GC6 A;  2KLC A;  2JY6 A;  1F9J A;  3VHT C;  2KK8 A;  2KXJ A;  3JSV B;  3ZVV A;  2KJ6 A;  4HXD A;  4BOZ B;  3CMM B;  1D3Z A;  2D11 A;  3A9J B;  1UEL A;  2LRU A;  1P1A A;  1T0Y A;  2DZK A;  4G11 A;  3VUY A;  3QJZ A;  2CR5 A;  1WJ4 A;  2KO3 A;  3DQV A;  2M17 A;  3A4R A;  4JQW C;  1WMH B;  3QAQ A;  4K7W A;  4W9L A;  3NOB A;  2KD0 A;  3B0A A;  2PJH A;  3MJW A;  3W1Y A;  4KZ0 A;  3EC8 A;  1VD2 A;  4W9F A;  2I1K A;  3AI5 A;  3QX1 A;  2KWV B;  1XQQ A;  2KFJ A;  2G45 B;  2L05 A;  3M63 B;  3KUC B;  3I3T B;  3PTF C;  3VFK A;  2K39 A;  3RD2 A;  3QC8 B;  4J6I A;  3T8M A;  1V5T A;  4EZK A;  2JZZ A;  3OJ3 A;  4PYU A;  2A4Z A;  3A9K B;  5KHQ A;  1UGM A;  2GMI C;  4GIV A;  1LM8 B;  1XD3 B;  2M1M A;  3ONS A;  3VAW A;  2NCN A;  3VQI A;  4G50 A;  2DEN B;  4GDK B;  2KTR A;  3PRP B;  4HVB A;  4GU2 A;  2NPT A;  5DPW A;  4X57 B;  4AP4 C;  1U4A A;  4KDI C;  3M62 B;  3DBS A;  4WAA A;  2RPQ A;  4KV2 A;  4BKS A;  1A5R A;  5AZF A;  2JRH A;  3K9P B;  2Z59 B;  3VXW A;  4FN2 A;  2EKE C;  2KQ7 A;  1YX6 B;  4W9K A;  1LXD A;  2N9P C;  2L8J A;  4GXB A;  4B95 A;  1WXS A;  2MP2 B;  2AEH A;  2K6D B;  3RT3 B;  2ZPY A;  3A4S C;  4G3X B;  4MJS A;  1NBF C;  4LJO B;  4B6W A;  1X1M A;  4MJS B;  3A9J A;  5BO4 B;  4MEL A;  3QQ8 B;  1E7V A;  1V86 A;  1NDD A;  4ZRI A;  1I35 A;  4F7Z A;  2KDE B;  2DZM A;  2HE7 A;  2JVC A;  2XK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...