1WGYA

Ra domain of guanine nucleotide exchange factor for rap1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
GSSGSSGEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAEEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 5
publication title RA domain of guanine nucleotide exchange factor for Rap1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgyA01
2KMCA 2K1FA 1VD2A 4AWJA 1ZKHA 1UELA 3PRZA 3TMPB 2CHZA 2CKHB 1WGRA 4M8NA 3IBEA 3H6NA 2N1VA 3EFUA 3ZDTA 3PGEA 4F7ZA 2Y5BB 2K8HA 4K7WA 2AYOB 2C7HA 2GBNA 1TZ1A 2KDBA 3QWZB 3Q3FA 4W9DA 5DPSA 5TR5A 4II3B 4DHZE 1UD7A 5AZHA 5C1ZA 3VUWA 2NBWB 2LD9A 1KJTA 2NR2A 2KQ7A 3RYTA 2DHZA 2IYDB 3UQBA 4BBNF 5CX3A 3JSVA 3A9JB 3WALA 4EKUA 4BKSA 4W9HA 3UINB 3LJ3A 3DVGY 1MG8A 4I6NB 4K1RB 1JRUA 1V2YA 1XD3B 1ZW7A 2DZMA 4NY0A 2YLMA 4E71A 3AU4A 3DBSA 3PVLA 4ANWA 4BFRA 3UIPB 4GN1A 2RSUA 4IWPA 5J17A 4KSKC 3SD5A 1WYWB 4MDKE 2DENB 2J0JA 1YD8U 4MGYE 2MCNB 3QC8B 1YJ1A 4ICVA 4PYUA 2G3QB 4WQOB 3R7QA 2J0MA 3ZRFA 1ZGUB 2JRIB 3NS8A 4G11A 3EC8A 1L2NA 2C60A 4LCDE 4ZRKA 2ZPNA 3Q3JA 2ZNVC 3IHPC 1R4MI 4W9LA 2D11A 3A1QB 1NBFC 2LJ5A 3X0WA 4URKA 4A3PA 2KK8A 2YVCA 2GMIC 3DVNU 1E5WA 1R4NI 2FCSA 2KN5A 2WX1A 2MWSB 5LXHA 1WRDB 4ZYNA 4DBGA 3L10B 2JF5A 3QHTA 2GBJA 4GDLA 3QCAA 3N30A 4G0NB 2EMTA 3M62B 2XK5A 2BYVE 2LVQA 4RM9A 1XQQA 3VTUA 2PEAA 4W9GA 2KOXA 3MTNB 2JT4B 1Z5SB 2W9NA 3CSFA 1E8XA 1P1AA 4NPNA 2EMSA 1OEYJ 4KDLB 1LFDA 3KYCD 4A3OA 4BOSC 1OQYA 3IVFA 1U4AA 3OLMD 2KO3A 3BINA 3L13A 2UWQA 3U8ZA 4BVUC 2V3SA 1X1MA 4ZDVA 1TBEA 2KNBA 1WMHA 2L05A 4IC7B 2L00B 3H9DA 4NNJB 3VHTC 3OJ3A 1SGHA 4MGKE 2WWZA 2DZKA 2WDTB 3WANA 2LZ6A 2MA9B 3A9KB 1LXDA 3B1LX 3SHQA 1WGDA 4HK2A 1CMXB 5CHVC 1WMHB 3DQVA 4FJYA 2NS5A 2QHOA 3VTWA 3D32A 2A5UA 2LUEA 4BKSD 4DHJD 1GC6A 2RPQA 1WGGA 3CF6E 3PSEB 2M0XA 3U7DA 4DDGD 1WR6E 2CHWA 5D94A 2BWES 3DVNV 4GSWA 3X23A 3WAPA 2G45B 2JVCA 4GB9A 5G55A 5KHOA 4FADA 3AXCA 2RR9A 2Z59B 2Z0DB 2IY1B 3ECIA 4KIKB 4IWOA 3A4SC 3U30A 1KOTA 3O65B 3C0RB 3EECA 3KW5B 4EEWA 4X57B 4LDTD 3L16A 5D2MB 2G4DB 3TBLD 2R2QA 1EF1A 1OGWA 2C7MB 3N32A 2MBQA 4ICUA 2FNJB 5CHFA 3WIMA 2ZNVB 4G3XB 3ML8A 3ZNGC 3DBLI 3KUDB 3CMMB 4FJZA 4MJSA 3VUXA 2KLGA 3ALBA 4GU2A 1LQBA 3L08A 2O6VA 4F8CB 3N3KB 2G4SA 2KJ6A 2REXA 4FHKA 2JRHA 3NOBA 3QA8A 2A4ZA 2K25A 2NPTB 4ANXA 4MJSB 5J18A 2ZEQA 5D7GA 3RUIB 3EHVA 4DWFA 2BPSA 3L0WB 3ML9A 4GDKA 1V5TA 2AL6A 4P7IA 2PJHA 3PS6A 5KHQA 4HWIB 2CU1A 2ZPYA 1OEYA 2MBEA 1WR1A 2ASQA 4JIOU 1T0YA 1WE7A 2IBIB 1V49A 4DXAB 1I35A 1GUAB 5DPRA 4WJNA 4HCNB 4XZ4A 1GJZA 1P3QU 1RLFA 5JHAA 2LVOA 3BY4B 4IM3A 2KWVB 5EDSA 2KD0A 2NBUA 2KX3A 3QK0A 3ZUNA 2ZJDA 4AUQC 4EFOA 3APDA 2IZVB 1WX7A 4GIVA 3W1YA 4AJYB 3SU8X 3JSVB 3PZDA 4KSLC 5DPTA 2KDFB 3UGBB 4DHJB 3ZLZA 1AARA 3ZIMA 2GBMA 3V60A 2DYOA 4TKNA 3ZNID 3GOEA 2KJHB 5AEKB 3VH4B 3KYDD 4KZ0A 1WIAA 4IM0A 2FIDA 2LGXA 2LVPA 3ZNZB 3ZO5B 1V9JA 1UZXB 3PV1A 3I3TB 1H4RA 4HCPB 4RM8A 3B0AA 4LDTB 2IY0B 2KHWB 4MELA 2L76A 4JGHB 1WX9A 3APFA 4ASWC 2LXAA 2RGFA 4KV2A 2XBBC 3OJ4B 2C7NB 5DCNA 2M4NA 3KUCB 4AOFA 2LI5A 3L17A 4PS7A 3W1SA 1Q5WB 4ANVA 4E3CA 4WAAA 1NI2A 4B6WA 1WXSA 3KVFB 3DPDA 2GBKA 3H7PA 4MGZE 3PRPB 4M0WB 1S3SG 2ZCBA 1YQBA 3AU5A 2JY6A 2K6DB 1QZEA 2MLBA 2V1YA 2V4LA 5C23A 3UQAA 2BKRB 4WWOA 3GZNI 2D2QA 2B3AA 2NCNA 1K8RB 3QARA 4WWPA 4IUMB 4KVGB 4MEMA 5JH5C 2O6VD 4GDLB 4JQWC 1WH3A 4DDID 2BKFA 3TJPA 4IM2A 2XK5B 2LASA 4W9CA 4OVVA 2MSED 1WGHA 1P0RA 3UIOB 2MP2A 1WM3A 2KZRA 3VUYA 4CYEA 1UBIA 2KMAA 4HLEA 3HIZA 2C5LC 4IWQA 2KDEB 1C1YB 3A4RA 4IG7B 3AULA 2L0TA 4EZJA 4F1SA 5L95C 1M94A 4K81A 2IO2B 4HDQA 5HKHA 1WI0A 3DDCB 2KDIA 4EZLA 4WJQA 3VFKA 2LRWA 4I6LB 3HHMA 2NVUI 1SE9A 4NQLB 1I42A 2UYZB 1Z2MA 3QX1A 1ISNA 2KC2A 3NY5A 1Y8RC 1E90A 3ZVVA 4ZRIA 2ZCCA 4FN2A 4FLHA 4JLCA 3PHWB 3WAMA 4HXDA 2K6QA 1WJ4A 4BKGA 2DYMA 3RULA 2L8JA 3PTFC 1WJUA 1H8CA 2FCMA 3IFWB 1IP9A 2VRRB 2KFKA 3TCAA 3VDZA 5DPWA 1WXVA 3ZTDA 3M3JA 2K8BA 1A5RA 2PE9A 3JW0X 2MBBB 1SIFA 1S1QB 2M1MA 3DBRI 4W9FA 1HE8A 1FXTB 3V61A 2JWZA 4W9IA 3RZWC 2L0FA 3A33B 1EUVB 1NDDA 2BYFA 3ZNHB 2DYBA 3W1SC 4YL8A 2OJRA 2RD0A 3KH0A 4M8MA 4MSQB 4MGIE 4EZKA 1G6JA 2KWCA 2FCQA 1IYFA 2I1JA 4B9KA 4HPLB 3V62A 1XT9B 4NAWA 1E7VA 5G2NA 1WY8A 2D10A 4J6IA 1V86A 5IA7A 1WZ0A 4XX5A 2PPHA 2KKCA 2O6VB 2DZJA 3ZKJC 2KTFA 3S2AA 2N4FA 2LGYA 3CSTA 2L3ZA 4NAWB 4WJPA 2BGFA 1WX8A 1J8CA 2BYEA 2LXCA 1WFYA 1YX6B 3HK0A 2L7RA 4HVBA 1RAXA 3M95A 5LLIA 4GOCA 2K39A 2WX0A 2BF8B 3LDZE 1IPGA 1V5OA 2N7DA 4KDIC 2CHXA 2JZZA 2M8SA 4GDKB 4PS8A 4A20A 2FAZA 4EOYA 1V81A 3V6EB 2MRPA 3A9JA 1RFAA 4TQ1A 3NZSA 4PYZA 5L83A 4FJVB 4MH0E 2AEHA 3H1UA 5JHBA 3DOWA 4I6PA 3ZW3A 2Z0EB 3TIXA 1WXMA 2DAFA 3ZTCA 4NJ6A 2EKEC 2O2VA 3RD2A 2MW5A 1UH6A 4GXBA 2JPHA 2I1KA 2ZVOA 3WAOA 2HE7A 3HM6X 4ANUA 2KLCA 5GMVA 2KX0A 1YIWA 2N1WA 2ZVNA 2CS4A 3VH3B 4FA6A 2KXJA 2O2VB 4N9F4 4XC2A 4FULA 2CR5A 3WA0A 3ZRCA 3JYUA 1Q1OA 2K8CA 2N9EB 4OVUA 2DAJA 4CHKA 4TV3A 2HD5B 2JUOA 3A1QA 2D07B 2HJ8A 1OTRB 2KC1A 2HTHA 1EO6A 1E8YA 3R66C 2IO1B 1J19A 2IO0B 1D3ZA 1WZ3A 4KZCA 3PLVA 4GGQA 1C3TA 2NBVB 1WJNA 5CTRC 3QIJA 2FCNA 3AI5A 2J7QB 3DBHI 1GG3A 5BO4B 4FHJA 3NZUA 1TTNA 3H7PB 1L7YA 4TQ0A 4W9JA 3VAWA 3TL5A 2GBRA 5E6PA 2XEWA 2PE6B 2KANA 2BWFA 4BKTA 4BOZB 2LWPA 3PHXB 2LRUA 3VQIA 5JZEB 3ENEA 3VVWB 3K9PB 4HJKA 3MJWA 3R7RA 1F9JA 4MM3A 1GNUA 1E8WA 3DCGA 1UGMA 2KWUB 1WXAA 3MHSD 3T8MA 4PS3A 1GC7A 4LJOB 2MP2B 2FUHB 2M17A 1VCBA 4B95A 2OOBB 2R2OA 3HM3A 4DK5A 2JXXA 3JVZX 2KTRA 3L54A 1E8ZA 3DVGX 3R3MA 3VXWA 3ZDMC 4AP4C 1KLVA 3A9KA 1BT0A 1P9DU 2JZ3B 4II2B 2C9WB 5D6JB 1WE6A 3RZFA 1Q0WB 2MX2A 2N9PC 2AL3A 5AZFA 2FIFA 3T9LA 1E7UA 1WJ6A 4LJPB 3APCA 5J2RA 4ZRJA 2MQJA 3VTVA 3B08A 3NHEB 2KTRB 1P98A 3UF8A 2KQSA 2MBHA 5E6NA 2DZIA 2KFJA 3RCZA 2N9XA 2ZZPB 4K7SA 3SDLC 4BBNC 4K7UA 2WYQA 1RRBA 4NJ7A 4DHZB 5E6OA 4FBJB 3QQ8B 1LM8B 4KIKA 4EUTA 4E74A 2IO3B 5AZGA 4IW0A 3M63B 4WWNA 3RT3B 1WF9A 3PRMB 2KFKB 1EF5A 2MBOA 4CO7A 1WM2A 3QAQA 3PLUA 3PREA 2AWTA 3P2BA 4GMVA 3V6CB 5LXIB 5CHWA 2N7EA 3PT2B 4TUUA 4WJOA 2DX5B 4G50A 1TGZB 4JL9A 5IAAC 3K9OB 2GOWA 3OAWA 4HPMB 1KM7A 3PPAA 2KVRA 3H7SA 2J0KA 4MSMB 1WGYA 2D3GA 4W9EA 2KJRA 5FR6A 1V6EA 1UBQA 3ONSA 4W9KA 4AJWA 1J0GA 3IG3A 4HDOA 4NQKE 2NPTA 1V80A 1YX5B 1PQSA 3QJZA 2LGDA 3KUZA 4RMAA
chains in the Genus database with same CATH superfamily
3UI3A 2IGHA 1HXYD 1FXIA 3TMPB 2CHZA 2LEKA 2UU7A 1NYRA 3H6NA 3ZDTA 5DPSA 1SEBD 3BVGA 1UD7A 2NBWB 1KJTA 1MHHE 2DHZA 3N1XC 5TSSA 2QC8A 3DVGY 4I6NB 4K1RB 4S0RA 4IKGA 3DBSA 3PVLA 2MHJA 4ANWA 1N6ZA 2WXFA 2DENB 1VLBA 4MGYE 1XCTL 1XEEA 2E3TA 1SIJA 3BVMA 3Q3MC 3KWLA 2JRIB 2WXPA 3Q2AC 1ZP0B 1L2NA 3NVVA 4ZRKA 2WXGA 2IDYA 3AE1B 2V0GA 4YSXB 3DVNU 3LXFA 4KGTA 4ZOHC 5LXHA 1WRDB 1B9RA 2JF5A 3C8YA 2CJNA 2GBJA 3QCAA 3N30A 4IOIE 2XK5A 2BYVE 4B0EA 4WWMA 3VTUA 3N1ZC 1V97A 4NPNA 2EMSA 1LFDA 1A70A 2XN9C 1I4HA 3BINA 5G5HA 3U8ZA 4A6QA 1WMHA 1F1HA 1ENFA 1V1OA 2L00B 1YN3A 4RF1A 2WWZA 2WDTB 3NG0A 1LXDA 3SHQA 1JWMD 1WMHB 4FJYA 3WCQA 1WWTA 3D32A 2LUEA 3CF6E 1WGGA 4DDGD 2BWES 1FIQA 1LO5D 3X23A 5KHOA 1N5XA 4JWUC 2FBWB 3KLSX 5IOIA 3O65B 3C0RB 2BS3B 3ZXRA 5D2MB 2G4DB 1UWMA 2Y5PA 1TYGB 3WIMA 3ZYYX 2FNJB 1QQRA 4G3XB 3VUXA 3KUDB 3W9CB 4GU2A 4F8CB 2G4SA 4M01A 5BMGA 1FXAA 3BYTB 4ANXA 5D7GA 3I5JC 1QLBB 2CJOA 3RUIB 4DWFA 2MEKA 3FC4A 3BK2A 1OEYA 1WR1A 1N5WA 1V49A 2PVOD 4C00A 1BMLC 2BQQA 4HCNB 5FK9C 3BY4B 2NBUA 3RNCC 5DPTA 1TZOA 3UGBB 4DHJB 1F2RC 3ZLZA 1BUIC 2GBMA 3V60A 5EE0A 4TKNA 3ZNID 2KJHB 3VH4B 3KYDD 1WIAA 4ARIA 3AEEB 2LVPA 3Q8BA 3ZNZB 3ZO5B 2K5PA 1H4RA 4HCPB 4RM8A 2W3SA 1WX9A 4ASWC 2C7NB 3BWUD 3IAM1 4YTNB 3KUCB 4AOFA 4RGOS 1Q5WB 3ZJTA 1VZ6A 1PYWD 1YMHE 2WGSA 3DPDA 2GBKA 1MI0A 1R4MB 3H7PA 4MGZE 2LGIA 1XXGA 1ZDVA 2JY6A 2YEPF 1OQQA 3GZNI 2M56B 1R4NB 4P1BC 1K8RB 3QARA 5JH5C 4JQWC 1WH3A 4ZRPA 1NENB 1IBXB 1L6VA 1DOIA 4OVVA 1WGHA 3VUYA 1UBIA 3E9SA 4L23A 1C1YB 3A4RA 4IG7B 1QOGA 1L5PA 3HUIA 2DNFA 1M94A 4K81A 2BBCA 5HKHA 5LNK1 2QMTA 3E56A 1J7CA 2NVUI 2R61A 4NQLB 2PIAA 4OHJA 4ZRIA 1OQRA 4CQNA 1WJ4A 2DWQA 1WJUA 1H8CA 3M3JA 2X38A 1GOZA 1T5XD 2L0FA 4C56C 2BYFA 3LB8C 3W1SC 1YJJA 4YL8A 1SF0A 3KH0A 1MFWA 4EZKA 1N60A 1G6JA 5IO9A 2KWCA 2FCQA 3W5UB 4B9KA 3Q3OC 3V62A 3O13A 1WY8A 4OW0A 4J6IA 5IA7A 1V8CA 2WXMA 1R7SA 2NTTA 3S2AA 1SBBB 2LGYA 2I2YA 1TIFA 2L32A 3HK0A 2L7RA 1XCQL 5LLIA 2BF8B 3AE2B 4KDIC 4GDKB 4US9A 1D6EC 3A9JA 4PYZA 1TY0A 2AEHA 3H1UA 3DOWA 4I6PA 3NS1A 1WXMA 1KRHA 4C4VB 2EKEC 2SEBD 1QOFA 2MW5A 2D3BA 1UH6A 2N7JA 4TSSA 4XE0A 3R2IA 2AQ3B 2HE7A 1YIWA 3U4EG 4FA6A 4LNOA 3VH3B 1DOYA 4N9F4 3ZRCA 2WXJA 2N9EB 3AEFB 5I4DA 2JUOA 2D07B 1OTRB 2HTHA 2G9HD 2KT7A 3EUB2 1J19A 1D3ZA 1DOXA 1SJED 1WJNA 2FCNA 4Q2JA 3DBHI 1GG3A 1UUPA 3NZUA 1HZ6A 3TEWA 3RNAC 3VAWA 3FAHA 1GPXA 4ARCA 3VQIA 3ENEA 5T8IA 4HJKA 1F9JA 3C19A 1E8WA 2KWUB 1GC7A 4JWSC 4KGRA 2M17A 3RI7C 1T0RC 4DK5A 3JVZX 5HHDG 3ZDMC 3DVGX 3R3MA 1KLVA 1JCKB 1NI3A 2MX2A 2AL3A 1PUTA 3T9LA 1E6EB 4LJPB 3NJTA 3UF8A 2KQSA 1VDVA 5E6NA 2N9XA 4K7SA 5E6OA 3QQ8B 4EUTA 3M63B 4WWNA 1WF9A 3PRMB 2KFKB 2W55A 2MBOA 3PLUA 1FEHA 3PREA 2WDRB 1YOVB 1JWSD 4XYCA 1EU4A 2PTLA 5IAAC 2GOWA 2QIEB 2J0KA 1WGYA 4W9EA 3DBLB 3AE5B 1UBQA 2RDBC 1J0GA 4HDOA 2D3CA 5C3JB 2NPTA 4S17A 2K1FA 1XLNA 2CKHB 4KGSA 5BYRA 1WGRA 5BYSA 3DHGC 2VH2A 4M02A 2QDFA 3TEYA 2K8HA 4K7WA 4MT5A 2KDBA 3Q3FA 5C1ZA 5BYQA 1KTKA 4RH6A 1XO3A 3RYTA 2KQ7A 3VR9B 1TS4A 2W54A 4MH8A 3WALA 4BKSA 3LJ3A 1JRUA 1XD3B 2DZMA 3GB1A 3AU4A 4BFRA 3ZXVA 3UIPB 2RSUA 3EA6A 1D5ZC 1WYWB 1TS2A 4K3CA 2OHFA 2W82A 3BZDB 4ICVA 2WHIA 2G3QB 2XNAC 4WQMA 1Q10A 1ZGUB 1RWSA 4G11A 1EWYC 2IGGA 2C60A 4RGTA 4YSZB 2TSSA 3Q3JA 2D3AA 1VJKA 3IHPC 3A1QB 1L0XB 1D5XC 1NBFC 2J4XA 2ACZB 4M0WA 1JW9D 3AEAB 1CK1A 2KN5A 2WX1A 4DBGA 4ZYNA 3BYYB 4GDLA 3CIRB 2NMQA 4RM9A 3L4PA 2WXKA 5IP4D 4BOSC 1OQYA 1U4AA 1ROEA 2KO3A 3MC8A 5BMIA 4MM3B 2KNBA 2RPVA 1XLQA 4DXGA 1SGHA 2DZKA 3WANA 3A9KB 3B1LX 4HK2A 3N9YC 3DQVA 2NS5A 2QHOA 3VTWA 4BKSD 1GC6A 2RPQA 3PO0A 2CHWA 5D94A 3DVNV 1T0SC 1ACCA 1PGBA 2JVCA 4GB9A 2Z0DB 4KIKB 4IWOA 3A4SC 2HTME 1KOTA 3SFEB 4LDTD 1ZXHA 3L16A 5HG2A 4NZLB 3RNFC 3TEZA 3AH7A 1QILA 2J53A 3ZNGC 3TEXA 4MJSA 2O6VA 2KJ6A 2JXTA 1J7BA 2A4ZA 3GE3C 4MJSB 3L0WB 3ML9A 1V5TA 4P7IA 1L0YB 2K3UA 3ABVB 2H89B 4OZAA 2INNE 2WXIA 1T0YA 1WE7A 1E10A 1I4PA 1GJZA 3MJ5A 2LVOA 4IM3A 1HTOA 5EDSA 2KD0A 2ZJDA 3P42A 2IZVB 3PZDA 2ON8A 2QILA 2MJEA 2N0SB 4DQOC 4A8XC 3GOEA 5AEKB 2X8XX 3IAS1 1QOBA 1UZXB 2L76A 4JGHB 2LXAA 2RGFA 3L17A 4PS7A 4E3CA 4B6WA 5IKCM 1EM7A 2Y5CA 2V9HA 3PZ7A 4AS1A 1S3SG 2K6DB 2MLBA 2JYEA 4WWPA 4KVGB 4RF0A 2O6VD 3VRAB 2BKFA 2XK5B 1HZ5A 4W9CA 2MSED 1P0RA 1WM3A 2NTSA 2C5LC 3RN9C 3AEBB 4EZJA 4F1SA 2IO2B 1F77A 4EZLA 3VFKA 2LRWA 1JROA 2G1EA 2UYZB 4KKIA 1Z2MA 4N6EB 1Y8RC 3ZVVA 4FN2A 4FLHA 1C4CA 2JZPA 4BKGA 3AV8A 2V3NA 1YN5A 1L4ZB 2L8JA 3RULA 3PTFC 3IFWB 5DPWA 1TS5A 1A5RA 1HE8A 3V61A 3RZWC 1UNSA 3A33B 1NDDA 3ZNHB 1QF6A 4MSQB 2IGDA 1JWUD 3GS2A 4OZBA 1VZ8A 1XT9B 3P63A 2D10A 5AUKA 2DZJA 3H8HA 2KTFA 4WJPA 2L3ZA 2OEDA 3URYA 2BYEA 2LXCA 4LNIA 1C4AA 3CWIA 4DXFA 5IN7A 3N1YC 1C4PA 1IPGA 4A20A 2CHXA 2JZZA 1VRAB 4A55A 2MRPA 1TJEA 3AE3B 3RFZB 2O2VA 4GLSC 1FM0D 2AQ1B 2KDMA 2QCZA 1TKGA 3WAOA 2KX0A 2N1WA 2KXJA 2O2VB 4FULA 3WA0A 2WXQA 1D4BA 1FRDA 4KX6B 4TV3A 2HD5B 4H2AA 2KC1A 5C2TB 3RNEC 1EO6A 1YN4A 3R66C 2IO0B 1WZ3A 4KZCA 1K50A 1J7AA 2NBVB 3AI5A 2VH1A 3RNBC 1SE2A 5BO4B 2H88B 3H7PB 4W9JA 1IGCA 5E6PA 2XEWA 2KANA 3AB5A 1QOAA 5JZEB 3VVWB 1FNUA 3K9PB 3GZNB 4O1NA 4XWTA 3MHSD 2FUHB 4C80A 5H92C 3U2SC 2JXXA 1P7EA 1E8ZA 3L54A 4AP4C 2BTEA 2C9WB 1ET6A 1E7UA 1UWXA 1WJ6A 1SSNA 4C7YA 1P98A 3AECB 2KFJA 3RCZA 1I4QA 3SDLC 3AE6B 4FBJB 4FADA 4USAA 1LM8B 4N58A 2IO3B 4YSYB 2BYTA 2BS2B 4B0MA 4GMVA 3IT6B 4LTUA 2K9XA 3B9JA 1F52A 3AE8B 4C7ZA 1TGZB 1V1PA 1ZDXA 3OAWA 3AMZA 2D3GA 1HA5A 4AJWA 4HRSA 1FCLA 1V1PB 1YX5B 4NJ7A 3KUZA 1DGJA 2KMCA 2N9KA 1VD2A 4ITKA 4WIPA 1ZKHA 1YQ4B 1UELA 4M8NA 2N1VA 3P4QB 3EFUA 3PGEA 4F7ZA 2Y5BB 2AYOB 3BVZA 1AWDA 1TZ1A 2GBNA 3QWZB 5TR5A 4II3B 2ZW0A 2GB1A 4OVZA 3VUWA 2Q5WD 3NVZA 1FFUA 2NR2A 4BBNF 5CX3A 3JSVA 3A9JB 3AE4B 2K22A 4HJGE 1MG8A 2WQYB 1ZW7A 4NY0A 4E71A 2YLMA 4HROA 5D3DA 4GN1A 4LNKA 4IWPA 1HQRD 5J17A 4MDKE 2J0JA 1YJ1A 1XF5L 5EE1A 2J0MA 2ZW1A 3ZRFA 3HVDA 3EC8A 4EE2A 2ZNVC 4A3PA 2YVCA 1E5WA 2FCSA 3B2FA 4G0NB 2EMTA 3M62B 2IPKD 1FMAD 2LVQA 3DBHB 3GE8C 2AX5A 2PEAA 4W9GA 2KOXA 3MTNB 1Z5SB 4YT0B 1YJIA 1OEYJ 3SEBA 3KYCD 4HEA1 3OLMD 4WAFA 4ZDVA 3R2TA 1TBEA 2L05A 3VRBB 3P4RB 2SAKA 4MGKE 3Q3NC 4TMAB 5D3IB 4KKJA 1I4RA 3PSEB 2M0XA 3U7DA 2M19A 4HKQA 1YNTE 1WR6E 5H8YE 4GSWA 2KQ4X 4US8A 2G45B 2RR9A 1KLUD 3ECIA 3U30A 1KH0A 3KW5B 1WYGA 1P7FA 3MP9A 2BVCA 1AYFA 2R2QA 4JPSA 4LLGM 3N32A 2MBQA 4ICUA 2KVZA 2ZNVB 1MHXA 3ML8A 3OG5A 3DBLI 4FJZA 3CMMB 4AQ7A 3ALBA 3V3XA 1LQBA 1TT5B 2PMVA 4N59A 2JRHA 5E6JA 2K25A 3HRDD 2NPTB 4R3DA 5GXGB 4RFBA 2BPSA 4YTMB 2QEJC 3NVWA 2CU3A 2CU1A 2ZPYA 3I9V1 2MBEA 4JIOU 3RMKC 2ICIA 2IBIB 2LHEA 1I35A 4XZ4A 5JHAA 3LYYA 2KWVB 4AUQC 4EFOA 1ZPSA 2BB6A 3SU8X 2INDC 2KDFB 2RMMA 3I63C 1AARA 2DYOA 2W3RA 3KQ4A 4IM0A 2FIDA 2LGXA 3PV1A 2WU5B 3I3TB 2PKOA 3B0AA 4LDTB 2IY0B 4MELA 3APFA 1MPEA 3T3NA 4KV2A 3OJ4B 2MJ3A 1E0ZA 5DCNA 2M4NA 2LI5A 4WAAA 1NI2A 4BZAA 1N63A 1FNVA 1F0ZA 4M0WB 2ZCBA 3W5VB 2V4LA 3UQAA 1E7PB 4XWWA 2B3AA 2NCNA 2FE8A 1M4VA 4GDLB 3TJPA 4IM2A 2K0PA 3UIOB 2MP2A 2KZRA 4HLEA 2KMAA 3HIZA 4IWQA 2KDEB 2MH7A 2L0TA 5L95C 4HDQA 1UF0A 1WI0A 4WJQA 3FILA 3HHMA 2WLBA 1I42A 2V4IB 3QX1A 1YQ3B 2KC2A 3NY5A 1QT9A 3P4SB 4JLCA 3TSSA 1NEKB 1JWAD 2DYMA 1K51A 4NJCA 2WXOA 2FCMA 2GRIA 1IP9A 3VDZA 2PE9A 3JW0X 2M1MA 3DBRI 3AE7B 1DYQA 1AW7A 1EUVB 1KF6B 5EE9A 4HPPA 4RNAA 4MGIE 1GB1A 2I1JA 4HPLB 4NAWA 1L0VB 1E7VA 5G2NA 4OZCA 2KYWA 1ET9A 2L52A 1SE3A 3MC0B 2KKCA 2O6VB 3ZGZA 2N4FA 3CSTA 4NAWB 2BGFA 2PLPA 1YX6B 4L1BA 4HVBA 2D5GA 1RAXA 3LDZE 2N7DA 4PS8A 1RFAA 4TQ1A 1T0QC 2HDEA 4FJVB 2KN4A 5JHBA 3ZW3A 2Z0EB 3TIXA 1I4XA 2DAFA 3ZTCA 1B1ZA 1L4DB 1UGJA 4NJ6A 4A9AA 1K52A 4RCOA 2JPHA 3RNGC 3HM6X 2KLCA 5GMVA 1SJHD 2JX5A 2JWUA 2ZVNA 3AN1A 3NRZA 4OVUA 4CHKA 2DAJA 2HJ8A 2N9LA 5FKAC 2IO1B 2BT6A 3PLVA 4PK1A 2QSDA 5HI1A 1N61A 5CTRC 3I57A 3Q8AA 4ZRQA 1TTNA 1T6BX 2JYTA 1L7YA 4TQ0A 2GBRA 4YXDB 3Q8EA 3AM9A 4BKTA 2LWPA 2LRUA 3IXSA 3MJWA 2OJWA 1GNUA 1JWBD 2GI9A 2LUMA 1UGMA 3OWEB 2YEPB 1VZ7A 3DWGC 4B95A 2OOBB 1XLPA 3VXWA 2EELA 4IDIA 1BT0A 4II2B 1Q0WB 2QJLA 5AZFA 2JSVX 3U7ZA 3APCA 4ZRJA 2MQJA 3VTVA 3B08A 4XDCA 2JU6X 2DZIA 2ZZPB 4BBNC 3PZ8A 2WYQA 1RRBA 4K7UA 5AZGA 4REZA 3MFGA 4A90A 1C9FA 3FKYA 1TS3A 2AWTA 5LXIB 2N7EA 4TUUA 2J42A 1L6UA 4JE3B 2KAJA 4JL9A 2WXNA 3K9OB 4HPMB 1KM7A 2KVRA 3H7SA 3Q8CA 5FR6A 1V6EA 3ONSA 2KACA 4W9KA 2RDGA 3BIID 3IG3A 2BW2A 1PQSA 3QJZA 2LGDA 4RMAA 1T3QA 4ACFA 3NUHB 4AWJA 3SR6A 3PRZA 4K3BA 3IBEA 3DWMA 3P4PB 3VR8B 2C7HA 4M00A 4W9DA 4DHZE 2WU2B 1HEZE 5AZHA 2WDVB 1JQ4A 2LD9A 3UQBA 2IYDB 4EKUA 2KMMA 4W9HA 3UINB 4LK0M 1V2YA 3Q14C 1EU3A 4KSKC 3SD5A 1YD8U 1WRIA 1IUEA 2MCNB 1IGDA 3QC8B 1STEA 4PYUA 3DHIC 4P16A 4WQOB 3R7QA 1GB4A 1C79A 3NS8A 2EKIA 4LCDE 2ZPNA 3EFCA 4UDUC 1R4MI 4W9LA 4WH4A 2D11A 5AUIA 2LJ5A 4JX1C 3X0WA 4URKA 2M0AA 2KK8A 2GMIC 1LGRA 1R4NI 1XLOA 2WS3B 2MWSB 3DHHC 2INPE 3L10B 3QHTA 1WXQA 1IBXA 3B2GA 5MPOA 1XQQA 3Q8FA 2JT4B 2W9NA 3CSFA 1E8XA 1P1AA 4KDLB 2PVGC 4A3OA 2DBYA 3IVFA 1PGXA 1QKZA 3L13A 2UWQA 4BVUC 2V3SA 1X1MA 2LMCA 4IC7B 3H9DA 4NNJB 3VHTC 3OJ3A 3AEGB 2LZ6A 2MA9B 2AQ2B 1WGDA 4WURA 1CMXB 5CHVC 1F2RI 2A5UA 4DHJD 3Q69A 3WAPA 5G55A 1PGAA 2Z59B 3AXCA 2IY1B 2WNMA 3EECA 3KWVA 4LNNA 4EEWA 4ZHOA 4X57B 3AE9B 3TBLD 1EF1A 1OGWA 2C7MB 5CHFA 5EE3A 1FNWA 1KFYB 2KLGA 3L08A 3N3KB 2WP9B 1NYQA 2REXA 4FHKA 4L2YA 3NOBA 2BS4B 3QA8A 1K53A 5J18A 2ZEQA 3RPFC 3EHVA 4XGAB 1ZE3D 5JXVA 3GP7A 4GDKA 2AL6A 3U52E 2PJHA 3PS6A 1PFDA 4HWIB 5KHQA 2E6XA 2ASQA 4DXAB 1GUAB 5DPRA 4WJNA 1P3QU 1RLFA 4C4VA 2WDQB 2KX3A 3QK0A 3ZUNA 1KLGD 3APDA 4GIVA 1WX7A 1ZXIA 3W1YA 4AJYB 3JSVB 4KSLC 5BMHA 3ZQ4A 1I7HA 3ZIMA 1PDXA 4KZ0A 1SXTA 1V9JA 1MVKA 2L83A 4PT5A 2KHWB 1C78A 2XBBC 4ANVA 3W1SA 2LJIA 3NZ3A 1WXSA 3KVFB 2Y3AA 3PRPB 1YQBA 3AU5A 2V1YA 5C23A 1QZEA 2BKRB 4WWOA 2D2QA 1C77A 1FRRA 3EGRA 3R8BA 4IUMB 4MEMA 3MC9A 4DDID 2LASA 3AEDB 4CYEA 4YTPB 3T3OA 4XDDA 3AULA 1MG4A 2VZKB 5G5GA 3DDCB 2KDIA 4I6LB 1SE9A 4YWGG 2I38A 1ISNA 1E90A 3NVYA 4J3OD 2ZCCA 1OFFA 4RGNA 3PHWB 3WAMA 4HXDA 2K6QA 1AN8A 3IT4B 1RYJA 2GLSA 2KFKA 2VRRB 2WXHA 3TCAA 1WXVA 3ZTDA 2K8BA 3Q6BA 3TUOA 2MBBB 1SIFA 1S1QB 4W9FA 2PW9A 1FXTB 4P6VF 2JWZA 4W9IA 1I4GA 2DYBA 2BB5A 1JALA 2OJRA 2RD0A 2KWDA 4M8MA 4NAMA 2INCC 2V3PA 4BAXA 1IYFA 1SE4A 3MHZA 1V86A 1CJEA 1HTQA 1WZ0A 4XX5A 2PPHA 3ZKJC 2L1AA 3HVZA 1WX8A 1J8CA 1WFYA 4LNFA 1VR9A 3M95A 4GOCA 2K39A 2WX0A 1ZOYB 2VZKD 1V5OA 2M8SA 2FAZA 4EOYA 1JRPA 1V81A 3V6EB 2LGSA 1FCCC 3NZSA 5L83A 4MH0E 1MJDA 5FR3A 2FUG1 4RGMA 2RDHA 3ZJUA 4ZHPA 3RD2A 4GXBA 2I1KA 2ZVOA 4ANUA 1NVID 2CS4A 1CQVA 4XC2A 2CR5A 3JYUA 1Q1OA 1RM6C 2K8CA 1FO4A 3A1QA 2HJ1A 1N62A 2LFIA 4P1CC 1E8YA 1Y56A 1EWCA 4GGQA 1C3TA 1ESFA 3QIJA 3P1MA 2J7QB 4D2KA 4FHJA 2ONQA 1E9MA 1TKEA 2B76B 3W2DA 4ZYSA 3N20C 3TL5A 1CZPA 4MACA 3SFDB 2PE6B 2LHDA 2BWFA 4BOZB 3PHXB 4HKZE 1WGKA 2IJ0A 1C76A 3R7RA 4MM3A 3DCGA 5HFYA 1WXAA 3T8MA 4PS3A 4FXCA 4LJOB 2MP2B 1BXTA 1VCBA 2R2OA 3HM3A 1SB3C 2KTRA 2WXLA 2J52A 3A9KA 1P9DU 2JZ3B 5D6JB 1WE6A 3FILB 3RZFA 2N9PC 2MJDA 2WXRA 3BK1A 2FIFA 5J2RA 1GAQB 3NHEB 2KTRB 1FPYA 2MBHA 2DLBA 4DHZB 4KIKA 4E74A 4IW0A 1TY2A 3RT3B 1JMLA 1EF5A 4CO7A 1RFKA 1WM2A 3QAQA 3P2BA 1TKYA 3V6CB 5CHWA 3PT2B 3DBRB 4WJOA 2Z8LA 4G50A 2DX5B 3J9CA 1FD6A 1D5MC 3PPAA 4MSMB 1FFVA 2KJRA 3ZJVA 3V05A 4NQKE 4QAYA 1V80A 1ZUD2 3ETRA 1WSPA 2JQRB
chains in the Genus database with same CATH topology
2KMCA 2K1FA 1VD2A 4AWJA 1ZKHA 1UELA 3PRZA 3TMPB 2CHZA 2CKHB 1WGRA 4M8NA 3IBEA 3H6NA 2N1VA 3EFUA 3ZDTA 3PGEA 4F7ZA 2Y5BB 2K8HA 4K7WA 2AYOB 2C7HA 2GBNA 1TZ1A 2KDBA 3QWZB 3Q3FA 4W9DA 5DPSA 5TR5A 4II3B 4DHZE 1UD7A 5AZHA 5C1ZA 3VUWA 2NBWB 2LD9A 1KJTA 2NR2A 2KQ7A 3RYTA 2DHZA 2IYDB 3UQBA 4BBNF 5CX3A 3JSVA 3A9JB 3WALA 4EKUA 4BKSA 4W9HA 3UINB 3LJ3A 3DVGY 1MG8A 4I6NB 4K1RB 1JRUA 1V2YA 1XD3B 1ZW7A 2DZMA 4NY0A 2YLMA 4E71A 3AU4A 3DBSA 3PVLA 4ANWA 4BFRA 3UIPB 4GN1A 2RSUA 4IWPA 5J17A 4KSKC 3SD5A 1WYWB 4MDKE 2DENB 2J0JA 1YD8U 4MGYE 2MCNB 3QC8B 1YJ1A 4ICVA 4PYUA 2G3QB 4WQOB 3R7QA 2J0MA 3ZRFA 1ZGUB 2JRIB 3NS8A 4G11A 3EC8A 1L2NA 2C60A 4LCDE 4ZRKA 2ZPNA 3Q3JA 2ZNVC 3IHPC 1R4MI 4W9LA 2D11A 3A1QB 1NBFC 2LJ5A 3X0WA 4URKA 4A3PA 2KK8A 2YVCA 2GMIC 3DVNU 1E5WA 1R4NI 2FCSA 2KN5A 2WX1A 2MWSB 5LXHA 1WRDB 4ZYNA 4DBGA 3L10B 2JF5A 3QHTA 2GBJA 4GDLA 3QCAA 3N30A 4G0NB 2EMTA 3M62B 2XK5A 2BYVE 2LVQA 4RM9A 1XQQA 3VTUA 2PEAA 4W9GA 2KOXA 3MTNB 2JT4B 1Z5SB 2W9NA 3CSFA 1E8XA 1P1AA 4NPNA 2EMSA 1OEYJ 4KDLB 1LFDA 3KYCD 4A3OA 4BOSC 1OQYA 3IVFA 1U4AA 3OLMD 2KO3A 3BINA 3L13A 2UWQA 3U8ZA 4BVUC 2V3SA 1X1MA 4ZDVA 1TBEA 2KNBA 1WMHA 2L05A 4IC7B 2L00B 3H9DA 4NNJB 3VHTC 3OJ3A 1SGHA 4MGKE 2WWZA 2DZKA 2WDTB 3WANA 2LZ6A 2MA9B 3A9KB 1LXDA 3B1LX 3SHQA 1WGDA 4HK2A 1CMXB 5CHVC 1WMHB 3DQVA 4FJYA 2NS5A 2QHOA 3VTWA 3D32A 2A5UA 2LUEA 4BKSD 4DHJD 1GC6A 2RPQA 1WGGA 3CF6E 3PSEB 2M0XA 3U7DA 4DDGD 1WR6E 2CHWA 5D94A 2BWES 3DVNV 4GSWA 3X23A 3WAPA 2G45B 2JVCA 4GB9A 5G55A 5KHOA 4FADA 3AXCA 2RR9A 2Z59B 2Z0DB 2IY1B 3ECIA 4KIKB 4IWOA 3A4SC 3U30A 1KOTA 3O65B 3C0RB 3EECA 3KW5B 4EEWA 4X57B 4LDTD 3L16A 5D2MB 2G4DB 3TBLD 2R2QA 1EF1A 1OGWA 2C7MB 3N32A 2MBQA 4ICUA 2FNJB 5CHFA 3WIMA 2ZNVB 4G3XB 3ML8A 3ZNGC 3DBLI 3KUDB 3CMMB 4FJZA 4MJSA 3VUXA 2KLGA 3ALBA 4GU2A 1LQBA 3L08A 2O6VA 4F8CB 3N3KB 2G4SA 2KJ6A 2REXA 4FHKA 2JRHA 3NOBA 3QA8A 2A4ZA 2K25A 2NPTB 4ANXA 4MJSB 5J18A 2ZEQA 5D7GA 3RUIB 3EHVA 4DWFA 2BPSA 3L0WB 3ML9A 4GDKA 1V5TA 2AL6A 4P7IA 2PJHA 3PS6A 5KHQA 4HWIB 2CU1A 2ZPYA 1OEYA 2MBEA 1WR1A 2ASQA 4JIOU 1T0YA 1WE7A 2IBIB 1V49A 4DXAB 1I35A 1GUAB 5DPRA 4WJNA 4HCNB 4XZ4A 1GJZA 1P3QU 1RLFA 5JHAA 2LVOA 3BY4B 4IM3A 2KWVB 5EDSA 2KD0A 2NBUA 2KX3A 3QK0A 3ZUNA 2ZJDA 4AUQC 4EFOA 3APDA 2IZVB 1WX7A 4GIVA 3W1YA 4AJYB 3SU8X 3JSVB 3PZDA 4KSLC 5DPTA 2KDFB 3UGBB 4DHJB 3ZLZA 1AARA 3ZIMA 2GBMA 3V60A 2DYOA 4TKNA 3ZNID 3GOEA 2KJHB 5AEKB 3VH4B 3KYDD 4KZ0A 1WIAA 4IM0A 2FIDA 2LGXA 2LVPA 3ZNZB 3ZO5B 1V9JA 1UZXB 3PV1A 3I3TB 1H4RA 4HCPB 4RM8A 3B0AA 4LDTB 2IY0B 2KHWB 4MELA 2L76A 4JGHB 1WX9A 3APFA 4ASWC 2LXAA 2RGFA 4KV2A 2XBBC 3OJ4B 2C7NB 5DCNA 2M4NA 3KUCB 4AOFA 2LI5A 3L17A 4PS7A 3W1SA 1Q5WB 4ANVA 4E3CA 4WAAA 1NI2A 4B6WA 1WXSA 3KVFB 3DPDA 2GBKA 3H7PA 4MGZE 3PRPB 4M0WB 1S3SG 2ZCBA 1YQBA 3AU5A 2JY6A 2K6DB 1QZEA 2MLBA 2V1YA 2V4LA 5C23A 3UQAA 2BKRB 4WWOA 3GZNI 2D2QA 2B3AA 2NCNA 1K8RB 3QARA 4WWPA 4IUMB 4KVGB 4MEMA 5JH5C 2O6VD 4GDLB 4JQWC 1WH3A 4DDID 2BKFA 3TJPA 4IM2A 2XK5B 2LASA 4W9CA 4OVVA 2MSED 1WGHA 1P0RA 3UIOB 2MP2A 1WM3A 2KZRA 3VUYA 4CYEA 1UBIA 2KMAA 4HLEA 3HIZA 2C5LC 4IWQA 2KDEB 1C1YB 3A4RA 4IG7B 3AULA 2L0TA 4EZJA 4F1SA 5L95C 1M94A 4K81A 2IO2B 4HDQA 5HKHA 1WI0A 3DDCB 2KDIA 4EZLA 4WJQA 3VFKA 2LRWA 4I6LB 3HHMA 2NVUI 1SE9A 4NQLB 1I42A 2UYZB 1Z2MA 3QX1A 1ISNA 2KC2A 3NY5A 1Y8RC 1E90A 3ZVVA 4ZRIA 2ZCCA 4FN2A 4FLHA 4JLCA 3PHWB 3WAMA 4HXDA 2K6QA 1WJ4A 4BKGA 2DYMA 3RULA 2L8JA 3PTFC 1WJUA 1H8CA 2FCMA 3IFWB 1IP9A 2VRRB 2KFKA 3TCAA 3VDZA 5DPWA 1WXVA 3ZTDA 3M3JA 2K8BA 1A5RA 2PE9A 3JW0X 2MBBB 1SIFA 1S1QB 2M1MA 3DBRI 4W9FA 1HE8A 1FXTB 3V61A 2JWZA 4W9IA 3RZWC 2L0FA 3A33B 1EUVB 1NDDA 2BYFA 3ZNHB 2DYBA 3W1SC 4YL8A 2OJRA 2RD0A 3KH0A 4M8MA 4MSQB 4MGIE 4EZKA 1G6JA 2KWCA 2FCQA 1IYFA 2I1JA 4B9KA 4HPLB 3V62A 1XT9B 4NAWA 1E7VA 5G2NA 1WY8A 2D10A 4J6IA 1V86A 5IA7A 1WZ0A 4XX5A 2PPHA 2KKCA 2O6VB 2DZJA 3ZKJC 2KTFA 3S2AA 2N4FA 2LGYA 3CSTA 2L3ZA 4NAWB 4WJPA 2BGFA 1WX8A 1J8CA 2BYEA 2LXCA 1WFYA 1YX6B 3HK0A 2L7RA 4HVBA 1RAXA 3M95A 5LLIA 4GOCA 2K39A 2WX0A 2BF8B 3LDZE 1IPGA 1V5OA 2N7DA 4KDIC 2CHXA 2JZZA 2M8SA 4GDKB 4PS8A 4A20A 2FAZA 4EOYA 1V81A 3V6EB 2MRPA 3A9JA 1RFAA 4TQ1A 3NZSA 4PYZA 5L83A 4FJVB 4MH0E 2AEHA 3H1UA 5JHBA 3DOWA 4I6PA 3ZW3A 2Z0EB 3TIXA 1WXMA 2DAFA 3ZTCA 4NJ6A 2EKEC 2O2VA 3RD2A 2MW5A 1UH6A 4GXBA 2JPHA 2I1KA 2ZVOA 3WAOA 2HE7A 3HM6X 4ANUA 2KLCA 5GMVA 2KX0A 1YIWA 2N1WA 2ZVNA 2CS4A 3VH3B 4FA6A 2KXJA 2O2VB 4N9F4 4XC2A 4FULA 2CR5A 3WA0A 3ZRCA 3JYUA 1Q1OA 2K8CA 2N9EB 4OVUA 2DAJA 4CHKA 4TV3A 2HD5B 2JUOA 3A1QA 2D07B 2HJ8A 1OTRB 2KC1A 2HTHA 1EO6A 1E8YA 3R66C 2IO1B 1J19A 2IO0B 1D3ZA 1WZ3A 4KZCA 3PLVA 4GGQA 1C3TA 2NBVB 1WJNA 5CTRC 3QIJA 2FCNA 3AI5A 2J7QB 3DBHI 1GG3A 5BO4B 4FHJA 3NZUA 1TTNA 3H7PB 1L7YA 4TQ0A 4W9JA 3VAWA 3TL5A 2GBRA 5E6PA 2XEWA 2PE6B 2KANA 2BWFA 4BKTA 4BOZB 2LWPA 3PHXB 2LRUA 3VQIA 5JZEB 3ENEA 3VVWB 3K9PB 4HJKA 3MJWA 3R7RA 1F9JA 4MM3A 1GNUA 1E8WA 3DCGA 1UGMA 2KWUB 1WXAA 3MHSD 3T8MA 4PS3A 1GC7A 4LJOB 2MP2B 2FUHB 2M17A 1VCBA 4B95A 2OOBB 2R2OA 3HM3A 4DK5A 2JXXA 3JVZX 2KTRA 3L54A 1E8ZA 3DVGX 3R3MA 3VXWA 3ZDMC 4AP4C 1KLVA 3A9KA 1BT0A 1P9DU 2JZ3B 4II2B 2C9WB 5D6JB 1WE6A 3RZFA 1Q0WB 2MX2A 2N9PC 2AL3A 5AZFA 2FIFA 3T9LA 1E7UA 1WJ6A 4LJPB 3APCA 5J2RA 4ZRJA 2MQJA 3VTVA 3B08A 3NHEB 2KTRB 1P98A 3UF8A 2KQSA 2MBHA 5E6NA 2DZIA 2KFJA 3RCZA 2N9XA 2ZZPB 4K7SA 3SDLC 4BBNC 4K7UA 2WYQA 1RRBA 4NJ7A 4DHZB 5E6OA 4FBJB 3QQ8B 1LM8B 4KIKA 4EUTA 4E74A 2IO3B 5AZGA 4IW0A 3M63B 4WWNA 3RT3B 1WF9A 3PRMB 2KFKB 1EF5A 2MBOA 4CO7A 1WM2A 3QAQA 3PLUA 3PREA 2AWTA 3P2BA 4GMVA 3V6CB 5LXIB 5CHWA 2N7EA 3PT2B 4TUUA 4WJOA 2DX5B 4G50A 1TGZB 4JL9A 5IAAC 3K9OB 2GOWA 3OAWA 4HPMB 1KM7A 3PPAA 2KVRA 3H7SA 2J0KA 4MSMB 1WGYA 2D3GA 4W9EA 2KJRA 5FR6A 1V6EA 1UBQA 3ONSA 4W9KA 4AJWA 1J0GA 3IG3A 4HDOA 4NQKE 2NPTA 1V80A 1YX5B 1PQSA 3QJZA 2LGDA 3KUZA 4RMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMC A;  2K1F A;  1VD2 A;  4AWJ A;  1ZKH A;  1UEL A;  3PRZ A;  3TMP B;  2CHZ A;  2CKH B;  1WGR A;  4M8N A;  3IBE A;  3H6N A;  2N1V A;  3EFU A;  3ZDT A;  3PGE A;  4F7Z A;  2Y5B B;  2K8H A;  4K7W A;  2AYO B;  2C7H A;  2GBN A;  1TZ1 A;  2KDB A;  3QWZ B;  3Q3F A;  4W9D A;  5DPS A;  5TR5 A;  4II3 B;  4DHZ E;  1UD7 A;  5AZH A;  5C1Z A;  3VUW A;  2NBW B;  2LD9 A;  1KJT A;  2NR2 A;  2KQ7 A;  3RYT A;  2DHZ A;  2IYD B;  3UQB A;  4BBN F;  5CX3 A;  3JSV A;  3A9J B;  3WAL A;  4EKU A;  4BKS A;  4W9H A;  3UIN B;  3LJ3 A;  3DVG Y;  1MG8 A;  4I6N B;  4K1R B;  1JRU A;  1V2Y A;  1XD3 B;  1ZW7 A;  2DZM A;  4NY0 A;  2YLM A;  4E71 A;  3AU4 A;  3DBS A;  3PVL A;  4ANW A;  4BFR A;  3UIP B;  4GN1 A;  2RSU A;  4IWP A;  5J17 A;  4KSK C;  3SD5 A;  1WYW B;  4MDK E;  2DEN B;  2J0J A;  1YD8 U;  4MGY E;  2MCN B;  3QC8 B;  1YJ1 A;  4ICV A;  4PYU A;  2G3Q B;  4WQO B;  3R7Q A;  2J0M A;  3ZRF A;  1ZGU B;  2JRI B;  3NS8 A;  4G11 A;  3EC8 A;  1L2N A;  2C60 A;  4LCD E;  4ZRK A;  2ZPN A;  3Q3J A;  2ZNV C;  3IHP C;  1R4M I;  4W9L A;  2D11 A;  3A1Q B;  1NBF C;  2LJ5 A;  3X0W A;  4URK A;  4A3P A;  2KK8 A;  2YVC A;  2GMI C;  3DVN U;  1E5W A;  1R4N I;  2FCS A;  2KN5 A;  2WX1 A;  2MWS B;  5LXH A;  1WRD B;  4ZYN A;  4DBG A;  3L10 B;  2JF5 A;  3QHT A;  2GBJ A;  4GDL A;  3QCA A;  3N30 A;  4G0N B;  2EMT A;  3M62 B;  2XK5 A;  2BYV E;  2LVQ A;  4RM9 A;  1XQQ A;  3VTU A;  2PEA A;  4W9G A;  2KOX A;  3MTN B;  2JT4 B;  1Z5S B;  2W9N A;  3CSF A;  1E8X A;  1P1A A;  4NPN A;  2EMS A;  1OEY J;  4KDL B;  1LFD A;  3KYC D;  4A3O A;  4BOS C;  1OQY A;  3IVF A;  1U4A A;  3OLM D;  2KO3 A;  3BIN A;  3L13 A;  2UWQ A;  3U8Z A;  4BVU C;  2V3S A;  1X1M A;  4ZDV A;  1TBE A;  2KNB A;  1WMH A;  2L05 A;  4IC7 B;  2L00 B;  3H9D A;  4NNJ B;  3VHT C;  3OJ3 A;  1SGH A;  4MGK E;  2WWZ A;  2DZK A;  2WDT B;  3WAN A;  2LZ6 A;  2MA9 B;  3A9K B;  1LXD A;  3B1L X;  3SHQ A;  1WGD A;  4HK2 A;  1CMX B;  5CHV C;  1WMH B;  3DQV A;  4FJY A;  2NS5 A;  2QHO A;  3VTW A;  3D32 A;  2A5U A;  2LUE A;  4BKS D;  4DHJ D;  1GC6 A;  2RPQ A;  1WGG A;  3CF6 E;  3PSE B;  2M0X A;  3U7D A;  4DDG D;  1WR6 E;  2CHW A;  5D94 A;  2BWE S;  3DVN V;  4GSW A;  3X23 A;  3WAP A;  2G45 B;  2JVC A;  4GB9 A;  5G55 A;  5KHO A;  4FAD A;  3AXC A;  2RR9 A;  2Z59 B;  2Z0D B;  2IY1 B;  3ECI A;  4KIK B;  4IWO A;  3A4S C;  3U30 A;  1KOT A;  3O65 B;  3C0R B;  3EEC A;  3KW5 B;  4EEW A;  4X57 B;  4LDT D;  3L16 A;  5D2M B;  2G4D B;  3TBL D;  2R2Q A;  1EF1 A;  1OGW A;  2C7M B;  3N32 A;  2MBQ A;  4ICU A;  2FNJ B;  5CHF A;  3WIM A;  2ZNV B;  4G3X B;  3ML8 A;  3ZNG C;  3DBL I;  3KUD B;  3CMM B;  4FJZ A;  4MJS A;  3VUX A;  2KLG A;  3ALB A;  4GU2 A;  1LQB A;  3L08 A;  2O6V A;  4F8C B;  3N3K B;  2G4S A;  2KJ6 A;  2REX A;  4FHK A;  2JRH A;  3NOB A;  3QA8 A;  2A4Z A;  2K25 A;  2NPT B;  4ANX A;  4MJS B;  5J18 A;  2ZEQ A;  5D7G A;  3RUI B;  3EHV A;  4DWF A;  2BPS A;  3L0W B;  3ML9 A;  4GDK A;  1V5T A;  2AL6 A;  4P7I A;  2PJH A;  3PS6 A;  5KHQ A;  4HWI B;  2CU1 A;  2ZPY A;  1OEY A;  2MBE A;  1WR1 A;  2ASQ A;  4JIO U;  1T0Y A;  1WE7 A;  2IBI B;  1V49 A;  4DXA B;  1I35 A;  1GUA B;  5DPR A;  4WJN A;  4HCN B;  4XZ4 A;  1GJZ A;  1P3Q U;  1RLF A;  5JHA A;  2LVO A;  3BY4 B;  4IM3 A;  2KWV B;  5EDS A;  2KD0 A;  2NBU A;  2KX3 A;  3QK0 A;  3ZUN A;  2ZJD A;  4AUQ C;  4EFO A;  3APD A;  2IZV B;  1WX7 A;  4GIV A;  3W1Y A;  4AJY B;  3SU8 X;  3JSV B;  3PZD A;  4KSL C;  5DPT A;  2KDF B;  3UGB B;  4DHJ B;  3ZLZ A;  1AAR A;  3ZIM A;  2GBM A;  3V60 A;  2DYO A;  4TKN A;  3ZNI D;  3GOE A;  2KJH B;  5AEK B;  3VH4 B;  3KYD D;  4KZ0 A;  1WIA A;  4IM0 A;  2FID A;  2LGX A;  2LVP A;  3ZNZ B;  3ZO5 B;  1V9J A;  1UZX B;  3PV1 A;  3I3T B;  1H4R A;  4HCP B;  4RM8 A;  3B0A A;  4LDT B;  2IY0 B;  2KHW B;  4MEL A;  2L76 A;  4JGH B;  1WX9 A;  3APF A;  4ASW C;  2LXA A;  2RGF A;  4KV2 A;  2XBB C;  3OJ4 B;  2C7N B;  5DCN A;  2M4N A;  3KUC B;  4AOF A;  2LI5 A;  3L17 A;  4PS7 A;  3W1S A;  1Q5W B;  4ANV A;  4E3C A;  4WAA A;  1NI2 A;  4B6W A;  1WXS A;  3KVF B;  3DPD A;  2GBK A;  3H7P A;  4MGZ E;  3PRP B;  4M0W B;  1S3S G;  2ZCB A;  1YQB A;  3AU5 A;  2JY6 A;  2K6D B;  1QZE A;  2MLB A;  2V1Y A;  2V4L A;  5C23 A;  3UQA A;  2BKR B;  4WWO A;  3GZN I;  2D2Q A;  2B3A A;  2NCN A;  1K8R B;  3QAR A;  4WWP A;  4IUM B;  4KVG B;  4MEM A;  5JH5 C;  2O6V D;  4GDL B;  4JQW C;  1WH3 A;  4DDI D;  2BKF A;  3TJP A;  4IM2 A;  2XK5 B;  2LAS A;  4W9C A;  4OVV A;  2MSE D;  1WGH A;  1P0R A;  3UIO B;  2MP2 A;  1WM3 A;  2KZR A;  3VUY A;  4CYE A;  1UBI A;  2KMA A;  4HLE A;  3HIZ A;  2C5L C;  4IWQ A;  2KDE B;  1C1Y B;  3A4R A;  4IG7 B;  3AUL A;  2L0T A;  4EZJ A;  4F1S A;  5L95 C;  1M94 A;  4K81 A;  2IO2 B;  4HDQ A;  5HKH A;  1WI0 A;  3DDC B;  2KDI A;  4EZL A;  4WJQ A;  3VFK A;  2LRW A;  4I6L B;  3HHM A;  2NVU I;  1SE9 A;  4NQL B;  1I42 A;  2UYZ B;  1Z2M A;  3QX1 A;  1ISN A;  2KC2 A;  3NY5 A;  1Y8R C;  1E90 A;  3ZVV A;  4ZRI A;  2ZCC A;  4FN2 A;  4FLH A;  4JLC A;  3PHW B;  3WAM A;  4HXD A;  2K6Q A;  1WJ4 A;  4BKG A;  2DYM A;  3RUL A;  2L8J A;  3PTF C;  1WJU A;  1H8C A;  2FCM A;  3IFW B;  1IP9 A;  2VRR B;  2KFK A;  3TCA A;  3VDZ A;  5DPW A;  1WXV A;  3ZTD A;  3M3J A;  2K8B A;  1A5R A;  2PE9 A;  3JW0 X;  2MBB B;  1SIF A;  1S1Q B;  2M1M A;  3DBR I;  4W9F A;  1HE8 A;  1FXT B;  3V61 A;  2JWZ A;  4W9I A;  3RZW C;  2L0F A;  3A33 B;  1EUV B;  1NDD A;  2BYF A;  3ZNH B;  2DYB A;  3W1S C;  4YL8 A;  2OJR A;  2RD0 A;  3KH0 A;  4M8M A;  4MSQ B;  4MGI E;  4EZK A;  1G6J A;  2KWC A;  2FCQ A;  1IYF A;  2I1J A;  4B9K A;  4HPL B;  3V62 A;  1XT9 B;  4NAW A;  1E7V A;  5G2N A;  1WY8 A;  2D10 A;  4J6I A;  1V86 A;  5IA7 A;  1WZ0 A;  4XX5 A;  2PPH A;  2KKC A;  2O6V B;  2DZJ A;  3ZKJ C;  2KTF A;  3S2A A;  2N4F A;  2LGY A;  3CST A;  2L3Z A;  4NAW B;  4WJP A;  2BGF A;  1WX8 A;  1J8C A;  2BYE A;  2LXC A;  1WFY A;  1YX6 B;  3HK0 A;  2L7R A;  4HVB A;  1RAX A;  3M95 A;  5LLI A;  4GOC A;  2K39 A;  2WX0 A;  2BF8 B;  3LDZ E;  1IPG A;  1V5O A;  2N7D A;  4KDI C;  2CHX A;  2JZZ A;  2M8S A;  4GDK B;  4PS8 A;  4A20 A;  2FAZ A;  4EOY A;  1V81 A;  3V6E B;  2MRP A;  3A9J A;  1RFA A;  4TQ1 A;  3NZS A;  4PYZ A;  5L83 A;  4FJV B;  4MH0 E;  2AEH A;  3H1U A;  5JHB A;  3DOW A;  4I6P A;  3ZW3 A;  2Z0E B;  3TIX A;  1WXM A;  2DAF A;  3ZTC A;  4NJ6 A;  2EKE C;  2O2V A;  3RD2 A;  2MW5 A;  1UH6 A;  4GXB A;  2JPH A;  2I1K A;  2ZVO A;  3WAO A;  2HE7 A;  3HM6 X;  4ANU A;  2KLC A;  5GMV A;  2KX0 A;  1YIW A;  2N1W A;  2ZVN A;  2CS4 A;  3VH3 B;  4FA6 A;  2KXJ A;  2O2V B;  4N9F 4;  4XC2 A;  4FUL A;  2CR5 A;  3WA0 A;  3ZRC A;  3JYU A;  1Q1O A;  2K8C A;  2N9E B;  4OVU A;  2DAJ A;  4CHK A;  4TV3 A;  2HD5 B;  2JUO A;  3A1Q A;  2D07 B;  2HJ8 A;  1OTR B;  2KC1 A;  2HTH A;  1EO6 A;  1E8Y A;  3R66 C;  2IO1 B;  1J19 A;  2IO0 B;  1D3Z A;  1WZ3 A;  4KZC A;  3PLV A;  4GGQ A;  1C3T A;  2NBV B;  1WJN A;  5CTR C;  3QIJ A;  2FCN A;  3AI5 A;  2J7Q B;  3DBH I;  1GG3 A;  5BO4 B;  4FHJ A;  3NZU A;  1TTN A;  3H7P B;  1L7Y A;  4TQ0 A;  4W9J A;  3VAW A;  3TL5 A;  2GBR A;  5E6P A;  2XEW A;  2PE6 B;  2KAN A;  2BWF A;  4BKT A;  4BOZ B;  2LWP A;  3PHX B;  2LRU A;  3VQI A;  5JZE B;  3ENE A;  3VVW B;  3K9P B;  4HJK A;  3MJW A;  3R7R A;  1F9J A;  4MM3 A;  1GNU A;  1E8W A;  3DCG A;  1UGM A;  2KWU B;  1WXA A;  3MHS D;  3T8M A;  4PS3 A;  1GC7 A;  4LJO B;  2MP2 B;  2FUH B;  2M17 A;  1VCB A;  4B95 A;  2OOB B;  2R2O A;  3HM3 A;  4DK5 A;  2JXX A;  3JVZ X;  2KTR A;  3L54 A;  1E8Z A;  3DVG X;  3R3M A;  3VXW A;  3ZDM C;  4AP4 C;  1KLV A;  3A9K A;  1BT0 A;  1P9D U;  2JZ3 B;  4II2 B;  2C9W B;  5D6J B;  1WE6 A;  3RZF A;  1Q0W B;  2MX2 A;  2N9P C;  2AL3 A;  5AZF A;  2FIF A;  3T9L A;  1E7U A;  1WJ6 A;  4LJP B;  3APC A;  5J2R A;  4ZRJ A;  2MQJ A;  3VTV A;  3B08 A;  3NHE B;  2KTR B;  1P98 A;  3UF8 A;  2KQS A;  2MBH A;  5E6N A;  2DZI A;  2KFJ A;  3RCZ A;  2N9X A;  2ZZP B;  4K7S A;  3SDL C;  4BBN C;  4K7U A;  2WYQ A;  1RRB A;  4NJ7 A;  4DHZ B;  5E6O A;  4FBJ B;  3QQ8 B;  1LM8 B;  4KIK A;  4EUT A;  4E74 A;  2IO3 B;  5AZG A;  4IW0 A;  3M63 B;  4WWN A;  3RT3 B;  1WF9 A;  3PRM B;  2KFK B;  1EF5 A;  2MBO A;  4CO7 A;  1WM2 A;  3QAQ A;  3PLU A;  3PRE A;  2AWT A;  3P2B A;  4GMV A;  3V6C B;  5LXI B;  5CHW A;  2N7E A;  3PT2 B;  4TUU A;  4WJO A;  2DX5 B;  4G50 A;  1TGZ B;  4JL9 A;  5IAA C;  3K9O B;  2GOW A;  3OAW A;  4HPM B;  1KM7 A;  3PPA A;  2KVR A;  3H7S A;  2J0K A;  4MSM B;  1WGY A;  2D3G A;  4W9E A;  2KJR A;  5FR6 A;  1V6E A;  1UBQ A;  3ONS A;  4W9K A;  4AJW A;  1J0G A;  3IG3 A;  4HDO A;  4NQK E;  2NPT A;  1V80 A;  1YX5 B;  1PQS A;  3QJZ A;  2LGD A;  3KUZ A;  4RMA A; 
#chains in the Genus database with same CATH topology
 3UI3 A;  2IGH A;  1HXY D;  1FXI A;  3TMP B;  2CHZ A;  2LEK A;  2UU7 A;  1NYR A;  3H6N A;  3ZDT A;  5DPS A;  1SEB D;  3BVG A;  1UD7 A;  2NBW B;  1KJT A;  1MHH E;  2DHZ A;  3N1X C;  5TSS A;  2QC8 A;  3DVG Y;  4I6N B;  4K1R B;  4S0R A;  4IKG A;  3DBS A;  3PVL A;  2MHJ A;  4ANW A;  1N6Z A;  2WXF A;  2DEN B;  1VLB A;  4MGY E;  1XCT L;  1XEE A;  2E3T A;  1SIJ A;  3BVM A;  3Q3M C;  3KWL A;  2JRI B;  2WXP A;  3Q2A C;  1ZP0 B;  1L2N A;  3NVV A;  4ZRK A;  2WXG A;  2IDY A;  3AE1 B;  2V0G A;  4YSX B;  3DVN U;  3LXF A;  4KGT A;  4ZOH C;  5LXH A;  1WRD B;  1B9R A;  2JF5 A;  3C8Y A;  2CJN A;  2GBJ A;  3QCA A;  3N30 A;  4IOI E;  2XK5 A;  2BYV E;  4B0E A;  4WWM A;  3VTU A;  3N1Z C;  1V97 A;  4NPN A;  2EMS A;  1LFD A;  1A70 A;  2XN9 C;  1I4H A;  3BIN A;  5G5H A;  3U8Z A;  4A6Q A;  1WMH A;  1F1H A;  1ENF A;  1V1O A;  2L00 B;  1YN3 A;  4RF1 A;  2WWZ A;  2WDT B;  3NG0 A;  1LXD A;  3SHQ A;  1JWM D;  1WMH B;  4FJY A;  3WCQ A;  1WWT A;  3D32 A;  2LUE A;  3CF6 E;  1WGG A;  4DDG D;  2BWE S;  1FIQ A;  1LO5 D;  3X23 A;  5KHO A;  1N5X A;  4JWU C;  2FBW B;  3KLS X;  5IOI A;  3O65 B;  3C0R B;  2BS3 B;  3ZXR A;  5D2M B;  2G4D B;  1UWM A;  2Y5P A;  1TYG B;  3WIM A;  3ZYY X;  2FNJ B;  1QQR A;  4G3X B;  3VUX A;  3KUD B;  3W9C B;  4GU2 A;  4F8C B;  2G4S A;  4M01 A;  5BMG A;  1FXA A;  3BYT B;  4ANX A;  5D7G A;  3I5J C;  1QLB B;  2CJO A;  3RUI B;  4DWF A;  2MEK A;  3FC4 A;  3BK2 A;  1OEY A;  1WR1 A;  1N5W A;  1V49 A;  2PVO D;  4C00 A;  1BML C;  2BQQ A;  4HCN B;  5FK9 C;  3BY4 B;  2NBU A;  3RNC C;  5DPT A;  1TZO A;  3UGB B;  4DHJ B;  1F2R C;  3ZLZ A;  1BUI C;  2GBM A;  3V60 A;  5EE0 A;  4TKN A;  3ZNI D;  2KJH B;  3VH4 B;  3KYD D;  1WIA A;  4ARI A;  3AEE B;  2LVP A;  3Q8B A;  3ZNZ B;  3ZO5 B;  2K5P A;  1H4R A;  4HCP B;  4RM8 A;  2W3S A;  1WX9 A;  4ASW C;  2C7N B;  3BWU D;  3IAM 1;  4YTN B;  3KUC B;  4AOF A;  4RGO S;  1Q5W B;  3ZJT A;  1VZ6 A;  1PYW D;  1YMH E;  2WGS A;  3DPD A;  2GBK A;  1MI0 A;  1R4M B;  3H7P A;  4MGZ E;  2LGI A;  1XXG A;  1ZDV A;  2JY6 A;  2YEP F;  1OQQ A;  3GZN I;  2M56 B;  1R4N B;  4P1B C;  1K8R B;  3QAR A;  5JH5 C;  4JQW C;  1WH3 A;  4ZRP A;  1NEN B;  1IBX B;  1L6V A;  1DOI A;  4OVV A;  1WGH A;  3VUY A;  1UBI A;  3E9S A;  4L23 A;  1C1Y B;  3A4R A;  4IG7 B;  1QOG A;  1L5P A;  3HUI A;  2DNF A;  1M94 A;  4K81 A;  2BBC A;  5HKH A;  5LNK 1;  2QMT A;  3E56 A;  1J7C A;  2NVU I;  2R61 A;  4NQL B;  2PIA A;  4OHJ A;  4ZRI A;  1OQR A;  4CQN A;  1WJ4 A;  2DWQ A;  1WJU A;  1H8C A;  3M3J A;  2X38 A;  1GOZ A;  1T5X D;  2L0F A;  4C56 C;  2BYF A;  3LB8 C;  3W1S C;  1YJJ A;  4YL8 A;  1SF0 A;  3KH0 A;  1MFW A;  4EZK A;  1N60 A;  1G6J A;  5IO9 A;  2KWC A;  2FCQ A;  3W5U B;  4B9K A;  3Q3O C;  3V62 A;  3O13 A;  1WY8 A;  4OW0 A;  4J6I A;  5IA7 A;  1V8C A;  2WXM A;  1R7S A;  2NTT A;  3S2A A;  1SBB B;  2LGY A;  2I2Y A;  1TIF A;  2L32 A;  3HK0 A;  2L7R A;  1XCQ L;  5LLI A;  2BF8 B;  3AE2 B;  4KDI C;  4GDK B;  4US9 A;  1D6E C;  3A9J A;  4PYZ A;  1TY0 A;  2AEH A;  3H1U A;  3DOW A;  4I6P A;  3NS1 A;  1WXM A;  1KRH A;  4C4V B;  2EKE C;  2SEB D;  1QOF A;  2MW5 A;  2D3B A;  1UH6 A;  2N7J A;  4TSS A;  4XE0 A;  3R2I A;  2AQ3 B;  2HE7 A;  1YIW A;  3U4E G;  4FA6 A;  4LNO A;  3VH3 B;  1DOY A;  4N9F 4;  3ZRC A;  2WXJ A;  2N9E B;  3AEF B;  5I4D A;  2JUO A;  2D07 B;  1OTR B;  2HTH A;  2G9H D;  2KT7 A;  3EUB 2;  1J19 A;  1D3Z A;  1DOX A;  1SJE D;  1WJN A;  2FCN A;  4Q2J A;  3DBH I;  1GG3 A;  1UUP A;  3NZU A;  1HZ6 A;  3TEW A;  3RNA C;  3VAW A;  3FAH A;  1GPX A;  4ARC A;  3VQI A;  3ENE A;  5T8I A;  4HJK A;  1F9J A;  3C19 A;  1E8W A;  2KWU B;  1GC7 A;  4JWS C;  4KGR A;  2M17 A;  3RI7 C;  1T0R C;  4DK5 A;  3JVZ X;  5HHD G;  3ZDM C;  3DVG X;  3R3M A;  1KLV A;  1JCK B;  1NI3 A;  2MX2 A;  2AL3 A;  1PUT A;  3T9L A;  1E6E B;  4LJP B;  3NJT A;  3UF8 A;  2KQS A;  1VDV A;  5E6N A;  2N9X A;  4K7S A;  5E6O A;  3QQ8 B;  4EUT A;  3M63 B;  4WWN A;  1WF9 A;  3PRM B;  2KFK B;  2W55 A;  2MBO A;  3PLU A;  1FEH A;  3PRE A;  2WDR B;  1YOV B;  1JWS D;  4XYC A;  1EU4 A;  2PTL A;  5IAA C;  2GOW A;  2QIE B;  2J0K A;  1WGY A;  4W9E A;  3DBL B;  3AE5 B;  1UBQ A;  2RDB C;  1J0G A;  4HDO A;  2D3C A;  5C3J B;  2NPT A;  4S17 A;  2K1F A;  1XLN A;  2CKH B;  4KGS A;  5BYR A;  1WGR A;  5BYS A;  3DHG C;  2VH2 A;  4M02 A;  2QDF A;  3TEY A;  2K8H A;  4K7W A;  4MT5 A;  2KDB A;  3Q3F A;  5C1Z A;  5BYQ A;  1KTK A;  4RH6 A;  1XO3 A;  3RYT A;  2KQ7 A;  3VR9 B;  1TS4 A;  2W54 A;  4MH8 A;  3WAL A;  4BKS A;  3LJ3 A;  1JRU A;  1XD3 B;  2DZM A;  3GB1 A;  3AU4 A;  4BFR A;  3ZXV A;  3UIP B;  2RSU A;  3EA6 A;  1D5Z C;  1WYW B;  1TS2 A;  4K3C A;  2OHF A;  2W82 A;  3BZD B;  4ICV A;  2WHI A;  2G3Q B;  2XNA C;  4WQM A;  1Q10 A;  1ZGU B;  1RWS A;  4G11 A;  1EWY C;  2IGG A;  2C60 A;  4RGT A;  4YSZ B;  2TSS A;  3Q3J A;  2D3A A;  1VJK A;  3IHP C;  3A1Q B;  1L0X B;  1D5X C;  1NBF C;  2J4X A;  2ACZ B;  4M0W A;  1JW9 D;  3AEA B;  1CK1 A;  2KN5 A;  2WX1 A;  4DBG A;  4ZYN A;  3BYY B;  4GDL A;  3CIR B;  2NMQ A;  4RM9 A;  3L4P A;  2WXK A;  5IP4 D;  4BOS C;  1OQY A;  1U4A A;  1ROE A;  2KO3 A;  3MC8 A;  5BMI A;  4MM3 B;  2KNB A;  2RPV A;  1XLQ A;  4DXG A;  1SGH A;  2DZK A;  3WAN A;  3A9K B;  3B1L X;  4HK2 A;  3N9Y C;  3DQV A;  2NS5 A;  2QHO A;  3VTW A;  4BKS D;  1GC6 A;  2RPQ A;  3PO0 A;  2CHW A;  5D94 A;  3DVN V;  1T0S C;  1ACC A;  1PGB A;  2JVC A;  4GB9 A;  2Z0D B;  4KIK B;  4IWO A;  3A4S C;  2HTM E;  1KOT A;  3SFE B;  4LDT D;  1ZXH A;  3L16 A;  5HG2 A;  4NZL B;  3RNF C;  3TEZ A;  3AH7 A;  1QIL A;  2J53 A;  3ZNG C;  3TEX A;  4MJS A;  2O6V A;  2KJ6 A;  2JXT A;  1J7B A;  2A4Z A;  3GE3 C;  4MJS B;  3L0W B;  3ML9 A;  1V5T A;  4P7I A;  1L0Y B;  2K3U A;  3ABV B;  2H89 B;  4OZA A;  2INN E;  2WXI A;  1T0Y A;  1WE7 A;  1E10 A;  1I4P A;  1GJZ A;  3MJ5 A;  2LVO A;  4IM3 A;  1HTO A;  5EDS A;  2KD0 A;  2ZJD A;  3P42 A;  2IZV B;  3PZD A;  2ON8 A;  2QIL A;  2MJE A;  2N0S B;  4DQO C;  4A8X C;  3GOE A;  5AEK B;  2X8X X;  3IAS 1;  1QOB A;  1UZX B;  2L76 A;  4JGH B;  2LXA A;  2RGF A;  3L17 A;  4PS7 A;  4E3C A;  4B6W A;  5IKC M;  1EM7 A;  2Y5C A;  2V9H A;  3PZ7 A;  4AS1 A;  1S3S G;  2K6D B;  2MLB A;  2JYE A;  4WWP A;  4KVG B;  4RF0 A;  2O6V D;  3VRA B;  2BKF A;  2XK5 B;  1HZ5 A;  4W9C A;  2MSE D;  1P0R A;  1WM3 A;  2NTS A;  2C5L C;  3RN9 C;  3AEB B;  4EZJ A;  4F1S A;  2IO2 B;  1F77 A;  4EZL A;  3VFK A;  2LRW A;  1JRO A;  2G1E A;  2UYZ B;  4KKI A;  1Z2M A;  4N6E B;  1Y8R C;  3ZVV A;  4FN2 A;  4FLH A;  1C4C A;  2JZP A;  4BKG A;  3AV8 A;  2V3N A;  1YN5 A;  1L4Z B;  2L8J A;  3RUL A;  3PTF C;  3IFW B;  5DPW A;  1TS5 A;  1A5R A;  1HE8 A;  3V61 A;  3RZW C;  1UNS A;  3A33 B;  1NDD A;  3ZNH B;  1QF6 A;  4MSQ B;  2IGD A;  1JWU D;  3GS2 A;  4OZB A;  1VZ8 A;  1XT9 B;  3P63 A;  2D10 A;  5AUK A;  2DZJ A;  3H8H A;  2KTF A;  4WJP A;  2L3Z A;  2OED A;  3URY A;  2BYE A;  2LXC A;  4LNI A;  1C4A A;  3CWI A;  4DXF A;  5IN7 A;  3N1Y C;  1C4P A;  1IPG A;  4A20 A;  2CHX A;  2JZZ A;  1VRA B;  4A55 A;  2MRP A;  1TJE A;  3AE3 B;  3RFZ B;  2O2V A;  4GLS C;  1FM0 D;  2AQ1 B;  2KDM A;  2QCZ A;  1TKG A;  3WAO A;  2KX0 A;  2N1W A;  2KXJ A;  2O2V B;  4FUL A;  3WA0 A;  2WXQ A;  1D4B A;  1FRD A;  4KX6 B;  4TV3 A;  2HD5 B;  4H2A A;  2KC1 A;  5C2T B;  3RNE C;  1EO6 A;  1YN4 A;  3R66 C;  2IO0 B;  1WZ3 A;  4KZC A;  1K50 A;  1J7A A;  2NBV B;  3AI5 A;  2VH1 A;  3RNB C;  1SE2 A;  5BO4 B;  2H88 B;  3H7P B;  4W9J A;  1IGC A;  5E6P A;  2XEW A;  2KAN A;  3AB5 A;  1QOA A;  5JZE B;  3VVW B;  1FNU A;  3K9P B;  3GZN B;  4O1N A;  4XWT A;  3MHS D;  2FUH B;  4C80 A;  5H92 C;  3U2S C;  2JXX A;  1P7E A;  1E8Z A;  3L54 A;  4AP4 C;  2BTE A;  2C9W B;  1ET6 A;  1E7U A;  1UWX A;  1WJ6 A;  1SSN A;  4C7Y A;  1P98 A;  3AEC B;  2KFJ A;  3RCZ A;  1I4Q A;  3SDL C;  3AE6 B;  4FBJ B;  4FAD A;  4USA A;  1LM8 B;  4N58 A;  2IO3 B;  4YSY B;  2BYT A;  2BS2 B;  4B0M A;  4GMV A;  3IT6 B;  4LTU A;  2K9X A;  3B9J A;  1F52 A;  3AE8 B;  4C7Z A;  1TGZ B;  1V1P A;  1ZDX A;  3OAW A;  3AMZ A;  2D3G A;  1HA5 A;  4AJW A;  4HRS A;  1FCL A;  1V1P B;  1YX5 B;  4NJ7 A;  3KUZ A;  1DGJ A;  2KMC A;  2N9K A;  1VD2 A;  4ITK A;  4WIP A;  1ZKH A;  1YQ4 B;  1UEL A;  4M8N A;  2N1V A;  3P4Q B;  3EFU A;  3PGE A;  4F7Z A;  2Y5B B;  2AYO B;  3BVZ A;  1AWD A;  1TZ1 A;  2GBN A;  3QWZ B;  5TR5 A;  4II3 B;  2ZW0 A;  2GB1 A;  4OVZ A;  3VUW A;  2Q5W D;  3NVZ A;  1FFU A;  2NR2 A;  4BBN F;  5CX3 A;  3JSV A;  3A9J B;  3AE4 B;  2K22 A;  4HJG E;  1MG8 A;  2WQY B;  1ZW7 A;  4NY0 A;  4E71 A;  2YLM A;  4HRO A;  5D3D A;  4GN1 A;  4LNK A;  4IWP A;  1HQR D;  5J17 A;  4MDK E;  2J0J A;  1YJ1 A;  1XF5 L;  5EE1 A;  2J0M A;  2ZW1 A;  3ZRF A;  3HVD A;  3EC8 A;  4EE2 A;  2ZNV C;  4A3P A;  2YVC A;  1E5W A;  2FCS A;  3B2F A;  4G0N B;  2EMT A;  3M62 B;  2IPK D;  1FMA D;  2LVQ A;  3DBH B;  3GE8 C;  2AX5 A;  2PEA A;  4W9G A;  2KOX A;  3MTN B;  1Z5S B;  4YT0 B;  1YJI A;  1OEY J;  3SEB A;  3KYC D;  4HEA 1;  3OLM D;  4WAF A;  4ZDV A;  3R2T A;  1TBE A;  2L05 A;  3VRB B;  3P4R B;  2SAK A;  4MGK E;  3Q3N C;  4TMA B;  5D3I B;  4KKJ A;  1I4R A;  3PSE B;  2M0X A;  3U7D A;  2M19 A;  4HKQ A;  1YNT E;  1WR6 E;  5H8Y E;  4GSW A;  2KQ4 X;  4US8 A;  2G45 B;  2RR9 A;  1KLU D;  3ECI A;  3U30 A;  1KH0 A;  3KW5 B;  1WYG A;  1P7F A;  3MP9 A;  2BVC A;  1AYF A;  2R2Q A;  4JPS A;  4LLG M;  3N32 A;  2MBQ A;  4ICU A;  2KVZ A;  2ZNV B;  1MHX A;  3ML8 A;  3OG5 A;  3DBL I;  4FJZ A;  3CMM B;  4AQ7 A;  3ALB A;  3V3X A;  1LQB A;  1TT5 B;  2PMV A;  4N59 A;  2JRH A;  5E6J A;  2K25 A;  3HRD D;  2NPT B;  4R3D A;  5GXG B;  4RFB A;  2BPS A;  4YTM B;  2QEJ C;  3NVW A;  2CU3 A;  2CU1 A;  2ZPY A;  3I9V 1;  2MBE A;  4JIO U;  3RMK C;  2ICI A;  2IBI B;  2LHE A;  1I35 A;  4XZ4 A;  5JHA A;  3LYY A;  2KWV B;  4AUQ C;  4EFO A;  1ZPS A;  2BB6 A;  3SU8 X;  2IND C;  2KDF B;  2RMM A;  3I63 C;  1AAR A;  2DYO A;  2W3R A;  3KQ4 A;  4IM0 A;  2FID A;  2LGX A;  3PV1 A;  2WU5 B;  3I3T B;  2PKO A;  3B0A A;  4LDT B;  2IY0 B;  4MEL A;  3APF A;  1MPE A;  3T3N A;  4KV2 A;  3OJ4 B;  2MJ3 A;  1E0Z A;  5DCN A;  2M4N A;  2LI5 A;  4WAA A;  1NI2 A;  4BZA A;  1N63 A;  1FNV A;  1F0Z A;  4M0W B;  2ZCB A;  3W5V B;  2V4L A;  3UQA A;  1E7P B;  4XWW A;  2B3A A;  2NCN A;  2FE8 A;  1M4V A;  4GDL B;  3TJP A;  4IM2 A;  2K0P A;  3UIO B;  2MP2 A;  2KZR A;  4HLE A;  2KMA A;  3HIZ A;  4IWQ A;  2KDE B;  2MH7 A;  2L0T A;  5L95 C;  4HDQ A;  1UF0 A;  1WI0 A;  4WJQ A;  3FIL A;  3HHM A;  2WLB A;  1I42 A;  2V4I B;  3QX1 A;  1YQ3 B;  2KC2 A;  3NY5 A;  1QT9 A;  3P4S B;  4JLC A;  3TSS A;  1NEK B;  1JWA D;  2DYM A;  1K51 A;  4NJC A;  2WXO A;  2FCM A;  2GRI A;  1IP9 A;  3VDZ A;  2PE9 A;  3JW0 X;  2M1M A;  3DBR I;  3AE7 B;  1DYQ A;  1AW7 A;  1EUV B;  1KF6 B;  5EE9 A;  4HPP A;  4RNA A;  4MGI E;  1GB1 A;  2I1J A;  4HPL B;  4NAW A;  1L0V B;  1E7V A;  5G2N A;  4OZC A;  2KYW A;  1ET9 A;  2L52 A;  1SE3 A;  3MC0 B;  2KKC A;  2O6V B;  3ZGZ A;  2N4F A;  3CST A;  4NAW B;  2BGF A;  2PLP A;  1YX6 B;  4L1B A;  4HVB A;  2D5G A;  1RAX A;  3LDZ E;  2N7D A;  4PS8 A;  1RFA A;  4TQ1 A;  1T0Q C;  2HDE A;  4FJV B;  2KN4 A;  5JHB A;  3ZW3 A;  2Z0E B;  3TIX A;  1I4X A;  2DAF A;  3ZTC A;  1B1Z A;  1L4D B;  1UGJ A;  4NJ6 A;  4A9A A;  1K52 A;  4RCO A;  2JPH A;  3RNG C;  3HM6 X;  2KLC A;  5GMV A;  1SJH D;  2JX5 A;  2JWU A;  2ZVN A;  3AN1 A;  3NRZ A;  4OVU A;  4CHK A;  2DAJ A;  2HJ8 A;  2N9L A;  5FKA C;  2IO1 B;  2BT6 A;  3PLV A;  4PK1 A;  2QSD A;  5HI1 A;  1N61 A;  5CTR C;  3I57 A;  3Q8A A;  4ZRQ A;  1TTN A;  1T6B X;  2JYT A;  1L7Y A;  4TQ0 A;  2GBR A;  4YXD B;  3Q8E A;  3AM9 A;  4BKT A;  2LWP A;  2LRU A;  3IXS A;  3MJW A;  2OJW A;  1GNU A;  1JWB D;  2GI9 A;  2LUM A;  1UGM A;  3OWE B;  2YEP B;  1VZ7 A;  3DWG C;  4B95 A;  2OOB B;  1XLP A;  3VXW A;  2EEL A;  4IDI A;  1BT0 A;  4II2 B;  1Q0W B;  2QJL A;  5AZF A;  2JSV X;  3U7Z A;  3APC A;  4ZRJ A;  2MQJ A;  3VTV A;  3B08 A;  4XDC A;  2JU6 X;  2DZI A;  2ZZP B;  4BBN C;  3PZ8 A;  2WYQ A;  1RRB A;  4K7U A;  5AZG A;  4REZ A;  3MFG A;  4A90 A;  1C9F A;  3FKY A;  1TS3 A;  2AWT A;  5LXI B;  2N7E A;  4TUU A;  2J42 A;  1L6U A;  4JE3 B;  2KAJ A;  4JL9 A;  2WXN A;  3K9O B;  4HPM B;  1KM7 A;  2KVR A;  3H7S A;  3Q8C A;  5FR6 A;  1V6E A;  3ONS A;  2KAC A;  4W9K A;  2RDG A;  3BII D;  3IG3 A;  2BW2 A;  1PQS A;  3QJZ A;  2LGD A;  4RMA A;  1T3Q A;  4ACF A;  3NUH B;  4AWJ A;  3SR6 A;  3PRZ A;  4K3B A;  3IBE A;  3DWM A;  3P4P B;  3VR8 B;  2C7H A;  4M00 A;  4W9D A;  4DHZ E;  2WU2 B;  1HEZ E;  5AZH A;  2WDV B;  1JQ4 A;  2LD9 A;  3UQB A;  2IYD B;  4EKU A;  2KMM A;  4W9H A;  3UIN B;  4LK0 M;  1V2Y A;  3Q14 C;  1EU3 A;  4KSK C;  3SD5 A;  1YD8 U;  1WRI A;  1IUE A;  2MCN B;  1IGD A;  3QC8 B;  1STE A;  4PYU A;  3DHI C;  4P16 A;  4WQO B;  3R7Q A;  1GB4 A;  1C79 A;  3NS8 A;  2EKI A;  4LCD E;  2ZPN A;  3EFC A;  4UDU C;  1R4M I;  4W9L A;  4WH4 A;  2D11 A;  5AUI A;  2LJ5 A;  4JX1 C;  3X0W A;  4URK A;  2M0A A;  2KK8 A;  2GMI C;  1LGR A;  1R4N I;  1XLO A;  2WS3 B;  2MWS B;  3DHH C;  2INP E;  3L10 B;  3QHT A;  1WXQ A;  1IBX A;  3B2G A;  5MPO A;  1XQQ A;  3Q8F A;  2JT4 B;  2W9N A;  3CSF A;  1E8X A;  1P1A A;  4KDL B;  2PVG C;  4A3O A;  2DBY A;  3IVF A;  1PGX A;  1QKZ A;  3L13 A;  2UWQ A;  4BVU C;  2V3S A;  1X1M A;  2LMC A;  4IC7 B;  3H9D A;  4NNJ B;  3VHT C;  3OJ3 A;  3AEG B;  2LZ6 A;  2MA9 B;  2AQ2 B;  1WGD A;  4WUR A;  1CMX B;  5CHV C;  1F2R I;  2A5U A;  4DHJ D;  3Q69 A;  3WAP A;  5G55 A;  1PGA A;  2Z59 B;  3AXC A;  2IY1 B;  2WNM A;  3EEC A;  3KWV A;  4LNN A;  4EEW A;  4ZHO A;  4X57 B;  3AE9 B;  3TBL D;  1EF1 A;  1OGW A;  2C7M B;  5CHF A;  5EE3 A;  1FNW A;  1KFY B;  2KLG A;  3L08 A;  3N3K B;  2WP9 B;  1NYQ A;  2REX A;  4FHK A;  4L2Y A;  3NOB A;  2BS4 B;  3QA8 A;  1K53 A;  5J18 A;  2ZEQ A;  3RPF C;  3EHV A;  4XGA B;  1ZE3 D;  5JXV A;  3GP7 A;  4GDK A;  2AL6 A;  3U52 E;  2PJH A;  3PS6 A;  1PFD A;  4HWI B;  5KHQ A;  2E6X A;  2ASQ A;  4DXA B;  1GUA B;  5DPR A;  4WJN A;  1P3Q U;  1RLF A;  4C4V A;  2WDQ B;  2KX3 A;  3QK0 A;  3ZUN A;  1KLG D;  3APD A;  4GIV A;  1WX7 A;  1ZXI A;  3W1Y A;  4AJY B;  3JSV B;  4KSL C;  5BMH A;  3ZQ4 A;  1I7H A;  3ZIM A;  1PDX A;  4KZ0 A;  1SXT A;  1V9J A;  1MVK A;  2L83 A;  4PT5 A;  2KHW B;  1C78 A;  2XBB C;  4ANV A;  3W1S A;  2LJI A;  3NZ3 A;  1WXS A;  3KVF B;  2Y3A A;  3PRP B;  1YQB A;  3AU5 A;  2V1Y A;  5C23 A;  1QZE A;  2BKR B;  4WWO A;  2D2Q A;  1C77 A;  1FRR A;  3EGR A;  3R8B A;  4IUM B;  4MEM A;  3MC9 A;  4DDI D;  2LAS A;  3AED B;  4CYE A;  4YTP B;  3T3O A;  4XDD A;  3AUL A;  1MG4 A;  2VZK B;  5G5G A;  3DDC B;  2KDI A;  4I6L B;  1SE9 A;  4YWG G;  2I38 A;  1ISN A;  1E90 A;  3NVY A;  4J3O D;  2ZCC A;  1OFF A;  4RGN A;  3PHW B;  3WAM A;  4HXD A;  2K6Q A;  1AN8 A;  3IT4 B;  1RYJ A;  2GLS A;  2KFK A;  2VRR B;  2WXH A;  3TCA A;  1WXV A;  3ZTD A;  2K8B A;  3Q6B A;  3TUO A;  2MBB B;  1SIF A;  1S1Q B;  4W9F A;  2PW9 A;  1FXT B;  4P6V F;  2JWZ A;  4W9I A;  1I4G A;  2DYB A;  2BB5 A;  1JAL A;  2OJR A;  2RD0 A;  2KWD A;  4M8M A;  4NAM A;  2INC C;  2V3P A;  4BAX A;  1IYF A;  1SE4 A;  3MHZ A;  1V86 A;  1CJE A;  1HTQ A;  1WZ0 A;  4XX5 A;  2PPH A;  3ZKJ C;  2L1A A;  3HVZ A;  1WX8 A;  1J8C A;  1WFY A;  4LNF A;  1VR9 A;  3M95 A;  4GOC A;  2K39 A;  2WX0 A;  1ZOY B;  2VZK D;  1V5O A;  2M8S A;  2FAZ A;  4EOY A;  1JRP A;  1V81 A;  3V6E B;  2LGS A;  1FCC C;  3NZS A;  5L83 A;  4MH0 E;  1MJD A;  5FR3 A;  2FUG 1;  4RGM A;  2RDH A;  3ZJU A;  4ZHP A;  3RD2 A;  4GXB A;  2I1K A;  2ZVO A;  4ANU A;  1NVI D;  2CS4 A;  1CQV A;  4XC2 A;  2CR5 A;  3JYU A;  1Q1O A;  1RM6 C;  2K8C A;  1FO4 A;  3A1Q A;  2HJ1 A;  1N62 A;  2LFI A;  4P1C C;  1E8Y A;  1Y56 A;  1EWC A;  4GGQ A;  1C3T A;  1ESF A;  3QIJ A;  3P1M A;  2J7Q B;  4D2K A;  4FHJ A;  2ONQ A;  1E9M A;  1TKE A;  2B76 B;  3W2D A;  4ZYS A;  3N20 C;  3TL5 A;  1CZP A;  4MAC A;  3SFD B;  2PE6 B;  2LHD A;  2BWF A;  4BOZ B;  3PHX B;  4HKZ E;  1WGK A;  2IJ0 A;  1C76 A;  3R7R A;  4MM3 A;  3DCG A;  5HFY A;  1WXA A;  3T8M A;  4PS3 A;  4FXC A;  4LJO B;  2MP2 B;  1BXT A;  1VCB A;  2R2O A;  3HM3 A;  1SB3 C;  2KTR A;  2WXL A;  2J52 A;  3A9K A;  1P9D U;  2JZ3 B;  5D6J B;  1WE6 A;  3FIL B;  3RZF A;  2N9P C;  2MJD A;  2WXR A;  3BK1 A;  2FIF A;  5J2R A;  1GAQ B;  3NHE B;  2KTR B;  1FPY A;  2MBH A;  2DLB A;  4DHZ B;  4KIK A;  4E74 A;  4IW0 A;  1TY2 A;  3RT3 B;  1JML A;  1EF5 A;  4CO7 A;  1RFK A;  1WM2 A;  3QAQ A;  3P2B A;  1TKY A;  3V6C B;  5CHW A;  3PT2 B;  3DBR B;  4WJO A;  2Z8L A;  4G50 A;  2DX5 B;  3J9C A;  1FD6 A;  1D5M C;  3PPA A;  4MSM B;  1FFV A;  2KJR A;  3ZJV A;  3V05 A;  4NQK E;  4QAY A;  1V80 A;  1ZUD 2;  3ETR A;  1WSP A;  2JQR B; 
#chains in the Genus database with same CATH homology
 2KMC A;  2K1F A;  1VD2 A;  4AWJ A;  1ZKH A;  1UEL A;  3PRZ A;  3TMP B;  2CHZ A;  2CKH B;  1WGR A;  4M8N A;  3IBE A;  3H6N A;  2N1V A;  3EFU A;  3ZDT A;  3PGE A;  4F7Z A;  2Y5B B;  2K8H A;  4K7W A;  2AYO B;  2C7H A;  2GBN A;  1TZ1 A;  2KDB A;  3QWZ B;  3Q3F A;  4W9D A;  5DPS A;  5TR5 A;  4II3 B;  4DHZ E;  1UD7 A;  5AZH A;  5C1Z A;  3VUW A;  2NBW B;  2LD9 A;  1KJT A;  2NR2 A;  2KQ7 A;  3RYT A;  2DHZ A;  2IYD B;  3UQB A;  4BBN F;  5CX3 A;  3JSV A;  3A9J B;  3WAL A;  4EKU A;  4BKS A;  4W9H A;  3UIN B;  3LJ3 A;  3DVG Y;  1MG8 A;  4I6N B;  4K1R B;  1JRU A;  1V2Y A;  1XD3 B;  1ZW7 A;  2DZM A;  4NY0 A;  2YLM A;  4E71 A;  3AU4 A;  3DBS A;  3PVL A;  4ANW A;  4BFR A;  3UIP B;  4GN1 A;  2RSU A;  4IWP A;  5J17 A;  4KSK C;  3SD5 A;  1WYW B;  4MDK E;  2DEN B;  2J0J A;  1YD8 U;  4MGY E;  2MCN B;  3QC8 B;  1YJ1 A;  4ICV A;  4PYU A;  2G3Q B;  4WQO B;  3R7Q A;  2J0M A;  3ZRF A;  1ZGU B;  2JRI B;  3NS8 A;  4G11 A;  3EC8 A;  1L2N A;  2C60 A;  4LCD E;  4ZRK A;  2ZPN A;  3Q3J A;  2ZNV C;  3IHP C;  1R4M I;  4W9L A;  2D11 A;  3A1Q B;  1NBF C;  2LJ5 A;  3X0W A;  4URK A;  4A3P A;  2KK8 A;  2YVC A;  2GMI C;  3DVN U;  1E5W A;  1R4N I;  2FCS A;  2KN5 A;  2WX1 A;  2MWS B;  5LXH A;  1WRD B;  4ZYN A;  4DBG A;  3L10 B;  2JF5 A;  3QHT A;  2GBJ A;  4GDL A;  3QCA A;  3N30 A;  4G0N B;  2EMT A;  3M62 B;  2XK5 A;  2BYV E;  2LVQ A;  4RM9 A;  1XQQ A;  3VTU A;  2PEA A;  4W9G A;  2KOX A;  3MTN B;  2JT4 B;  1Z5S B;  2W9N A;  3CSF A;  1E8X A;  1P1A A;  4NPN A;  2EMS A;  1OEY J;  4KDL B;  1LFD A;  3KYC D;  4A3O A;  4BOS C;  1OQY A;  3IVF A;  1U4A A;  3OLM D;  2KO3 A;  3BIN A;  3L13 A;  2UWQ A;  3U8Z A;  4BVU C;  2V3S A;  1X1M A;  4ZDV A;  1TBE A;  2KNB A;  1WMH A;  2L05 A;  4IC7 B;  2L00 B;  3H9D A;  4NNJ B;  3VHT C;  3OJ3 A;  1SGH A;  4MGK E;  2WWZ A;  2DZK A;  2WDT B;  3WAN A;  2LZ6 A;  2MA9 B;  3A9K B;  1LXD A;  3B1L X;  3SHQ A;  1WGD A;  4HK2 A;  1CMX B;  5CHV C;  1WMH B;  3DQV A;  4FJY A;  2NS5 A;  2QHO A;  3VTW A;  3D32 A;  2A5U A;  2LUE A;  4BKS D;  4DHJ D;  1GC6 A;  2RPQ A;  1WGG A;  3CF6 E;  3PSE B;  2M0X A;  3U7D A;  4DDG D;  1WR6 E;  2CHW A;  5D94 A;  2BWE S;  3DVN V;  4GSW A;  3X23 A;  3WAP A;  2G45 B;  2JVC A;  4GB9 A;  5G55 A;  5KHO A;  4FAD A;  3AXC A;  2RR9 A;  2Z59 B;  2Z0D B;  2IY1 B;  3ECI A;  4KIK B;  4IWO A;  3A4S C;  3U30 A;  1KOT A;  3O65 B;  3C0R B;  3EEC A;  3KW5 B;  4EEW A;  4X57 B;  4LDT D;  3L16 A;  5D2M B;  2G4D B;  3TBL D;  2R2Q A;  1EF1 A;  1OGW A;  2C7M B;  3N32 A;  2MBQ A;  4ICU A;  2FNJ B;  5CHF A;  3WIM A;  2ZNV B;  4G3X B;  3ML8 A;  3ZNG C;  3DBL I;  3KUD B;  3CMM B;  4FJZ A;  4MJS A;  3VUX A;  2KLG A;  3ALB A;  4GU2 A;  1LQB A;  3L08 A;  2O6V A;  4F8C B;  3N3K B;  2G4S A;  2KJ6 A;  2REX A;  4FHK A;  2JRH A;  3NOB A;  3QA8 A;  2A4Z A;  2K25 A;  2NPT B;  4ANX A;  4MJS B;  5J18 A;  2ZEQ A;  5D7G A;  3RUI B;  3EHV A;  4DWF A;  2BPS A;  3L0W B;  3ML9 A;  4GDK A;  1V5T A;  2AL6 A;  4P7I A;  2PJH A;  3PS6 A;  5KHQ A;  4HWI B;  2CU1 A;  2ZPY A;  1OEY A;  2MBE A;  1WR1 A;  2ASQ A;  4JIO U;  1T0Y A;  1WE7 A;  2IBI B;  1V49 A;  4DXA B;  1I35 A;  1GUA B;  5DPR A;  4WJN A;  4HCN B;  4XZ4 A;  1GJZ A;  1P3Q U;  1RLF A;  5JHA A;  2LVO A;  3BY4 B;  4IM3 A;  2KWV B;  5EDS A;  2KD0 A;  2NBU A;  2KX3 A;  3QK0 A;  3ZUN A;  2ZJD A;  4AUQ C;  4EFO A;  3APD A;  2IZV B;  1WX7 A;  4GIV A;  3W1Y A;  4AJY B;  3SU8 X;  3JSV B;  3PZD A;  4KSL C;  5DPT A;  2KDF B;  3UGB B;  4DHJ B;  3ZLZ A;  1AAR A;  3ZIM A;  2GBM A;  3V60 A;  2DYO A;  4TKN A;  3ZNI D;  3GOE A;  2KJH B;  5AEK B;  3VH4 B;  3KYD D;  4KZ0 A;  1WIA A;  4IM0 A;  2FID A;  2LGX A;  2LVP A;  3ZNZ B;  3ZO5 B;  1V9J A;  1UZX B;  3PV1 A;  3I3T B;  1H4R A;  4HCP B;  4RM8 A;  3B0A A;  4LDT B;  2IY0 B;  2KHW B;  4MEL A;  2L76 A;  4JGH B;  1WX9 A;  3APF A;  4ASW C;  2LXA A;  2RGF A;  4KV2 A;  2XBB C;  3OJ4 B;  2C7N B;  5DCN A;  2M4N A;  3KUC B;  4AOF A;  2LI5 A;  3L17 A;  4PS7 A;  3W1S A;  1Q5W B;  4ANV A;  4E3C A;  4WAA A;  1NI2 A;  4B6W A;  1WXS A;  3KVF B;  3DPD A;  2GBK A;  3H7P A;  4MGZ E;  3PRP B;  4M0W B;  1S3S G;  2ZCB A;  1YQB A;  3AU5 A;  2JY6 A;  2K6D B;  1QZE A;  2MLB A;  2V1Y A;  2V4L A;  5C23 A;  3UQA A;  2BKR B;  4WWO A;  3GZN I;  2D2Q A;  2B3A A;  2NCN A;  1K8R B;  3QAR A;  4WWP A;  4IUM B;  4KVG B;  4MEM A;  5JH5 C;  2O6V D;  4GDL B;  4JQW C;  1WH3 A;  4DDI D;  2BKF A;  3TJP A;  4IM2 A;  2XK5 B;  2LAS A;  4W9C A;  4OVV A;  2MSE D;  1WGH A;  1P0R A;  3UIO B;  2MP2 A;  1WM3 A;  2KZR A;  3VUY A;  4CYE A;  1UBI A;  2KMA A;  4HLE A;  3HIZ A;  2C5L C;  4IWQ A;  2KDE B;  1C1Y B;  3A4R A;  4IG7 B;  3AUL A;  2L0T A;  4EZJ A;  4F1S A;  5L95 C;  1M94 A;  4K81 A;  2IO2 B;  4HDQ A;  5HKH A;  1WI0 A;  3DDC B;  2KDI A;  4EZL A;  4WJQ A;  3VFK A;  2LRW A;  4I6L B;  3HHM A;  2NVU I;  1SE9 A;  4NQL B;  1I42 A;  2UYZ B;  1Z2M A;  3QX1 A;  1ISN A;  2KC2 A;  3NY5 A;  1Y8R C;  1E90 A;  3ZVV A;  4ZRI A;  2ZCC A;  4FN2 A;  4FLH A;  4JLC A;  3PHW B;  3WAM A;  4HXD A;  2K6Q A;  1WJ4 A;  4BKG A;  2DYM A;  3RUL A;  2L8J A;  3PTF C;  1WJU A;  1H8C A;  2FCM A;  3IFW B;  1IP9 A;  2VRR B;  2KFK A;  3TCA A;  3VDZ A;  5DPW A;  1WXV A;  3ZTD A;  3M3J A;  2K8B A;  1A5R A;  2PE9 A;  3JW0 X;  2MBB B;  1SIF A;  1S1Q B;  2M1M A;  3DBR I;  4W9F A;  1HE8 A;  1FXT B;  3V61 A;  2JWZ A;  4W9I A;  3RZW C;  2L0F A;  3A33 B;  1EUV B;  1NDD A;  2BYF A;  3ZNH B;  2DYB A;  3W1S C;  4YL8 A;  2OJR A;  2RD0 A;  3KH0 A;  4M8M A;  4MSQ B;  4MGI E;  4EZK A;  1G6J A;  2KWC A;  2FCQ A;  1IYF A;  2I1J A;  4B9K A;  4HPL B;  3V62 A;  1XT9 B;  4NAW A;  1E7V A;  5G2N A;  1WY8 A;  2D10 A;  4J6I A;  1V86 A;  5IA7 A;  1WZ0 A;  4XX5 A;  2PPH A;  2KKC A;  2O6V B;  2DZJ A;  3ZKJ C;  2KTF A;  3S2A A;  2N4F A;  2LGY A;  3CST A;  2L3Z A;  4NAW B;  4WJP A;  2BGF A;  1WX8 A;  1J8C A;  2BYE A;  2LXC A;  1WFY A;  1YX6 B;  3HK0 A;  2L7R A;  4HVB A;  1RAX A;  3M95 A;  5LLI A;  4GOC A;  2K39 A;  2WX0 A;  2BF8 B;  3LDZ E;  1IPG A;  1V5O A;  2N7D A;  4KDI C;  2CHX A;  2JZZ A;  2M8S A;  4GDK B;  4PS8 A;  4A20 A;  2FAZ A;  4EOY A;  1V81 A;  3V6E B;  2MRP A;  3A9J A;  1RFA A;  4TQ1 A;  3NZS A;  4PYZ A;  5L83 A;  4FJV B;  4MH0 E;  2AEH A;  3H1U A;  5JHB A;  3DOW A;  4I6P A;  3ZW3 A;  2Z0E B;  3TIX A;  1WXM A;  2DAF A;  3ZTC A;  4NJ6 A;  2EKE C;  2O2V A;  3RD2 A;  2MW5 A;  1UH6 A;  4GXB A;  2JPH A;  2I1K A;  2ZVO A;  3WAO A;  2HE7 A;  3HM6 X;  4ANU A;  2KLC A;  5GMV A;  2KX0 A;  1YIW A;  2N1W A;  2ZVN A;  2CS4 A;  3VH3 B;  4FA6 A;  2KXJ A;  2O2V B;  4N9F 4;  4XC2 A;  4FUL A;  2CR5 A;  3WA0 A;  3ZRC A;  3JYU A;  1Q1O A;  2K8C A;  2N9E B;  4OVU A;  2DAJ A;  4CHK A;  4TV3 A;  2HD5 B;  2JUO A;  3A1Q A;  2D07 B;  2HJ8 A;  1OTR B;  2KC1 A;  2HTH A;  1EO6 A;  1E8Y A;  3R66 C;  2IO1 B;  1J19 A;  2IO0 B;  1D3Z A;  1WZ3 A;  4KZC A;  3PLV A;  4GGQ A;  1C3T A;  2NBV B;  1WJN A;  5CTR C;  3QIJ A;  2FCN A;  3AI5 A;  2J7Q B;  3DBH I;  1GG3 A;  5BO4 B;  4FHJ A;  3NZU A;  1TTN A;  3H7P B;  1L7Y A;  4TQ0 A;  4W9J A;  3VAW A;  3TL5 A;  2GBR A;  5E6P A;  2XEW A;  2PE6 B;  2KAN A;  2BWF A;  4BKT A;  4BOZ B;  2LWP A;  3PHX B;  2LRU A;  3VQI A;  5JZE B;  3ENE A;  3VVW B;  3K9P B;  4HJK A;  3MJW A;  3R7R A;  1F9J A;  4MM3 A;  1GNU A;  1E8W A;  3DCG A;  1UGM A;  2KWU B;  1WXA A;  3MHS D;  3T8M A;  4PS3 A;  1GC7 A;  4LJO B;  2MP2 B;  2FUH B;  2M17 A;  1VCB A;  4B95 A;  2OOB B;  2R2O A;  3HM3 A;  4DK5 A;  2JXX A;  3JVZ X;  2KTR A;  3L54 A;  1E8Z A;  3DVG X;  3R3M A;  3VXW A;  3ZDM C;  4AP4 C;  1KLV A;  3A9K A;  1BT0 A;  1P9D U;  2JZ3 B;  4II2 B;  2C9W B;  5D6J B;  1WE6 A;  3RZF A;  1Q0W B;  2MX2 A;  2N9P C;  2AL3 A;  5AZF A;  2FIF A;  3T9L A;  1E7U A;  1WJ6 A;  4LJP B;  3APC A;  5J2R A;  4ZRJ A;  2MQJ A;  3VTV A;  3B08 A;  3NHE B;  2KTR B;  1P98 A;  3UF8 A;  2KQS A;  2MBH A;  5E6N A;  2DZI A;  2KFJ A;  3RCZ A;  2N9X A;  2ZZP B;  4K7S A;  3SDL C;  4BBN C;  4K7U A;  2WYQ A;  1RRB A;  4NJ7 A;  4DHZ B;  5E6O A;  4FBJ B;  3QQ8 B;  1LM8 B;  4KIK A;  4EUT A;  4E74 A;  2IO3 B;  5AZG A;  4IW0 A;  3M63 B;  4WWN A;  3RT3 B;  1WF9 A;  3PRM B;  2KFK B;  1EF5 A;  2MBO A;  4CO7 A;  1WM2 A;  3QAQ A;  3PLU A;  3PRE A;  2AWT A;  3P2B A;  4GMV A;  3V6C B;  5LXI B;  5CHW A;  2N7E A;  3PT2 B;  4TUU A;  4WJO A;  2DX5 B;  4G50 A;  1TGZ B;  4JL9 A;  5IAA C;  3K9O B;  2GOW A;  3OAW A;  4HPM B;  1KM7 A;  3PPA A;  2KVR A;  3H7S A;  2J0K A;  4MSM B;  1WGY A;  2D3G A;  4W9E A;  2KJR A;  5FR6 A;  1V6E A;  1UBQ A;  3ONS A;  4W9K A;  4AJW A;  1J0G A;  3IG3 A;  4HDO A;  4NQK E;  2NPT A;  1V80 A;  1YX5 B;  1PQS A;  3QJZ A;  2LGD A;  3KUZ A;  4RMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...